BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22134_g1_i1 len=1741 path=[729:0-456 22:457-653 219:654-758
559:759-916 @1444@!:917-1625 2270:1626-1740]

Length=1741
                                                                      Score     E

ref|XP_009625326.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    582   0.0      
ref|XP_009765246.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    582   0.0      
ref|XP_006357169.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    574   0.0      
ref|XP_011097351.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    571   0.0      
ref|XP_002271417.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    570   0.0      Vitis vinifera
emb|CAN61056.1|  hypothetical protein VITISV_041140                     570   0.0      Vitis vinifera
ref|XP_004233311.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    568   0.0      
gb|EYU34762.1|  hypothetical protein MIMGU_mgv1a008412mg                568   0.0      
ref|XP_011098787.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    566   0.0      
emb|CDP16627.1|  unnamed protein product                                564   0.0      
ref|XP_010033350.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    561   0.0      
gb|KCW52964.1|  hypothetical protein EUGRSUZ_J02265                     561   0.0      
ref|XP_010111663.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)]        560   0.0      
gb|KEH25377.1|  glycerol-3-phosphate dehydrogenase, NAD                 559   0.0      
ref|XP_007031668.1|  NAD-dependent glycerol-3-phosphate dehydroge...    562   0.0      
ref|XP_006446670.1|  hypothetical protein CICLE_v10015567mg             558   0.0      
ref|XP_004489553.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    557   0.0      
ref|XP_006470193.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    558   0.0      
gb|KDP46370.1|  hypothetical protein JCGZ_10210                         556   0.0      
sp|P52425.1|GPDA_CUPLA  RecName: Full=Glycerol-3-phosphate dehydr...    555   0.0      Cuphea lanceolata
ref|XP_011010495.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    556   0.0      
gb|AEZ56250.1|  plastid glycerol-3-phosphate dehydrogenase              556   0.0      
ref|XP_003553315.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    554   0.0      
ref|XP_006373281.1|  hypothetical protein POPTR_0017s10710g             552   0.0      
ref|XP_011010494.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    556   0.0      
ref|XP_002526956.1|  glycerol-3-phosphate dehydrogenase, putative       553   0.0      Ricinus communis
gb|KHG19199.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)]             555   0.0      
ref|XP_007151588.1|  hypothetical protein PHAVU_004G059500g             552   0.0      
ref|XP_002323799.2|  hypothetical protein POPTR_0017s10710g             552   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010033349.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    551   0.0      
ref|XP_007215552.1|  hypothetical protein PRUPE_ppa007261mg             550   0.0      
ref|XP_009371731.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    551   0.0      
ref|XP_009370329.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    551   0.0      
ref|XP_010435997.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    547   0.0      
ref|XP_010450637.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    547   0.0      
ref|XP_006283863.1|  hypothetical protein CARUB_v10004974mg             546   0.0      
ref|XP_008230931.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    545   0.0      
ref|XP_004516127.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    544   0.0      
ref|XP_008348010.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    546   0.0      
gb|AAL87336.1|  putative dihydroxyacetone 3-phosphate reductase d...    545   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_198877.1|  glycerol-3-phosphate dehydrogenase [NAD+]             545   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441214.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    545   0.0      
ref|XP_002868644.1|  hypothetical protein ARALYDRAFT_493921             543   0.0      
ref|XP_010555924.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    543   0.0      
gb|KFK33089.1|  hypothetical protein AALP_AA6G329300                    538   0.0      
emb|CDX67466.1|  BnaA07g15060D                                          537   0.0      
emb|CDY42567.1|  BnaA04g10460D                                          536   0.0      
emb|CDY67407.1|  BnaC06g42250D                                          537   0.0      
ref|XP_004156696.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    537   0.0      
ref|XP_008341361.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    535   0.0      
ref|XP_004304684.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    537   0.0      
ref|XP_008458845.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    538   0.0      
ref|XP_003618783.1|  Glycerol-3-phosphate dehydrogenase                 546   0.0      
ref|XP_009125149.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    534   0.0      
ref|XP_004142775.1|  PREDICTED: LOW QUALITY PROTEIN: glycerol-3-p...    532   0.0      
ref|XP_006604107.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    530   0.0      
ref|XP_009140027.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    530   0.0      
gb|AIE76330.1|  glycerol-3-phosphate dehydrogenase-like protein         530   0.0      
gb|KHN18269.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)]             530   0.0      
ref|XP_006852214.1|  hypothetical protein AMTR_s00049p00131690          530   0.0      
ref|XP_007141023.1|  hypothetical protein PHAVU_008G160800g             527   0.0      
ref|XP_009415986.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    525   7e-180   
emb|CDY36365.1|  BnaC04g32730D                                          525   7e-180   
dbj|BAK07844.1|  predicted protein                                      523   2e-179   
ref|XP_003622291.1|  Glycerol-3-phosphate dehydrogenase                 522   3e-179   
ref|XP_002459175.1|  hypothetical protein SORBIDRAFT_03g047310          523   3e-179   Sorghum bicolor [broomcorn]
ref|XP_010232866.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    522   6e-179   
ref|XP_010528202.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    524   9e-179   
gb|AGS79224.1|  glycerol-3-phosphate dehydrogenase                      521   9e-179   
ref|XP_004971422.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    520   4e-178   
ref|NP_001150493.1|  glycerol-3-phosphate dehydrogenase                 519   1e-177   Zea mays [maize]
ref|XP_006645328.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    518   2e-177   
ref|NP_001045535.1|  Os01g0971600                                       517   4e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008776514.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    518   5e-177   
ref|XP_010912925.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    517   1e-176   
ref|XP_010912926.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    514   5e-176   
gb|KHG11302.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)]             508   4e-173   
ref|XP_009340866.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    502   1e-170   
ref|XP_010694658.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    500   3e-170   
ref|XP_006405454.1|  hypothetical protein EUTSA_v10027824mg             498   1e-169   
gb|KHN45993.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)]             498   2e-169   
gb|EMT17048.1|  Glycerol-3-phosphate dehydrogenase (NAD+)               497   9e-169   
ref|XP_006603999.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    488   2e-166   
ref|XP_002991706.1|  hypothetical protein SELMODRAFT_451466             486   5e-164   
ref|XP_002991027.1|  hypothetical protein SELMODRAFT_132832             485   8e-164   
ref|XP_010232867.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    468   4e-158   
ref|XP_001768070.1|  predicted protein                                  461   1e-154   
emb|CDJ26518.1|  unnamed protein product                                446   9e-150   
gb|EAY77398.1|  hypothetical protein OsI_05386                          442   3e-148   Oryza sativa Indica Group [Indian rice]
gb|ABN05902.1|  Peptidase S26A, signal peptidase I; NAD-dependent...    385   2e-126   Medicago truncatula
gb|KFH66320.1|  glycerol-3-phosphate dehydrogenase [NAD+]               350   6e-112   
gb|KFH71024.1|  glycerol-3-phosphate dehydrogenase [NAD+]               349   8e-112   
ref|XP_005535472.1|  glycerol-3-phosphate dehydrogenase                 347   2e-110   
ref|XP_006676005.1|  hypothetical protein BATDEDRAFT_84716              343   3e-109   
dbj|GAC99292.1|  glycerol-3-phosphate dehydrogenase NAD+                340   8e-108   
ref|XP_005825533.1|  hypothetical protein GUITHDRAFT_115328             340   1e-107   
emb|CDI51478.1|  probable glycerol-3-phosphate dehydrogenase (NAD)      338   3e-107   
ref|XP_004340799.1|  glycerol-3-phosphate dehydrogenase family pr...    337   1e-106   
gb|EST06489.1|  glycerol-3-phosphate dehydrogenase                      336   3e-106   
emb|CCF48500.1|  probable glycerol-3-phosphate dehydrogenase (NAD)      335   4e-106   
gb|ETS63800.1|  hypothetical protein PaG_02118                          335   8e-106   
dbj|GAC73796.1|  glycerol-3-phosphate dehydrogenase                     337   1e-105   
ref|XP_002948394.1|  hypothetical protein VOLCADRAFT_57957              337   1e-105   
gb|ESA19971.1|  hypothetical protein GLOINDRAFT_343845                  333   1e-105   
emb|CBQ67968.1|  probable glycerol-3-phosphate dehydrogenase (NAD)      333   2e-105   
gb|ABX56138.1|  glycerol-3-phosphate dehydrogenase                      333   2e-105   Triatoma infestans
ref|XP_756702.1|  hypothetical protein UM00555.1                        333   2e-105   Ustilago maydis 521
gb|ABX56137.1|  glycerol-3-phosphate dehydrogenase                      333   2e-105   Triatoma infestans
gb|EPB92754.1|  glycerol-3-phosphate dehydrogenase [NAD+]               332   3e-105   
gb|EWM29423.1|  glycerol-3-phosphate dehydrogenase 1-like protein       333   9e-105   
ref|XP_005820695.1|  hypothetical protein GUITHDRAFT_81199              332   9e-105   
ref|XP_001702598.1|  predicted protein                                  330   5e-104   Chlamydomonas reinhardtii
emb|CDH53061.1|  glycerol-3-phosphate dehydrogenase                     328   1e-103   
ref|XP_567088.1|  hypothetical protein                                  327   6e-103   Cryptococcus neoformans var. neoformans JEC21
ref|XP_003191980.1|  glycerol-3-phosphate dehydrogenase (NAD+)          326   8e-103   
dbj|GAK62099.1|  NAD-dependent glycerol-3-phosphate dehydrogenase       335   1e-102   
gb|KGB74596.1|  Gpd1 protein                                            326   1e-102   
gb|AFR92257.1|  glycerol-3-phosphate dehydrogenase (NAD( ))             326   1e-102   
emb|CCF73366.1|  unnamed protein product                                326   2e-102   
gb|KFG28048.1|  NAD-dependent glycerol-3-phosphate dehydrogenase        327   2e-102   
ref|XP_004529382.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    323   2e-101   
ref|XP_004529383.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    322   3e-101   
ref|XP_006264701.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    322   5e-101   
ref|XP_008888647.1|  NAD-dependent glycerol-3-phosphate dehydroge...    327   5e-101   
emb|CEG71092.1|  Putative Glycerol-3-phosphate dehydrogenase [NAD ]     322   6e-101   
gb|EMS21005.1|  glycerol-3-phosphate dehydrogenase (NAD+)               322   6e-101   
ref|XP_009689111.1|  glycerol-3-phosphate dehydrogenase                 322   7e-101   
ref|XP_002371838.1|  glycerol-3-phosphate dehydrogenase, putative       327   7e-101   Toxoplasma gondii ME49
ref|XP_003881321.1|  glycerol-3-phosphate dehydrogenase, related        327   8e-101   
gb|KFO72682.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    320   2e-100   
ref|XP_009554466.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    320   2e-100   
ref|XP_006030783.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    320   3e-100   
ref|XP_001841997.1|  glycerol-3-phosphate dehydrogenase                 320   3e-100   Culex quinquefasciatus
ref|XP_765829.1|  NAD-dependent glycerol-3-phosphate dehydrogenase      320   3e-100   Theileria parva strain Muguga
emb|CEG69801.1|  Putative Glycerol-3-phosphate dehydrogenase [NAD ]     320   3e-100   
ref|XP_006087639.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    320   4e-100   
ref|XP_542745.2|  PREDICTED: glycerol-3-phosphate dehydrogenase 1...    320   4e-100   Canis lupus familiaris [dogs]
ref|NP_001080270.1|  glycerol-3-phosphate dehydrogenase 1-like pr...    320   4e-100   Xenopus laevis [clawed frog]
ref|XP_008152122.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    320   4e-100   
gb|EKC29995.1|  Glycerol-3-phosphate dehydrogenase [NAD+], cytopl...    319   4e-100   
ref|NP_001030431.1|  glycerol-3-phosphate dehydrogenase [NAD(+)],...    319   6e-100   Bos taurus [bovine]
ref|XP_004692821.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    319   7e-100   
ref|XP_008102172.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    319   7e-100   
ref|XP_308279.2|  AGAP007593-PB                                         318   8e-100   Anopheles gambiae str. PEST
ref|XP_001687881.1|  AGAP007593-PA                                      319   9e-100   Anopheles gambiae str. PEST
ref|XP_004529381.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    323   1e-99    
ref|NP_989027.1|  glycerol-3-phosphate dehydrogenase 1-like protein     318   1e-99    Xenopus tropicalis [western clawed frog]
ref|XP_003770927.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   1e-99    
ref|XP_005892079.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   1e-99    
gb|KGG52613.1|  hypothetical protein DI09_151p60                        319   1e-99    
ref|XP_006075841.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   1e-99    
ref|XP_006629312.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   2e-99    
ref|XP_005717176.1|  glycerol-3-phosphate dehydrogenase                 318   2e-99    
gb|KFP21935.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    318   2e-99    
ref|XP_001653596.1|  glycerol-3-phosphate dehydrogenase                 318   2e-99    Aedes aegypti
ref|XP_009644405.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   2e-99    
ref|XP_009881479.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   2e-99    
ref|XP_010711197.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   2e-99    
ref|XP_006755507.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    318   2e-99    
gb|KFB42472.1|  glycerol-3-phosphate dehydrogenase                      318   2e-99    
ref|XP_418763.1|  PREDICTED: glycerol-3-phosphate dehydrogenase 1...    318   2e-99    Gallus gallus [bantam]
ref|XP_954425.1|  glycerol-3-phosphate dehydrogenase (gpdh)             318   2e-99    Theileria annulata strain Ankara
gb|KGL82655.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    317   2e-99    
ref|XP_009052905.1|  hypothetical protein LOTGIDRAFT_231803             317   3e-99    
ref|XP_010220821.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   3e-99    
gb|ELR59039.1|  Glycerol-3-phosphate dehydrogenase [NAD+], cytopl...    318   3e-99    
ref|XP_001653595.1|  glycerol-3-phosphate dehydrogenase                 317   3e-99    Aedes aegypti
ref|XP_006635606.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   3e-99    
gb|KFM04261.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    317   3e-99    
ref|XP_001653594.1|  glycerol-3-phosphate dehydrogenase                 317   3e-99    Aedes aegypti
ref|XP_009272675.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   4e-99    
ref|XP_010309022.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   4e-99    
ref|XP_004414668.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   4e-99    
ref|XP_005999356.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   4e-99    
ref|XP_008119603.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   4e-99    
gb|KFO03680.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    317   4e-99    
ref|XP_004599029.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   5e-99    
ref|NP_001005934.1|  glycerol-3-phosphate dehydrogenase 1-like pr...    317   5e-99    Danio rerio [leopard danio]
ref|XP_003939204.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   5e-99    
ref|XP_422110.3|  PREDICTED: glycerol-3-phosphate dehydrogenase 1...    317   6e-99    Gallus gallus [bantam]
ref|XP_004754360.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   6e-99    
ref|XP_005278761.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    317   7e-99    
gb|ETB57845.1|  glycerol-3-phosphate dehydrogenase (NAD( ))             318   7e-99    
ref|XP_003781817.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   8e-99    
ref|XP_010181705.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   8e-99    
gb|KFQ34684.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    316   8e-99    
ref|XP_005021619.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   9e-99    
dbj|BAD38675.1|  glycerol-3-phosphate dehydrogenase-2                   316   9e-99    Bombyx mori [silk moth]
gb|AAI05514.1|  GPD1 protein                                            316   9e-99    Bos taurus [bovine]
gb|ETN67939.1|  glycerol-3-phosphate dehydrogenase                      316   9e-99    
ref|NP_001036970.1|  glycerol-3-phosphate dehydrogenase-1               317   9e-99    Bombyx mori [silk moth]
ref|XP_006030269.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   1e-98    
ref|XP_003507879.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   1e-98    
emb|CDU18121.1|  glycerol-3-phosphate dehydrogenase                     317   1e-98    
ref|XP_004006413.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   1e-98    
emb|CDS14221.1|  hypothetical protein LRAMOSA06391                      316   1e-98    
ref|XP_009673116.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   1e-98    
gb|EIE84166.1|  glycerol-3-phosphate dehydrogenase [NAD+]               315   1e-98    
ref|XP_010560718.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   2e-98    
gb|KFV81244.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    315   2e-98    
ref|XP_009462557.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   2e-98    
gb|KFQ96352.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    315   2e-98    
gb|EPB86832.1|  glycerol-3-phosphate dehydrogenase [NAD+]               315   2e-98    
ref|XP_009002017.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   2e-98    
ref|XP_009896624.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   2e-98    
gb|KFV65669.1|  Glycerol-3-phosphate dehydrogenase 1-like               315   2e-98    
ref|XP_005062139.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   2e-98    
ref|XP_005488006.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   3e-98    
ref|XP_003397689.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   3e-98    
ref|XP_006970317.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   3e-98    
gb|ADB28156.1|  glycerol-3-phosphate dehydrogenase 1                    315   3e-98    Sus scrofa [pigs]
ref|XP_010815754.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   3e-98    
ref|XP_005242319.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   4e-98    
ref|XP_009097270.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   4e-98    
gb|KFW80215.1|  Glycerol-3-phosphate dehydrogenase 1-like               314   4e-98    
gb|AGW15345.1|  glycerol-3-phosphate dehydrogenase                      314   4e-98    
ref|XP_007251891.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   4e-98    
ref|XP_008921195.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   4e-98    
ref|XP_009286908.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   4e-98    
ref|XP_005067290.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   4e-98    
ref|NP_001177169.1|  glycerol-3-phosphate dehydrogenase [NAD+], c...    314   4e-98    
ref|XP_004603906.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   5e-98    
ref|XP_006004372.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   5e-98    
ref|NP_001126675.1|  glycerol-3-phosphate dehydrogenase 1-like pr...    314   5e-98    Pongo abelii [orang utan]
ref|XP_003483187.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   5e-98    
ref|XP_005877362.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   5e-98    
ref|XP_003252212.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
ref|NP_001083978.1|  glycerol-3-phosphate dehydrogenase 1 (soluble)     314   6e-98    Xenopus laevis [clawed frog]
ref|XP_003895264.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
ref|XP_008060463.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
ref|XP_005981015.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   6e-98    
ref|XP_008828690.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
ref|XP_004676412.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
ref|XP_003486248.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   6e-98    
emb|CEG68204.1|  Putative Glycerol-3-phosphate dehydrogenase [NAD ]     313   6e-98    
ref|XP_002372025.1|  glycerol-3-phosphate dehydrogenase, putative       316   6e-98    Toxoplasma gondii ME49
ref|NP_055956.1|  glycerol-3-phosphate dehydrogenase 1-like protein     314   6e-98    Homo sapiens [man]
pdb|2PLA|A  Chain A, Crystal Structure Of Human Glycerol-3-Phosph...    314   6e-98    
ref|XP_004279734.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   7e-98    
ref|XP_005387582.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   7e-98    
ref|NP_001093833.1|  glycerol-3-phosphate dehydrogenase 1-like pr...    314   7e-98    Bos taurus [bovine]
emb|CEJ02460.1|  Putative Glycerol-3-phosphate dehydrogenase [NAD ]     313   7e-98    
ref|XP_005545608.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   7e-98    
ref|XP_004588312.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    314   7e-98    
ref|XP_005075092.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   8e-98    
ref|XP_002187049.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   8e-98    Taeniopygia guttata
ref|XP_010567308.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   8e-98    
ref|XP_010184375.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   8e-98    
ref|XP_006017970.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   9e-98    
ref|NP_001006808.1|  glycerol-3-phosphate dehydrogenase [NAD(+)],...    313   9e-98    Xenopus tropicalis [western clawed frog]
ref|XP_010383660.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   9e-98    
gb|KFQ37291.1|  Glycerol-3-phosphate dehydrogenase 1-like               314   1e-97    
gb|AFS17319.1|  glycerol-3-phosphate dehydrogenase                      313   1e-97    
gb|KFM13820.1|  Glycerol-3-phosphate dehydrogenase 1-like               314   1e-97    
ref|XP_006265948.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_005519693.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_004312317.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_004477939.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_006137715.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_005353961.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
gb|EGV93605.1|  Glycerol-3-phosphate dehydrogenase [NAD+], cytopl...    316   1e-97    
ref|XP_006091606.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
ref|XP_004070862.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   1e-97    
dbj|BAC34327.1|  unnamed protein product                                312   1e-97    Mus musculus [mouse]
ref|XP_007464977.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-97    
ref|XP_005519032.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-97    
ref|XP_001154939.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-97    Pan troglodytes
ref|XP_009267043.1|  Glycerol-3-phosphate dehydrogenase 2               312   2e-97    
ref|XP_001504291.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-97    Equus caballus [domestic horse]
ref|XP_008581264.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-97    
ref|XP_007936010.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
ref|NP_005267.2|  glycerol-3-phosphate dehydrogenase [NAD(+)], cy...    312   2e-97    Homo sapiens [man]
ref|XP_007107529.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
ref|XP_002191251.2|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    Taeniopygia guttata
gb|AAX36153.1|  glycerol-3-phosphate dehydrogenase 1                    312   2e-97    
ref|XP_008317504.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
ref|XP_004018251.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
ref|NP_001125302.1|  glycerol-3-phosphate dehydrogenase [NAD(+)],...    312   2e-97    Pongo abelii [orang utan]
pdb|1X0X|A  Chain A, Co-Structure Of Homo Sapiens Glycerol-3-Phos...    312   2e-97    
ref|XP_005152904.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
gb|KFQ04260.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    312   2e-97    
ref|NP_071551.2|  glycerol-3-phosphate dehydrogenase [NAD(+)], cy...    312   2e-97    
ref|XP_009178978.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   2e-97    
ref|XP_009958945.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   2e-97    
gb|EIE79327.1|  glycerol-3-phosphate dehydrogenase [NAD+]               311   3e-97    
ref|XP_005680034.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    316   3e-97    
ref|XP_007190835.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   3e-97    
ref|XP_007607068.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   3e-97    
gb|EIE85071.1|  glycerol-3-phosphate dehydrogenase [NAD+]               312   3e-97    
ref|XP_007524109.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   3e-97    
ref|XP_008624696.1|  glycerol-3-phosphate dehydrogenase [NAD+]          313   3e-97    
ref|XP_003496301.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   3e-97    
ref|XP_001945715.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   4e-97    
ref|XP_004388371.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   4e-97    
emb|CAG04058.1|  unnamed protein product                                312   4e-97    
ref|XP_004649881.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   4e-97    
ref|XP_004274392.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   4e-97    
ref|XP_001617733.1|  hypothetical protein NEMVEDRAFT_v1g156868          311   4e-97    
ref|XP_004857880.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   4e-97    
ref|XP_004894458.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-97    
dbj|BAA07648.1|  KIAA0089                                               314   5e-97    
ref|NP_780589.3|  glycerol-3-phosphate dehydrogenase 1-like protein     311   5e-97    
ref|XP_010397203.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-97    
ref|XP_010564812.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-97    
ref|XP_008264323.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-97    
ref|XP_005101439.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   5e-97    
ref|XP_003475834.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-97    
ref|NP_001178814.1|  glycerol-3-phosphate dehydrogenase 1-like pr...    311   6e-97    
ref|XP_008254663.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   6e-97    
ref|XP_008184495.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   6e-97    
ref|XP_004053154.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   7e-97    
dbj|BAG35417.1|  unnamed protein product                                311   7e-97    
ref|XP_004778886.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   7e-97    
ref|XP_005040931.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   7e-97    
ref|XP_008138887.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   7e-97    
ref|XP_003906409.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   7e-97    
gb|KFW61052.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    311   8e-97    
ref|XP_006890685.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   8e-97    
ref|XP_009992366.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   8e-97    
pdb|1WPQ|A  Chain A, Ternary Complex Of Glycerol 3-Phosphate Dehy...    311   8e-97    
ref|XP_005659291.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    312   8e-97    
dbj|BAD32164.1|  mKIAA0089 protein                                      311   8e-97    
ref|XP_006851652.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   8e-97    
gb|KFU86963.1|  Glycerol-3-phosphate dehydrogenase [NAD(+)], cyto...    311   8e-97    
ref|XP_010405388.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    315   8e-97    
ref|XP_009319550.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   9e-97    
ref|XP_006900305.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   9e-97    
ref|XP_007946824.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   9e-97    
ref|XP_002198046.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   1e-96    
gb|EDL09291.1|  glycerol-3-phosphate dehydrogenase 1-like, isofor...    311   1e-96    
dbj|BAE23246.1|  unnamed protein product                                311   1e-96    
ref|NP_034401.1|  glycerol-3-phosphate dehydrogenase [NAD(+)], cy...    311   1e-96    
ref|XP_007452347.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   1e-96    
ref|XP_005532883.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   1e-96    
ref|XP_004829961.1|  glycerol-3-phosphate dehydrogenase, putative       313   1e-96    
gb|EHH20720.1|  Glycerol-3-phosphate dehydrogenase [NAD+], cytopl...    310   1e-96    
ref|XP_003790415.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   1e-96    
ref|XP_008824744.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   1e-96    
emb|CBW47554.1|  glycerol-3-phosphate dehydrogenase                     310   1e-96    
ref|XP_004634275.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   2e-96    
ref|XP_005636915.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   2e-96    
ref|XP_008001399.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   2e-96    
ref|XP_003480311.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    313   2e-96    
dbj|BAD90479.1|  mKIAA4010 protein                                      310   2e-96    
gb|KDN50866.1|  NAD-dependent glycerol-3-phosphate dehydrogenase        310   2e-96    
gb|ELU01876.1|  hypothetical protein CAPTEDRAFT_220756                  310   2e-96    
gb|AAA37726.1|  glycerol-3-phosphate dehydrogenase                      310   2e-96    
ref|XP_001730655.1|  hypothetical protein MGL_2451                      310   2e-96    
gb|AAH37729.1|  Gpd1l protein                                           311   2e-96    
ref|XP_009902700.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   2e-96    
ref|XP_008982205.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   2e-96    
gb|EZG83906.1|  putative glycerol-3-phosphate dehydrogenase             311   2e-96    
ref|XP_004317682.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   2e-96    
ref|XP_743804.1|  glycerol-3-phosphate dehydrogenase                    311   2e-96    
ref|XP_001102726.2|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   3e-96    
dbj|BAE26458.1|  unnamed protein product                                310   3e-96    
ref|XP_005324992.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   3e-96    
emb|CDS47046.1|  glycerol-3-phosphate dehydrogenase, putative           311   3e-96    
ref|XP_003405820.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   3e-96    
ref|XP_004263921.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    310   3e-96    
ref|XP_008202955.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   3e-96    
ref|XP_002922432.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   3e-96    
ref|XP_003257306.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   4e-96    
ref|XP_850380.1|  PREDICTED: glycerol-3-phosphate dehydrogenase [...    309   4e-96    
gb|EUD72763.1|  glycerol-3-phosphate dehydrogenase [NAD+]               311   4e-96    
ref|XP_006974473.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   5e-96    
ref|XP_006177766.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   5e-96    
ref|XP_003480037.2|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   5e-96    
ref|XP_003748533.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   5e-96    
ref|XP_007179402.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    311   5e-96    
ref|XP_007907297.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   6e-96    
ref|XP_004601513.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   6e-96    
gb|AAH05756.1|  Gpd1 protein                                            308   7e-96    
ref|XP_004379005.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   7e-96    
dbj|BAA21763.1|  glycerol 3-phosphate dehydrogenase                     308   7e-96    
gb|EPH53596.1|  glycerol-3-phosphate dehydrogenase, variant             308   8e-96    
ref|XP_001607937.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    309   8e-96    
ref|XP_006168240.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   8e-96    
ref|XP_007118874.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   8e-96    
ref|XP_010718838.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   8e-96    
ref|XP_003643165.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   9e-96    
ref|XP_008702787.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   9e-96    
ref|XP_005901696.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   9e-96    
ref|XP_003439015.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   1e-95    
ref|XP_008817917.1|  glycerol-3-phosphate dehydrogenase [NAD+]          310   1e-95    
ref|XP_007404810.1|  hypothetical protein MELLADRAFT_101681             308   1e-95    
ref|XP_007566411.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   1e-95    
emb|CBL52983.1|  glycerol-3-phosphate dehydrogenase                     308   1e-95    
gb|KDE04892.1|  glycerol-3-phosphate dehydrogenase [NAD+] 1             308   1e-95    
ref|XP_006870120.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   1e-95    
dbj|BAC36001.1|  unnamed protein product                                308   1e-95    
ref|XP_005241713.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   2e-95    
ref|XP_005801802.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    308   2e-95    
ref|XP_005515468.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_005684578.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_005731819.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_006203020.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_006916850.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_003963492.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_004419514.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_010621963.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   2e-95    
ref|XP_004637861.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
ref|XP_005188668.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
ref|XP_006751380.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
gb|KFG29452.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      320   3e-95    
ref|XP_007895748.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
tpg|DAA26327.1|  TPA: KIAA0089-like                                     307   3e-95    
emb|CDS06950.1|  hypothetical protein LRAMOSA09473                      306   3e-95    
ref|XP_005188669.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
ref|XP_007003199.1|  hypothetical protein TREMEDRAFT_28636              306   3e-95    
ref|XP_008412408.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
ref|XP_004068862.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   3e-95    
gb|KFH00965.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      319   4e-95    
ref|XP_001615267.1|  glycerol-3-phosphate dehydrogenase                 308   4e-95    
gb|KFG27835.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      319   4e-95    
ref|NP_001017709.1|  glycerol-3-phosphate dehydrogenase 1a              306   5e-95    
emb|CDS46806.1|  glycerol-3-phosphate dehydrogenase, putative           308   5e-95    
ref|XP_005972603.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   5e-95    
ref|XP_008407124.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   5e-95    
ref|XP_004429062.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   5e-95    
ref|XP_005411930.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   5e-95    
gb|ACO09722.1|  Glycerol-3-phosphate dehydrogenase, cytoplasmic         306   6e-95    
gb|EFW45224.2|  glycerol-3-phosphate dehydrogenase                      310   6e-95    
ref|XP_010777941.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   6e-95    
ref|XP_007881839.1|  hypothetical protein PFL1_06110                    311   7e-95    
ref|XP_004880729.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   8e-95    
ref|XP_008281893.1|  PREDICTED: LOW QUALITY PROTEIN: glycerol-3-p...    307   8e-95    
gb|ACO10070.1|  Glycerol-3-phosphate dehydrogenase, cytoplasmic         305   9e-95    
ref|XP_006796578.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   9e-95    
gb|ELK33316.1|  Glycerol-3-phosphate dehydrogenase 1-like protein       305   1e-94    
emb|CDH58544.1|  glycerol-3-phosphate dehydrogenase                     305   1e-94    
gb|KFG59195.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      318   1e-94    
ref|XP_005926252.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    307   1e-94    
gb|KFH02516.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      318   1e-94    
ref|XP_005755455.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    306   1e-94    
ref|XP_010730014.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   1e-94    
gb|ESS29105.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      318   1e-94    
ref|XP_004400892.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   2e-94    
ref|XP_008559103.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   2e-94    
ref|XP_010593892.1|  PREDICTED: LOW QUALITY PROTEIN: glycerol-3-p...    308   2e-94    
ref|NP_956000.1|  glycerol-3-phosphate dehydrogenase 1b                 305   2e-94    
ref|XP_002259146.1|  glycerol-3-phosphate dehydrogenase                 306   2e-94    
pdb|1X0V|A  Chain A, Crystal Structure Of Homo Sapien Glycerol-3-...    305   2e-94    
gb|ACO14565.1|  Glycerol-3-phosphate dehydrogenase, cytoplasmic         305   2e-94    
ref|XP_004562644.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   3e-94    
ref|XP_006759711.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   3e-94    
gb|EPR56915.1|  putative glycerol-3-phosphate dehydrogenase (gpdh)      318   3e-94    
ref|XP_010895998.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   3e-94    
ref|XP_007438824.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   3e-94    
ref|NP_001086027.1|  MGC83663 protein                                   304   3e-94    
emb|CDS11054.1|  hypothetical protein LRAMOSA03318                      304   3e-94    
ref|XP_004066568.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   3e-94    
gb|KFM77204.1|  Glycerol-3-phosphate dehydrogenase 1-like protein       302   4e-94    
gb|AAT47549.1|  glycerol-3-phosphate dehydrogenase                      304   4e-94    
ref|NP_999918.1|  glycerol-3-phosphate dehydrogenase [NAD+], cyto...    304   4e-94    
ref|XP_006636319.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   4e-94    
ref|XP_008322079.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   5e-94    
ref|XP_002425102.1|  glycerol-3-phosphate dehydrogenase, putative       303   6e-94    
ref|XP_006959799.1|  NAD-dependent glycerol-3-phosphate dehydroge...    303   6e-94    
ref|XP_008559108.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   6e-94    
ref|XP_003397690.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    304   6e-94    
ref|XP_008559107.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   8e-94    
ref|XP_010741176.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   9e-94    
ref|XP_007239668.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   9e-94    
ref|XP_008559106.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   9e-94    
ref|XP_004546281.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    305   9e-94    
ref|XP_005999357.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   9e-94    
ref|XP_008172067.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   9e-94    
ref|XP_003453233.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   1e-93    
emb|CDQ74436.1|  unnamed protein product                                303   1e-93    
gb|EPT27501.1|  glycerol-3-phosphate dehydrogenase (gpdh), putative     318   1e-93    
ref|XP_005877189.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   1e-93    
ref|NP_001117111.1|  glycerol-3-phosphate dehydrogenase                 303   1e-93    
ref|XP_002129029.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   1e-93    
ref|XP_007428030.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    303   1e-93    
emb|CDQ93243.1|  unnamed protein product                                302   1e-93    
ref|XP_006051373.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   2e-93    
emb|CDJ89408.1|  NAD-dependent glycerol-3-phosphate dehydrogenase...    303   2e-93    
gb|EPB83898.1|  glycerol-3-phosphate dehydrogenase [NAD+]               302   2e-93    
ref|XP_002171690.1|  glycerol-3-phosphate dehydrogenase Gpd1            303   2e-93    
ref|XP_006792963.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   2e-93    
ref|XP_010891021.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   2e-93    
gb|AEQ55209.2|  GPDH                                                    302   2e-93    
dbj|BAM09217.1|  glycerol-3-phosphate dehydrogenase 1                   301   2e-93    
emb|CBY13174.1|  unnamed protein product                                302   2e-93    
ref|XP_004391475.1|  PREDICTED: LOW QUALITY PROTEIN: glycerol-3-p...    305   2e-93    
ref|XP_003697604.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   3e-93    
sp|P08507.2|GPDA_RABIT  RecName: Full=Glycerol-3-phosphate dehydr...    301   3e-93    
gb|EEZ98249.1|  hypothetical protein TcasGA2_TC000688                   301   3e-93    
emb|CDQ87658.1|  unnamed protein product                                301   4e-93    
ref|XP_006623255.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    302   4e-93    
gb|AAY63979.1|  glycerol-3-phosphate dehydrogenase                      301   4e-93    
ref|XP_008107591.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    301   5e-93    
ref|XP_004711449.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    301   6e-93    
ref|XP_007546900.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    301   6e-93    
ref|XP_006558427.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    301   7e-93    
gb|EGT33683.1|  CBN-GPDH-2 protein                                      301   9e-93    
gb|EOB02426.1|  Glycerol-3-phosphate dehydrogenase 1-like protein       300   9e-93    
ref|XP_007251571.1|  PREDICTED: glycerol-3-phosphate dehydrogenas...    300   9e-93    
dbj|GAA99997.1|  hypothetical protein E5Q_06700                         303   1e-92    



>ref|XP_009625326.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Nicotiana 
tomentosiformis]
Length=400

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/314 (90%), Positives = 297/314 (95%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASNTL  NSFHDEVRMWVFEE LP+GEKLSEVIN+TNENV
Sbjct  42    KSRVTVVGSGNWGSVAAKLIASNTLNFNSFHDEVRMWVFEETLPSGEKLSEVINRTNENV  101

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNV+ADPDLEHA RDANMLVFVTPHQFMEGICK+LVGKIRKDA+AISLIKG
Sbjct  102   KYLPGIKLGKNVVADPDLEHAVRDANMLVFVTPHQFMEGICKRLVGKIRKDAQAISLIKG  161

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLI+E LGINCCVL GANIANEIAVEKFSEATVGYRENKEIA+KWV+L
Sbjct  162   MEVKREGPCMISTLISEILGINCCVLCGANIANEIAVEKFSEATVGYRENKEIAEKWVRL  221

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGL+MGNNTKAAIMRIGLREMKAFSK
Sbjct  222   FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLDMGNNTKAAIMRIGLREMKAFSK  281

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK++TFFESCGVAD+ITTCLGGRNRKCADAFA+NGGKRSFDELEAEMLQGQKLQ 
Sbjct  282   LLFPSVKDNTFFESCGVADLITTCLGGRNRKCADAFARNGGKRSFDELEAEMLQGQKLQG  341

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  342   VSTAKEVYEVLSHR  355


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSA  288
            GVSTAKEVYEVL +RG L+LFPLFSTVHEIC+GRL PSAIVEY+EH+ R  L+ GSA
Sbjct  341  GVSTAKEVYEVLSHRGLLQLFPLFSTVHEICSGRLAPSAIVEYTEHSARLPLLEGSA  397



>ref|XP_009765246.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Nicotiana 
sylvestris]
Length=400

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/314 (89%), Positives = 297/314 (95%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASNTL  NSFHDEVRMWVFEE LP+GEKLSEVIN+TNENV
Sbjct  42    KSRVTVVGSGNWGSVAAKLIASNTLNFNSFHDEVRMWVFEETLPSGEKLSEVINRTNENV  101

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNV+ADPDLEHA RDANMLVFVTPHQFMEGICK+LVGKIRKDA+AISLIKG
Sbjct  102   KYLPGIKLGKNVVADPDLEHAVRDANMLVFVTPHQFMEGICKRLVGKIRKDAQAISLIKG  161

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLI+E LGINCCVL GANIANEIAVEKFSEATVGYRENKEIA+KWV+L
Sbjct  162   MEVKREGPCMISTLISEILGINCCVLCGANIANEIAVEKFSEATVGYRENKEIAEKWVRL  221

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             FNTPYFMVS+VQDVEGVELCGTLKNVVALAAGFVDGL+MGNNTKAAIMRIGLREMKAFSK
Sbjct  222   FNTPYFMVSSVQDVEGVELCGTLKNVVALAAGFVDGLDMGNNTKAAIMRIGLREMKAFSK  281

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK++TFFESCGVAD+ITTCLGGRNRKCADAFA+NGGKRSFDELEAEMLQGQKLQ 
Sbjct  282   LLFPSVKDNTFFESCGVADLITTCLGGRNRKCADAFARNGGKRSFDELEAEMLQGQKLQG  341

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  342   VSTAKEVYEVLSHR  355


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSA  288
            GVSTAKEVYEVL +RG L+LFPLFSTVHEIC+GRL PSAIVEY+EH+ R  L+ GSA
Sbjct  341  GVSTAKEVYEVLSHRGLLQLFPLFSTVHEICSGRLAPSAIVEYTEHSARLPLLEGSA  397



>ref|XP_006357169.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Solanum 
tuberosum]
Length=369

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/320 (87%), Positives = 299/320 (93%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASNTL +NSFHDEVRMWVFEE LP+GEKLSEVIN+TNENV
Sbjct  18    KSRVTVVGSGNWGSVAAKLIASNTLNINSFHDEVRMWVFEETLPSGEKLSEVINRTNENV  77

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+L KNV+ADPD+EHA +DANMLVFVTPHQFMEGICK+L+GKIRKDA AISLIKG
Sbjct  78    KYLPGIKLPKNVVADPDIEHAVKDANMLVFVTPHQFMEGICKRLIGKIRKDAVAISLIKG  137

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLI+E LGI+CCVLMGANIANEIAVEKFSEATVGYRENKEIA+KWV+L
Sbjct  138   MEVKKEGPCMISTLISEILGISCCVLMGANIANEIAVEKFSEATVGYRENKEIAEKWVRL  197

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGL+MGNNTKAAIMRIGLREMKA SK
Sbjct  198   FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLDMGNNTKAAIMRIGLREMKALSK  257

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK++TFFESCGVAD+ITTCLGGRNR+CADAFA+NGGKRSFDELEAEMLQGQKLQ 
Sbjct  258   LLFPSVKDNTFFESCGVADLITTCLGGRNRRCADAFARNGGKRSFDELEAEMLQGQKLQG  317

Query  652   HQTA---------MGYIELF  620
               TA          G++ELF
Sbjct  318   VSTAKEVYEVLSHRGWLELF  337


 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLV  300
            GVSTAKEVYEVL +RGWLELFPLFSTVHEIC+GRL PSAIVEY+EH+ R  L+
Sbjct  317  GVSTAKEVYEVLSHRGWLELFPLFSTVHEICSGRLAPSAIVEYTEHSARLPLL  369



>ref|XP_011097351.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Sesamum 
indicum]
Length=389

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/323 (86%), Positives = 299/323 (93%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D   +RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEV MWVFEE+LPTGEKLS+VIN+TN
Sbjct  28    DEMTTRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVIMWVFEEILPTGEKLSQVINRTN  87

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LGKNV+A+PDLE A +DAN+LVFVTPHQFMEGICK+LVGKIR DAEAISL
Sbjct  88    ENVKYLPGIKLGKNVVANPDLESAVKDANLLVFVTPHQFMEGICKRLVGKIRADAEAISL  147

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             IKGMEVK EGPCMIS+LI+EQLGINCCVLMGANIANEIAVEKFSEATVGYR+NKEIA KW
Sbjct  148   IKGMEVKREGPCMISSLISEQLGINCCVLMGANIANEIAVEKFSEATVGYRKNKEIADKW  207

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLFNT YF V+AVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMR+GLREMKA
Sbjct  208   VQLFNTSYFAVTAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRVGLREMKA  267

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             FSKLLFPSVK+STFFESCG+ADVITTCLGGRNRKCA+AFA+NGGKRSFDELEAEMLQGQK
Sbjct  268   FSKLLFPSVKDSTFFESCGIADVITTCLGGRNRKCAEAFARNGGKRSFDELEAEMLQGQK  327

Query  661   LQVHQTA---------MGYIELF  620
             LQ   TA          G++ELF
Sbjct  328   LQGVSTAKEVYEVLRHRGWLELF  350


 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTAKEVYEVLR+RGWLELFPLFSTVHEIC  RLPP+AIVEYSEHTP++SLVGG A +F
Sbjct  330  GVSTAKEVYEVLRHRGWLELFPLFSTVHEICISRLPPTAIVEYSEHTPKYSLVGGPAQFF  389



>ref|XP_002271417.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Vitis 
vinifera]
 emb|CBI17717.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/321 (85%), Positives = 301/321 (94%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVAAKLIASNTLKL+SFHDEVRMWV+EE+LP+GEKLSEVIN+ NEN
Sbjct  22    HKSKVTVVGSGNWGSVAAKLIASNTLKLSSFHDEVRMWVYEEILPSGEKLSEVINQNNEN  81

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLEHA +DA MLVFVTPHQFMEGICK+LVGKIR DAEAISLIK
Sbjct  82    VKYLPGIKLGKNVVADPDLEHAVKDATMLVFVTPHQFMEGICKRLVGKIRGDAEAISLIK  141

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLIT+ LGINCCVLMGANIANEIAVEKFSEATVGYREN++IA++WV+
Sbjct  142   GMEVKMEGPCMISTLITDLLGINCCVLMGANIANEIAVEKFSEATVGYRENRDIAERWVR  201

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMVSAVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  202   LFSTPYFMVSAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  261

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLF SV++STFFESCG+AD+ITTCLGGRNRK A+AFA+NGGKRSFDELEAEMLQGQKLQ
Sbjct  262   KLLFSSVRDSTFFESCGIADLITTCLGGRNRKVAEAFARNGGKRSFDELEAEMLQGQKLQ  321

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  322   GVSTAREVYEVLSHRGWLELF  342


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANY  282
            GVSTA+EVYEVL +RGWLELFPLF+ VHEI TGRLPPSAIVEYSEHTPR +++ GSA Y
Sbjct  322  GVSTAREVYEVLSHRGWLELFPLFTAVHEISTGRLPPSAIVEYSEHTPRLNVLEGSAQY  380



>emb|CAN61056.1| hypothetical protein VITISV_041140 [Vitis vinifera]
Length=398

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/321 (85%), Positives = 301/321 (94%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVAAKLIASNTLKL+SFHDEVRMWV+EE+LP+GEKLSEVIN+ NEN
Sbjct  22    HKSKVTVVGSGNWGSVAAKLIASNTLKLSSFHDEVRMWVYEEILPSGEKLSEVINQNNEN  81

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLEHA +DA MLVFVTPHQFMEGICK+LVGKIR DAEAISLIK
Sbjct  82    VKYLPGIKLGKNVVADPDLEHAVKDATMLVFVTPHQFMEGICKRLVGKIRGDAEAISLIK  141

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLIT+ LGINCCVLMGANIANEIAVEKFSEATVGYREN++IA++WV+
Sbjct  142   GMEVKMEGPCMISTLITDLLGINCCVLMGANIANEIAVEKFSEATVGYRENRDIAERWVR  201

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMVSAVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  202   LFSTPYFMVSAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  261

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLF SV++STFFESCG+AD+ITTCLGGRNRK A+AFA+NGGKRSFDELEAEMLQGQKLQ
Sbjct  262   KLLFSSVRDSTFFESCGIADLITTCLGGRNRKVAEAFARNGGKRSFDELEAEMLQGQKLQ  321

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  322   GVSTAREVYEVLSHRGWLELF  342


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYS  327
            GVSTA+EVYEVL +RGWLELFPLF+ VHEI TGRLPPSAIVEY+
Sbjct  322  GVSTAREVYEVLSHRGWLELFPLFTAVHEISTGRLPPSAIVEYT  365



>ref|XP_004233311.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Solanum 
lycopersicum]
Length=369

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/320 (86%), Positives = 296/320 (93%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASNTL +NSFHDEVRMWVFEE +P+GEKLSEVIN+TNENV
Sbjct  18    KSRVTVVGSGNWGSVAAKLIASNTLNINSFHDEVRMWVFEETVPSGEKLSEVINRTNENV  77

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+L KNV+ADPD+EHA +DANMLVFVTPHQFMEGICK+LVGKIRKDA AISLIKG
Sbjct  78    KYLPGIKLPKNVVADPDIEHAVKDANMLVFVTPHQFMEGICKRLVGKIRKDAVAISLIKG  137

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLI+E LGI+CCVLMGANIANEIAVEKFSEATVGYR+NKEIA KWV L
Sbjct  138   MEVKREGPCMISTLISEILGISCCVLMGANIANEIAVEKFSEATVGYRDNKEIADKWVCL  197

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             FNTPYF+VSAVQDVEGVELCGTLKNVVALAAGFVDGL+MGNNTKAAIMRIGLREMKA SK
Sbjct  198   FNTPYFLVSAVQDVEGVELCGTLKNVVALAAGFVDGLDMGNNTKAAIMRIGLREMKALSK  257

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK++TFFESCGVAD+ITTCLGGRNR+CADAFA+NGGKRSFDELEAEMLQGQKLQ 
Sbjct  258   LLFPSVKDNTFFESCGVADLITTCLGGRNRRCADAFARNGGKRSFDELEAEMLQGQKLQG  317

Query  652   HQTA---------MGYIELF  620
               TA          G+ ELF
Sbjct  318   VSTAKEVYEVLSHRGWFELF  337


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLV  300
            GVSTAKEVYEVL +RGW ELFPLF+TVH+IC+GRL PSAIVEY+EH+ R  L+
Sbjct  317  GVSTAKEVYEVLSHRGWFELFPLFATVHQICSGRLAPSAIVEYTEHSARLPLL  369



>gb|EYU34762.1| hypothetical protein MIMGU_mgv1a008412mg [Erythranthe guttata]
Length=374

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/320 (87%), Positives = 297/320 (93%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEV MWVFEE LPTGEKLS+VIN+TNENV
Sbjct  30    KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVSMWVFEETLPTGEKLSQVINRTNENV  89

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG++LGKNV+A+PDLE+A +DAN+LVFVTPHQFMEGICK+LVGKIR DAEAISLIKG
Sbjct  90    KYLPGVKLGKNVVANPDLENAVKDANLLVFVTPHQFMEGICKRLVGKIRADAEAISLIKG  149

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR+NKE+A+KWVQL
Sbjct  150   MEVKREGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRKNKEMAEKWVQL  209

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             FNT YFMVS VQDVEGVELCGTLKNVVA+AAG VDGLEMGNNTKAAIMRIGLREM A SK
Sbjct  210   FNTSYFMVSPVQDVEGVELCGTLKNVVAIAAGLVDGLEMGNNTKAAIMRIGLREMMALSK  269

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVAD+ITTCLGGRNRKCA+AFA+NGGKRSFDELEAEMLQGQKLQ 
Sbjct  270   LLFPSVKDSTFFESCGVADLITTCLGGRNRKCAEAFARNGGKRSFDELEAEMLQGQKLQG  329

Query  652   HQTA---------MGYIELF  620
               TA          G++ELF
Sbjct  330   VSTAKEVYEVLNHRGWLELF  349


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVE  333
            GVSTAKEVYEVL +RGWLELFPLFSTVHEIC  RLPP AIV 
Sbjct  329  GVSTAKEVYEVLNHRGWLELFPLFSTVHEICIARLPPIAIVN  370



>ref|XP_011098787.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Sesamum 
indicum]
Length=363

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/319 (86%), Positives = 298/319 (93%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             SRVTVVGSGNWGSVAAKLIASNTLKL+SFHDEVRMWVFEE+LP+GEKLS+VIN+TNENVK
Sbjct  6     SRVTVVGSGNWGSVAAKLIASNTLKLDSFHDEVRMWVFEEILPSGEKLSQVINRTNENVK  65

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LG NV+ADPDLE+A RDA+MLVFVTPHQF+EGICK+LVGKIRKD EAISLIKGM
Sbjct  66    YLPGIKLGTNVVADPDLENAVRDASMLVFVTPHQFVEGICKRLVGKIRKDTEAISLIKGM  125

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVK EGPCMIS+LI+EQLGI+CCVLMGANIANEIAVEKFSEATVGYR++KE A KWVQLF
Sbjct  126   EVKREGPCMISSLISEQLGISCCVLMGANIANEIAVEKFSEATVGYRKDKETADKWVQLF  185

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             NT YFMVSAVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMK FSKL
Sbjct  186   NTSYFMVSAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKTFSKL  245

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LFPSVK+STFFESCGVAD+ITTCLGGRNR+CA+AFA+NGGKRSFDELEAEMLQGQKLQ  
Sbjct  246   LFPSVKDSTFFESCGVADLITTCLGGRNRRCAEAFARNGGKRSFDELEAEMLQGQKLQGV  305

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  306   STAKEVYEVLRHRGWLELF  324


 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTAKEVYEVLR+RGWLELFPLFSTVHEIC GRLPP+AIVEYSEHTP+FSLVGGSA +F
Sbjct  304  GVSTAKEVYEVLRHRGWLELFPLFSTVHEICVGRLPPTAIVEYSEHTPKFSLVGGSAQFF  363



>emb|CDP16627.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/322 (85%), Positives = 297/322 (92%), Gaps = 9/322 (3%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             +NKS+VTVVGSGNWGSVAAKLIASNTLK  SFHDEVRMWVFEE L  GEKLSEVIN+TNE
Sbjct  31    SNKSKVTVVGSGNWGSVAAKLIASNTLKFPSFHDEVRMWVFEETLSNGEKLSEVINQTNE  90

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPG++LGKNV+ADPDLEHA RDANMLVFVTPHQFMEGICK+LVGKI+K+AEAISLI
Sbjct  91    NVKYLPGVKLGKNVVADPDLEHAVRDANMLVFVTPHQFMEGICKRLVGKIKKEAEAISLI  150

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVKMEGPCMISTLI+E+LGINCCVLMGANIANEIA EKFSEATVGYR NKEIA +WV
Sbjct  151   KGMEVKMEGPCMISTLISEKLGINCCVLMGANIANEIAEEKFSEATVGYRGNKEIADRWV  210

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LFN PYF+VSAVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAF
Sbjct  211   ELFNHPYFIVSAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAF  270

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLF SV +STFFESCGVAD+ITTCLGGRNRKCA+AFA++GGKR+FDELEAEMLQGQKL
Sbjct  271   SKLLFSSVNDSTFFESCGVADIITTCLGGRNRKCAEAFARHGGKRTFDELEAEMLQGQKL  330

Query  658   QVHQTA---------MGYIELF  620
             Q   TA          G++ELF
Sbjct  331   QGVSTAKEVYEVLRHRGWLELF  352


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVE  333
            GVSTAKEVYEVLR+RGWLELFPLF+TVHEIC+GRLPPSAIVE
Sbjct  332  GVSTAKEVYEVLRHRGWLELFPLFTTVHEICSGRLPPSAIVE  373



>ref|XP_010033350.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X2 [Eucalyptus grandis]
Length=380

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/321 (84%), Positives = 297/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
              KSRVTVVG GNWGSVA KLIASNTL+L SFHDEVRMWVFEE+LP+GEKL++VIN TNEN
Sbjct  21    QKSRVTVVGRGNWGSVAPKLIASNTLRLPSFHDEVRMWVFEEILPSGEKLTDVINSTNEN  80

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LG NV+ADPDLE+A +DANMLVFVTPHQF+EGICK+LVGK+++  EAISLIK
Sbjct  81    VKYLPGIKLGNNVVADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKVKEGVEAISLIK  140

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMIS+LI+EQLGINCCVLMGANIANEIAVEKFSEATVGYREN+EIA+KWV+
Sbjct  141   GMEVKMEGPCMISSLISEQLGINCCVLMGANIANEIAVEKFSEATVGYRENREIAEKWVK  200

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMVS VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  201   LFSTPYFMVSPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  260

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK++TFFESCGVAD+ITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ
Sbjct  261   KLLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQ  320

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  321   GVSTARELYEVLSHRGWLELF  341


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+E+YEVL +RGWLELFPLF+TVHEI +GRL PSAIVEYSEH P FSLV GSA Y+
Sbjct  321  GVSTARELYEVLSHRGWLELFPLFATVHEISSGRLLPSAIVEYSEHKPNFSLVQGSAQYY  380



>gb|KCW52964.1| hypothetical protein EUGRSUZ_J02265 [Eucalyptus grandis]
Length=365

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/320 (84%), Positives = 297/320 (93%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVG GNWGSVA KLIASNTL+L SFHDEVRMWVFEE+LP+GEKL++VIN TNENV
Sbjct  22    KSRVTVVGRGNWGSVAPKLIASNTLRLPSFHDEVRMWVFEEILPSGEKLTDVINSTNENV  81

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NV+ADPDLE+A +DANMLVFVTPHQF+EGICK+LVGK+++  EAISLIKG
Sbjct  82    KYLPGIKLGNNVVADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKVKEGVEAISLIKG  141

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS+LI+EQLGINCCVLMGANIANEIAVEKFSEATVGYREN+EIA+KWV+L
Sbjct  142   MEVKMEGPCMISSLISEQLGINCCVLMGANIANEIAVEKFSEATVGYRENREIAEKWVKL  201

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMVS VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFSK
Sbjct  202   FSTPYFMVSPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  261

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK++TFFESCGVAD+ITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ 
Sbjct  262   LLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQG  321

Query  652   HQTA---------MGYIELF  620
               TA          G++ELF
Sbjct  322   VSTARELYEVLSHRGWLELF  341


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYS  327
            GVSTA+E+YEVL +RGWLELFPLF+TVHEI +GRL PSAIVEY+
Sbjct  321  GVSTARELYEVLSHRGWLELFPLFATVHEISSGRLLPSAIVEYN  364



>ref|XP_010111663.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Morus notabilis]
 gb|EXC31408.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Morus notabilis]
Length=376

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/330 (83%), Positives = 300/330 (91%), Gaps = 18/330 (5%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KSRVTVVGSGNWGSVAAKLIASNTL L SFHDEVRMWVFEE LP+GEKL++VIN+TNEN
Sbjct  11    SKSRVTVVGSGNWGSVAAKLIASNTLTLPSFHDEVRMWVFEETLPSGEKLTDVINRTNEN  70

Query  1375  VKYLPGIQLGKNVIADPDLEHAAR---------DANMLVFVTPHQFMEGICKKLVGKIRK  1223
             VKYLPGI+LGKNVIADPDLE+A R         DANMLVFVTPHQFMEGICK+LVGKI+ 
Sbjct  71    VKYLPGIKLGKNVIADPDLENAGRSMFLCFYGTDANMLVFVTPHQFMEGICKRLVGKIKG  130

Query  1222  DAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN  1043
             D EAISLIKGMEVKMEGPCMISTLI++QLG+NCCVLMGANIANEIAVEKFSEATVGYRE+
Sbjct  131   DVEAISLIKGMEVKMEGPCMISTLISQQLGLNCCVLMGANIANEIAVEKFSEATVGYRES  190

Query  1042  KEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRI  863
             +EIA+KWVQLF+TPYF+V+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRI
Sbjct  191   REIAEKWVQLFSTPYFIVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRI  250

Query  862   GLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEA  683
             GLREMKAFSK+LF SVK+STFFESCGVAD+ITTCLGGRNRK ADAFA+NGGKRSFDELEA
Sbjct  251   GLREMKAFSKMLFSSVKDSTFFESCGVADLITTCLGGRNRKVADAFARNGGKRSFDELEA  310

Query  682   EMLQGQKLQVHQTA---------MGYIELF  620
             EMLQGQKLQ   TA          G++ELF
Sbjct  311   EMLQGQKLQGVSTAREVYEVLSHRGWLELF  340


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLV  300
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC GRLPPSAIVE+SE  P+ SLV
Sbjct  320  GVSTAREVYEVLSHRGWLELFPLFATVHEICVGRLPPSAIVEHSERIPKLSLV  372



>gb|KEH25377.1| glycerol-3-phosphate dehydrogenase, NAD [Medicago truncatula]
Length=352

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/314 (83%), Positives = 296/314 (94%), Gaps = 6/314 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             N+S+VTV+GSGNWGSVA+KLIASNT+++N+FHDEVRMWV+EE LP+GEKL++VIN+TNEN
Sbjct  27    NRSKVTVIGSGNWGSVASKLIASNTIRMNNFHDEVRMWVYEETLPSGEKLTDVINQTNEN  86

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A RDANMLVFVTPHQFMEGICK++ GKIR DAEAISL+K
Sbjct  87    VKYLPGIKLGKNVVADPDLENAVRDANMLVFVTPHQFMEGICKRIAGKIRADAEAISLVK  146

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI+E+LGINC VLMGANIANEIAVEKFSEATVGYR+N+E A++WV 
Sbjct  147   GMEVKMEGPCMISTLISEELGINCSVLMGANIANEIAVEKFSEATVGYRQNREAAERWVH  206

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF TPYF+V+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKAFS
Sbjct  207   LFYTPYFIVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRLGLREMKAFS  266

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK+STFFESCGVAD+ITTCLGGRNRK A+A+AKNGGKRSFDELEAEMLQGQKLQ
Sbjct  267   KLLFPSVKDSTFFESCGVADLITTCLGGRNRKVAEAYAKNGGKRSFDELEAEMLQGQKLQ  326

Query  655   VHQTAMGYIELFLP  614
                    Y E+ LP
Sbjct  327   T------YFEVSLP  334



>ref|XP_007031668.1| NAD-dependent glycerol-3-phosphate dehydrogenase family protein 
[Theobroma cacao]
 gb|EOY02594.1| NAD-dependent glycerol-3-phosphate dehydrogenase family protein 
[Theobroma cacao]
Length=444

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/320 (85%), Positives = 297/320 (93%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSR+TVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEE LP+GEKL++VIN+TNEN 
Sbjct  86    KSRITVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEETLPSGEKLTDVINRTNENA  145

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNVIADPDL++A +DANMLVFVTPHQFMEGICK+LVGK+  D EAISLIKG
Sbjct  146   KYLPGIKLGKNVIADPDLDNAVKDANMLVFVTPHQFMEGICKRLVGKVSGDVEAISLIKG  205

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMISTLI+EQLGINC VLMGANIANEIAVEKFSEATVGYR+N+EIA++WVQL
Sbjct  206   MEVKMEGPCMISTLISEQLGINCSVLMGANIANEIAVEKFSEATVGYRDNREIAEQWVQL  265

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ VQDVEGVELCGTLKNVVA+AAGFVDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  266   FSTPYFMVTPVQDVEGVELCGTLKNVVAIAAGFVDGLDMGNNTKAAIMRIGLREMRAFSK  325

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLF SV++STFFESCGVADVITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ 
Sbjct  326   LLFSSVRDSTFFESCGVADVITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQG  385

Query  652   HQTA---------MGYIELF  620
               TA          G++ELF
Sbjct  386   VSTAREVYEVLSHRGWLELF  405


 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANY  282
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC G LPPSAIVEYSE  PR SL+  SA Y
Sbjct  385  GVSTAREVYEVLSHRGWLELFPLFATVHEICIGHLPPSAIVEYSEKKPRLSLLEDSARY  443



>ref|XP_006446670.1| hypothetical protein CICLE_v10015567mg [Citrus clementina]
 ref|XP_006446671.1| hypothetical protein CICLE_v10015567mg [Citrus clementina]
 gb|ESR59910.1| hypothetical protein CICLE_v10015567mg [Citrus clementina]
 gb|ESR59911.1| hypothetical protein CICLE_v10015567mg [Citrus clementina]
Length=386

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/321 (83%), Positives = 299/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVA+KLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++VIN+TNEN
Sbjct  27    HKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNEN  86

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A +DANMLVFVTPHQFMEGICK+LVGK+  D EAISLIK
Sbjct  87    VKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIK  146

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVK EGPCMISTLI+EQLG++CCVLMGANIANEIAVEKFSEATVGYR+N+EIA+KWVQ
Sbjct  147   GMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQ  206

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMV+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+AFS
Sbjct  207   LFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFS  266

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLF SVK+STFFESCGVAD+ITTCLGGRNRK A+AFAKN GKRSFD+LEAEMLQGQKLQ
Sbjct  267   KLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQ  326

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  327   GVSTAREVYEVLSHRGWLELF  347


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC G LPPSAIVEYSE  PR SL+ GS  Y+
Sbjct  327  GVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY  386



>ref|XP_004489553.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Cicer 
arietinum]
Length=377

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 297/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             N+S+VTV+GSGNWGSVA+KLIASNTL+L++FHDEVRMWV+EE LP+GEKL++VIN+TNEN
Sbjct  27    NRSKVTVIGSGNWGSVASKLIASNTLRLSNFHDEVRMWVYEETLPSGEKLTDVINQTNEN  86

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A RDANMLVFVTPHQFMEGICK++ GKIR DAEAISL+K
Sbjct  87    VKYLPGIKLGKNVVADPDLENAVRDANMLVFVTPHQFMEGICKRIAGKIRADAEAISLVK  146

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI+ +LGINC VLMGANIANEIAVEKFSEATVGYR+N+E A++WV 
Sbjct  147   GMEVKMEGPCMISTLISHELGINCSVLMGANIANEIAVEKFSEATVGYRQNREAAERWVH  206

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF TPYF+V+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKAFS
Sbjct  207   LFYTPYFIVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRLGLREMKAFS  266

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK+STFFESCGVAD+ITTCLGGRNRK A+A+AKNGGKRSFDELE EMLQGQKLQ
Sbjct  267   KLLFPSVKDSTFFESCGVADLITTCLGGRNRKVAEAYAKNGGKRSFDELEVEMLQGQKLQ  326

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  327   GVSTAREVYEVLSHRGWLELF  347


 Score = 89.0 bits (219),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYEVL +RGWLELFPLFSTVHEI +G LPPSAIVEYSE +PR
Sbjct  327  GVSTAREVYEVLSHRGWLELFPLFSTVHEISSGLLPPSAIVEYSEKSPR  375



>ref|XP_006470193.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X1 [Citrus sinensis]
 ref|XP_006470194.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X2 [Citrus sinensis]
 ref|XP_006470195.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X3 [Citrus sinensis]
 gb|KDO47662.1| hypothetical protein CISIN_1g014739mg [Citrus sinensis]
 gb|KDO47663.1| hypothetical protein CISIN_1g014739mg [Citrus sinensis]
Length=419

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/321 (83%), Positives = 299/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVA+KLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++VIN+TNEN
Sbjct  60    HKSKVTVVGSGNWGSVASKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDVINRTNEN  119

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A +DANMLVFVTPHQFMEGICK+LVGK+  D EAISLIK
Sbjct  120   VKYLPGIKLGKNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLVGKVNGDVEAISLIK  179

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVK EGPCMISTLI+EQLG++CCVLMGANIANEIAVEKFSEATVGYR+N+EIA+KWVQ
Sbjct  180   GMEVKREGPCMISTLISEQLGVSCCVLMGANIANEIAVEKFSEATVGYRDNREIAEKWVQ  239

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMV+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+AFS
Sbjct  240   LFSTPYFMVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRAFS  299

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLF SVK+STFFESCGVAD+ITTCLGGRNRK A+AFAKN GKRSFD+LEAEMLQGQKLQ
Sbjct  300   KLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKNEGKRSFDDLEAEMLQGQKLQ  359

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  360   GVSTAREVYEVLSHRGWLELF  380


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC G LPPSAIVEYSE  PR SL+ GS  Y+
Sbjct  360  GVSTAREVYEVLSHRGWLELFPLFATVHEICVGHLPPSAIVEYSERKPRLSLLEGSTQYY  419



>gb|KDP46370.1| hypothetical protein JCGZ_10210 [Jatropha curcas]
Length=394

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/319 (85%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             S+VTVVGSGNWGSVAAKLIASNTLKL SFHDEVRMWVFEE LP+GEKL++VIN+TNENVK
Sbjct  37    SKVTVVGSGNWGSVAAKLIASNTLKLTSFHDEVRMWVFEEALPSGEKLTDVINRTNENVK  96

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDANMLVFVTPHQFMEGICK+LVGKI++  EAISLIKGM
Sbjct  97    YLPGIKLGKNVVADPDLDNAVRDANMLVFVTPHQFMEGICKRLVGKIKEGVEAISLIKGM  156

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGPCMIS+LI+ QL +NCCVLMGANIANEIAVEKFSEATVGY+ N+EIA+KWVQLF
Sbjct  157   EVKMEGPCMISSLISSQLRVNCCVLMGANIANEIAVEKFSEATVGYKGNREIAEKWVQLF  216

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYFMV+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  217   STPYFMVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  276

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LF SVK+STFFESCGVADVITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ  
Sbjct  277   LFSSVKDSTFFESCGVADVITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQGV  336

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  337   STAREVYEVLSHRGWLELF  355


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGWLELFPLFSTVHEIC GRLPPSAIVEYSEH P F+LV GSA Y+
Sbjct  335  GVSTAREVYEVLSHRGWLELFPLFSTVHEICIGRLPPSAIVEYSEHKPNFALVEGSAQYY  394



>sp|P52425.1|GPDA_CUPLA RecName: Full=Glycerol-3-phosphate dehydrogenase [Cuphea lanceolata]
 emb|CAA56125.1| glycerol-3-phosphate dehydrogenase (NAD+) [Cuphea lanceolata]
Length=372

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 301/323 (93%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D  +SRVTVVGSGNWGSVAAKLIA+NTLKL SFHDEVRMWVFEE LP+GEKL++VIN+TN
Sbjct  19    DGPRSRVTVVGSGNWGSVAAKLIATNTLKLPSFHDEVRMWVFEETLPSGEKLTDVINQTN  78

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDLE+A +DANMLVFVTPHQFMEGICK+L GKI++ A+A+SL
Sbjct  79    ENVKYLPGIKLGRNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLEGKIQEGAQALSL  138

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             IKGMEVKMEGPCMIS+LI++ LGINCCVLMGANIANEIAVEKFSEATVG+REN++IA+KW
Sbjct  139   IKGMEVKMEGPCMISSLISDLLGINCCVLMGANIANEIAVEKFSEATVGFRENRDIAEKW  198

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMVSAV+DVEGVELCGTLKN+VA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  199   VQLFSTPYFMVSAVEDVEGVELCGTLKNIVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  258

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             FSKLLFPSVK++TFFESCGVAD+ITTCLGGRNRK A+AFAKNGGKRSFD+LEAEML+GQK
Sbjct  259   FSKLLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFAKNGGKRSFDDLEAEMLRGQK  318

Query  661   LQVHQTA---------MGYIELF  620
             LQ   TA          G++ELF
Sbjct  319   LQGVSTAKEVYEVLGHRGWLELF  341


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFS  306
            GVSTAKEVYEVL +RGWLELFPLFSTVHEI TGRLPPSAIVEYSE    FS
Sbjct  321  GVSTAKEVYEVLGHRGWLELFPLFSTVHEISTGRLPPSAIVEYSEQKTIFS  371



>ref|XP_011010495.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X2 [Populus euphratica]
Length=429

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/319 (84%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             SRVTVVGSGNWGSVAAKLIASNTL L SFHDEVRMWVFEE+LPTG+KL+EVIN+TNENVK
Sbjct  79    SRVTVVGSGNWGSVAAKLIASNTLMLASFHDEVRMWVFEEILPTGQKLTEVINQTNENVK  138

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDANMLVFVTPHQFMEGICK+LVGK++ D  AISLIKGM
Sbjct  139   YLPGIKLGKNVVADPDLDNAVRDANMLVFVTPHQFMEGICKRLVGKLKDDVVAISLIKGM  198

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGP MISTLI+EQL +NCCVLMGANIANEIAVEKFSEATVGYREN+E+A+KWVQLF
Sbjct  199   EVKMEGPHMISTLISEQLRVNCCVLMGANIANEIAVEKFSEATVGYRENREVAEKWVQLF  258

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYF+V+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  259   STPYFVVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  318

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LF SVK+STFFESCGVAD+ITTCLGGRNR+ A+AFAKNGGKRSFDELEAEMLQGQKLQ  
Sbjct  319   LFSSVKDSTFFESCGVADLITTCLGGRNRRVAEAFAKNGGKRSFDELEAEMLQGQKLQGV  378

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  379   STAREVYEVLSHRGWLELF  397


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLV  300
            GVSTA+EVYEVL +RGWLELFPLF+TVHEI  GRLPPSAIVEYSEH P  SLV
Sbjct  377  GVSTAREVYEVLSHRGWLELFPLFATVHEISVGRLPPSAIVEYSEHKPNCSLV  429



>gb|AEZ56250.1| plastid glycerol-3-phosphate dehydrogenase [Jatropha curcas]
Length=433

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/319 (85%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             S+VTVVGSGNWGSVAAKLIASNTLKL SFHDEVRMWVFEE LP+GEKL++VIN+TNENVK
Sbjct  76    SKVTVVGSGNWGSVAAKLIASNTLKLTSFHDEVRMWVFEEALPSGEKLTDVINRTNENVK  135

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDANMLVFVTPHQFMEGICK+LVGKI++  EAISLIKGM
Sbjct  136   YLPGIKLGKNVVADPDLDNAVRDANMLVFVTPHQFMEGICKRLVGKIKEGVEAISLIKGM  195

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGPCMIS+LI+ QL +NCCVLMGANIANEIAVEKFSEATVGY+ N+EIA+KWVQLF
Sbjct  196   EVKMEGPCMISSLISSQLRVNCCVLMGANIANEIAVEKFSEATVGYKGNREIAEKWVQLF  255

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYFMV+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  256   STPYFMVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  315

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LF SVK+STFFESCGVADVITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ  
Sbjct  316   LFSSVKDSTFFESCGVADVITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQGV  375

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  376   STAREVYEVLSHRGWLELF  394


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGWLELFPLFSTVHEIC GRLPPSAIVEYSEH P F+LV GSA Y+
Sbjct  374  GVSTAREVYEVLSHRGWLELFPLFSTVHEICIGRLPPSAIVEYSEHKPNFALVEGSAQYY  433



>ref|XP_003553315.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X1 [Glycine max]
 gb|KHN04265.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Glycine soja]
Length=380

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 299/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             ++S+VTV+GSGNWGSVAAKLIASNTL+L+SFHDEVRMWV+EE L +GEKL++VIN+TNEN
Sbjct  30    HRSKVTVIGSGNWGSVAAKLIASNTLRLSSFHDEVRMWVYEETLLSGEKLTDVINRTNEN  89

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE A +D+NMLVFVTPHQFMEGICK+LVGKIR+DAEAISL+K
Sbjct  90    VKYLPGIKLGKNVVADPDLESAVKDSNMLVFVTPHQFMEGICKRLVGKIREDAEAISLVK  149

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMIS+LI++QLGINC VLMGANIANEIAVEKFSEATVGYR N+E+A++WVQ
Sbjct  150   GMEVKMEGPCMISSLISQQLGINCSVLMGANIANEIAVEKFSEATVGYRLNREVAERWVQ  209

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF T YF+V+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKAFS
Sbjct  210   LFYTHYFIVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRLGLREMKAFS  269

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK+STFFESCGVAD+ITTCLGGRNRK A+A+A+NGGKRSFDELEAEMLQGQKLQ
Sbjct  270   KLLFPSVKDSTFFESCGVADLITTCLGGRNRKVAEAYARNGGKRSFDELEAEMLQGQKLQ  329

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  330   GVSTASEVYEVLSHRGWLELF  350


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA EVYEVL +RGWLELFPLFSTVHEI TG LPPSAIVEYSE  PR
Sbjct  330  GVSTASEVYEVLSHRGWLELFPLFSTVHEISTGLLPPSAIVEYSEKLPR  378



>ref|XP_006373281.1| hypothetical protein POPTR_0017s10710g [Populus trichocarpa]
 gb|ERP51078.1| hypothetical protein POPTR_0017s10710g [Populus trichocarpa]
Length=335

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/299 (88%), Positives = 288/299 (96%), Gaps = 0/299 (0%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             SRVTVVGSGNWGSVAAKLIASNTLKL SFHDEVRMWVFEE LPTG+KL+EVIN+TNENVK
Sbjct  31    SRVTVVGSGNWGSVAAKLIASNTLKLASFHDEVRMWVFEETLPTGQKLTEVINQTNENVK  90

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDA MLVFVTPHQFM+GICK+LVGK+++D  AISLIKGM
Sbjct  91    YLPGIKLGKNVVADPDLDNAVRDAKMLVFVTPHQFMDGICKRLVGKLKEDVVAISLIKGM  150

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGP MISTLI+EQL +NCCVLMGANIANEIAVEKFSEATVGYREN+E+A+KWV+LF
Sbjct  151   EVKMEGPHMISTLISEQLRVNCCVLMGANIANEIAVEKFSEATVGYRENREVAEKWVRLF  210

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYF+V+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  211   STPYFVVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  270

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LF SVK+STFFESCGVAD+ITTCLGGRNR+ A+AFAKNGGKRSFDELEAEMLQGQKLQV
Sbjct  271   LFSSVKDSTFFESCGVADLITTCLGGRNRRVAEAFAKNGGKRSFDELEAEMLQGQKLQV  329



>ref|XP_011010494.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X1 [Populus euphratica]
Length=436

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/319 (84%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             SRVTVVGSGNWGSVAAKLIASNTL L SFHDEVRMWVFEE+LPTG+KL+EVIN+TNENVK
Sbjct  79    SRVTVVGSGNWGSVAAKLIASNTLMLASFHDEVRMWVFEEILPTGQKLTEVINQTNENVK  138

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDANMLVFVTPHQFMEGICK+LVGK++ D  AISLIKGM
Sbjct  139   YLPGIKLGKNVVADPDLDNAVRDANMLVFVTPHQFMEGICKRLVGKLKDDVVAISLIKGM  198

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGP MISTLI+EQL +NCCVLMGANIANEIAVEKFSEATVGYREN+E+A+KWVQLF
Sbjct  199   EVKMEGPHMISTLISEQLRVNCCVLMGANIANEIAVEKFSEATVGYRENREVAEKWVQLF  258

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYF+V+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  259   STPYFVVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  318

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LF SVK+STFFESCGVAD+ITTCLGGRNR+ A+AFAKNGGKRSFDELEAEMLQGQKLQ  
Sbjct  319   LFSSVKDSTFFESCGVADLITTCLGGRNRRVAEAFAKNGGKRSFDELEAEMLQGQKLQGV  378

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  379   STAREVYEVLSHRGWLELF  397


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGWLELFPLF+TVHEI  GRLPPSAIVEYSEH P  SLV GSA YF
Sbjct  377  GVSTAREVYEVLSHRGWLELFPLFATVHEISVGRLPPSAIVEYSEHKPNCSLVEGSAQYF  436



>ref|XP_002526956.1| glycerol-3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF35443.1| glycerol-3-phosphate dehydrogenase, putative [Ricinus communis]
Length=380

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/322 (83%), Positives = 297/322 (92%), Gaps = 9/322 (3%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++ S+VTVVGSGNWG+VAAKLIASNTLKLN FHDEVRMWVFEE LP+GEKLS+VIN+TNE
Sbjct  27    SHMSKVTVVGSGNWGTVAAKLIASNTLKLNYFHDEVRMWVFEETLPSGEKLSDVINRTNE  86

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LGKNVIADPD+++A +DANMLVFVTPHQFM+GICK+LV KI+   EAISLI
Sbjct  87    NVKYLPGIKLGKNVIADPDIDNAVKDANMLVFVTPHQFMDGICKRLVRKIKDGVEAISLI  146

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVKMEGPCMIS+LI+EQLG+NCCVLMGANIANEIAVEKFSEATVG+R N+EIA+KWV
Sbjct  147   KGMEVKMEGPCMISSLISEQLGVNCCVLMGANIANEIAVEKFSEATVGFRTNREIAEKWV  206

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYFMV+AVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAA+MRIGLREM+A 
Sbjct  207   QLFSTPYFMVTAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAMMRIGLREMRAL  266

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLF SVK+STFFESCGVADVITTCLGGRNRK A+AFA+NGGKRSFDELEAEMLQGQKL
Sbjct  267   SKLLFSSVKDSTFFESCGVADVITTCLGGRNRKVAEAFARNGGKRSFDELEAEMLQGQKL  326

Query  658   QVHQTA---------MGYIELF  620
             Q   TA          G++ELF
Sbjct  327   QGVSTAREVYEVLSHRGWLELF  348


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLV  300
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC GRLPPSAIVEYSEH P F+LV
Sbjct  328  GVSTAREVYEVLSHRGWLELFPLFATVHEICIGRLPPSAIVEYSEHKPNFALV  380



>gb|KHG19199.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Gossypium arboreum]
Length=438

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/321 (84%), Positives = 298/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEE L TGEKL++VINKTNEN
Sbjct  79    SKSKVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEETLQTGEKLTDVINKTNEN  138

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNVIADPDL++A +DANMLVFVTPHQFMEGICK+LVGK+R D EAISLIK
Sbjct  139   VKYLPGIKLGKNVIADPDLDNAVKDANMLVFVTPHQFMEGICKRLVGKVRGDVEAISLIK  198

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMIS LI+EQLGINC VLMGANIANEIAVEKFSEATVG+R+N+EIA++WV+
Sbjct  199   GMEVKMEGPCMISNLISEQLGINCSVLMGANIANEIAVEKFSEATVGFRDNREIAEQWVK  258

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMV+ VQDVEGVELCGTLKNVVA+AAGFVDGL+MGNNTKAAIMRIGLREM+AFS
Sbjct  259   LFSTPYFMVTPVQDVEGVELCGTLKNVVAIAAGFVDGLDMGNNTKAAIMRIGLREMRAFS  318

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLF SV++STFFESCGVADVITTCLGGRNRK A+AFA+NGGKRSFD+LEAEMLQGQKLQ
Sbjct  319   KLLFSSVRDSTFFESCGVADVITTCLGGRNRKVAEAFARNGGKRSFDDLEAEMLQGQKLQ  378

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  379   GVSTAREVYEVLSHRGWLELF  399


 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANY  282
            GVSTA+EVYEVL +RGWLELFPLF+TVHEIC GRLPPSAIV YSE  PR SL+   A Y
Sbjct  379  GVSTAREVYEVLSHRGWLELFPLFATVHEICVGRLPPSAIVGYSEKKPRLSLLEDPACY  437



>ref|XP_007151588.1| hypothetical protein PHAVU_004G059500g [Phaseolus vulgaris]
 gb|ESW23582.1| hypothetical protein PHAVU_004G059500g [Phaseolus vulgaris]
Length=381

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/321 (81%), Positives = 298/321 (93%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             ++S+VTV+GSGNWGSVAAKLIASNTL+L  FHDEVRMWV+EE LP+GEKL++VIN+TNEN
Sbjct  31    HRSKVTVIGSGNWGSVAAKLIASNTLRLRFFHDEVRMWVYEETLPSGEKLTDVINRTNEN  90

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LG+NV+ADPDLE+A RD+NMLVFVTPHQF+EGICK+LV KIR+DAEAISL+K
Sbjct  91    VKYLPGIKLGQNVVADPDLENAVRDSNMLVFVTPHQFVEGICKRLVRKIREDAEAISLVK  150

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI++QLGINC VLMGANIANEIAVEKFSEATVGYR N+E+A++WVQ
Sbjct  151   GMEVKMEGPCMISTLISQQLGINCSVLMGANIANEIAVEKFSEATVGYRNNREVAERWVQ  210

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF TPYF+V+A QDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKAFS
Sbjct  211   LFYTPYFIVTAAQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRLGLREMKAFS  270

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LFPSVK+STFFESCGVAD+ITTCLGGRNRK A+A+A+NGGKRSFDELEAEMLQGQKLQ
Sbjct  271   KMLFPSVKDSTFFESCGVADLITTCLGGRNRKVAEAYARNGGKRSFDELEAEMLQGQKLQ  330

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  331   GVSTASEVYEVLSHRGWLELF  351


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA EVYEVL +RGWLELFPLFSTVHEIC+G LPPSAIVEYSE  PR
Sbjct  331  GVSTASEVYEVLSHRGWLELFPLFSTVHEICSGLLPPSAIVEYSEKLPR  379



>ref|XP_002323799.2| hypothetical protein POPTR_0017s10710g [Populus trichocarpa]
 gb|EEF03932.2| hypothetical protein POPTR_0017s10710g [Populus trichocarpa]
Length=388

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/319 (84%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             SRVTVVGSGNWGSVAAKLIASNTLKL SFHDEVRMWVFEE LPTG+KL+EVIN+TNENVK
Sbjct  31    SRVTVVGSGNWGSVAAKLIASNTLKLASFHDEVRMWVFEETLPTGQKLTEVINQTNENVK  90

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+LGKNV+ADPDL++A RDA MLVFVTPHQFM+GICK+LVGK+++D  AISLIKGM
Sbjct  91    YLPGIKLGKNVVADPDLDNAVRDAKMLVFVTPHQFMDGICKRLVGKLKEDVVAISLIKGM  150

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVKMEGP MISTLI+EQL +NCCVLMGANIANEIAVEKFSEATVGYREN+E+A+KWV+LF
Sbjct  151   EVKMEGPHMISTLISEQLRVNCCVLMGANIANEIAVEKFSEATVGYRENREVAEKWVRLF  210

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             +TPYF+V+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSKL
Sbjct  211   STPYFVVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSKL  270

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
             LF SVK+STFFESCGVAD+ITTCLGGRNR+ A+AFAKNGGKRSFDELEAEMLQGQKLQ  
Sbjct  271   LFSSVKDSTFFESCGVADLITTCLGGRNRRVAEAFAKNGGKRSFDELEAEMLQGQKLQGV  330

Query  649   QTA---------MGYIELF  620
              TA          G++ELF
Sbjct  331   STAREVYEVLRHRGWLELF  349


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVLR+RGWLELFPLF+TVHEI  GRLPPSAIVEYSEH P  SLV GSA YF
Sbjct  329  GVSTAREVYEVLRHRGWLELFPLFATVHEISAGRLPPSAIVEYSEHKPNCSLVEGSAQYF  388



>ref|XP_010033349.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X1 [Eucalyptus grandis]
Length=378

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/321 (83%), Positives = 295/321 (92%), Gaps = 11/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
              KSRVTVVG GNWGSVA KLIASNTL+L SFH  VRMWVFEE+LP+GEKL++VIN TNEN
Sbjct  21    QKSRVTVVGRGNWGSVAPKLIASNTLRLPSFH--VRMWVFEEILPSGEKLTDVINSTNEN  78

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LG NV+ADPDLE+A +DANMLVFVTPHQF+EGICK+LVGK+++  EAISLIK
Sbjct  79    VKYLPGIKLGNNVVADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKVKEGVEAISLIK  138

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMIS+LI+EQLGINCCVLMGANIANEIAVEKFSEATVGYREN+EIA+KWV+
Sbjct  139   GMEVKMEGPCMISSLISEQLGINCCVLMGANIANEIAVEKFSEATVGYRENREIAEKWVK  198

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMVS VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  199   LFSTPYFMVSPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  258

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK++TFFESCGVAD+ITTCLGGRNRK A+AFAKNGGKRSFDELEAEMLQGQKLQ
Sbjct  259   KLLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFAKNGGKRSFDELEAEMLQGQKLQ  318

Query  655   VHQTA---------MGYIELF  620
                TA          G++ELF
Sbjct  319   GVSTARELYEVLSHRGWLELF  339


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+E+YEVL +RGWLELFPLF+TVHEI +GRL PSAIVEYSEH P FSLV GSA Y+
Sbjct  319  GVSTARELYEVLSHRGWLELFPLFATVHEISSGRLLPSAIVEYSEHKPNFSLVQGSAQYY  378



>ref|XP_007215552.1| hypothetical protein PRUPE_ppa007261mg [Prunus persica]
 gb|EMJ16751.1| hypothetical protein PRUPE_ppa007261mg [Prunus persica]
Length=376

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/336 (79%), Positives = 299/336 (89%), Gaps = 0/336 (0%)
 Frame = -1

Query  1618  QLDGETnanvssgnaagAPDNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWV  1439
             Q DGET    ++         +K++VTVVGSGNWGSVAAKLIASNTL+L+SFHDEVRMWV
Sbjct  6     QQDGETLPQNNNTYTRDHEALHKTKVTVVGSGNWGSVAAKLIASNTLRLSSFHDEVRMWV  65

Query  1438  FEEVLPTGEKLSEVINKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFME  1259
             FEE LP+GEKL++ IN+ NENVKYLPGI+LGKNV+ADPDL++A   ANMLVFVTPHQFME
Sbjct  66    FEETLPSGEKLTDAINRNNENVKYLPGIKLGKNVVADPDLDNAVNGANMLVFVTPHQFME  125

Query  1258  GICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVE  1079
             GICK+LVGKI+ D EAISLIKGMEVKMEGPCMISTLI+EQLGINCCVLMGANIANEIA+E
Sbjct  126   GICKRLVGKIKGDVEAISLIKGMEVKMEGPCMISTLISEQLGINCCVLMGANIANEIALE  185

Query  1078  KFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLE  899
             KFSEATVGYREN+ IA+KWV LF+TPYF+V+ VQDVEGVELCGTLKNVVA+AAGFVDGLE
Sbjct  186   KFSEATVGYRENRAIAEKWVHLFSTPYFIVTPVQDVEGVELCGTLKNVVAIAAGFVDGLE  245

Query  898   MGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAK  719
             MGNNTKAAIMRIGLREMKAFSK+LF SVK+STFFESCGVAD+ITTCLGGRNRK A+AFA+
Sbjct  246   MGNNTKAAIMRIGLREMKAFSKMLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAR  305

Query  718   NGGKRSFDELEAEMLQGQKLQVHQTAMGYIELFLPR  611
             +GGKRSFDELEAEMLQGQKLQ   TA    E+   R
Sbjct  306   SGGKRSFDELEAEMLQGQKLQGVSTAKEVYEVLSHR  341


 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWLE FPLF+TVHEIC G LPPSAIVE+SE  P  
Sbjct  327  GVSTAKEVYEVLSHRGWLEFFPLFATVHEICIGSLPPSAIVEHSERKPEL  376



>ref|XP_009371731.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Pyrus 
x bretschneideri]
Length=420

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/315 (83%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K+RVTVVGSGNWGSVAAKLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  71    HKTRVTVVGSGNWGSVAAKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDAINRNNEN  130

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A   ANMLVFVTPHQFMEGIC++LVGK++ D EAISLIK
Sbjct  131   VKYLPGIKLGKNVVADPDLENAVNGANMLVFVTPHQFMEGICRRLVGKVKADVEAISLIK  190

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI++QLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ
Sbjct  191   GMEVKMEGPCMISTLISQQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  250

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+T YF+V+ +QDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  251   LFSTSYFIVTPIQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  310

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LF SVK++TFFESCGVAD+ITTCLGGRNRK A+AFA++GGKRSFDELEAEMLQGQKLQ
Sbjct  311   KMLFSSVKDTTFFESCGVADLITTCLGGRNRKVAEAFARSGGKRSFDELEAEMLQGQKLQ  370

Query  655   VHQTAMGYIELFLPR  611
                TA    E+   R
Sbjct  371   GVSTAKEVYEVLSHR  385


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWL+ FPLF+TVHEIC G LPPSAIVE+SE TP+ 
Sbjct  371  GVSTAKEVYEVLSHRGWLDFFPLFATVHEICIGTLPPSAIVEHSERTPKI  420



>ref|XP_009370329.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Pyrus 
x bretschneideri]
Length=420

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/315 (83%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K+RVTVVGSGNWGSVAAKLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  71    HKTRVTVVGSGNWGSVAAKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDAINRNNEN  130

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A   ANMLVFVTPHQFMEGIC++LVGK++ D EAISLIK
Sbjct  131   VKYLPGIKLGKNVVADPDLENAVNGANMLVFVTPHQFMEGICRRLVGKVKADVEAISLIK  190

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI++QLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ
Sbjct  191   GMEVKMEGPCMISTLISQQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  250

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+T YF+V+ +QDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  251   LFSTSYFIVTPIQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  310

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LF SVK++TFFESCGVAD+ITTCLGGRNRK A+AFA++GGKRSFDELEAEMLQGQKLQ
Sbjct  311   KMLFSSVKDTTFFESCGVADLITTCLGGRNRKVAEAFARSGGKRSFDELEAEMLQGQKLQ  370

Query  655   VHQTAMGYIELFLPR  611
                TA    E+   R
Sbjct  371   GVSTAKEVYEVLSHR  385


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWL+ FPLF+TVHEIC G LPPSAIVE+SE TP+ 
Sbjct  371  GVSTAKEVYEVLSHRGWLDFFPLFATVHEICIGTLPPSAIVEHSERTPKI  420



>ref|XP_010435997.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic 
[Camelina sativa]
Length=400

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/320 (83%), Positives = 292/320 (91%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNENV
Sbjct  54    KSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNENV  113

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI  D EAISL+KG
Sbjct  114   KYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLDGKITGDVEAISLVKG  173

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  174   MEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  233

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA SK
Sbjct  234   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKALSK  293

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+GGKRSFDELEAEMLQGQKLQ 
Sbjct  294   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSGGKRSFDELEAEMLQGQKLQG  353

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  354   VSTAREVYEVLNYCGWVEMF  373


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL Y GW+E+FPLFSTVH+ICTGRL P AIV Y E 
Sbjct  353  GVSTAREVYEVLNYCGWVEMFPLFSTVHQICTGRLQPEAIVHYREQ  398



>ref|XP_010450637.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic-like 
[Camelina sativa]
Length=402

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/320 (83%), Positives = 293/320 (92%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KS+VTVVGSGNWGSVAAKLIASN LKL+SFHDEVRMWVFEE+LP GEKL++VINKTNENV
Sbjct  56    KSKVTVVGSGNWGSVAAKLIASNALKLSSFHDEVRMWVFEELLPNGEKLTDVINKTNENV  115

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI  D EAISL+KG
Sbjct  116   KYLPGIKLGKNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLDGKITGDVEAISLVKG  175

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  176   MEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  235

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA SK
Sbjct  236   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKALSK  295

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+GGKRSFDELEAEMLQGQKLQ 
Sbjct  296   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSGGKRSFDELEAEMLQGQKLQG  355

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  356   VSTAREVYEVLNHCGWVEMF  375


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GW+E+FPLFSTVH+ICTGRL P AIV Y +H
Sbjct  355  GVSTAREVYEVLNHCGWVEMFPLFSTVHQICTGRLQPEAIVHYRDH  400



>ref|XP_006283863.1| hypothetical protein CARUB_v10004974mg [Capsella rubella]
 gb|EOA16761.1| hypothetical protein CARUB_v10004974mg [Capsella rubella]
Length=398

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/323 (82%), Positives = 294/323 (91%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D+ KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL+++INKTN
Sbjct  49    DDLKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDIINKTN  108

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICK+L GKI  D EAISL
Sbjct  109   ENVKYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKRLDGKITGDVEAISL  168

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             +KGMEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  W
Sbjct  169   VKGMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTW  228

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  229   VQLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  288

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+A+AK+GGKRSFDELEAEMLQGQK
Sbjct  289   LSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAYAKSGGKRSFDELEAEMLQGQK  348

Query  661   LQVHQTAM---------GYIELF  620
             LQ   TA          G++E+F
Sbjct  349   LQGVSTAREVYEVLNHCGWVEMF  371


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GW+E+FPLFSTVH+ICTGRL P AIV+Y EH
Sbjct  351  GVSTAREVYEVLNHCGWVEMFPLFSTVHQICTGRLQPEAIVQYREH  396



>ref|XP_008230931.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Prunus 
mume]
Length=386

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 293/321 (91%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K++VTVVGSGNWGSVAAKLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  37    HKTKVTVVGSGNWGSVAAKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDAINRNNEN  96

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDL++A   ANMLVFVTPHQFMEGICK+LVGKI+ D EAISLIK
Sbjct  97    VKYLPGIKLGKNVVADPDLDNAVNGANMLVFVTPHQFMEGICKRLVGKIKGDVEAISLIK  156

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI+EQLGINCCVLMGANIANEIA+EKFSEATVGYREN+ IA+KWV 
Sbjct  157   GMEVKMEGPCMISTLISEQLGINCCVLMGANIANEIALEKFSEATVGYRENRAIAEKWVH  216

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYF+V+ VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  217   LFSTPYFIVTPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  276

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LF SVK+STFFESCGVAD+ITTCLGGRNRK A+AFA+ GGKRSFDELEAEMLQGQKLQ
Sbjct  277   KMLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFARGGGKRSFDELEAEMLQGQKLQ  336

Query  655   VHQTA---------MGYIELF  620
                TA          G++E F
Sbjct  337   GVSTAKEVYEVLSHRGWLEFF  357


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWLE FPLF+TVHEIC G LPPSAIVE+SE  P  
Sbjct  337  GVSTAKEVYEVLSHRGWLEFFPLFATVHEICIGSLPPSAIVEHSERKPEL  386



>ref|XP_004516127.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Cicer 
arietinum]
Length=356

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 295/319 (92%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             ++VT+VGSGNWGSVAAKLIASNTLKL+SFHDEVRMWVFEE LPTGEKL+EVIN+TNENVK
Sbjct  2     NKVTIVGSGNWGSVAAKLIASNTLKLSSFHDEVRMWVFEETLPTGEKLTEVINQTNENVK  61

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPG++LGKNV+ADPDLE A +DANMLVFVTPHQFMEGICK++ GKIR DAE ISL+KGM
Sbjct  62    YLPGVKLGKNVVADPDLESAVKDANMLVFVTPHQFMEGICKRVAGKIRTDAEGISLVKGM  121

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVK EGPCMISTLI+ QLGINC VLMGANIANEIA+EKFSEATVGY +NKE A+KWVQLF
Sbjct  122   EVKKEGPCMISTLISNQLGINCSVLMGANIANEIAMEKFSEATVGYSQNKEAAEKWVQLF  181

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             NTPYF V++VQDVEGVE+CGTLKN+VA+AAGFVDGLEMGNNTKAAIMRIGL+EM AFS+L
Sbjct  182   NTPYFNVTSVQDVEGVEMCGTLKNIVAVAAGFVDGLEMGNNTKAAIMRIGLKEMIAFSRL  241

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ--  656
             LFPSVK+STFFESCGVAD+ITTC+GGRNRK A+A+AKNGGKRSF+ELEAE+L+GQKLQ  
Sbjct  242   LFPSVKDSTFFESCGVADLITTCMGGRNRKVAEAYAKNGGKRSFEELEAEILRGQKLQGV  301

Query  655   -----VHQ--TAMGYIELF  620
                  V++  TA G++ELF
Sbjct  302   LTAKEVYEVLTARGWVELF  320


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTP  315
            GV TAKEVYEVL  RGW+ELFPLF  V+EI TG  PPSAIVE+S + P
Sbjct  300  GVLTAKEVYEVLTARGWVELFPLFRAVYEISTGVQPPSAIVEFSNNKP  347



>ref|XP_008348010.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Malus 
domestica]
Length=414

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/315 (83%), Positives = 290/315 (92%), Gaps = 0/315 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
              K+RVTVVGSGNWGSVAAKLIASNTL+L+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  65    QKTRVTVVGSGNWGSVAAKLIASNTLRLSSFHDEVRMWVFEETLPSGEKLTDAINRNNEN  124

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A   ANMLVFVTPHQFMEGIC++LVGK++ D EAISLIK
Sbjct  125   VKYLPGIKLGKNVVADPDLENAVNGANMLVFVTPHQFMEGICRRLVGKVKADVEAISLIK  184

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE KEIAQKWVQ
Sbjct  185   GMEVKMEGPCMISTLISDQLGINCCVLMGANIANEIAVEKFSEATVGYREKKEIAQKWVQ  244

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+T YF+V+ VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  245   LFSTSYFIVTPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  304

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LF SVK++TFFESCGVAD+ITTCLGGRNRK A+AFA++ GKRSFDELEAEMLQGQKLQ
Sbjct  305   KMLFSSVKDTTFFESCGVADLITTCLGGRNRKVAEAFARSEGKRSFDELEAEMLQGQKLQ  364

Query  655   VHQTAMGYIELFLPR  611
                TA    E+   R
Sbjct  365   GVSTAKEVYEVLSHR  379


 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWL+ FPLF+TVHEIC G LPP+AIVE+SE TP+ 
Sbjct  365  GVSTAKEVYEVLSHRGWLDFFPLFATVHEICIGTLPPTAIVEHSERTPKM  414



>gb|AAL87336.1| putative dihydroxyacetone 3-phosphate reductase dhaprd [Arabidopsis 
thaliana]
Length=395

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 293/323 (91%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D++KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTN
Sbjct  46    DDSKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLNDVINKTN  105

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDLE+A +DANMLVFVTPHQFM+GICKKL GKI  D EAISL
Sbjct  106   ENVKYLPGIKLGRNVVADPDLENAVKDANMLVFVTPHQFMDGICKKLDGKITGDVEAISL  165

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             +KGMEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYR ++EIA  W
Sbjct  166   VKGMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRGSREIADTW  225

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  226   VQLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  285

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+ GKRSFDELEAEMLQGQK
Sbjct  286   LSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSRGKRSFDELEAEMLQGQK  345

Query  661   LQVHQTAM---------GYIELF  620
             LQ   TA          G++E+F
Sbjct  346   LQGVSTAREVYEVLKHCGWLEMF  368


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL++ GWLE+FPLFSTVH+ICTGRL P AIV+Y E+
Sbjct  348  GVSTAREVYEVLKHCGWLEMFPLFSTVHQICTGRLQPEAIVQYREN  393



>ref|NP_198877.1| glycerol-3-phosphate dehydrogenase [NAD+] [Arabidopsis thaliana]
 sp|Q9SCX9.1|GPDA1_ARATH RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB64726.1| dihydroxyacetone 3-phosphate reductase [Arabidopsis thaliana]
 dbj|BAB08532.1| dihydroxyacetone 3-phosphate reductase [Arabidopsis thaliana]
 gb|AAN41367.1| putative dihydroxyacetone 3-phosphate reductase dhaprd [Arabidopsis 
thaliana]
 gb|AED94573.1| glycerol-3-phosphate dehydrogenase [NAD+] [Arabidopsis thaliana]
Length=400

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 293/323 (91%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D++KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTN
Sbjct  51    DDSKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLNDVINKTN  110

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDLE+A +DANMLVFVTPHQFM+GICKKL GKI  D EAISL
Sbjct  111   ENVKYLPGIKLGRNVVADPDLENAVKDANMLVFVTPHQFMDGICKKLDGKITGDVEAISL  170

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             +KGMEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYR ++EIA  W
Sbjct  171   VKGMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRGSREIADTW  230

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  231   VQLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  290

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+ GKRSFDELEAEMLQGQK
Sbjct  291   LSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSRGKRSFDELEAEMLQGQK  350

Query  661   LQVHQTAM---------GYIELF  620
             LQ   TA          G++E+F
Sbjct  351   LQGVSTAREVYEVLKHCGWLEMF  373


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL++ GWLE+FPLFSTVH+ICTGRL P AIV+Y E+
Sbjct  353  GVSTAREVYEVLKHCGWLEMFPLFSTVHQICTGRLQPEAIVQYREN  398



>ref|XP_010441214.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic-like 
[Camelina sativa]
Length=402

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 293/323 (91%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D+ KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTN
Sbjct  53    DDLKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTN  112

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDL +A ++ANMLVF+TPHQFM+GICKKL GKI  D EAISL
Sbjct  113   ENVKYLPGIKLGRNVVADPDLLNAVKEANMLVFITPHQFMDGICKKLDGKITGDVEAISL  172

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             +KGMEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  W
Sbjct  173   VKGMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTW  232

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMV+ VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  233   VQLFSTPYFMVTPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  292

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+GGKRSFDELEAEMLQGQK
Sbjct  293   LSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSGGKRSFDELEAEMLQGQK  352

Query  661   LQVHQTAM---------GYIELF  620
             LQ   TA          G++E F
Sbjct  353   LQGVSTAREVYEVLNHCGWVETF  375


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GW+E FPLFSTVH+ICTGRL P A V Y EH
Sbjct  355  GVSTAREVYEVLNHCGWVETFPLFSTVHQICTGRLQPEAFVHYREH  400



>ref|XP_002868644.1| hypothetical protein ARALYDRAFT_493921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44903.1| hypothetical protein ARALYDRAFT_493921 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/321 (82%), Positives = 292/321 (91%), Gaps = 9/321 (3%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +KS+VTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNEN
Sbjct  19    SKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNEN  78

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG++LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI  D EAISL+K
Sbjct  79    VKYLPGVKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLDGKITGDVEAISLVK  138

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVK EGPCMIS+LI++QLGINCCVLMGANIANEIAVEKFSEATVGYR ++EIA  WVQ
Sbjct  139   GMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRGSREIADTWVQ  198

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA S
Sbjct  199   LFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKALS  258

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFAK+GGKRSFDELEAEMLQGQKLQ
Sbjct  259   KLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSGGKRSFDELEAEMLQGQKLQ  318

Query  655   VHQTAM---------GYIELF  620
                TA          G++E+F
Sbjct  319   GVSTAREVYEVLNHCGWLEMF  339


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GWLE+FPLFSTVH+ICTG L P AIV+Y E+
Sbjct  319  GVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGHLQPEAIVQYREN  364



>ref|XP_010555924.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010555925.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=420

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/316 (84%), Positives = 289/316 (91%), Gaps = 0/316 (0%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++KSR+TVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKT E
Sbjct  68    DSKSRITVVGSGNWGSVAAKLIASNVLKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTKE  127

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LG+NVIADPDLE+A +++NMLVFVTPHQFM+GICK+L GKI    EAISLI
Sbjct  128   NVKYLPGIKLGRNVIADPDLENAVKESNMLVFVTPHQFMDGICKRLRGKIDGAVEAISLI  187

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGPCMIS+LI+EQLGI+CCVLMGANIANEIAVEKFSEATVGYR ++EI  KWV
Sbjct  188   KGMEVKKEGPCMISSLISEQLGISCCVLMGANIANEIAVEKFSEATVGYRGSREIPDKWV  247

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF TPYFMV+AV DVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AF
Sbjct  248   QLFTTPYFMVTAVHDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAF  307

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA+NGGKRSFDELEAEMLQGQKL
Sbjct  308   SKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLQGQKL  367

Query  658   QVHQTAMGYIELFLPR  611
             Q   TA    E+   R
Sbjct  368   QGVSTAREVYEVLSHR  383


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSE  324
            GVSTA+EVYEVL +RGWLE FPL S+VHEICTGRLPPSAIV Y++
Sbjct  369  GVSTAREVYEVLSHRGWLEHFPLLSSVHEICTGRLPPSAIVNYND  413



>gb|KFK33089.1| hypothetical protein AALP_AA6G329300 [Arabis alpina]
Length=364

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/323 (80%), Positives = 292/323 (90%), Gaps = 9/323 (3%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             D++KSRVT+VGSGNWGSVAAKLIASN +KL SFHDEVRMWVFEEVLP GEKL++VINKTN
Sbjct  15    DDSKSRVTIVGSGNWGSVAAKLIASNAIKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTN  74

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKIR + EAISL
Sbjct  75    ENVKYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLDGKIRGEVEAISL  134

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             +KGMEVK EGP MIS+LI++QLGINCCVLMGANIANEIA+EKFSEATVGYRE+KEIA  W
Sbjct  135   VKGMEVKKEGPRMISSLISKQLGINCCVLMGANIANEIALEKFSEATVGYRESKEIADTW  194

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF+TPYFMV+   DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA
Sbjct  195   VQLFSTPYFMVTPAHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKA  254

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLFPSV + TFFESCGVAD+ITTCLGGRNR+ A+A+A+NGGKRSFDELEAEMLQGQK
Sbjct  255   LSKLLFPSVNDCTFFESCGVADLITTCLGGRNRRVAEAYAQNGGKRSFDELEAEMLQGQK  314

Query  661   LQVHQTAM---------GYIELF  620
             LQ   TA          G++E+F
Sbjct  315   LQGVSTAKEVYEVLKHNGWLEMF  337


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTAKEVYEVL++ GWLE+FPLF+TVH+IC GRL P AIV Y E+
Sbjct  317  GVSTAKEVYEVLKHNGWLEMFPLFATVHQICIGRLKPEAIVHYREY  362



>emb|CDX67466.1| BnaA07g15060D [Brassica napus]
Length=356

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/320 (82%), Positives = 290/320 (91%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNENV
Sbjct  10    KSRVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNENV  69

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM GICKKL GK+  + EAISL+KG
Sbjct  70    KYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMGGICKKLKGKVTGEVEAISLVKG  129

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS+LI+++LGIN CVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  130   MEVKKEGPCMISSLISKELGINSCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  189

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+A SK
Sbjct  190   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRALSK  249

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELEAEMLQGQKLQ 
Sbjct  250   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEAEMLQGQKLQG  309

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  310   VSTAREVYEVLNHCGWLEMF  329


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GWLE+FPLFSTVH+ICTGRL P AIV Y +H
Sbjct  309  GVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGRLKPEAIVHYRDH  354



>emb|CDY42567.1| BnaA04g10460D [Brassica napus]
Length=368

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/306 (83%), Positives = 286/306 (93%), Gaps = 0/306 (0%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++KSRVT+VGSG+WGSVAAKL+ASN LKL SFHDEVRMWVFEEVLP GEKL++ INKTNE
Sbjct  16    DSKSRVTIVGSGSWGSVAAKLVASNALKLPSFHDEVRMWVFEEVLPNGEKLTDAINKTNE  75

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N  YLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI+ + EAISL+
Sbjct  76    NANYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLKGKIKGEVEAISLV  135

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGPCMIS+LIT++LGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  WV
Sbjct  136   KGMEVKKEGPCMISSLITKELGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTWV  195

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA 
Sbjct  196   QLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAL  255

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELEAEML+GQKL
Sbjct  256   SKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEAEMLEGQKL  315

Query  658   QVHQTA  641
             Q   TA
Sbjct  316   QGVSTA  321


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYE L + G LE+FPLFSTVH+IC GRL P AIV Y    P 
Sbjct  317  GVSTAREVYETLNHCGKLEMFPLFSTVHQICIGRLKPDAIVHYRNFGPN  365



>emb|CDY67407.1| BnaC06g42250D [Brassica napus]
Length=389

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/320 (82%), Positives = 290/320 (91%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNENV
Sbjct  43    KSRVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNENV  102

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM GICKKL GK+  + EAISL+KG
Sbjct  103   KYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMGGICKKLKGKVTGEVEAISLVKG  162

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS+LI+++LGIN CVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  163   MEVKKEGPCMISSLISKELGINSCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  222

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+A SK
Sbjct  223   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRALSK  282

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELEAEMLQGQKLQ 
Sbjct  283   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEAEMLQGQKLQG  342

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  343   VSTAREVYEVLNHCGWLEMF  362


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GWLE+FPLFSTVH+ICTGRL P AIV Y +H
Sbjct  342  GVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGRLKPEAIVHYRDH  387



>ref|XP_004156696.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic-like 
[Cucumis sativus]
Length=388

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/323 (82%), Positives = 291/323 (90%), Gaps = 10/323 (3%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K +VTVVGSGNWGSVAAKLIASN  +L+SFHDEVRMWV+EE LPTGEKL++VIN  NE
Sbjct  29    SSKFKVTVVGSGNWGSVAAKLIASNAARLSSFHDEVRMWVYEETLPTGEKLTDVINLNNE  88

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LGKNVIADPDLE+A +DANMLVFVTPHQF+EGICK+LVGKIR D EAISLI
Sbjct  89    NVKYLPGIKLGKNVIADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKIRGDVEAISLI  148

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN-KEIAQKW  1022
             KGMEVK EGPCMIS+LI+++LGINCCVLMGANIANEIAVEKFSEATVGYREN +EIA+KW
Sbjct  149   KGMEVKKEGPCMISSLISQELGINCCVLMGANIANEIAVEKFSEATVGYRENMREIAEKW  208

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF TPYF+V+ VQDVEGVE+CGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+ 
Sbjct  209   VQLFTTPYFVVTPVQDVEGVEMCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRM  268

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLF SVK+STFFESCGVAD+ITTCLGGRNRK A AFA NGGKRSFDELEAEMLQGQK
Sbjct  269   ISKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAAAFAMNGGKRSFDELEAEMLQGQK  328

Query  661   LQVHQTA---------MGYIELF  620
             LQ   TA          G++ELF
Sbjct  329   LQGVSTAKEMYEVLNHRGWLELF  351


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSA  288
            GVSTAKE+YEVL +RGWLELFPLF++VHEICTG L PSAIVEYSE  P FS++ G A
Sbjct  331  GVSTAKEMYEVLNHRGWLELFPLFASVHEICTGHLSPSAIVEYSERKPNFSVIDGHA  387



>ref|XP_008341361.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Malus 
domestica]
Length=368

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/315 (82%), Positives = 286/315 (91%), Gaps = 0/315 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K RVTVVGSGNWGSVAAKLIASNTLKL+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  19    HKXRVTVVGSGNWGSVAAKLIASNTLKLSSFHDEVRMWVFEETLPSGEKLTDAINRXNEN  78

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A   ANMLVFVTPHQFMEGIC++LVGK++ D EAISLIK
Sbjct  79    VKYLPGIKLGKNVVADPDLENAVNGANMLVFVTPHQFMEGICRRLVGKVKADVEAISLIK  138

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
              MEVK+EGPCMISTLI++QLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV+
Sbjct  139   EMEVKIEGPCMISTLISQQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVZ  198

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF T YF V+ +QDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGL EM AFS
Sbjct  199   LFXTSYFXVTPIQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLXEMXAFS  258

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+LF SVK++TF ESCGVAD+ITTCLGGRNRK A+AFA++GGKRSFDELEAEMLQGQKLQ
Sbjct  259   KMLFSSVKDTTFXESCGVADLITTCLGGRNRKVAEAFARSGGKRSFDELEAEMLQGQKLQ  318

Query  655   VHQTAMGYIELFLPR  611
                TA    E+   R
Sbjct  319   GVSTAKEVYEVLSHR  333


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GVSTAKEVYEVL +RGWL+ FPLF+TVHEIC G LPPSAIVE+SE TP+ 
Sbjct  319  GVSTAKEVYEVLSHRGWLDFFPLFATVHEICIGTLPPSAIVEHSERTPKI  368



>ref|XP_004304684.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/314 (83%), Positives = 285/314 (91%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K+RVTVVGSGNWGSVAAKLIASNT++L SFHDEVRMWVFEE LP+GEKL++ IN  NENV
Sbjct  64    KNRVTVVGSGNWGSVAAKLIASNTIRLPSFHDEVRMWVFEETLPSGEKLTDAINTRNENV  123

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNV+ADPDL +A   ANMLVFVTPHQFMEGICK+L GKI  D EAISLIKG
Sbjct  124   KYLPGIKLGKNVVADPDLVNAVTGANMLVFVTPHQFMEGICKRLAGKISGDVEAISLIKG  183

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LIT+QLG+N CVLMGANIANEIA+EKFSEATVGYRENKEIA+KWVQL
Sbjct  184   MEVKMEGPCMISKLITDQLGVNSCVLMGANIANEIALEKFSEATVGYRENKEIAEKWVQL  243

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+T YF+VS VQDVEGVELCGTLKNVVA+AAGFVDGL+MGNNTKAAIMRIGLREMKAFSK
Sbjct  244   FSTSYFIVSPVQDVEGVELCGTLKNVVAIAAGFVDGLDMGNNTKAAIMRIGLREMKAFSK  303

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             +LF SVK+STFFESCGVAD+ITTCLGGRNRK A+AFAK+GGKRSFDELEAEMLQGQKLQ 
Sbjct  304   MLFSSVKDSTFFESCGVADLITTCLGGRNRKVAEAFAKSGGKRSFDELEAEMLQGQKLQG  363

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  364   VSTAKEVYEVLSHR  377


 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTAKEVYEVL +RGWL+ FPLF+TVHEIC G LPPSAIVE+SE TP+
Sbjct  363  GVSTAKEVYEVLSHRGWLQFFPLFATVHEICIGTLPPSAIVEHSERTPK  411



>ref|XP_008458845.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Cucumis 
melo]
 ref|XP_008458846.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Cucumis 
melo]
Length=447

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/323 (81%), Positives = 291/323 (90%), Gaps = 10/323 (3%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K +VTVVGSGNWGSVAAKLIASN  +L+ FHDEVRMWV+EE LPTGEKL++VIN+ NE
Sbjct  88    SSKFKVTVVGSGNWGSVAAKLIASNAARLSCFHDEVRMWVYEETLPTGEKLTDVINRNNE  147

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LGKNVIADPDLE+A +DANMLVFVTPHQF+EGICK+LVGKIR D EAISLI
Sbjct  148   NVKYLPGIKLGKNVIADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKIRGDVEAISLI  207

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN-KEIAQKW  1022
             KGMEVK EGPCMIS+LI+++LGINCCVLMGANIANEIAVEKFSEATVGYREN +EIA+KW
Sbjct  208   KGMEVKKEGPCMISSLISQELGINCCVLMGANIANEIAVEKFSEATVGYRENMREIAEKW  267

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQLF TPYF+V+ VQDVEGVE+CGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+ 
Sbjct  268   VQLFTTPYFVVTPVQDVEGVEMCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRM  327

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              SKLLF SVK+STFFESCGVAD+ITTCLGGRNRK A AFA NGGKRSFDELEAEMLQGQK
Sbjct  328   ISKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAAAFAMNGGKRSFDELEAEMLQGQK  387

Query  661   LQVHQTA---------MGYIELF  620
             LQ   TA          G++ELF
Sbjct  388   LQGVSTAKEMYEVLNHRGWLELF  410


 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSAN  285
            GVSTAKE+YEVL +RGWLELFPLF++VHEICTG L PSAIVEYSE  P FS++ G A 
Sbjct  390  GVSTAKEMYEVLNHRGWLELFPLFASVHEICTGHLSPSAIVEYSERKPNFSVIDGHAQ  447



>ref|XP_003618783.1| Glycerol-3-phosphate dehydrogenase [Medicago truncatula]
Length=683

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/299 (85%), Positives = 288/299 (96%), Gaps = 1/299 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             N+S+VTV+GSGNWGSVA+KLIASNT+++N+FHDEVRMWV+EE LP+GEKL++VIN+TNEN
Sbjct  27    NRSKVTVIGSGNWGSVASKLIASNTIRMNNFHDEVRMWVYEETLPSGEKLTDVINQTNEN  86

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LGKNV+ADPDLE+A RDANMLVFVTPHQFMEGICK++ GKIR DAEAISL+K
Sbjct  87    VKYLPGIKLGKNVVADPDLENAVRDANMLVFVTPHQFMEGICKRIAGKIRADAEAISLVK  146

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI+E+LGINC VLMGANIANEIAVEKFSEATVGYR+N+E A++WV 
Sbjct  147   GMEVKMEGPCMISTLISEELGINCSVLMGANIANEIAVEKFSEATVGYRQNREAAERWVH  206

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF TPYF+V+AVQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKAFS
Sbjct  207   LFYTPYFIVTAVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRLGLREMKAFS  266

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             KLLFPSVK+STFFESCGVAD+ITT LGGRNRK A+A+AKNGGKRSFDELEAEMLQGQK 
Sbjct  267   KLLFPSVKDSTFFESCGVADLITT-LGGRNRKVAEAYAKNGGKRSFDELEAEMLQGQKF  324


 Score = 85.1 bits (209),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTP  315
            GVSTA+EVYEVL +RGWLELFPLFSTVHEI +G LPPSAIVEYSE  P
Sbjct  629  GVSTAREVYEVLSHRGWLELFPLFSTVHEISSGLLPPSAIVEYSEKLP  676



>ref|XP_009125149.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic 
[Brassica rapa]
Length=390

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/320 (81%), Positives = 289/320 (90%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASN LKL SFHDEVRMWVFEE+LP GEKL++VINKTNENV
Sbjct  44    KSRVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEELLPNGEKLTDVINKTNENV  103

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM GICKKL GK+  + EAISL+KG
Sbjct  104   KYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMGGICKKLKGKVTGEVEAISLVKG  163

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS+LI+++LGIN CVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  164   MEVKKEGPCMISSLISKELGINSCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  223

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+A SK
Sbjct  224   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRALSK  283

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+ FA++GGKRSFDELEAEMLQGQKLQ 
Sbjct  284   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAETFAQSGGKRSFDELEAEMLQGQKLQG  343

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  344   VSTAREVYEVLNHCGWLEMF  363


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GWLE+FPLFSTVH+ICTGRL P AIV Y +H
Sbjct  343  GVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGRLKPEAIVHYRDH  388



>ref|XP_004142775.1| PREDICTED: LOW QUALITY PROTEIN: glycerol-3-phosphate dehydrogenase 
[NAD(+)] 1, chloroplastic-like [Cucumis sativus]
Length=392

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/327 (81%), Positives = 291/327 (89%), Gaps = 14/327 (4%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K +VTVVGSGNWGSVAAKLIASN  +L+SFHDEVRMWV+EE LPTGEKL++VIN  NE
Sbjct  29    SSKFKVTVVGSGNWGSVAAKLIASNAARLSSFHDEVRMWVYEETLPTGEKLTDVINLNNE  88

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LGKNVIADPDLE+A +DANMLVFVTPHQF+EGICK+LVGKIR D EAISLI
Sbjct  89    NVKYLPGIKLGKNVIADPDLENAVKDANMLVFVTPHQFVEGICKRLVGKIRGDVEAISLI  148

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN-KEIAQKW  1022
             KGMEVK EGPCMIS+LI+++LGINCCVLMGANIANEIAVEKFSEATVGYREN +EIA+KW
Sbjct  149   KGMEVKKEGPCMISSLISQELGINCCVLMGANIANEIAVEKFSEATVGYRENMREIAEKW  208

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAA----GFVDGLEMGNNTKAAIMRIGLR  854
             VQLF TPYF+V+ VQDVEGVE+CGTLKNVVALAA    GFVDGLEMGNNTKAAIMRIGLR
Sbjct  209   VQLFTTPYFVVTPVQDVEGVEMCGTLKNVVALAALIITGFVDGLEMGNNTKAAIMRIGLR  268

Query  853   EMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEML  674
             EM+  SKLLF SVK+STFFESCGVAD+ITTCLGGRNRK A AFA NGGKRSFDELEAEML
Sbjct  269   EMRMISKLLFSSVKDSTFFESCGVADLITTCLGGRNRKVAAAFAMNGGKRSFDELEAEML  328

Query  673   QGQKLQVHQTA---------MGYIELF  620
             QGQKLQ   TA          G++ELF
Sbjct  329   QGQKLQGVSTAKEMYEVLNHRGWLELF  355


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSA  288
            GVSTAKE+YEVL +RGWLELFPLF++VHEICTG L PSAIVEYSE  P FS++ G A
Sbjct  335  GVSTAKEMYEVLNHRGWLELFPLFASVHEICTGHLSPSAIVEYSERKPNFSVIDGHA  391



>ref|XP_006604107.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Glycine 
max]
Length=356

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/318 (80%), Positives = 289/318 (91%), Gaps = 9/318 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTVVGSGNWGSVAAKLIASNT++L SFHDEVRMWVFEE LP+GEKL++VINKTNENVKY
Sbjct  3     KVTVVGSGNWGSVAAKLIASNTIRLASFHDEVRMWVFEEKLPSGEKLTDVINKTNENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPGI+LGKNV+ADP+LE+A +DANMLVFVTPHQFMEGICK+L GKIR D E ISLIKGME
Sbjct  63    LPGIKLGKNVVADPELENAVKDANMLVFVTPHQFMEGICKRLAGKIRSDTEGISLIKGME  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
             VK EGP MISTLIT+QLGINC VLMGANIANEIA+EKFSEATVGY +NK  A++WV+LFN
Sbjct  123   VKKEGPTMISTLITKQLGINCSVLMGANIANEIALEKFSEATVGYNQNKLAAERWVELFN  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TPYF V+AV+DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGL+EM+AFSK+ 
Sbjct  183   TPYFNVTAVEDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLKEMRAFSKMW  242

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ---  656
             FPSVK++TFFESCGVAD+ITTC+GGRNRK ADA+A+NGGKR FDELEAEMLQGQKLQ   
Sbjct  243   FPSVKDNTFFESCGVADLITTCMGGRNRKVADAYARNGGKRPFDELEAEMLQGQKLQGVL  302

Query  655   ----VHQ--TAMGYIELF  620
                 VH+  +  G++ +F
Sbjct  303   TAQEVHEVLSHRGWLHMF  320


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GV TA+EV+EVL +RGWL +FPLFS VH I TGRLPPSAIV+ S+  PR
Sbjct  300  GVLTAQEVHEVLSHRGWLHMFPLFSAVHAISTGRLPPSAIVKISDLKPR  348



>ref|XP_009140027.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic 
[Brassica rapa]
Length=368

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/306 (83%), Positives = 285/306 (93%), Gaps = 0/306 (0%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++KSRVT+VGSG+ GSVAAKL+ASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNE
Sbjct  16    DSKSRVTIVGSGSCGSVAAKLVASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNE  75

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N  YLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI+ + EAISL+
Sbjct  76    NANYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLKGKIKGEVEAISLV  135

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGPCMIS LI+++LGINCCVLMGANIANEIAVEKFSEATVGYRE++EIA  WV
Sbjct  136   KGMEVKKEGPCMISNLISKELGINCCVLMGANIANEIAVEKFSEATVGYRESREIADTWV  195

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKA 
Sbjct  196   QLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAL  255

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELEAEML+GQKL
Sbjct  256   SKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEAEMLEGQKL  315

Query  658   QVHQTA  641
             Q   TA
Sbjct  316   QGVSTA  321


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYE L + G LE+FPLFSTVH+IC GRL P AIV Y    P 
Sbjct  317  GVSTAREVYETLNHCGKLEMFPLFSTVHQICIGRLKPDAIVHYRNFGPN  365



>gb|AIE76330.1| glycerol-3-phosphate dehydrogenase-like protein [Brassica napus]
Length=356

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/320 (81%), Positives = 288/320 (90%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             KSRVTVVGSGNWGSVAAKLIASN LKL  FHDEVRMWVFEEVLP GEKL++VINKTNENV
Sbjct  10    KSRVTVVGSGNWGSVAAKLIASNALKLPFFHDEVRMWVFEEVLPNGEKLTDVINKTNENV  69

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM GICKKL GK+  + EAISL+KG
Sbjct  70    KYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMGGICKKLKGKVTGEVEAISLVKG  129

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGP MIS+LI+++LGIN CVLMGANIANEIAVEKFSEATVGYRE++EIA  WVQL
Sbjct  130   MEVKKEGPRMISSLISKELGINSCVLMGANIANEIAVEKFSEATVGYRESREIADTWVQL  189

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYFMV+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREM+A SK
Sbjct  190   FSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMRALSK  249

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELEAEMLQGQKLQ 
Sbjct  250   LLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEAEMLQGQKLQG  309

Query  652   HQTAM---------GYIELF  620
               TA          G++E+F
Sbjct  310   VSTAREVYEVLNHCGWLEMF  329


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTA+EVYEVL + GWLE+FPLFSTVH+ICTGRL P AIV Y +H
Sbjct  309  GVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGRLKPEAIVHYRDH  354



>gb|KHN18269.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Glycine soja]
Length=364

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/318 (80%), Positives = 289/318 (91%), Gaps = 9/318 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTVVGSGNWGSVAAKLIASNT++L SFHDEVRMWVFEE LP+GEKL++VINKTNENVKY
Sbjct  3     KVTVVGSGNWGSVAAKLIASNTIRLASFHDEVRMWVFEEKLPSGEKLTDVINKTNENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPGI+LGKNV+ADP+LE+A +DANMLVFVTPHQFMEGICK+L GKIR D E ISLIKGME
Sbjct  63    LPGIKLGKNVVADPELENAVKDANMLVFVTPHQFMEGICKRLAGKIRSDTEGISLIKGME  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
             VK EGP MISTLIT+QLGINC VLMGANIANEIA+EKFSEATVGY +NK  A++WV+LFN
Sbjct  123   VKKEGPTMISTLITKQLGINCSVLMGANIANEIALEKFSEATVGYNQNKLAAERWVELFN  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TPYF V+AV+DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGL+EM+AFSK+ 
Sbjct  183   TPYFNVTAVEDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLKEMRAFSKMW  242

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ---  656
             FPSVK++TFFESCGVAD+ITTC+GGRNRK ADA+A+NGGKR FDELEAEMLQGQKLQ   
Sbjct  243   FPSVKDNTFFESCGVADLITTCMGGRNRKVADAYARNGGKRPFDELEAEMLQGQKLQGVL  302

Query  655   ----VHQ--TAMGYIELF  620
                 VH+  +  G++ +F
Sbjct  303   TAQEVHEVLSHRGWLHMF  320


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSL  303
            GV TA+EV+EVL +RGWL +FPLFS VH I TGRLPPSAIV+ S+  PR++L
Sbjct  300  GVLTAQEVHEVLSHRGWLHMFPLFSAVHAISTGRLPPSAIVKISDLKPRYTL  351



>ref|XP_006852214.1| hypothetical protein AMTR_s00049p00131690 [Amborella trichopoda]
 gb|ERN13681.1| hypothetical protein AMTR_s00049p00131690 [Amborella trichopoda]
Length=388

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/339 (78%), Positives = 292/339 (86%), Gaps = 8/339 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVA+KLIASNT KL+SFHDEVRMWVFEE LP+GEKLSEVIN+ NENV
Sbjct  30    QERVAVIGSGNWGSVASKLIASNTAKLSSFHDEVRMWVFEETLPSGEKLSEVINRENENV  89

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG++LGKNV+ADPDL +  +DA MLVFVTPHQFMEGICK+L+GK+R DA+AISLIKG
Sbjct  90    KYLPGVKLGKNVVADPDLVNTVKDATMLVFVTPHQFMEGICKRLIGKVRPDAQAISLIKG  149

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMISTLIT+ L INC VLMGANIANEIA EKFSEATVGYRE++E A KWV L
Sbjct  150   MEVKKEGPCMISTLITQLLHINCSVLMGANIANEIAQEKFSEATVGYREDEETALKWVLL  209

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYF+V+ VQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+AFSK
Sbjct  210   FSTPYFLVTPVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAFSK  269

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             L+FPSVK +TFFESCGVAD+ITTCLGGRNRK A+AFAKN GKRSFDELEAEMLQGQKLQ 
Sbjct  270   LMFPSVKNNTFFESCGVADLITTCLGGRNRKVAEAFAKNNGKRSFDELEAEMLQGQKLQG  329

Query  652   HQTAMGYIELFLPRT*KE--PLTKNTAYE*LMKEITISH  542
               TA    E+   R  +E  PL   T Y     EI I H
Sbjct  330   VSTAREVYEVLSHRGWQELFPLF-TTVY-----EICIGH  362


 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL +RGW ELFPLF+TV+EIC G L PSAIVEYSEH P F+LV GSA  +
Sbjct  329  GVSTAREVYEVLSHRGWQELFPLFTTVYEICIGHLSPSAIVEYSEHKPNFALVDGSAQVY  388



>ref|XP_007141023.1| hypothetical protein PHAVU_008G160800g [Phaseolus vulgaris]
 gb|ESW13017.1| hypothetical protein PHAVU_008G160800g [Phaseolus vulgaris]
Length=356

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/318 (80%), Positives = 287/318 (90%), Gaps = 9/318 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTV+GSGNWGSVAAKLIASNT+KL SFHDEVRMWVFEE LP+GEKL++VINKTNENVKY
Sbjct  3     KVTVIGSGNWGSVAAKLIASNTIKLPSFHDEVRMWVFEEKLPSGEKLTDVINKTNENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG++LGKNV+ADPDL +A +DANMLVFVTPHQFMEGICK+L GKIR DAE ISLIKGME
Sbjct  63    LPGVKLGKNVVADPDLVNAVKDANMLVFVTPHQFMEGICKRLAGKIRADAEGISLIKGME  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
             VK EGP MISTLIT+QLGINC VLMGANIANEIA+EKFSEATVGY +NK  A +WVQLF 
Sbjct  123   VKKEGPSMISTLITKQLGINCSVLMGANIANEIAMEKFSEATVGYNQNKSAADRWVQLFC  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TPYF V++V+DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGL+EM AFSK+ 
Sbjct  183   TPYFNVTSVEDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLKEMMAFSKMW  242

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ---  656
             FPSVK+STFFESCGVAD+ITTC+GGRNRK ADA+A+NGGKRSF+ELEAEMLQGQKLQ   
Sbjct  243   FPSVKDSTFFESCGVADLITTCMGGRNRKVADAYARNGGKRSFEELEAEMLQGQKLQGVL  302

Query  655   ----VHQ--TAMGYIELF  620
                 VH+  +  G++ +F
Sbjct  303   TAQEVHEVLSDRGWLHIF  320


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GV TA+EV+EVL  RGWL +FPLFS VH I  G LPPSAIV+ SE  PR
Sbjct  300  GVLTAQEVHEVLSDRGWLHIFPLFSAVHAISIGHLPPSAIVKISEEKPR  348



>ref|XP_009415986.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Musa 
acuminata subsp. malaccensis]
Length=387

 Score =   525 bits (1353),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 252/314 (80%), Positives = 284/314 (90%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RVTVVGSGNWGSVAAKLIASNT+KL  FHDEVRMWVFEE+LP GEKLS+ IN+TNENV
Sbjct  29    RYRVTVVGSGNWGSVAAKLIASNTVKLPIFHDEVRMWVFEEILPGGEKLSKAINQTNENV  88

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNVIADPDLE+A ++ANMLVFVTPHQF+ GICK+LVGKI+ + EAISLIKG
Sbjct  89    KYLPGIKLGKNVIADPDLENAVKEANMLVFVTPHQFVAGICKRLVGKIKPNTEAISLIKG  148

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK EGPCMIS LIT+ LGINCCVLMGANIANEIAVEKFSEAT+GY+++KE+AQ+W +L
Sbjct  149   MEVKTEGPCMISKLITDMLGINCCVLMGANIANEIAVEKFSEATIGYKQDKEVAQRWARL  208

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS VQDVEGVELCGTLKNVVA+AAG VDG+ MGNNTKAAIMRIGLREM+A SK
Sbjct  209   FCTPYFLVSVVQDVEGVELCGTLKNVVAIAAGLVDGMNMGNNTKAAIMRIGLREMRALSK  268

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV++STFFESCGVAD+ITTCLGGRNRK A+AFAK+GGKRSFDELEAE+L GQKLQ 
Sbjct  269   LLFPSVRDSTFFESCGVADLITTCLGGRNRKVAEAFAKSGGKRSFDELEAELLGGQKLQG  328

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  329   VSTAKEVYEILSHR  342


 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANY  282
            GVSTAKEVYE+L +RGW  +FPLF+TVHEIC G+LP SAIVEYSE    FS+V G A Y
Sbjct  328  GVSTAKEVYEILSHRGWQAIFPLFTTVHEICIGQLPSSAIVEYSEQATNFSIVEGLAQY  386



>emb|CDY36365.1| BnaC04g32730D [Brassica napus]
Length=374

 Score =   525 bits (1352),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 291/328 (89%), Gaps = 15/328 (5%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++KSRVT+VGSG+WGSVAAKL+ASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNE
Sbjct  16    DSKSRVTIVGSGSWGSVAAKLVASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNE  75

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N  YLPGI+LG+NV+ADPDLE+A ++ANMLVFVTPHQFM+GICKKL GKI+ + EAISL+
Sbjct  76    NANYLPGIKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGICKKLKGKIKGEVEAISLV  135

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGPCMIS LI+++LGINC VLMGANIANEIAVEKFSEATVGYRE++EIA  WV
Sbjct  136   KGMEVKKEGPCMISNLISKELGINCSVLMGANIANEIAVEKFSEATVGYRESREIADTWV  195

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTK------AAIMRIGL  857
             QLF+TPYFMV+ V+DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTK      AAIMRIGL
Sbjct  196   QLFSTPYFMVTPVRDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKASSSNEAAIMRIGL  255

Query  856   REMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEM  677
             REMKA SKLLFPSVK+STFFESCGVADVITTCLGGRNR+ A+AFA++GGKRSFDELE EM
Sbjct  256   REMKALSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAQSGGKRSFDELEEEM  315

Query  676   LQGQKLQVHQTA---------MGYIELF  620
             L+GQKLQ   TA          G++E+F
Sbjct  316   LEGQKLQGVSTAREVYEALNHRGWMEMF  343


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYE L +RGW+E+FPLFSTVH+IC GRL P AIV Y    P 
Sbjct  323  GVSTAREVYEALNHRGWMEMFPLFSTVHQICIGRLKPDAIVNYRNFGPN  371



>dbj|BAK07844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   523 bits (1347),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 250/320 (78%), Positives = 282/320 (88%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVA++L+ASNT KL SFHDEVRMWVFEE LPTGEKLSE IN+ NEN 
Sbjct  8     RHRVAVIGSGNWGSVASRLLASNTAKLPSFHDEVRMWVFEETLPTGEKLSESINQANENC  67

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NV+ADPDLE A +DA+MLVFVTPHQF+EGICKKLVGK+R   EAISLIKG
Sbjct  68    KYLPGIKLGTNVVADPDLESAVKDADMLVFVTPHQFVEGICKKLVGKLRPGVEAISLIKG  127

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LIT+ LGINCCVLMGANIANEIAVEKFSEAT+GYR++KE A +W +L
Sbjct  128   MEVKMEGPCMISKLITDTLGINCCVLMGANIANEIAVEKFSEATIGYRKDKEAANRWAKL  187

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  188   FTTPYFLVSVVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  247

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  248   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  307

Query  652   HQTA---------MGYIELF  620
               TA          G+ ELF
Sbjct  308   VSTAREVYEVLTYHGWQELF  327


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEY  330
            GVSTA+EVYEVL Y GW ELFPL STVHEIC G+LPP++IVEY
Sbjct  307  GVSTAREVYEVLTYHGWQELFPLLSTVHEICIGQLPPTSIVEY  349



>ref|XP_003622291.1| Glycerol-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES78509.1| glycerol-3-phosphate dehydrogenase, NAD [Medicago truncatula]
Length=348

 Score =   522 bits (1345),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 247/319 (77%), Positives = 289/319 (91%), Gaps = 9/319 (3%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             ++VT+VGSGNWGSVAAKLIASNT+KL++FHDEVRMWVFEE LP G+KL++VI +TNENVK
Sbjct  2     NKVTIVGSGNWGSVAAKLIASNTIKLSNFHDEVRMWVFEETLPNGDKLTDVIKQTNENVK  61

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPG++LG+NV+ADPDLE+A +DANMLVFVTPHQFMEGICK+L GKIR DAE ISL+KGM
Sbjct  62    YLPGVKLGQNVVADPDLENAVKDANMLVFVTPHQFMEGICKRLDGKIRTDAEGISLVKGM  121

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             EVK EG  MISTLI+ QL INC VLMGANIANEIA++KFSEAT+GYRENKE A++WVQLF
Sbjct  122   EVKKEGASMISTLISNQLKINCSVLMGANIANEIAMQKFSEATIGYRENKEAAERWVQLF  181

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             NTPYF V++VQDVEGVE+CGTLKN+VA+AAGF+DGLEMGNNTK+AIMRIGL+EM AFSKL
Sbjct  182   NTPYFNVTSVQDVEGVEMCGTLKNIVAIAAGFIDGLEMGNNTKSAIMRIGLKEMMAFSKL  241

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ--  656
             LFPSVK STFFESCGVAD+ITTC+GGRNRK A A+A+NGGKRSFDELEAE+L+GQKLQ  
Sbjct  242   LFPSVKYSTFFESCGVADLITTCMGGRNRKVAAAYARNGGKRSFDELEAELLKGQKLQGV  301

Query  655   -----VHQ--TAMGYIELF  620
                  V++  TA G++E F
Sbjct  302   LTAKEVYEVLTARGWVERF  320


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTP  315
            GV TAKEVYEVL  RGW+E FPLF+TV+EI +G LPPSAIVE++  + 
Sbjct  300  GVLTAKEVYEVLTARGWVERFPLFTTVYEISSGLLPPSAIVEFNNKSK  347



>ref|XP_002459175.1| hypothetical protein SORBIDRAFT_03g047310 [Sorghum bicolor]
 gb|EES04295.1| hypothetical protein SORBIDRAFT_03g047310 [Sorghum bicolor]
Length=365

 Score =   523 bits (1347),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 285/318 (90%), Gaps = 0/318 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+GSGNWGSVA++LIASNT KL SF+DEVRMWVFEE+LPTG+KLSE IN+ NEN 
Sbjct  7     KYRVAVIGSGNWGSVASRLIASNTAKLPSFYDEVRMWVFEEILPTGKKLSESINEQNENC  66

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LGKNVIADPDLE A +DANMLVFVTPHQF+EGICKKLVGK+R  AEAISLIKG
Sbjct  67    KYLPGIKLGKNVIADPDLESAVKDANMLVFVTPHQFVEGICKKLVGKLRPGAEAISLIKG  126

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LI + LG+NCCVLMGANIANEIAVE+FSEAT+GYR++KE+A +W QL
Sbjct  127   MEVKMEGPCMISKLIADTLGVNCCVLMGANIANEIAVEEFSEATIGYRKDKEVANRWAQL  186

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS  +D+EGVELCGTLKN+VA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  187   FTTPYFLVSIAEDIEGVELCGTLKNIVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  246

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFD+LEAEML+GQKLQ 
Sbjct  247   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDDLEAEMLRGQKLQG  306

Query  652   HQTAMGYIELFLPRT*KE  599
               TA    E+   R  +E
Sbjct  307   VSTAREVYEVLTYRGWQE  324


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  SL+GG   ++
Sbjct  306  GVSTAREVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSLIGGPTPFY  365



>ref|XP_010232866.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X1 [Brachypodium distachyon]
Length=367

 Score =   522 bits (1345),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 248/319 (78%), Positives = 283/319 (89%), Gaps = 0/319 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K RV V+GSGNWGSVA++L+ASNT KL SF+DEVRMWVFEE LPTGEKLSE IN+ NEN
Sbjct  8     SKHRVAVIGSGNWGSVASRLLASNTAKLPSFYDEVRMWVFEETLPTGEKLSECINRANEN  67

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPGI+LG NVIADPDLE A +DA+MLVFVTPHQF+EGICKKLVGK+R   +AISLIK
Sbjct  68    CKYLPGIKLGTNVIADPDLESAVKDADMLVFVTPHQFVEGICKKLVGKLRPGVQAISLIK  127

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMIS LI++ LGINCCVLMGANIANEIAVEKFSEAT+GYRE+KE A +W +
Sbjct  128   GMEVKMEGPCMISKLISDTLGINCCVLMGANIANEIAVEKFSEATIGYREDKEAASRWAK  187

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF TPYF+VS V+D+EGVELCGTLKN+VA+AAG VDGL+MGNNTKAAIMRIGLREM+AFS
Sbjct  188   LFTTPYFLVSVVEDIEGVELCGTLKNIVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFS  247

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             KLLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ
Sbjct  248   KLLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQ  307

Query  655   VHQTAMGYIELFLPRT*KE  599
                TA    E+   R  +E
Sbjct  308   GVSTAREVYEVLTYRGWQE  326


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGS  291
            GVSTA+EVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  S++GGS
Sbjct  308  GVSTAREVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIIGGS  363



>ref|XP_010528202.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=428

 Score =   524 bits (1350),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 288/322 (89%), Gaps = 9/322 (3%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K RVTVVGSGNWGSVAAKL+ASN LKL S HDEVRMWVFEEVLP GEKL++VINK +E
Sbjct  76    DSKYRVTVVGSGNWGSVAAKLVASNALKLPSCHDEVRMWVFEEVLPNGEKLTDVINKAHE  135

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LG+NVIADPDLE+A + ANMLVFVTPHQFM+GICK+L GKI  D EAISL+
Sbjct  136   NVKYLPGIKLGRNVIADPDLENAVKGANMLVFVTPHQFMDGICKRLRGKIDGDVEAISLV  195

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGP MIS+LI+EQLGINCCVLMGANIANEIAV KFSEATVG+R + E+A  WV
Sbjct  196   KGMEVKKEGPRMISSLISEQLGINCCVLMGANIANEIAVGKFSEATVGHRGSIEVADTWV  255

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+ PYFM+++V DVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM+A 
Sbjct  256   QLFSAPYFMITSVHDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMRAI  315

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             SKLLFPSVK++TFFESCGVADVITTCLGGRNR+ A+AFA+NGGKRSFDELEAEMLQGQKL
Sbjct  316   SKLLFPSVKDNTFFESCGVADVITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLQGQKL  375

Query  658   Q-------VHQ--TAMGYIELF  620
             Q       VH+  +  G++ELF
Sbjct  376   QGVSTAREVHEVLSHNGWLELF  397


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTP  315
            GVSTA+EV+EVL + GWLELFPLF+TVHEI TGRLPP+AIV+Y+E  P
Sbjct  377  GVSTAREVHEVLSHNGWLELFPLFTTVHEISTGRLPPAAIVKYNEQKP  424



>gb|AGS79224.1| glycerol-3-phosphate dehydrogenase [Triticum aestivum]
Length=356

 Score =   521 bits (1343),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 250/320 (78%), Positives = 281/320 (88%), Gaps = 9/320 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+GSGNWGSVA++L+ASNT KL SFHDEVRMWVFEE LP GEKLSE IN+ +EN 
Sbjct  8     KHRVAVIGSGNWGSVASRLLASNTAKLPSFHDEVRMWVFEETLPAGEKLSESINQAHENC  67

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DA+MLVFVTPHQF+EGICKKLVGK+R   EAISLIKG
Sbjct  68    KYLPGIKLGTNVIADPDLESAVKDADMLVFVTPHQFVEGICKKLVGKLRPGVEAISLIKG  127

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LIT+ LGINCCVLMGANIANEIAVEKFSEAT+GYRE+KE A +W +L
Sbjct  128   MEVKMEGPCMISKLITDTLGINCCVLMGANIANEIAVEKFSEATIGYREDKEAANRWAKL  187

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+V+ V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  188   FTTPYFLVAIVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  247

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  248   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  307

Query  652   HQTA---------MGYIELF  620
               TA          G+ ELF
Sbjct  308   VSTAREVYEVLTYHGWQELF  327


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEY  330
            GVSTA+EVYEVL Y GW ELFPL STVHEIC G+LPP++IVEY
Sbjct  307  GVSTAREVYEVLTYHGWQELFPLLSTVHEICIGQLPPTSIVEY  349



>ref|XP_004971422.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X1 [Setaria italica]
 ref|XP_004971423.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X2 [Setaria italica]
 ref|XP_004971424.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X3 [Setaria italica]
Length=365

 Score =   520 bits (1339),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 281/318 (88%), Gaps = 0/318 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+GSGNWGSVA++LIASNT KL SF+DEVRMWVFEE+LPTG+KLSE IN+ NEN 
Sbjct  7     KYRVAVIGSGNWGSVASRLIASNTAKLPSFYDEVRMWVFEEILPTGKKLSESINEENENC  66

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DANMLVFVTPHQF+EGICKKLVGK+R  AEAISLIKG
Sbjct  67    KYLPGIKLGANVIADPDLESAVKDANMLVFVTPHQFVEGICKKLVGKLRPGAEAISLIKG  126

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LI + LGINCCVLMGANIANEIAVE FSEAT+GYR++KE+A +W  L
Sbjct  127   MEVKMEGPCMISKLIADTLGINCCVLMGANIANEIAVEMFSEATIGYRKDKEVANRWANL  186

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS  +D+EGVELCGTLKN+VA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  187   FTTPYFLVSVAEDIEGVELCGTLKNIVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  246

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  247   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  306

Query  652   HQTAMGYIELFLPRT*KE  599
               TA    E+   R  +E
Sbjct  307   VSTAREVYEVLTYRGWQE  324


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  S++GG   ++
Sbjct  306  GVSTAREVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIIGGPTPFY  365



>ref|NP_001150493.1| glycerol-3-phosphate dehydrogenase [Zea mays]
 gb|ACF87652.1| unknown [Zea mays]
 gb|ACG39274.1| glycerol-3-phosphate dehydrogenase [Zea mays]
Length=367

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 280/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+GSGNWGSVA++LIASNT KL SF+DEVRMWVFEE+LPTG KLSE IN+ NEN 
Sbjct  9     KYRVAVIGSGNWGSVASRLIASNTAKLPSFYDEVRMWVFEEILPTGRKLSESINEQNENC  68

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DANMLVFVTPHQF+EGICKKLVGK+   AEAISLIKG
Sbjct  69    KYLPGIKLGTNVIADPDLESAVKDANMLVFVTPHQFVEGICKKLVGKLTPGAEAISLIKG  128

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LI + LGINCCVLMGANIANEIAVE+FSEAT+GYR++KE+A +W +L
Sbjct  129   MEVKMEGPCMISKLIADTLGINCCVLMGANIANEIAVEEFSEATIGYRKDKEVANRWAKL  188

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS  +D+EGVELCGTLKN+VA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  189   FTTPYFLVSVAEDIEGVELCGTLKNIVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  248

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML+GQKLQ 
Sbjct  249   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLRGQKLQG  308

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  309   VSTAREVYEVLTYR  322


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTA+EVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  S++GG   ++
Sbjct  308  GVSTAREVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIIGGHTPFY  367



>ref|XP_006645328.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like [Oryza 
brachyantha]
Length=351

 Score =   518 bits (1334),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 248/314 (79%), Positives = 281/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K+RV V+GSGNWGSVA++LIASNT KL SFHDEVRMWVFEE+LPTG+KLSE IN+ NEN 
Sbjct  7     KNRVAVIGSGNWGSVASRLIASNTAKLPSFHDEVRMWVFEEILPTGKKLSESINQANENC  66

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DANMLVFVTPHQF+EGICKKLVGK+R  AEAISLIKG
Sbjct  67    KYLPGIKLGANVIADPDLESAVKDANMLVFVTPHQFVEGICKKLVGKLRPGAEAISLIKG  126

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LIT  LGINCCVLMGANIANEIAVEKFSEAT+GY+++KE+A +W ++
Sbjct  127   MEVKMEGPCMISKLITNILGINCCVLMGANIANEIAVEKFSEATIGYKKDKEMATRWAKI  186

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGL EM+AFSK
Sbjct  187   FTTPYFLVSIVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLWEMRAFSK  246

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LL PSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  247   LLSPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  306

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  307   VSTAKEVYEVLTYR  320


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTAKEVYEVL YRGW ELFPL STVHEIC G+LPP+AIVEY  H
Sbjct  306  GVSTAKEVYEVLTYRGWQELFPLLSTVHEICIGQLPPTAIVEYRLH  351



>ref|NP_001045535.1| Os01g0971600 [Oryza sativa Japonica Group]
 dbj|BAD87362.1| putative glycerol-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF07449.1| Os01g0971600 [Oryza sativa Japonica Group]
 dbj|BAG91906.1| unnamed protein product [Oryza sativa Japonica Group]
Length=351

 Score =   517 bits (1331),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 280/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K+ V V+GSGNWGSVA++LIASNT KL SFHDEVRMWVFEE+LPTG+KLSE IN+ NEN 
Sbjct  7     KNLVAVIGSGNWGSVASRLIASNTAKLPSFHDEVRMWVFEEILPTGKKLSESINQANENC  66

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE+A +DANMLVFVTPHQF+EGICKKLVGK+R   E ISLIKG
Sbjct  67    KYLPGIKLGANVIADPDLENAVKDANMLVFVTPHQFVEGICKKLVGKLRPGTEGISLIKG  126

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGPCMIS LIT  LGINCCVLMGANIANEIAVEKFSEAT+GY+++KE+A +W +L
Sbjct  127   MEVKMEGPCMISKLITNILGINCCVLMGANIANEIAVEKFSEATIGYKKDKEVATRWAKL  186

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  187   FTTPYFLVSVVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  246

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LL P+V+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  247   LLSPTVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  306

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  307   VSTAKEVYEVLTYR  320


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEH  321
            GVSTAKEVYEVL YRGW ELFPL STVHEIC G+LPP++IVEY  H
Sbjct  306  GVSTAKEVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYRIH  351



>ref|XP_008776514.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Phoenix 
dactylifera]
Length=376

 Score =   518 bits (1333),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 249/317 (79%), Positives = 283/317 (89%), Gaps = 0/317 (0%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             +  + RV V+GSGNWGSVAAKLIASNT+K   F+DEVRMWV+EE LPTG KLSEVIN+T+
Sbjct  15    EREQYRVAVIGSGNWGSVAAKLIASNTIKQPIFYDEVRMWVYEETLPTGRKLSEVINQTH  74

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI+L  NVIADPDLE+A ++ANMLVFVTPHQF+ GICK+LVGKIR   EAISL
Sbjct  75    ENVKYLPGIKLRNNVIADPDLENAVKEANMLVFVTPHQFVAGICKRLVGKIRPGTEAISL  134

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             IKGMEVKMEGP MIS LIT+ LGINCCVLMGANIANEIAVEKFSEATVGYR++KE+AQ+W
Sbjct  135   IKGMEVKMEGPFMISKLITDMLGINCCVLMGANIANEIAVEKFSEATVGYRQDKEVAQRW  194

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
              +LF+TPYF+VS VQDVEGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+A
Sbjct  195   ARLFSTPYFLVSVVQDVEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRA  254

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             FSKLLF SV+++TFFESCGVAD+ITTCLGGRNRK A+AFA++GGKRSFDELEAE+LQGQK
Sbjct  255   FSKLLFSSVRDNTFFESCGVADLITTCLGGRNRKVAEAFARSGGKRSFDELEAELLQGQK  314

Query  661   LQVHQTAMGYIELFLPR  611
             LQ   TA    E+   R
Sbjct  315   LQGVSTAKEVYEVLSHR  331


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTAKEVYEVL +RGW  LFPLF+TVHEIC G+LP SAIVEYSEHTP F LV GSA Y+
Sbjct  317  GVSTAKEVYEVLSHRGWQGLFPLFTTVHEICIGQLPASAIVEYSEHTPNFLLVEGSALYY  376



>ref|XP_010912925.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X1 [Elaeis guineensis]
Length=372

 Score =   517 bits (1331),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 282/314 (90%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVAAKLIASNT+K   F+DEV MWV+EE L TGEKLSEVIN+TNENV
Sbjct  14    QYRVVVIGSGNWGSVAAKLIASNTIKQPIFYDEVWMWVYEETLHTGEKLSEVINQTNENV  73

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE+A ++ANMLVFVTPHQF+ GICK+LVGKIR   EAISLIKG
Sbjct  74    KYLPGIKLGNNVIADPDLENAVKEANMLVFVTPHQFVAGICKRLVGKIRPGTEAISLIKG  133

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGP MIS LIT+ LGINCCVLMGANIANEIAVEKFSEATVGYR++KE+AQ+W +L
Sbjct  134   MEVKMEGPFMISKLITDMLGINCCVLMGANIANEIAVEKFSEATVGYRQDKEVAQRWARL  193

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYF+VS VQDVEGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  194   FSTPYFLVSIVQDVEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  253

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLF SV++STFFESCGVAD+ITTCLGGRNRK ++AFA++GGKRSFDELEAE+LQGQKLQ 
Sbjct  254   LLFSSVRDSTFFESCGVADLITTCLGGRNRKVSEAFARSGGKRSFDELEAELLQGQKLQG  313

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  314   VSTAKEVYEVLSHR  327


 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTAKEVYEVL +RGW  LFPLF+TVHEIC G+LPPSAIVEYSEHTP FSLV GSA Y+
Sbjct  313  GVSTAKEVYEVLSHRGWQGLFPLFTTVHEICIGQLPPSAIVEYSEHTPNFSLVEGSALYY  372



>ref|XP_010912926.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X2 [Elaeis guineensis]
Length=354

 Score =   514 bits (1325),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/299 (82%), Positives = 277/299 (93%), Gaps = 0/299 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVAAKLIASNT+K   F+DEV MWV+EE L TGEKLSEVIN+TNENV
Sbjct  14    QYRVVVIGSGNWGSVAAKLIASNTIKQPIFYDEVWMWVYEETLHTGEKLSEVINQTNENV  73

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE+A ++ANMLVFVTPHQF+ GICK+LVGKIR   EAISLIKG
Sbjct  74    KYLPGIKLGNNVIADPDLENAVKEANMLVFVTPHQFVAGICKRLVGKIRPGTEAISLIKG  133

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVKMEGP MIS LIT+ LGINCCVLMGANIANEIAVEKFSEATVGYR++KE+AQ+W +L
Sbjct  134   MEVKMEGPFMISKLITDMLGINCCVLMGANIANEIAVEKFSEATVGYRQDKEVAQRWARL  193

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+TPYF+VS VQDVEGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  194   FSTPYFLVSIVQDVEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  253

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             LLF SV++STFFESCGVAD+ITTCLGGRNRK ++AFA++GGKRSFDELEAE+LQGQKLQ
Sbjct  254   LLFSSVRDSTFFESCGVADLITTCLGGRNRKVSEAFARSGGKRSFDELEAELLQGQKLQ  312



>gb|KHG11302.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Gossypium arboreum]
Length=382

 Score =   508 bits (1308),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 248/340 (73%), Positives = 291/340 (86%), Gaps = 4/340 (1%)
 Frame = -1

Query  1618  QLDGETnanvssgnaagAPDNN----KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEV  1451
             +L+GET     + +A    ++N    KSRV+V+GSG+WGSVAAKL+A NTL L+SFHDEV
Sbjct  6     ELEGETATTHHTNSANNGANDNQIGFKSRVSVIGSGSWGSVAAKLVAFNTLNLSSFHDEV  65

Query  1450  RMWVFEEVLPTGEKLSEVINKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPH  1271
             +MWVFEE L +G+KL++ IN+TNENVKYLPGI+L KNVI DPDL++A + AN++VFVTPH
Sbjct  66    KMWVFEETLQSGKKLTDAINRTNENVKYLPGIKLVKNVIGDPDLDNAVKGANIMVFVTPH  125

Query  1270  QFMEGICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANE  1091
             QF++ ICK LVGK+R DAEAISLIKGMEVK+EGPC+IST I+EQLGINC VLMGAN+A+E
Sbjct  126   QFIDNICKSLVGKVRSDAEAISLIKGMEVKIEGPCLISTYISEQLGINCSVLMGANLASE  185

Query  1090  IAVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFV  911
             IA EKFSEATVGY +N+EIA++WVQLF TPYFMV+ VQDVEGVELCGTLKNVVA+AAGFV
Sbjct  186   IAEEKFSEATVGYGKNREIAEQWVQLFTTPYFMVTPVQDVEGVELCGTLKNVVAIAAGFV  245

Query  910   DGLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCAD  731
             DGL+MGNNTKAAI+R GLREM+ F KLLF SVK+ TFFESCGVADVITTC GGRNRK A+
Sbjct  246   DGLDMGNNTKAAIIRFGLREMREFCKLLFSSVKDDTFFESCGVADVITTCFGGRNRKVAE  305

Query  730   AFAKNGGKRSFDELEAEMLQGQKLQVHQTAMGYIELFLPR  611
             AFAKNGGKRSFDELEAEMLQGQKLQ   TA    E+   R
Sbjct  306   AFAKNGGKRSFDELEAEMLQGQKLQGVPTAREVYEVLRHR  345


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRF  309
            GV TA+EVYEVLR+RG LELFPLF+TVHEIC+G LPPSAIV YSE  PR 
Sbjct  331  GVPTAREVYEVLRHRGLLELFPLFATVHEICSGCLPPSAIVIYSEKKPRL  380



>ref|XP_009340866.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like, 
partial [Pyrus x bretschneideri]
Length=401

 Score =   502 bits (1293),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 239/280 (85%), Positives = 265/280 (95%), Gaps = 0/280 (0%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
              K+RVTVVGSGNWGSVAAKLIASNT +L+SFHDEVRMWVFEE LP+GEKL++ IN+ NEN
Sbjct  5     QKTRVTVVGSGNWGSVAAKLIASNTRRLSSFHDEVRMWVFEETLPSGEKLTDAINRNNEN  64

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI+LG+NV+ADPDL +A   ANMLVFVTPHQFMEGIC++LVGK++ D EAISLIK
Sbjct  65    VKYLPGIKLGENVVADPDLGNAVNGANMLVFVTPHQFMEGICRRLVGKVKADVEAISLIK  124

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GMEVKMEGPCMISTLI++QLGINCCVLMGANIANEIAVEKFSEATVGYRE KEIAQKWVQ
Sbjct  125   GMEVKMEGPCMISTLISDQLGINCCVLMGANIANEIAVEKFSEATVGYREKKEIAQKWVQ  184

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LFNT YF+V+ VQDVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMRIGLREMKAFS
Sbjct  185   LFNTSYFIVTPVQDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  244

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKN  716
             K+LFPSVK++TFFESCGVAD+ITTCLGGRNRK A+AFA+N
Sbjct  245   KMLFPSVKDTTFFESCGVADLITTCLGGRNRKVAEAFARN  284



>ref|XP_010694658.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] [Beta 
vulgaris subsp. vulgaris]
Length=362

 Score =   500 bits (1287),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 231/299 (77%), Positives = 271/299 (91%), Gaps = 0/299 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K +V +VGSGNWGSVAAKLIASNTLK N FHDEV+MWVF+E LP+GEKLSEVIN+TN NV
Sbjct  8     KYKVAIVGSGNWGSVAAKLIASNTLKHNIFHDEVKMWVFDETLPSGEKLSEVINRTNVNV  67

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG QLGKNVIA+PDL HA RDANMLVFVTPHQF+EG+CK+LVGK++ D EAISLIKG
Sbjct  68    KYLPGTQLGKNVIAEPDLHHAVRDANMLVFVTPHQFLEGVCKRLVGKLKGDIEAISLIKG  127

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK++GP  IS++I++ LG+NCCVLMGANIA+EIA EKFSEAT+GY++N+++A++W +L
Sbjct  128   MEVKVDGPSTISSIISKHLGVNCCVLMGANIADEIAEEKFSEATIGYKDNRDVAERWARL  187

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF V+AV+DVEGVELCGTLKNVVA+AAGFVDGL MG+NTKAAIMRIGL EM+AFSK
Sbjct  188   FATPYFSVTAVEDVEGVELCGTLKNVVAIAAGFVDGLGMGSNTKAAIMRIGLNEMRAFSK  247

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
              LFPS+++ TFFESCGVAD+I TC GGRNRK A+AF  NGGKR F+ELEAEMLQGQKLQ
Sbjct  248   RLFPSIRDDTFFESCGVADLIATCFGGRNRKVAEAFVINGGKRPFEELEAEMLQGQKLQ  306


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSE  324
            G+ TAKEVYEVL+   W + FPLF T++EIC G   PSAIV Y++
Sbjct  307  GILTAKEVYEVLKSNSWFDAFPLFRTIYEICVGSKLPSAIVHYND  351



>ref|XP_006405454.1| hypothetical protein EUTSA_v10027824mg [Eutrema salsugineum]
 gb|ESQ46907.1| hypothetical protein EUTSA_v10027824mg [Eutrema salsugineum]
Length=345

 Score =   498 bits (1282),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 265/285 (93%), Gaps = 0/285 (0%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             +++SRVTV+GSGNWGSVAAKLIASN LKL SFHDEVRMWVFEEVLP GEKL++VINKTNE
Sbjct  48    DSQSRVTVIGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLTDVINKTNE  107

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGI+LG NV+ADPDLE+A ++ANMLVFVTPHQFM+GICK+L GKI    EAISL+
Sbjct  108   NVKYLPGIKLGTNVVADPDLENAVKEANMLVFVTPHQFMDGICKELSGKITGAVEAISLV  167

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KGMEVK EGPCMIS+LI++QLGINCCVLMGANIA EIA EKFSEATVGYRE++EIA  WV
Sbjct  168   KGMEVKTEGPCMISSLISKQLGINCCVLMGANIAKEIAEEKFSEATVGYRESREIADTWV  227

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYF+V+ V DVEGVELCGTLKNVVA+AAGFVDGLEMGNNTKAAIMR+GLREMKA 
Sbjct  228   QLFSTPYFIVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRVGLREMKAL  287

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKR  704
             SKL+FPSVK+STF ESCGVADVITTCLGGRNR+ A+AFA++GGKR
Sbjct  288   SKLMFPSVKDSTFLESCGVADVITTCLGGRNRRVAEAFAQSGGKR  332



>gb|KHN45993.1| Glycerol-3-phosphate dehydrogenase [NAD(+)] [Glycine soja]
Length=362

 Score =   498 bits (1282),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 248/351 (71%), Positives = 291/351 (83%), Gaps = 37/351 (11%)
 Frame = -1

Query  1630  LDSKQL----DGETnanvssgnaagAPD-NNKSRVTVVGSGNWGSVAAKLIASNTLKLNS  1466
             L++KQ+    +GET    ++   +   D  ++S+VTV+GSGNWGSVAAKLIASNTL+L+S
Sbjct  5     LEAKQVVLPQEGETTVAPNNFLNSVVNDATHRSKVTVIGSGNWGSVAAKLIASNTLRLSS  64

Query  1465  FHDEVRMWVFEEVLPTGEKLSEVINKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLV  1286
             FHDEVRMWV+EE L +GE+L++VIN+TNENVKYLPGI+LGKNV+ADPDLE A +D+NMLV
Sbjct  65    FHDEVRMWVYEETLRSGEQLTDVINRTNENVKYLPGIKLGKNVVADPDLESAVKDSNMLV  124

Query  1285  FVTPHQFMEGICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGA  1106
             FVTPHQFMEGICK+LVGKIR+D+EAISL+KGMEVKMEGPCMI                  
Sbjct  125   FVTPHQFMEGICKRLVGKIREDSEAISLVKGMEVKMEGPCMI------------------  166

Query  1105  NIANEIAVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVAL  926
                  IAVEKFSEATVGYR N+E+A++WVQLF T YF+V+AVQDVEGVELCGTLKNVVA+
Sbjct  167   -----IAVEKFSEATVGYRLNREVAERWVQLFYTHYFIVTAVQDVEGVELCGTLKNVVAI  221

Query  925   AAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRN  746
             AAGFVDGLEMGNNTKAAIMR+GLREMKAFSKLLFPSVK+STFFESCGVAD+ITTCLGGRN
Sbjct  222   AAGFVDGLEMGNNTKAAIMRLGLREMKAFSKLLFPSVKDSTFFESCGVADLITTCLGGRN  281

Query  745   RKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQTA---------MGYIELF  620
             RK A+A+A+NGGKRSFDE+EAEMLQGQKLQ   TA          G++ELF
Sbjct  282   RKVAEAYARNGGKRSFDEVEAEMLQGQKLQGVSTASEVYEVLSHRGWLELF  332


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA EVYEVL +RGWLELFPLFSTVHEI TG LPPSAIVEYSE  P+
Sbjct  312  GVSTASEVYEVLSHRGWLELFPLFSTVHEISTGLLPPSAIVEYSEKLPK  360



>gb|EMT17048.1| Glycerol-3-phosphate dehydrogenase (NAD+) [Aegilops tauschii]
Length=388

 Score =   497 bits (1280),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 248/349 (71%), Positives = 279/349 (80%), Gaps = 41/349 (12%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+G   WGSVA++L+ASNT KL SFHDEVRMWVFEE LPTGEKLSE IN+ +EN 
Sbjct  8     KHRVAVIG---WGSVASRLLASNTAKLPSFHDEVRMWVFEETLPTGEKLSESINQAHENC  64

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DA+MLVFVTPHQF+EGICKKLVGK+R   EAISLIKG
Sbjct  65    KYLPGIKLGTNVIADPDLESAVKDADMLVFVTPHQFVEGICKKLVGKLRPGVEAISLIKG  124

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANE--------------------------  1091
             MEVKMEGPCMIS LIT+ LGINCCVLMGANIANE                          
Sbjct  125   MEVKMEGPCMISKLITDTLGINCCVLMGANIANEASVYSTFHAKFLIAFSGTEKISGCVS  184

Query  1090  ---IAVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAA  920
                IAVEKFSEAT+GYRE+KE A +W +LF TPYF+V+ V+D+EGVELCGTLKNVVA+AA
Sbjct  185   HMQIAVEKFSEATIGYREDKEAANRWAKLFTTPYFLVAIVEDIEGVELCGTLKNVVAIAA  244

Query  919   GFVDGLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRK  740
             G VDGL+MGNNTKAAIMRIGLREM+AFSKLLFPSV+++TFFESCGVAD+ITTCLGGRNR+
Sbjct  245   GLVDGLDMGNNTKAAIMRIGLREMRAFSKLLFPSVRDNTFFESCGVADLITTCLGGRNRR  304

Query  739   CADAFAKNGGKRSFDELEAEMLQGQKLQVHQTA---------MGYIELF  620
              A+AFA+NGGKRSFDELEAEML GQKLQ   TA          G+ ELF
Sbjct  305   VAEAFARNGGKRSFDELEAEMLHGQKLQGVSTAREVYEVLTYHGWQELF  353


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEY  330
            GVSTA+EVYEVL Y GW ELFPL STVHEIC G+LPP++IVEY
Sbjct  333  GVSTAREVYEVLTYHGWQELFPLLSTVHEICIGQLPPTSIVEY  375



>ref|XP_006603999.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)]-like isoform 
X2 [Glycine max]
Length=315

 Score =   488 bits (1256),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 263/285 (92%), Gaps = 9/285 (3%)
 Frame = -1

Query  1447  MWVFEEVLPTGEKLSEVINKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQ  1268
             MWV+EE L +GEKL++VIN+TNENVKYLPGI+LGKNV+ADPDLE A +D+NMLVFVTPHQ
Sbjct  1     MWVYEETLLSGEKLTDVINRTNENVKYLPGIKLGKNVVADPDLESAVKDSNMLVFVTPHQ  60

Query  1267  FMEGICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEI  1088
             FMEGICK+LVGKIR+DAEAISL+KGMEVKMEGPCMIS+LI++QLGINC VLMGANIANEI
Sbjct  61    FMEGICKRLVGKIREDAEAISLVKGMEVKMEGPCMISSLISQQLGINCSVLMGANIANEI  120

Query  1087  AVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVD  908
             AVEKFSEATVGYR N+E+A++WVQLF T YF+V+AVQDVEGVELCGTLKNVVA+AAGFVD
Sbjct  121   AVEKFSEATVGYRLNREVAERWVQLFYTHYFIVTAVQDVEGVELCGTLKNVVAIAAGFVD  180

Query  907   GLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADA  728
             GLEMGNNTKAAIMR+GLREMKAFSKLLFPSVK+STFFESCGVAD+ITTCLGGRNRK A+A
Sbjct  181   GLEMGNNTKAAIMRLGLREMKAFSKLLFPSVKDSTFFESCGVADLITTCLGGRNRKVAEA  240

Query  727   FAKNGGKRSFDELEAEMLQGQKLQVHQTA---------MGYIELF  620
             +A+NGGKRSFDELEAEMLQGQKLQ   TA          G++ELF
Sbjct  241   YARNGGKRSFDELEAEMLQGQKLQGVSTASEVYEVLSHRGWLELF  285


 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA EVYEVL +RGWLELFPLFSTVHEI TG LPPSAIVEYSE  PR
Sbjct  265  GVSTASEVYEVLSHRGWLELFPLFSTVHEISTGLLPPSAIVEYSEKLPR  313



>ref|XP_002991706.1| hypothetical protein SELMODRAFT_451466 [Selaginella moellendorffii]
 gb|EFJ07277.1| hypothetical protein SELMODRAFT_451466 [Selaginella moellendorffii]
Length=404

 Score =   486 bits (1250),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 268/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVAAKLIASNT   + F DEVRMWV+EE LP+GEKLS+VIN+  ENV
Sbjct  45    RDRVAVIGSGNWGSVAAKLIASNTCCSDLFDDEVRMWVYEETLPSGEKLSQVINREKENV  104

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG++LG NV+A PDL +A  DA MLVFVTPHQF+EGIC +L G IR++A AISLIKG
Sbjct  105   KYLPGVKLGSNVVAVPDLLNAVADATMLVFVTPHQFIEGICNRLKGNIRQNAIAISLIKG  164

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK +GPCMIS LITE LGI+C VLMGANIANE+AVEKFSEATVG+R +K  A KWV++
Sbjct  165   MEVKKDGPCMISNLITELLGIDCAVLMGANIANEVAVEKFSEATVGFRHDKRAADKWVRI  224

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F  PYF+V+ VQDVEGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGL+EM+ FSK
Sbjct  225   FRRPYFLVTPVQDVEGVELCGTLKNVVAVAAGLVDGLDMGNNTKAAIMRIGLKEMRFFSK  284

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ ADAFA+N GKRSFD+LE E+LQGQKLQ 
Sbjct  285   LLFPSVRDTTFFESCGVADLITTCLGGRNRRVADAFARNKGKRSFDDLETELLQGQKLQG  344

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  345   VSTAREVYEVLRAR  358


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYEVLR R W E FPLFSTVH I TG L PSAI+EYSEHTPR
Sbjct  344  GVSTAREVYEVLRARKWEESFPLFSTVHLIATGALAPSAILEYSEHTPR  392



>ref|XP_002991027.1| hypothetical protein SELMODRAFT_132832 [Selaginella moellendorffii]
 gb|EFJ07835.1| hypothetical protein SELMODRAFT_132832 [Selaginella moellendorffii]
Length=404

 Score =   485 bits (1249),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 267/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             + RV V+GSGNWGSVAAKLIASNT   + F DEVRMWV+EE LP+GEKLS+VIN+  ENV
Sbjct  45    RDRVAVIGSGNWGSVAAKLIASNTCCSDLFDDEVRMWVYEETLPSGEKLSQVINREKENV  104

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG++LG NV+A PDL +A  DA MLVFVTPHQF+EGIC  L G IR++A AISLIKG
Sbjct  105   KYLPGVKLGSNVVAVPDLLNAVADATMLVFVTPHQFIEGICNTLKGNIRQNAIAISLIKG  164

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             MEVK +GPCMIS LITE LGI+C VLMGANIANE+AVEKFSEATVG+R +K  A KWV++
Sbjct  165   MEVKKDGPCMISNLITELLGIDCAVLMGANIANEVAVEKFSEATVGFRHDKRAADKWVRI  224

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F  PYF+V+ VQDVEGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGL+EM+ FSK
Sbjct  225   FRRPYFLVTPVQDVEGVELCGTLKNVVAVAAGLVDGLDMGNNTKAAIMRIGLKEMRFFSK  284

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ ADAFA+N GKRSFD+LE E+LQGQKLQ 
Sbjct  285   LLFPSVRDTTFFESCGVADLITTCLGGRNRRVADAFARNKGKRSFDDLETELLQGQKLQG  344

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  345   VSTAREVYEVLRAR  358


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GVSTA+EVYEVLR R W E FPLFSTVH I TG L PSAIVEYSEHTPR
Sbjct  344  GVSTAREVYEVLRARKWEESFPLFSTVHLIATGALAPSAIVEYSEHTPR  392



>ref|XP_010232867.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] isoform 
X2 [Brachypodium distachyon]
Length=324

 Score =   468 bits (1203),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 221/279 (79%), Positives = 249/279 (89%), Gaps = 0/279 (0%)
 Frame = -1

Query  1447  MWVFEEVLPTGEKLSEVINKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQ  1268
             MWVFEE LPTGEKLSE IN+ NEN KYLPGI+LG NVIADPDLE A +DA+MLVFVTPHQ
Sbjct  1     MWVFEETLPTGEKLSECINRANENCKYLPGIKLGTNVIADPDLESAVKDADMLVFVTPHQ  60

Query  1267  FMEGICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEI  1088
             F+EGICKKLVGK+R   +AISLIKGMEVKMEGPCMIS LI++ LGINCCVLMGANIANEI
Sbjct  61    FVEGICKKLVGKLRPGVQAISLIKGMEVKMEGPCMISKLISDTLGINCCVLMGANIANEI  120

Query  1087  AVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVD  908
             AVEKFSEAT+GYRE+KE A +W +LF TPYF+VS V+D+EGVELCGTLKN+VA+AAG VD
Sbjct  121   AVEKFSEATIGYREDKEAASRWAKLFTTPYFLVSVVEDIEGVELCGTLKNIVAIAAGLVD  180

Query  907   GLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADA  728
             GL+MGNNTKAAIMRIGLREM+AFSKLLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+A
Sbjct  181   GLDMGNNTKAAIMRIGLREMRAFSKLLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEA  240

Query  727   FAKNGGKRSFDELEAEMLQGQKLQVHQTAMGYIELFLPR  611
             FA+NGGKRSFDELEAEML GQKLQ   TA    E+   R
Sbjct  241   FARNGGKRSFDELEAEMLHGQKLQGVSTAREVYEVLTYR  279


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGS  291
            GVSTA+EVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  S++GGS
Sbjct  265  GVSTAREVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIIGGS  320



>ref|XP_001768070.1| predicted protein [Physcomitrella patens]
 gb|EDQ67142.1| predicted protein [Physcomitrella patens]
Length=384

 Score =   461 bits (1185),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 257/302 (85%), Gaps = 0/302 (0%)
 Frame = -1

Query  1561  DNNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             +  K R+ V+GSGNWGSVAAKL+A+N L   + HDEVRMWVFEE L  GEKL++VINK  
Sbjct  22    NTGKERIAVIGSGNWGSVAAKLVATNALSHENIHDEVRMWVFEETLANGEKLTQVINKNK  81

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
              NVKYLP + LG NV+ADP+LE+  +DA MLVF TPHQF+E ICK+L GK+  +A+AISL
Sbjct  82    INVKYLPNVNLGVNVVADPNLENTVKDATMLVFCTPHQFVESICKQLQGKVNPNAKAISL  141

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             IKGMEVK +GP M+S LIT+ LGI+C VLMGANIANE+A+E+FSEATVGY+ +  IA+ W
Sbjct  142   IKGMEVKPDGPVMLSKLITKHLGIDCSVLMGANIANEVAMEQFSEATVGYKADTSIAKSW  201

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             VQ F TPYF V+A++DVEGVELCGTLKNVVA+AAGFVDGL MGNNTKAAIMRIGL+EM  
Sbjct  202   VQAFATPYFHVAAIKDVEGVELCGTLKNVVAIAAGFVDGLGMGNNTKAAIMRIGLKEMIG  261

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             FSKLLFP+V ++TFFESCGVAD+ITTC GGRNRK A+A+A+NGGKRSFDELEAE+L GQK
Sbjct  262   FSKLLFPTVSDATFFESCGVADLITTCFGGRNRKVAEAYARNGGKRSFDELEAELLGGQK  321

Query  661   LQ  656
             LQ
Sbjct  322   LQ  323


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPR  312
            GV TA EV++VL+ R W + FPLF+TVH+I  G LPPS IV+Y   + +
Sbjct  324  GVLTAGEVFQVLKARNWEKKFPLFATVHKIAIGHLPPSTIVDYDNESAQ  372



>emb|CDJ26518.1| unnamed protein product [Triticum aestivum]
Length=334

 Score =   446 bits (1148),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 222/320 (69%), Positives = 252/320 (79%), Gaps = 41/320 (13%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV V+GSGNWGSVA++L+ASNT KL SFHDEVRMWVFEE LPTGEKLSE IN+ +EN 
Sbjct  8     KHRVAVIGSGNWGSVASRLLASNTAKLPSFHDEVRMWVFEETLPTGEKLSESINQAHENC  67

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE A +DA+MLVFVTPHQF+EGICKKLVGK+R   EAISLIKG
Sbjct  68    KYLPGIKLGTNVIADPDLESAVKDADMLVFVTPHQFVEGICKKLVGKLRPGVEAISLIKG  127

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             ME                                IAVEKFSEAT+GYRE+KE A +W +L
Sbjct  128   ME--------------------------------IAVEKFSEATIGYREDKEAANRWAKL  155

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+V+ V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  156   FTTPYFLVAIVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  215

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LLFPSV+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  216   LLFPSVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  275

Query  652   HQTA---------MGYIELF  620
               TA          G+ ELF
Sbjct  276   VSTAREVYEVLTYHGWQELF  295


 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGS  291
            GVSTA+EVYEVL Y GW ELFPL STVHEIC G+LPP++IVEYSEHTP  S VGGS
Sbjct  275  GVSTAREVYEVLTYHGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSFVGGS  330



>gb|EAY77398.1| hypothetical protein OsI_05386 [Oryza sativa Indica Group]
 gb|EAZ14989.1| hypothetical protein OsJ_04924 [Oryza sativa Japonica Group]
Length=333

 Score =   442 bits (1138),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 251/314 (80%), Gaps = 32/314 (10%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K+ V V+GSGNWGSVA++LIASNT KL SFHDEVRMWVFEE+LPTG+KLSE IN+ NEN 
Sbjct  7     KNLVAVIGSGNWGSVASRLIASNTAKLPSFHDEVRMWVFEEILPTGKKLSESINQANENC  66

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPGI+LG NVIADPDLE+A +DANMLVFVTPHQF+EGICKKLVGK+R   E ISLIKG
Sbjct  67    KYLPGIKLGANVIADPDLENAVKDANMLVFVTPHQFVEGICKKLVGKLRPGTEGISLIKG  126

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             ME                                IAVEKFSEAT+GY+++KE+A +W +L
Sbjct  127   ME--------------------------------IAVEKFSEATIGYKKDKEVATRWAKL  154

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F TPYF+VS V+D+EGVELCGTLKNVVA+AAG VDGL+MGNNTKAAIMRIGLREM+AFSK
Sbjct  155   FTTPYFLVSVVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLREMRAFSK  214

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             LL P+V+++TFFESCGVAD+ITTCLGGRNR+ A+AFA+NGGKRSFDELEAEML GQKLQ 
Sbjct  215   LLSPTVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLHGQKLQG  274

Query  652   HQTAMGYIELFLPR  611
               TA    E+   R
Sbjct  275   VSTAKEVYEVLTYR  288


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTPRFSLVGGSANYF  279
            GVSTAKEVYEVL YRGW ELFPL STVHEIC G+LPP++IVEYSEHTP  S++ GS  Y+
Sbjct  274  GVSTAKEVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIINGSNAYY  333



>gb|ABN05902.1| Peptidase S26A, signal peptidase I; NAD-dependent glycerol-3-phosphate 
dehydrogenase, C-terminal [Medicago truncatula]
Length=272

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 215/243 (88%), Gaps = 9/243 (4%)
 Frame = -1

Query  1321  LEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGMEVKMEGPCMISTLITE  1142
             +++  +DANMLVFVTPHQFMEGICK+L GKIR DAE ISL+KGMEVK EG  MISTLI+ 
Sbjct  2     VKYIVKDANMLVFVTPHQFMEGICKRLDGKIRTDAEGISLVKGMEVKKEGASMISTLISN  61

Query  1141  QLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFNTPYFMVSAVQDVEGV  962
             QL INC VLMGANIANEIA++KFSEAT+GYRENKE A++WVQLFNTPYF V++VQDVEGV
Sbjct  62    QLKINCSVLMGANIANEIAMQKFSEATIGYRENKEAAERWVQLFNTPYFNVTSVQDVEGV  121

Query  961   ELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGV  782
             E+CGTLKN+VA+AAGF+DGLEMGNNTK+AIMRIGL+EM AFSKLLFPSVK STFFESCGV
Sbjct  122   EMCGTLKNIVAIAAGFIDGLEMGNNTKSAIMRIGLKEMMAFSKLLFPSVKYSTFFESCGV  181

Query  781   ADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ-------VHQ--TAMGYI  629
             AD+ITTC+GGRNRK A A+A+NGGKRSFDELEAE+L+GQKLQ       V++  TA G++
Sbjct  182   ADLITTCMGGRNRKVAAAYARNGGKRSFDELEAELLKGQKLQGVLTAKEVYEVLTARGWV  241

Query  628   ELF  620
             E F
Sbjct  242   ERF  244


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  458  GVSTAKEVYEVLRYRGWLELFPLFSTVHEICTGRLPPSAIVEYSEHTP  315
            GV TAKEVYEVL  RGW+E FPLF+TV+EI +G LPPSAIVE++  + 
Sbjct  224  GVLTAKEVYEVLTARGWVERFPLFTTVYEISSGLLPPSAIVEFNNKSK  271



>gb|KFH66320.1| glycerol-3-phosphate dehydrogenase [NAD+] [Mortierella verticillata 
NRRL 6337]
Length=340

 Score =   350 bits (897),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 224/302 (74%), Gaps = 4/302 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V ++GSGNWGS  AK+I  N  K + F +EV+MWVFEE +  G+ L+++IN  +EN+KY
Sbjct  4     KVALIGSGNWGSAVAKIIGRNVRKFDHFDNEVKMWVFEEKV-NGQNLTDIINTKHENIKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPGIQL +NV+A PDL     DA MLVFV PHQF+  ICK+L G+I  + +AISLIKG++
Sbjct  63    LPGIQLPENVVACPDLVRTCEDATMLVFVVPHQFVTSICKQLKGRIPANCKAISLIKGID  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
             V  +G  +I+ +I + LG+  CVL GANIANE+A EKF E T+GYR N+   + +  +F+
Sbjct  123   VNADGFRLITDMIQDSLGVRSCVLSGANIANEVAEEKFCETTIGYR-NRADGELFRDIFH  181

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ V+DV GVELCG LKN+VA+  G VDGL++G+NTKAAI+RIGL EM+ FS++ 
Sbjct  182   TPSFRVNIVEDVVGVELCGALKNIVAIGGGLVDGLKLGDNTKAAIIRIGLYEMRKFSQMF  241

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQ  647
             +  VK+ TFFESCGVAD+ITTC GGRNRK A+A    G  +SFD+LE EML GQKLQ   
Sbjct  242   YADVKDETFFESCGVADLITTCAGGRNRKVAEAHVTTG--KSFDQLEQEMLNGQKLQGTS  299

Query  646   TA  641
             TA
Sbjct  300   TA  301



>gb|KFH71024.1| glycerol-3-phosphate dehydrogenase [NAD+] [Mortierella verticillata 
NRRL 6337]
Length=340

 Score =   349 bits (896),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 226/312 (72%), Gaps = 4/312 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V ++GSGNWGS  AK+I  N    + F  EV+MWV+EE +  G  L+++IN  +ENVKY
Sbjct  4     KVALIGSGNWGSAVAKIIGRNVQNFDHFKKEVKMWVYEEQVD-GMNLTDIINTKHENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPGI+L +NV+A PDL     DA MLVFV PHQF+ GICK+L GKI  + +AISLIKG++
Sbjct  63    LPGIKLPENVVACPDLIKTCEDATMLVFVVPHQFVSGICKQLKGKISANCKAISLIKGVD  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
             V  +G  +I+ +I + LGI  CVL GANIANE+A E+F E T+GYR N+   Q + ++FN
Sbjct  123   VNEDGFRLITDMIQDALGIRSCVLSGANIANEVAEEQFCETTIGYR-NQADGQLFKEIFN  181

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP+F V+ V+DV GVELCG LKN++A+  G VDGL++G+NTKAAI+RIGL EM+ FS++ 
Sbjct  182   TPFFRVNIVKDVVGVELCGALKNIIAIGGGLVDGLKLGDNTKAAIIRIGLYEMRKFSQMF  241

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQ  647
             +  VK+ TFFESCGVAD+ITTC GGRNRK A+A    G  +SFD+LE EML GQKLQ   
Sbjct  242   YKDVKDETFFESCGVADLITTCAGGRNRKVAEAHVTTG--KSFDQLEKEMLNGQKLQGTS  299

Query  646   TAMGYIELFLPR  611
             TA     +   R
Sbjct  300   TAKDMFNILSKR  311



>ref|XP_005535472.1| glycerol-3-phosphate dehydrogenase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79186.1| glycerol-3-phosphate dehydrogenase [Cyanidioschyzon merolae strain 
10D]
Length=357

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 224/305 (73%), Gaps = 3/305 (1%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNT-LKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V ++GSGNWGS  AK++ SN   K  SF  EVR+WV+EE L  G KL+E+IN  +EN
Sbjct  4     KHKVAILGSGNWGSTVAKIVGSNVKTKTESFDPEVRVWVYEE-LVDGRKLTEIINSDHEN  62

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +NV+A PD   A   A++LVFV PHQF+ G+C KL G +R+ A A+SLIK
Sbjct  63    VKYLPGKKLPENVVAVPDPIEAVAGADILVFVLPHQFVRGLCAKLRGNVREGAFAVSLIK  122

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G+E    G  +IS +I+++LG+ C VLMGANIANEIA E+FSEAT+GY+ N   A+    
Sbjct  123   GVEFDENGIVLISDVISKELGVECSVLMGANIANEIADEQFSEATIGYK-NAAHAKLLQI  181

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +F  PYF ++   D+ GVE+CG LKNVVAL AGF DGL  GNNTKAA++R GL EM  F+
Sbjct  182   IFQKPYFRIAGAPDIPGVEICGALKNVVALGAGFCDGLGYGNNTKAAVIRFGLLEMVRFA  241

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K  F +V+ +TF +S GVAD+ITTC GGRNRKCA+AFA+ GG++SF+ELE E+L GQKLQ
Sbjct  242   KKFFKNVQYTTFLQSSGVADLITTCYGGRNRKCAEAFARAGGRKSFEELEVELLNGQKLQ  301

Query  655   VHQTA  641
                TA
Sbjct  302   GTLTA  306



>ref|XP_006676005.1| hypothetical protein BATDEDRAFT_84716 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83177.1| hypothetical protein BATDEDRAFT_84716 [Batrachochytrium dendrobatidis 
JAM81]
Length=340

 Score =   343 bits (879),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 230/315 (73%), Gaps = 9/315 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV ++GSGNWGS  AK++  N +K  +FH EVRMWVFEE++ +G++LS +IN T+ENVKY
Sbjct  3     RVALIGSGNWGSAIAKIVGRNIIKQPNFHKEVRMWVFEEIV-SGQRLSHIINSTHENVKY  61

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LP I+L +NV+A P+L  +   A +LVFV PHQF++G+C +L  KI  +A AISLIKG++
Sbjct  62    LPNIKLPENVVAVPELLKSVEGATLLVFVIPHQFVKGVCDQLKDKISINARAISLIKGVD  121

Query  1186  VK-MEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGY--RENKEIAQKWVQ  1016
                  G  ++S +I + L I+  VLMGANIA+E+A E F E+T+GY  +EN ++ QK   
Sbjct  122   AGGSSGLSLVSDIIRDSLKIDVSVLMGANIASEVAQENFCESTIGYSIKENADVFQK---  178

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +FNTPYF ++ VQDV GVELCG LKNVVA+AAG VDGL+ G NTKAAI+RIGL EMK F+
Sbjct  179   IFNTPYFRINCVQDVAGVELCGALKNVVAIAAGLVDGLKCGENTKAAIIRIGLLEMKKFA  238

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K  +  +K+ TFFESCG+ADVITTC GGRNR+ A+A    G  +SF+ LE EML GQKLQ
Sbjct  239   KTFYEGIKDETFFESCGIADVITTCFGGRNRRLAEARVLTG--KSFEMLEEEMLNGQKLQ  296

Query  655   VHQTAMGYIELFLPR  611
                T+    E+ + R
Sbjct  297   GSLTSRDIHEILVHR  311



>dbj|GAC99292.1| glycerol-3-phosphate dehydrogenase NAD+ [Pseudozyma hubeiensis 
SY62]
Length=357

 Score =   340 bits (871),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 228/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT +  ++F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  13    KHKVVIVGSGNWGSAIARIAGQNTQRHSDTFEREVQMYVFEEDY-KGKPLSQVINETHEN  71

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG QL +NV+A+PD   A +DA +LVFV PHQF+  +CK+L GK+  DA AIS+IK
Sbjct  72    PKYLPGCQLPENVVANPDPVDAVKDATLLVFVLPHQFIRSVCKQLKGKVSADAHAISMIK  131

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LG++C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  132   GVEVKDGKISIFADVIQESLGVSCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  191

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  192   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  251

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  252   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  309

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  310   QKLQGTETAREVHELLAAR  328



>ref|XP_005825533.1| hypothetical protein GUITHDRAFT_115328 [Guillardia theta CCMP2712]
 gb|EKX38553.1| hypothetical protein GUITHDRAFT_115328 [Guillardia theta CCMP2712]
Length=380

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 221/302 (73%), Gaps = 7/302 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K RV +VGSGNWG   AK++ +N        DEVRMWVFEE++  G KL+++IN+ +ENV
Sbjct  2     KKRVAIVGSGNWGCAIAKIVGNNCTHHPHLEDEVRMWVFEEMV-KGRKLTDIINEEHENV  60

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KY+PG++L  NVIADPD+  A R AN+L+FV PHQF+ G+CKK+ G   +D  A+SLIKG
Sbjct  61    KYMPGVKLPTNVIADPDVVSATRGANVLIFVLPHQFLGGLCKKIKGNHAQDCIAVSLIKG  120

Query  1192  MEVKMEGPCMISTLITEQL-GINCCVLMGANIANEIAVEKFSEATVGY--RENKEIAQKW  1022
             +    +G  +IS +I E L G++  VLMGAN+A E+A   F E T+GY   EN ++    
Sbjct  121   VHFDSKGMVLISDMIKEGLNGMDVSVLMGANLAKEVAGGAFCETTIGYNVEENGKLLH--  178

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
               +FN P F V+ + DV GVE+CG LKN+VAL AGF DG+ +G+N+KAAI+RIGL EMK 
Sbjct  179   -TIFNDPLFHVTIINDVPGVEICGALKNIVALGAGFTDGMGLGDNSKAAIIRIGLMEMKK  237

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F +  +PSVK++TFFESCGVAD+I TC GGRNR+CA+AF K GG++SF+ELE E+L GQK
Sbjct  238   FIQSRYPSVKDATFFESCGVADLIVTCYGGRNRRCAEAFVKAGGRKSFEELERELLNGQK  297

Query  661   LQ  656
             LQ
Sbjct  298   LQ  299



>emb|CDI51478.1| probable glycerol-3-phosphate dehydrogenase (NAD) [Melanopsichium 
pennsylvanicum 4]
Length=360

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 226/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  16    KHKVVIVGSGNWGSAIARIAGQNTQRHSDIFEREVQMYVFEEDY-KGKPLSQVINETHEN  74

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG QL +NV A+P    A +DA MLVFV PHQF+  ICK+L GKI  DA AIS+IK
Sbjct  75    PKYLPGCQLPENVNANPSPVDAVKDATMLVFVLPHQFIRSICKQLKGKINPDAHAISMIK  134

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LG++C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  135   GVEVKDGKISIFADVIQETLGVSCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  194

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGLE G+N KAA+MRIGL EMK
Sbjct  195   FYKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLEWGDNAKAAVMRIGLMEMK  254

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  +K  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  255   RFSEEFFEGIKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  312

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  313   QKLQGTETAREVHELLAAR  331



>ref|XP_004340799.1| glycerol-3-phosphate dehydrogenase family protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18747.1| glycerol-3-phosphate dehydrogenase family protein [Acanthamoeba 
castellanii str. Neff]
Length=375

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 217/305 (71%), Gaps = 4/305 (1%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V ++GSGNWGS  AK++  N  +    F DEVRM+V+EE++     L+ +IN  +EN
Sbjct  2     KHKVAILGSGNWGSAIAKVVGQNVRQHPELFEDEVRMYVYEELVDGERYLTSIINTNHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG++L  N++ADPD    A DA +L+FV PHQF+  +C KL GK+   A+AISLIK
Sbjct  62    VKYLPGVKLPDNIVADPDPIRTAEDATLLIFVLPHQFVNSLCHKLKGKLHHRAKAISLIK  121

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             GM    +GP +IS++I + LGI+  VL GANIA ++A E FSE TVGY++ KE+AQ W Q
Sbjct  122   GMAFNEKGPVLISSIIEDILGIDVSVLCGANIAKDVAWEHFSETTVGYKD-KEVAQVWKQ  180

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +F++P F V  V+D+ GVELCG LKN++A+  G  DGL  G NTKAAIMRIGL EM+ F+
Sbjct  181   VFHSPSFNVGLVEDIAGVELCGALKNIIAVGLGMADGLGAGANTKAAIMRIGLAEMRRFA  240

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +  F  VK+ TFFESCGVAD+I TC  GRNRK A AF K   K+SF++LE EML GQKLQ
Sbjct  241   ETFFKGVKQETFFESCGVADLIVTCFFGRNRKVAAAFVKQ--KKSFEQLEKEMLHGQKLQ  298

Query  655   VHQTA  641
                TA
Sbjct  299   GTLTA  303



>gb|EST06489.1| glycerol-3-phosphate dehydrogenase [Pseudozyma brasiliensis GHG001]
Length=357

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  FH EV+M+VFEE    G  LS+VIN+T+EN
Sbjct  13    KHKVAIVGSGNWGSAIARIAGQNTQRHSDVFHPEVQMYVFEEDY-KGTPLSKVINETHEN  71

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG  L +NV+A+PD   A + A MLVFV PHQF+  +CK+L GK+  +A AIS+IK
Sbjct  72    PKYLPGCALPENVVANPDPVDAVKGATMLVFVLPHQFIHSVCKQLAGKVDPNAHAISMIK  131

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LGI+C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  132   GVEVKNGKISIFADVIQEALGISCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  191

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  192   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  251

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  252   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  309

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  310   QKLQGTETAREVHELLAAR  328



>emb|CCF48500.1| probable glycerol-3-phosphate dehydrogenase (NAD) [Ustilago hordei]
Length=361

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  17    KHQVAIVGSGNWGSAIARIAGQNTQRHSDIFESEVQMYVFEEDY-NGKPLSQVINETHEN  75

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG +L +NVIA+P    A + A MLVFV PHQF+ G+CK+L GKI  DA AIS+IK
Sbjct  76    PKYLPGCKLPENVIANPSPIDAVKGATMLVFVLPHQFIRGVCKQLQGKISPDAHAISMIK  135

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + S +I E LG++C  L GANIANE+A +KFSE T+G+R +   +E A  
Sbjct  136   GVEVKDGKISIFSDVIQEALGVSCSALSGANIANEVAQDKFSETTIGHRADAKGRENANL  195

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  196   FSKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  255

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  +K  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  256   RFSEEFFEGIKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  313

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  314   QKLQGTETAREVHELLAAR  332



>gb|ETS63800.1| hypothetical protein PaG_02118 [Pseudozyma aphidis DSM 70725]
Length=360

 Score =   335 bits (858),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  16    KHKVAIVGSGNWGSAIARIAGHNTQRHSDIFEHEVQMYVFEEDY-KGKPLSQVINETHEN  74

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG QL  NV+A+P    A +DA MLVFV PHQF+  +CK+L GK+  +A AIS+IK
Sbjct  75    PKYLPGCQLPDNVVANPSPVDAVKDATMLVFVLPHQFIRSVCKQLKGKVDPNAHAISMIK  134

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LGI+C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  135   GVEVKDGKISIFADVIQEALGISCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  194

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  195   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  254

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  255   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  312

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  313   QKLQGTETAREVHELLAAR  331



>dbj|GAC73796.1| glycerol-3-phosphate dehydrogenase [Pseudozyma antarctica T-34]
Length=421

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  77    KHKVAIVGSGNWGSAIARIAGHNTQRHSDIFEHEVQMYVFEEDY-KGKPLSQVINETHEN  135

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG QL  NV+A+P    A +DA MLVFV PHQF+  +CK+L GK+  +A AIS+IK
Sbjct  136   PKYLPGCQLPDNVVANPSPVDAVKDATMLVFVLPHQFIRSVCKQLKGKVDPNAHAISMIK  195

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LGI+C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  196   GVEVKDGKISIFADVIQEALGISCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  255

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  256   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  315

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  316   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  373

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  374   QKLQGTETAREVHELLAAR  392



>ref|XP_002948394.1| hypothetical protein VOLCADRAFT_57957 [Volvox carteri f. nagariensis]
 gb|EFJ50801.1| hypothetical protein VOLCADRAFT_57957 [Volvox carteri f. nagariensis]
Length=428

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 220/305 (72%), Gaps = 8/305 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTL---KLNSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             + RV ++GSG W   A +++A NTL     ++F DE++MWV+EE    G KL+EVIN+T+
Sbjct  65    RYRVAMIGSGAWACAAVRMMAQNTLAHDPADNFTDEIKMWVYEEEY-EGRKLTEVINETH  123

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             EN KY PG  LG NV A P ++ A  DA+++VF  PHQFM  ICK+L+GK++  A AISL
Sbjct  124   ENPKYFPGFDLGSNVRAVPSIDEAVADADLIVFCAPHQFMHSICKQLIGKVKPGASAISL  183

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
              KGM V+ EGP +IS ++   LGI+C VLMGANIA +I  E+ SEA +GY +N + A+++
Sbjct  184   TKGMRVRPEGPQLISQMVRRNLGIDCAVLMGANIATDIGREQLSEAVIGY-DNLDSAERF  242

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
              +LF  PYF VS + D  G E+CGTLKN+VAL AG VDGL +G N+KA I+R GL EM+A
Sbjct  243   KKLFERPYFRVSLLPDPVGAEMCGTLKNIVALGAGVVDGLGLGPNSKATIIRQGLVEMRA  302

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAK---NGGKRSFDELEAEMLQ  671
             FSK L+PSV++ TF + CGV D++ TC GGRNR  A+A+ +   +G  R+F+ELEAE+L+
Sbjct  303   FSKALYPSVRDDTFLDCCGVGDLVATCYGGRNRLVAEAWTRAQMSGTPRTFEELEAELLR  362

Query  670   GQKLQ  656
             GQKLQ
Sbjct  363   GQKLQ  367



>gb|ESA19971.1| hypothetical protein GLOINDRAFT_343845 [Rhizophagus irregularis 
DAOM 181602]
Length=342

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 222/305 (73%), Gaps = 6/305 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGE-KLSEVINKTNEN  1376
             K +V V+GSGNWG+V AK++ +N ++ + F  E++MWVFEE++  GE KL+++IN+ +EN
Sbjct  3     KEKVAVIGSGNWGTVVAKILGTNVVQQSGFEHEIKMWVFEEMI--GERKLTDLINEKHEN  60

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG+ + +NV+A PD+  AA+ A +LV V PHQF+ G+C KL G +    +AISL+K
Sbjct  61    VKYLPGVSIPENVVAVPDVVEAAKGATILVIVIPHQFVNGVCDKLKGNVHPKVKAISLVK  120

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G      G   IS LI E L I+ C L GAN+ANEIA EKFSE T+GY+ N+   + + +
Sbjct  121   GFYTTESGIRPISHLIKEALKISVCTLSGANLANEIAQEKFSETTIGYK-NRHEGKLFKR  179

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF T YF V+ V DV GVELCG LKNV+A+ AG +DGL++G NTKAAI+RIGL EMK + 
Sbjct  180   LFETKYFKVNIVDDVLGVELCGALKNVIAIGAGMIDGLKLGENTKAAIIRIGLLEMKKYI  239

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             K+ +  +K+ TFFESCG+ADVITTC GGRNRK A+AF   G  +SF++LE E+L GQKLQ
Sbjct  240   KMFYKGIKDETFFESCGIADVITTCYGGRNRKAAEAFIVTG--KSFEQLEKELLNGQKLQ  297

Query  655   VHQTA  641
                TA
Sbjct  298   GTLTA  302



>emb|CBQ67968.1| probable glycerol-3-phosphate dehydrogenase (NAD) [Sporisorium 
reilianum SRZ2]
Length=361

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 223/319 (70%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLK-LNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V ++GSGNWGS  A++   NT +  ++F  +V+M+VFEE    G+ LS+VIN+T+EN
Sbjct  17    KHKVAIIGSGNWGSAIARIAGQNTQRHTDTFERQVQMYVFEEDY-NGKPLSQVINETHEN  75

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG  L  NV+A+P    AARDA MLVFV PHQF+  +CK+L G++  DA AIS+IK
Sbjct  76    PKYLPGCALPDNVVANPSAVDAARDATMLVFVLPHQFIRSVCKQLQGQVSPDAHAISMIK  135

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EV      + + +I E LG++C  L GANIANE+A +KFSE T+G+R +    E A  
Sbjct  136   GVEVTDGKISIFADVIQEALGVSCSALSGANIANEVAQDKFSETTIGHRPDAKGHENAHL  195

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  196   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  255

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  256   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  313

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  314   QKLQGTETAREVHELLAAR  332



>gb|ABX56138.1| glycerol-3-phosphate dehydrogenase [Triatoma infestans]
Length=358

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 221/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V++VGSGNWGS  AK+I +N + L  F +EV+M+V+EE L  G+KL+E+IN T+ENVKY
Sbjct  5     KVSIVGSGNWGSAIAKIIGANVVNLKEFDNEVKMYVYEE-LVDGKKLTEIINTTHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A PDL +AA DA+ LVFV PHQF+EGICK LVGKI+  A  +SLIKG E
Sbjct  64    LPGHKLPENVVAVPDLVNAACDADFLVFVVPHQFVEGICKSLVGKIKSSAVGLSLIKGFE  123

Query  1186  VKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGY--RENKEIAQKWVQ  1016
              K  G   +IS++I   L I+ CVLMGANIA+E+A  KF E T+G   ++N E+  K ++
Sbjct  124   KKEGGGIELISSVIKRNLNIDVCVLMGANIASEVASGKFCETTIGCVDKKNAELLHKLIE  183

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
                T YF V  VQDV  VELCG LKN+VA AAGF+DGL  G NTKAAI+RIGL EM  F 
Sbjct  184   ---TDYFRVKVVQDVNTVELCGALKNIVAPAAGFIDGLGYGENTKAAIIRIGLMEMINFI  240

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
                +P  K +T+FESCG+AD+ITTC GGRNR+ A+ F   G  +SFDELE E+L GQKLQ
Sbjct  241   DYFYPKSKVTTYFESCGIADLITTCYGGRNRRLAEQFVITG--KSFDELEKELLNGQKLQ  298

Query  655   VHQTA  641
                TA
Sbjct  299   GPITA  303



>ref|XP_756702.1| hypothetical protein UM00555.1 [Ustilago maydis 521]
 gb|EAK81204.1| hypothetical protein UM00555.1 [Ustilago maydis 521]
Length=356

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 226/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT +  ++F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  12    KHKVVIVGSGNWGSAIARIAGQNTQRHSDTFQREVQMYVFEEDY-NGKPLSQVINETHEN  70

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG +L  NVIA+P+   A +DA +LVFV PHQF+  +CK+L G +  DA AIS+IK
Sbjct  71    PKYLPGCKLPDNVIANPNPVDAVKDATLLVFVLPHQFIRSVCKQLKGHVNPDAHAISMIK  130

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LG++C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  131   GVEVKDGKISIFADVIQEALGVSCSALSGANIANEVAQDKFSETTIGHRPDAKGRENAEL  190

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  191   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  250

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  +K  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  251   RFSEEFFEGIKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  308

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  309   QKLQGTETAREVHELLAAR  327



>gb|ABX56137.1| glycerol-3-phosphate dehydrogenase [Triatoma infestans]
Length=355

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 219/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V++VGSGNWGS  AK+I +N + L  F +EV+M+V+EE L  G+KL+E+IN T+ENVKY
Sbjct  5     KVSIVGSGNWGSAIAKIIGANVVNLKEFDNEVKMYVYEE-LVDGKKLTEIINTTHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A PDL +AA DA+ LVFV PHQF+EGICK LVGKI+  A  +SLIKG E
Sbjct  64    LPGHKLPENVVAVPDLVNAACDADFLVFVVPHQFVEGICKSLVGKIKSSAVGLSLIKGFE  123

Query  1186  VKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
              K  G   +IS++I   L I+ CVLMGANIA+E+A  KF E T+G  + K  A+   +L 
Sbjct  124   KKEGGGIELISSVIKRNLNIDVCVLMGANIASEVASGKFCETTIGCVDKKN-AELLHKLI  182

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
              T YF V  VQDV  VELCG LKN+VA AAGF+DGL  G NTKAAI+RIGL EM  F   
Sbjct  183   ETDYFRVKVVQDVNTVELCGALKNIVAPAAGFIDGLGYGENTKAAIIRIGLMEMINFIDY  242

Query  829   LFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
              +P  K +T+FESCG+AD+ITTC GGRNR+ A+ F   G  +SFDELE E+L GQKLQ  
Sbjct  243   FYPKSKVTTYFESCGIADLITTCYGGRNRRLAEQFVITG--KSFDELEKELLNGQKLQGP  300

Query  649   QTA  641
              TA
Sbjct  301   ITA  303



>gb|EPB92754.1| glycerol-3-phosphate dehydrogenase [NAD+] [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=342

 Score =   332 bits (852),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 221/305 (72%), Gaps = 5/305 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K RV V+GSGNWGS   K+IA N LK +  F  EVR WVFEE    GEKL++VIN+  EN
Sbjct  3     KERVCVIGSGNWGSAVGKIIAENVLKHSEIFEPEVRQWVFEEDF-KGEKLTDVINREREN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPGI+   N+ A PDL  A+RDA++LVFV PHQF+ G+C+K+   I  +A+AISLIK
Sbjct  62    PKYLPGIKFTPNIKAVPDLVDASRDASVLVFVLPHQFVRGVCEKMKEAIAPNAKAISLIK  121

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G+E+  EG  + S  I+ +LGIN   L GANIA+E+A+E+F E T+G R ++E  + + +
Sbjct  122   GLEITPEGVTLFSEEISRKLGINVAALSGANIADEVALERFCETTIGSR-SEEDGELFFK  180

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LFNT YF V+ ++D  GVELCG LKNVVA+ AG  DGL  G+NTKAAI+R+GL EM+ F 
Sbjct  181   LFNTNYFHVNVIRDYVGVELCGALKNVVAVGAGISDGLGYGSNTKAAIIRLGLMEMRKFG  240

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +  F +V+++TFFESCGVAD+ITTC GGRNRK A+AFAK G  +  D LE +ML GQKLQ
Sbjct  241   QTFFGTVEDTTFFESCGVADLITTCSGGRNRKVAEAFAKTG--KPIDVLEKQMLNGQKLQ  298

Query  655   VHQTA  641
                TA
Sbjct  299   GTLTA  303



>gb|EWM29423.1| glycerol-3-phosphate dehydrogenase 1-like protein [Nannochloropsis 
gaditana]
Length=402

 Score =   333 bits (855),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 172/314 (55%), Positives = 220/314 (70%), Gaps = 7/314 (2%)
 Frame = -1

Query  1564  PDNNKSR---VTVVGSGNWGSVAAKLIASNTLK-LNSFHDEVRMWVFEEVLPTGEKLSEV  1397
             P +N  +   +T+VGSGN+GS  A+L+  N L+    F  EVRMWVFEE L  G KLS+V
Sbjct  49    PSSNPVKPHSITIVGSGNFGSAIARLLGRNVLRSPKHFRSEVRMWVFEEELDDGRKLSDV  108

Query  1396  INKTNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDA  1217
             IN  +ENVKYLPGIQL  NV A PDL  A R+A+++VFV PHQF+ G+  ++   + + A
Sbjct  109   INADHENVKYLPGIQLPTNVRAVPDLSDAVRNASIVVFVLPHQFLPGLLPRISSCLHRGA  168

Query  1216  EAISLIKGMEVKMEGPCMISTLITEQLGINC---CVLMGANIANEIAVEKFSEATVGYRE  1046
              A+SL+KG++   EGP +I+ +I E LG +    CVLMGAN+A+E+A ++F EAT+G  +
Sbjct  169   MAVSLVKGLDFDDEGPVLITDMIREGLGEDVSEVCVLMGANVADEMARDEFCEATLGCPD  228

Query  1045  NKEIAQKWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMR  866
              +       QLF+ P F V    D  GVELCG LKNVVALAAGF DGL+ G NTKAAI+R
Sbjct  229   PEGAGAVLQQLFDCPTFRVEVTPDPIGVELCGALKNVVALAAGFCDGLDWGGNTKAAIIR  288

Query  865   IGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELE  686
              GL EM+ F KLL PSV++ TFFESCGVAD+ITTC GGRNRKCA+ FA+ GG  ++DE+E
Sbjct  289   RGLEEMRLFCKLLHPSVRDMTFFESCGVADLITTCYGGRNRKCAETFARAGGTMAWDEIE  348

Query  685   AEMLQGQKLQVHQT  644
              E L GQ LQ  QT
Sbjct  349   KEELGGQHLQGPQT  362



>ref|XP_005820695.1| hypothetical protein GUITHDRAFT_81199 [Guillardia theta CCMP2712]
 gb|EKX33715.1| hypothetical protein GUITHDRAFT_81199 [Guillardia theta CCMP2712]
Length=363

 Score =   332 bits (851),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 163/316 (52%), Positives = 228/316 (72%), Gaps = 7/316 (2%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             + + +V +VGSG WGS  A++I  N  +L++FH  V+ WVFEE +  G KL+++IN+ +E
Sbjct  8     DQRKQVAIVGSGAWGSAIARIIGRNCQRLDTFHSTVKQWVFEETV-NGRKLTDIINQDHE  66

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KY+PG +L  NV+ADPD+  A +DA++L+FV PHQF+ G+C+K+   +      ISLI
Sbjct  67    NPKYMPGQKLPHNVVADPDICSATKDADILIFVLPHQFLNGLCEKIKASVAPGCIGISLI  126

Query  1198  KGMEVKMEGPCMISTLITEQLG-INCCVLMGANIANEIAVEKFSEATVGYRE--NKEIAQ  1028
             KG+    +G  +IS +I E +G ++  VLMGAN+A E+A  +F EAT+G R+  N  + Q
Sbjct  127   KGVHFDEQGMVLISDMIKEGMGGMDMSVLMGANLAPEVAAGQFCEATIGCRDETNGTLLQ  186

Query  1027  KWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM  848
                 LF+ P F V+  +DV GVE+CG LKNVVAL AGFVDG+ +G+NTKAAI+RIG+ EM
Sbjct  187   ---SLFHDPNFHVAVRKDVPGVEICGALKNVVALGAGFVDGMGLGDNTKAAIIRIGMMEM  243

Query  847   KAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
             K F +  +P V+++TFFESCGVAD+I TC GGRNRKCA+AF K GGK+SFDELEAE+L G
Sbjct  244   KRFIQSHYPEVEDATFFESCGVADLIVTCYGGRNRKCAEAFVKAGGKKSFDELEAELLNG  303

Query  667   QKLQVHQTAMGYIELF  620
             QK+Q   TA+  +++ 
Sbjct  304   QKIQGTGTAVEVVKIL  319



>ref|XP_001702598.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06377.1| predicted protein [Chlamydomonas reinhardtii]
Length=348

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 218/304 (72%), Gaps = 6/304 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLN-SFHDEVRMWVFEE---VLPTG-EKLSEVINK  1388
             +  V +VGSG W   A ++IA NT  ++ SF DEVRMWV+EE   V P G +KL+EVIN+
Sbjct  3     RYSVAMVGSGAWACAAVRMIAQNTQVVSQSFVDEVRMWVYEEDFEVRPWGGKKLTEVINQ  62

Query  1387  TNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAI  1208
             T+ N KY PG  LG NV+A P++  A  DA+++VF  PHQF+  ICK+LVGKI+  A AI
Sbjct  63    THTNPKYFPGFDLGPNVVAVPNIVDAVADADLIVFCAPHQFLHHICKQLVGKIKPGAAAI  122

Query  1207  SLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQ  1028
             SL KGM V+ EGP +IS ++   LGI+CCVLMGANIA +I  E+ SEA +GY +N + A 
Sbjct  123   SLTKGMRVRPEGPQLISQMVRRLLGIDCCVLMGANIATDIGREQLSEAVIGY-DNLDAAT  181

Query  1027  KWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM  848
              + ++F  PYF V+ + D  G E+CGTLKN+VAL AG VDGL +G N+KAAI+R GL EM
Sbjct  182   LFQKIFQRPYFRVNLLPDPVGAEMCGTLKNIVALGAGMVDGLGLGPNSKAAIIRQGLVEM  241

Query  847   KAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
             +AFSK L+PSV++ TF ESCGV D++ TC GGRNR  A  + K    R+F++LE ++L+G
Sbjct  242   RAFSKALYPSVRDDTFMESCGVGDLVATCYGGRNRLVACEWTKAQMPRTFEDLETDLLKG  301

Query  667   QKLQ  656
             QKLQ
Sbjct  302   QKLQ  305



>emb|CDH53061.1| glycerol-3-phosphate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=346

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 214/316 (68%), Gaps = 6/316 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             NK RV+++GSGNWGS   K+I  N LK  + F  EVR WVFEE    GEKL+ +IN+ +E
Sbjct  7     NKERVSIIGSGNWGSAVGKIIGQNVLKHKDVFDTEVRQWVFEETF-QGEKLTTLINRDHE  65

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPGI+   N+ A PDL  A RDA +LVFV PHQF+  +C+ L GKI  +A AISLI
Sbjct  66    NPKYLPGIKFTDNIKATPDLLEACRDATVLVFVLPHQFVREVCEDLAGKISPNARAISLI  125

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG+E+K +   + S  I ++LG+    L GANIA+E+A EKF E T+G     E    + 
Sbjct  126   KGLEIKPDQVVLFSEEIAKRLGLRVAALSGANIADEVAQEKFCETTIGC--TSEDGDLFF  183

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LFNTPYF V+ +QD  GV+LCG LKNVVA+ AGF DGL  G+NTKAAI+R GL EM+ F
Sbjct  184   KLFNTPYFRVNVIQDAVGVQLCGALKNVVAVGAGFSDGLGYGSNTKAAIIRRGLLEMRKF  243

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
              +  F +V+  TFFESCGVAD+ITTC GGRNR+ A+AF K G  +  D LE E+L GQKL
Sbjct  244   GQTFFGTVENETFFESCGVADLITTCAGGRNRRVAEAFVKTG--KPIDVLEQELLHGQKL  301

Query  658   QVHQTAMGYIELFLPR  611
             Q   TA    +   PR
Sbjct  302   QGTLTAKEVHDFLAPR  317



>ref|XP_567088.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_567089.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_778104.1| hypothetical protein CNBA1070 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL23457.1| hypothetical protein CNBA1070 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41269.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
 gb|AAW41270.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=344

 Score =   327 bits (837),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 217/307 (71%), Gaps = 7/307 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRM--WVFEEVLPTGEKLSEVINKTNE  1379
             K +V VVGSGNWGS  +++   NT K     D+ R+  WV+EE    G+KL+E+IN  +E
Sbjct  3     KEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYEEEFE-GKKLTEIINSEHE  61

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPG++L  NV+A PDL+ A +DA  LVFVTPHQF+  +   L G +RKDA+AI+LI
Sbjct  62    NRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGKVLDTLEGNVRKDAKAITLI  121

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG+EV+ +   + + +I ++LGI C  L GANIANE+A + FSE T+GYR NKE  + W+
Sbjct  122   KGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVARDTFSETTIGYR-NKEDGELWL  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LF TP F V  + DV GV LCG LKN+VA+AAGF+DGL  G+N+KAAIMRIGL EMK F
Sbjct  181   KLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDGLGYGSNSKAAIMRIGLLEMKHF  240

Query  838   SKLLFPSVKESTFF-ESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              +  F  VKE +F  ES GV+DVIT+CL GRN K A AF   G  +SFD+LEAEML GQK
Sbjct  241   CQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVAAAFV--GANKSFDQLEAEMLNGQK  298

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  299   LQGIHTA  305



>ref|XP_003191980.1| glycerol-3-phosphate dehydrogenase (NAD+) [Cryptococcus gattii 
WM276]
 gb|ADV20193.1| Glycerol-3-phosphate dehydrogenase (NAD+) [Cryptococcus gattii 
WM276]
Length=344

 Score =   326 bits (836),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 216/307 (70%), Gaps = 7/307 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRM--WVFEEVLPTGEKLSEVINKTNE  1379
             K +V +VGSGNWGS  A+L   NT K     D+ R+  WV+EE    G+KL+EVIN  +E
Sbjct  3     KEKVAIVGSGNWGSAIARLAGMNTRKHPDVFDDSRIAVWVYEEEFE-GKKLTEVINSEHE  61

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPG++L  NV+A PDL+ A +DA  L+FVTPHQF+      L G +RKDA+AISLI
Sbjct  62    NRKYLPGVKLEDNVVAIPDLKEAVKDATALIFVTPHQFLGRALDTLEGNVRKDAKAISLI  121

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG++V  +   + + +I ++LGI C  L GANIANE+A + FSE T+GYR NKE  + W+
Sbjct  122   KGVDVHGDDIHIFADVIEQRLGIPCSALSGANIANEVARDTFSETTIGYR-NKEDGELWL  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LF TP F V  ++DV GV LCG LKN+VA+AAGFVDGL  G+N+KAAIMRIGL EMK F
Sbjct  181   KLFQTPKFKVQLIEDVAGVSLCGALKNIVAVAAGFVDGLGYGSNSKAAIMRIGLLEMKHF  240

Query  838   SKLLFPSVKESTFF-ESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              +  F  VKE +F  ES GV+DVIT+CL GRN K A AF   G  +SFD+LE+EML GQK
Sbjct  241   CQEFFTDVKEESFLQESAGVSDVITSCLAGRNYKVAAAFV--GANKSFDQLESEMLNGQK  298

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  299   LQGIHTA  305



>dbj|GAK62099.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Pseudozyma 
antarctica]
Length=638

 Score =   335 bits (860),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V +VGSGNWGS  A++   NT + +  F  EV+M+VFEE    G+ LS+VIN+T+EN
Sbjct  294   KHKVAIVGSGNWGSAIARIAGQNTQRHSDIFEHEVQMYVFEEDY-KGKPLSQVINETHEN  352

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPG QL  NV+A+P    A +DA MLVFV PHQF+  +CK+L GK+  +A AIS+IK
Sbjct  353   PKYLPGCQLPDNVVANPSPVDAVKDATMLVFVLPHQFIRSVCKQLKGKVDPNAHAISMIK  412

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYREN---KEIAQK  1025
             G+EVK     + + +I E LGI+C  L GANIANE+A +KFSE T+G+R +   +E A+ 
Sbjct  413   GVEVKDGKISIFADVIQEALGISCSALSGANIANEVAQDKFSETTIGHRADAKGRENAEL  472

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             + +LF+TP F V  ++DV GV LCG LKNVVA+AAGF DGL  G+N KAA+MRIGL EMK
Sbjct  473   FFKLFDTPTFKVGIIEDVAGVSLCGALKNVVAIAAGFTDGLGWGDNAKAAVMRIGLMEMK  532

Query  844   AFSKLLFPSVKESTFFE-SCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
              FS+  F  VK  TF E S GVAD+ITTCLGGRNRKCA+AF K G  + FD+LE E+L G
Sbjct  533   RFSEEFFDGVKPETFTETSAGVADLITTCLGGRNRKCAEAFVKTG--KPFDQLEKELLNG  590

Query  667   QKLQVHQTAMGYIELFLPR  611
             QKLQ  +TA    EL   R
Sbjct  591   QKLQGTETAREVHELLAAR  609



>gb|KGB74596.1| Gpd1 protein [Cryptococcus gattii R265]
Length=344

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 216/307 (70%), Gaps = 7/307 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRM--WVFEEVLPTGEKLSEVINKTNE  1379
             K +V +VGSGNWGS  A+L   NT K     D+ R+  WV+EE    G+KL+EVIN  +E
Sbjct  3     KEKVAIVGSGNWGSAIARLAGMNTKKHPDVFDDSRVAVWVYEEEFE-GKKLTEVINSEHE  61

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPG++L  NV+A PDL+ A +DA  L+FVTPHQF+      L G +RKDA+AISLI
Sbjct  62    NRKYLPGVKLEDNVVAIPDLKEAVKDATALIFVTPHQFLGKALDSLEGNVRKDAKAISLI  121

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG++V  +   + + +I ++LGI C  L GANIANE+A + FSE T+GYR NKE  + W+
Sbjct  122   KGVDVHGDDIHIFADVIEQRLGIPCSALSGANIANEVARDTFSETTIGYR-NKEDGELWL  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LF TP F V  ++DV GV LCG LKN+VA+AAGFVDGL  G+N+KAAIMRIGL EMK F
Sbjct  181   KLFQTPNFKVQLIEDVAGVSLCGALKNIVAVAAGFVDGLGYGSNSKAAIMRIGLLEMKHF  240

Query  838   SKLLFPSVKESTFF-ESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              +  F  VKE +F  ES GV+DVIT+CL GRN K A AF   G  +SFD+LE+EML GQK
Sbjct  241   CQEFFTDVKEESFLQESAGVSDVITSCLAGRNYKVAAAFV--GANKSFDQLESEMLNGQK  298

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  299   LQGIHTA  305



>gb|AFR92257.1| glycerol-3-phosphate dehydrogenase (NAD( )) [Cryptococcus neoformans 
var. grubii H99]
Length=344

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 216/307 (70%), Gaps = 7/307 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRM--WVFEEVLPTGEKLSEVINKTNE  1379
             K +V VVGSGNWGS  ++L   NT K +   D+ R+  WV+EE    G+KL+E+IN  +E
Sbjct  3     KEKVAVVGSGNWGSAISRLAGMNTKKHSDVFDDSRVSVWVYEEEFE-GKKLTEIINSEHE  61

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPG++   NV+A PDL+ A +DA  LVFVTPHQF+  +   L G +RKDA+AI+LI
Sbjct  62    NRKYLPGVKFEDNVVAIPDLKEAVKDATALVFVTPHQFLGKVLDTLEGNVRKDAKAITLI  121

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG++V  +   + + LI ++LGI C  L GANIANE+A + FSE T+GYR NKE  + W+
Sbjct  122   KGIDVHGDDIHIFADLIEQRLGIPCSALSGANIANEVARDTFSETTIGYR-NKEDGELWL  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             +LF TP F V  + DV GV LCG LKN+VA+AAGF+DGL  G+N+KAAIMRIGL EMK F
Sbjct  181   KLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDGLGYGSNSKAAIMRIGLIEMKHF  240

Query  838   SKLLFPSVKESTFF-ESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
              +  F  VKE +F  ES GV+DVIT+CL GRN K A AF   G  +SFD+LEAEML GQK
Sbjct  241   CQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVAAAFV--GANKSFDQLEAEMLNGQK  298

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  299   LQGIHTA  305



>emb|CCF73366.1| unnamed protein product [Babesia microti strain RI]
Length=364

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 218/299 (73%), Gaps = 4/299 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTV+GSGNWG+ AAK+++ N      F   V+M+V EE++  G+KL+E+IN  +ENVKY
Sbjct  16    KVTVIGSGNWGTAAAKIVSQNVKVKTMFDPTVKMYVLEELI-NGQKLTEIINTKHENVKY  74

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICK--KLVGKIRKDAEAISLIKG  1193
             LPGI L  N+IA PDL+ A  D+++L+FV PHQF++ +    K    ++  A AISLIKG
Sbjct  75    LPGITLPSNLIAIPDLKEAITDSDLLIFVLPHQFIKSVVSNVKATNAVKSGAIAISLIKG  134

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             +++K   P + + +ITE+L I+C +L GAN+A  +A E+F EAT+G+   KE A+ W QL
Sbjct  135   IDIKGHVPTLNTAIITEELNIDCSILSGANVAMNVAKEEFCEATIGFNV-KENAKVWQQL  193

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+T YF +  V DV GVE+CG +KNV+A+AAGF DGLE+G+NTKAAIMR+G  EMK F+ 
Sbjct  194   FDTSYFKIRCVNDVAGVEICGAIKNVIAVAAGFCDGLELGSNTKAAIMRMGFLEMKKFTL  253

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
               FP   + TFFES G+AD+ITTC GGRN KCA  FAK+GG + ++++E+E+L GQKLQ
Sbjct  254   QFFPKALDETFFESAGIADLITTCFGGRNVKCAAEFAKHGGNKPWNQIESELLNGQKLQ  312



>gb|KFG28048.1| NAD-dependent glycerol-3-phosphate dehydrogenase, partial [Toxoplasma 
gondii p89]
Length=390

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 223/301 (74%), Gaps = 5/301 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V+VVGSGNWGSV AK++A N  K   FH+EVRMWV+EE++  GEKL+++INKT+EN KY
Sbjct  18    KVSVVGSGNWGSVIAKIVALNAQKSYVFHNEVRMWVYEEMV-DGEKLTDIINKTHENRKY  76

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAISLIKG  1193
             LPG +L +N++A PD+  A RD+++L+F+ PHQF   +C++L     +   A AI+L+KG
Sbjct  77    LPGHKLPENLVALPDVVEACRDSDLLIFIMPHQFATKVCEQLAEARVVPGHARAITLLKG  136

Query  1192  MEVKMEGPCMISTLITEQLGI-NCCVLMGANIANEIAVEKFSEATVGYR-ENKEIAQKWV  1019
             + V+   P + S +   +L I +CCVL GAN+AN++A E+F+EAT+GY  E  + A  W 
Sbjct  137   LHVENGKPTLFSDIFKTKLDIVDCCVLSGANVANDVAREEFAEATIGYSPEETDAALIWQ  196

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYF V+A+ DV GV++CG +KNV+A+AAGF DGL +G N K AI+R+G+ EMK F
Sbjct  197   QLFDTPYFKVNALPDVAGVQVCGAVKNVIAIAAGFCDGLGLGTNAKTAIIRLGVEEMKQF  256

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             + + F ++   TFF+S G ADVITT  GGRN +CA  F + GGK ++D++EA++L+GQKL
Sbjct  257   AMIFFDNIMAETFFDSAGYADVITTVFGGRNARCAAEFLRRGGKATWDQIEADLLKGQKL  316

Query  658   Q  656
             Q
Sbjct  317   Q  317



>ref|XP_004529382.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X2 [Ceratitis capitata]
Length=360

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 218/306 (71%), Gaps = 7/306 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K  V +VGSGNWGS  AK++ +N   L  F   V M+V+EE++  G+KL+E+IN T+ENV
Sbjct  4     KISVCIVGSGNWGSAIAKIVGNNCATLPQFEKCVTMYVYEEMI-EGKKLTEIINTTHENV  62

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L +NV+A PDL  A ++A++L+FV PHQF+   CK L+GKI+ +A AISLIKG
Sbjct  63    KYLPGHKLPENVVAVPDLIEACKNADILIFVVPHQFIPNFCKTLLGKIKPNAVAISLIKG  122

Query  1192  MEVKMEGPC--MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
              + K EG    +IS +IT  L I C VLMGAN+ANE+A+  F E T+G R+ K  A+   
Sbjct  123   FD-KAEGGGIDLISHIITRHLKIPCSVLMGANLANEVALGNFCETTIGCRDIK-YAKPLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF  PYF V  V+D + VE+CG LKN+VA  AGFVDGL +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQAPYFRVVVVEDSDAVEVCGALKNIVATGAGFVDGLGLGDNTKAAVIRLGLMEMVRF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEKEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPPTA  304



>ref|XP_004529383.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X3 [Ceratitis capitata]
Length=353

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 218/306 (71%), Gaps = 7/306 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K  V +VGSGNWGS  AK++ +N   L  F   V M+V+EE++  G+KL+E+IN T+ENV
Sbjct  4     KISVCIVGSGNWGSAIAKIVGNNCATLPQFEKCVTMYVYEEMI-EGKKLTEIINTTHENV  62

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L +NV+A PDL  A ++A++L+FV PHQF+   CK L+GKI+ +A AISLIKG
Sbjct  63    KYLPGHKLPENVVAVPDLIEACKNADILIFVVPHQFIPNFCKTLLGKIKPNAVAISLIKG  122

Query  1192  MEVKMEGPC--MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
              + K EG    +IS +IT  L I C VLMGAN+ANE+A+  F E T+G R+ K  A+   
Sbjct  123   FD-KAEGGGIDLISHIITRHLKIPCSVLMGANLANEVALGNFCETTIGCRDIK-YAKPLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF  PYF V  V+D + VE+CG LKN+VA  AGFVDGL +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQAPYFRVVVVEDSDAVEVCGALKNIVATGAGFVDGLGLGDNTKAAVIRLGLMEMVRF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEKEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPPTA  304



>ref|XP_006264701.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Alligator mississippiensis]
Length=349

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 219/313 (70%), Gaps = 5/313 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V +WVF+E +  G +LS++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAARLQRFEPAVSLWVFDEDV-GGTRLSDIINTRHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PDL  AA  A++L+FV PHQF+ GIC++L   +RKDA  +SLIKG++
Sbjct  64    LPGHRLPDNVVAVPDLVQAAAGADVLIFVVPHQFVGGICEQLREHVRKDAIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N E  Q   +L  
Sbjct  124   EGPDGLKLISDIIRERLGIEMSVLMGANIANEVAEEKFCETTIGSK-NPEHGQILKELLQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQD + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQDADTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCG+AD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSATFLESCGIADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTAMGYIELFLPR  611
             QTA     +  P+
Sbjct  301   QTAAELHHILKPK  313



>ref|XP_008888647.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Hammondia hammondi]
 gb|KEP60762.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Hammondia hammondi]
Length=515

 Score =   327 bits (839),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 223/301 (74%), Gaps = 5/301 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V+VVGSGNWGSV AK++A N  K   FH+EVRMWV+EE++  GEKL+++INKT+EN KY
Sbjct  18    KVSVVGSGNWGSVIAKIVALNAQKSYVFHNEVRMWVYEEMV-DGEKLTDIINKTHENRKY  76

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAISLIKG  1193
             LPG +L +N++A PD+  A RD+++L+F+ PHQF   +C++L     +   A AI+L+KG
Sbjct  77    LPGHKLPENLVALPDVVEACRDSDLLIFIMPHQFATKVCEQLAEARVVPGHARAITLLKG  136

Query  1192  MEVKMEGPCMISTLITEQLGI-NCCVLMGANIANEIAVEKFSEATVGYR-ENKEIAQKWV  1019
             + V+   P + S +   +L I +CCVL GAN+AN++A E+F+EAT+GY  E  + A  W 
Sbjct  137   LHVENGKPSLFSDIFKTKLDIVDCCVLSGANVANDVAREEFAEATIGYNPEETDAALIWQ  196

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYF V+A+ DV GV++CG +KNV+A+AAGF DGL +G N K AI+R+G+ EMK F
Sbjct  197   QLFDTPYFKVNALPDVAGVQVCGAVKNVIAIAAGFCDGLGLGTNAKTAIIRLGVEEMKQF  256

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             + + F ++   TFF+S G ADVITT  GGRN +CA  F + GGK ++D++EA++L+GQKL
Sbjct  257   AMIFFDNIMAETFFDSAGYADVITTVFGGRNARCAAEFLRRGGKATWDQIEADLLKGQKL  316

Query  658   Q  656
             Q
Sbjct  317   Q  317



>emb|CEG71092.1| Putative Glycerol-3-phosphate dehydrogenase [NAD ] [Rhizopus 
microsporus]
Length=345

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 217/315 (69%), Gaps = 5/315 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K  V V+GSGNWGS   K+I  N LK  + F +EVR WVFEE    GEKL++VIN+  EN
Sbjct  4     KESVCVIGSGNWGSAVGKIIGENVLKYPDVFEEEVRQWVFEENY-RGEKLTDVINREREN  62

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPGI+   N+ A P+L  A + A++LVFV PHQF+ G+C+++ G I  +A AISLIK
Sbjct  63    PKYLPGIKFPPNIRAVPNLVEATKSASVLVFVLPHQFVRGVCEEMKGHIAPNARAISLIK  122

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G+E+  E   + S  I+ +LGIN   L GANIA+E+A E+F E T+G  +NKE  + +  
Sbjct  123   GLEILPEKVTLFSEEISRKLGINVASLSGANIADEVAKERFCETTIGC-QNKEDGELFHM  181

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LFNT YF V+ ++D  GVELCG LKNVVA+ AG  DGL  G+NTKAAI+R+GL EM+ F 
Sbjct  182   LFNTDYFKVNVIRDYVGVELCGALKNVVAVGAGISDGLGYGSNTKAAIIRLGLMEMRKFG  241

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +  F +V++STFFESCGVAD+ITTC GGRNRK A+AF + G  +  D LE E+L GQKLQ
Sbjct  242   QTFFGTVEDSTFFESCGVADLITTCSGGRNRKVAEAFVRTG--KPIDVLEKELLNGQKLQ  299

Query  655   VHQTAMGYIELFLPR  611
                TA    E   PR
Sbjct  300   GTLTAQEVYEFLSPR  314



>gb|EMS21005.1| glycerol-3-phosphate dehydrogenase (NAD+) [Rhodosporidium toruloides 
NP11]
 emb|CDR48166.1| RHTO0S16e02674g1_1 [Rhodosporidium toruloides]
Length=351

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 217/316 (69%), Gaps = 6/316 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTL-KLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V ++GSGNWGS  A+L+  N   + + F  EV+MW +EE    G KL+EVIN+ +EN
Sbjct  11    KWKVALIGSGNWGSAIARLVGKNIKERSDEFDTEVKMWCYEEDFE-GRKLTEVINEKHEN  69

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPGI LG NV+A+PDL  A   AN L+FV PHQF+   CK+L GK+  + +AISL+K
Sbjct  70    VKYLPGIDLGDNVVAEPDLIKAIEGANALIFVIPHQFIIETCKQLEGKVPSNTQAISLVK  129

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G++VK     + S +I E L I C  L GANIANE+A E FSE T+G R + E+A++W +
Sbjct  130   GVDVKDGQIHIFSEVIKEHLDIECAALSGANIANEVAKEAFSETTIGCR-DIEVAKRWAR  188

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF T  F V+  +DV GV L G LKNVVA+AAG +DGL+ GNN KAAIMRIGL EMK F+
Sbjct  189   LFETEKFRVAVSKDVLGVSLGGALKNVVAVAAGLIDGLQWGNNAKAAIMRIGLLEMKRFA  248

Query  835   KLLFPSVKESTFF-ESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
                FP  +  TF  ES G+AD+IT+CLGGRNRKCA+AF   G  ++FD+LE EML GQKL
Sbjct  249   LEFFPGTEPETFVQESAGIADLITSCLGGRNRKCAEAFVTTG--KTFDQLEKEMLNGQKL  306

Query  658   QVHQTAMGYIELFLPR  611
             Q  QTA    E    R
Sbjct  307   QGVQTAKELHEFLKAR  322



>ref|XP_009689111.1| glycerol-3-phosphate dehydrogenase [Theileria orientalis strain 
Shintoku]
 dbj|BAM38810.1| glycerol-3-phosphate dehydrogenase [Theileria orientalis strain 
Shintoku]
Length=351

 Score =   322 bits (824),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 218/311 (70%), Gaps = 4/311 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTV+G GNWGS A+K+IA NT K + F D VRMWV EE +  G  LSE+IN  +EN KY
Sbjct  6     KVTVIGCGNWGSAASKVIAENTKKYDLFDDTVRMWVLEEKV-DGVNLSELINTHHENKKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKL--VGKIRKDAEAISLIKG  1193
             LPGI+L +N++A PDL    +D ++ VFV PHQF++G  +K+   G+++  A AISL+KG
Sbjct  65    LPGIKLPENILAVPDLAECVKDTDLFVFVIPHQFVKGTAEKMKNSGQLKSGALAISLVKG  124

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             + +  + P ++S L+  +LG+ C  L GAN+AN IA E+FSEAT+GY   KE A+ W +L
Sbjct  125   IMIVDKKPVLVSDLVESELGVPCSALSGANVANCIAREEFSEATIGYT-TKEHARLWQRL  183

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+ PYF +S + DV G+++ G LKNVVALAAGF DGL +G+NTKAA+MRIGL E+  F++
Sbjct  184   FDRPYFKISCLDDVAGIQVYGALKNVVALAAGFCDGLGLGSNTKAAVMRIGLNEIHTFAR  243

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
               FP   E   FES G+AD+ITTC+GGRN +CA  FA   GKR ++E+E E L GQKLQ 
Sbjct  244   NFFPGTNEKVVFESAGLADLITTCIGGRNVRCAAEFAAKEGKRPWNEIELEFLNGQKLQG  303

Query  652   HQTAMGYIELF  620
               T +   E+ 
Sbjct  304   TTTCVETYEVL  314



>ref|XP_002371838.1| glycerol-3-phosphate dehydrogenase, putative [Toxoplasma gondii 
ME49]
 gb|EPR59640.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii GT1]
 gb|EPT28174.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii ME49]
 gb|ESS28370.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii VEG]
 gb|KFG29620.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii GAB2-2007-GAL-DOM2]
 gb|KFG33353.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii FOU]
 gb|KFG62965.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii RUB]
 gb|KFH02326.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii MAS]
 gb|KFH12776.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Toxoplasma 
gondii VAND]
Length=515

 Score =   327 bits (838),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 223/301 (74%), Gaps = 5/301 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V+VVGSGNWGSV AK++A N  K   FH+EVRMWV+EE++  GEKL+++INKT+EN KY
Sbjct  18    KVSVVGSGNWGSVIAKIVALNAQKSYVFHNEVRMWVYEEMV-DGEKLTDIINKTHENRKY  76

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAISLIKG  1193
             LPG +L +N++A PD+  A RD+++L+F+ PHQF   +C++L     +   A AI+L+KG
Sbjct  77    LPGHKLPENLVALPDVVEACRDSDLLIFIMPHQFATKVCEQLAEARVVPGHARAITLLKG  136

Query  1192  MEVKMEGPCMISTLITEQLGI-NCCVLMGANIANEIAVEKFSEATVGYR-ENKEIAQKWV  1019
             + V+   P + S +   +L I +CCVL GAN+AN++A E+F+EAT+GY  E  + A  W 
Sbjct  137   LHVENGKPTLFSDIFKTKLDIVDCCVLSGANVANDVAREEFAEATIGYSPEETDAALIWQ  196

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYF V+A+ DV GV++CG +KNV+A+AAGF DGL +G N K AI+R+G+ EMK F
Sbjct  197   QLFDTPYFKVNALPDVAGVQVCGAVKNVIAIAAGFCDGLGLGTNAKTAIIRLGVEEMKQF  256

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             + + F ++   TFF+S G ADVITT  GGRN +CA  F + GGK ++D++EA++L+GQKL
Sbjct  257   AMIFFDNIMAETFFDSAGYADVITTVFGGRNARCAAEFLRRGGKATWDQIEADLLKGQKL  316

Query  658   Q  656
             Q
Sbjct  317   Q  317



>ref|XP_003881321.1| glycerol-3-phosphate dehydrogenase, related [Neospora caninum 
Liverpool]
 emb|CBZ51288.1| glycerol-3-phosphate dehydrogenase, related [Neospora caninum 
Liverpool]
Length=514

 Score =   327 bits (838),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 222/301 (74%), Gaps = 5/301 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V+VVGSGNWGSV AK++A N  K   FH+EVRMWV+EE++  GEKL+++INKT+EN KY
Sbjct  18    KVSVVGSGNWGSVIAKIVALNAKKSYVFHNEVRMWVYEEIV-GGEKLTDIINKTHENTKY  76

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAISLIKG  1193
             LPG +L  N++A PD+  A RD+++L+F+ PHQF   +C++L     +   A AI+L+KG
Sbjct  77    LPGHKLPDNLVALPDVVEACRDSDLLIFIMPHQFAMRVCEQLAEAKVVPGHARAITLLKG  136

Query  1192  MEVKMEGPCMISTLITEQLGI-NCCVLMGANIANEIAVEKFSEATVGYR-ENKEIAQKWV  1019
             + V+   P + S +   +L I +CCVL GAN+AN++A E+F+EAT+GY  E  + A  W 
Sbjct  137   LHVENGKPTLFSDIFKTKLDIVDCCVLSGANVANDVAREEFAEATIGYSPEEADAALIWQ  196

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+TPYF V+A+ DV GV++CG +KNV+A+AAGF DGL +G N K AI+R+G+ EMK F
Sbjct  197   QLFDTPYFKVNALPDVAGVQVCGAVKNVIAIAAGFCDGLGLGTNAKTAIIRLGVEEMKQF  256

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             + + F ++   TFF+S G ADVITT  GGRN +CA  F + GGK ++D++EA++L+GQKL
Sbjct  257   AMIFFDNIMAETFFDSAGYADVITTVFGGRNARCAAEFLRRGGKATWDQIEADLLKGQKL  316

Query  658   Q  656
             Q
Sbjct  317   Q  317



>gb|KFO72682.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Cuculus canorus]
Length=348

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEDV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIRKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NVQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQD + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQDTDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_009554466.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Cuculus canorus]
Length=349

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEDV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIRKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NVQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQD + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQDTDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_006030783.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Alligator sinensis]
Length=349

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 217/313 (69%), Gaps = 5/313 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V +WVF+E +  G +LS++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAARLQHFEPAVSLWVFDEDV-GGARLSDIINTRHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PDL  AA  A +L+FV PHQF+ GIC++L   +RKDA  +SLIKG++
Sbjct  64    LPGHRLPDNVVAVPDLVQAAAGAEVLIFVVPHQFVSGICEQLREHVRKDAIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N E  Q   +L  
Sbjct  124   EGPDGLKLISDIIRERLGIEMSVLMGANIANEVAEEKFCETTIGSK-NPEHGQILKELLQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQD + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQDADTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCG+AD+ITTC GGRN K A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSATFLESCGIADLITTCYGGRNHKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTAMGYIELFLPR  611
             QTA     +  P+
Sbjct  301   QTAAELHHILKPK  313



>ref|XP_001841997.1| glycerol-3-phosphate dehydrogenase [Culex quinquefasciatus]
 gb|EDS35205.1| glycerol-3-phosphate dehydrogenase [Culex quinquefasciatus]
Length=354

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 224/306 (73%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K +V +VGSGNWGS  AK++  N  +L +F D V M+VFEE +  G+KL+E+IN T+EN
Sbjct  3     DKVKVCIVGSGNWGSAIAKIVGVNAKRLPTFEDRVTMYVFEEQV-DGKKLTEIINSTHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +N++A PD+  AA+DA++L+FV PHQF+ G+ ++L+GKI+K A  +SLIK
Sbjct  62    VKYLPGHKLPENIVAVPDVVEAAKDADILIFVVPHQFIRGLGQQLLGKIKKTAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G +V   G   +IS LIT+ L I C VLMGAN+ANE+A EKF E T+G R+ K +AQ + 
Sbjct  122   GFDVAEGGGMELISHLITKHLNIPCNVLMGANLANEVAEEKFCETTIGCRDMK-VAQTFR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+  G+NTKAA++R+GL EM  F
Sbjct  181   DLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGGGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  +S  +LE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KSIKQLEDEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPITA  304



>ref|XP_765829.1| NAD-dependent glycerol-3-phosphate dehydrogenase [Theileria parva 
strain Muguga]
 gb|EAN33546.1| NAD-dependent glycerol-3-phosphate dehydrogenase, putative [Theileria 
parva]
Length=354

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 213/299 (71%), Gaps = 4/299 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTVVG GNWG+ AAK+I+ NT K N F+  VRMWV EE L  G KLSE+IN T+EN KY
Sbjct  5     KVTVVGCGNWGTAAAKVISENTPKFNLFNPTVRMWVLEE-LVEGVKLSELINTTHENKKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKL--VGKIRKDAEAISLIKG  1193
             LPGI+L  N++A PDL    +D ++ +FV PHQF++    K+   G ++K+A A+SL+KG
Sbjct  64    LPGIKLPNNLLAVPDLNECVKDTDLFIFVIPHQFVKSTAVKMRECGLMKKEAVALSLVKG  123

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             + +    P ++S +I  +LGI C  L GAN+AN IA E+FSEATV Y    E  + W +L
Sbjct  124   IMILDNEPVLVSDVIERELGIPCSALSGANVANCIAREEFSEATVAYTTRDE-GRLWQRL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+ PYF +  ++DV G+++ G +KNVVAL+AGF DGL +G+NTKAA+MRIGL E+  F+K
Sbjct  183   FDRPYFKIRCIKDVAGIQVYGAIKNVVALSAGFCDGLGLGSNTKAAVMRIGLVEIHKFAK  242

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             L FP+  E   FES GVAD+ITTC+GGRN +CA  FA   GKRS++E+E E L GQKLQ
Sbjct  243   LFFPNTTEDVVFESAGVADLITTCIGGRNVRCAAEFAAKEGKRSWNEIEQEFLNGQKLQ  301



>emb|CEG69801.1| Putative Glycerol-3-phosphate dehydrogenase [NAD ] [Rhizopus 
microsporus]
Length=355

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 221/317 (70%), Gaps = 5/317 (2%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTN  1382
             NNK RV ++GSGNWGS  A++ A NT+K  ++F  EVRMWV+EE++  G+KL+E+IN+ +
Sbjct  4     NNKQRVAIIGSGNWGSSIARVCAQNTIKHSDTFEKEVRMWVYEEMIE-GKKLTEIINEKH  62

Query  1381  ENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISL  1202
             ENVKYLPGI LG+NV+A PD++ AA+DA +LVFV PHQF+ G+C  L   I K+ +AISL
Sbjct  63    ENVKYLPGINLGENVVAIPDVKDAAKDATILVFVLPHQFVYGVCGNLRDVISKNCKAISL  122

Query  1201  IKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             IKG++ K     + S  I   LGI C  L GANIA E+A E+F E T+  +++K+  + +
Sbjct  123   IKGLDYKDNNLHIFSEEIERILGIPCAALSGANIATEVAEEQFGETTIACQDSKD-GELF  181

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
             ++LF+T YF  + ++D  G+++CG LKN++A+ AG  DGL  GNNTKAA++R GL EM+ 
Sbjct  182   LKLFHTDYFDCTVIEDYRGLQICGALKNIIAIGAGICDGLNYGNNTKAAVIRRGLLEMRK  241

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F K  F  V+  TFF+SCGVAD+ITTC GGRNRK A AF  +G  +  +E+E EML GQK
Sbjct  242   FGKTFFGGVRTETFFQSCGVADLITTCSGGRNRKVAAAFINSG--KPIEEVEKEMLNGQK  299

Query  661   LQVHQTAMGYIELFLPR  611
             LQ   T+         R
Sbjct  300   LQGTTTSQEVYHFLSAR  316



>ref|XP_006087639.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Myotis lucifugus]
Length=351

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V MWVFEE++  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVNMWVFEEMV-DGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L+ A +DA+MLVFV PHQF+  IC ++ GK+ K A  I+LIKG++
Sbjct  66    LPGHKLPDNVVAVPNLQEAVQDADMLVFVIPHQFIHRICDEITGKVPKKARGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVLENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ VQD + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVQDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
                T+
Sbjct  301   GPMTS  305



>ref|XP_542745.2| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like [Canis lupus 
familiaris]
Length=351

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 220/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLTKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NVIA P+L  A +DA++LVFV PHQF+  IC +L G++ KDA  I+LIKG++
Sbjct  66    LPGHKLPENVIAVPNLGEAVKDADLLVFVIPHQFIHRICDELTGRVPKDALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDVSVLMGANIASEVAAEKFCETTIGSKIMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHSGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|NP_001080270.1| glycerol-3-phosphate dehydrogenase 1-like protein [Xenopus laevis]
 sp|Q801R8.1|GPD1L_XENLA RecName: Full=Glycerol-3-phosphate dehydrogenase 1-like protein 
[Xenopus laevis]
 gb|AAH47958.1| Kiaa0089 protein [Xenopus laevis]
 gb|AAI08482.1| Kiaa0089 protein [Xenopus laevis]
Length=352

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N   +  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  8     KVCIVGSGNWGSAVAKIIGHNVKNMKKFASTVNMWVFEENI-NGRKLTEIINTEHENVKY  66

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A RDA++L+FV PHQF+  +C+++ GK+ K+A  I+LIKG++
Sbjct  67    LPGHKLPENVVALPNLTDAVRDADLLIFVIPHQFIHKVCQEISGKVHKNALGITLIKGID  126

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++ I+  VLMGANIANE+A EKF E T+G + NK     + +L  
Sbjct  127   EGPEGLRLISDIIREKMNIDVSVLMGANIANEVAAEKFCETTIGSK-NKNHGLLFKELLQ  185

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V+D + VELCG LKN+VA+AAGF DGL  G+NTKAA++R+GL EM AF+ + 
Sbjct  186   TPNFRITVVEDADTVELCGALKNIVAVAAGFCDGLSCGDNTKAAVIRLGLMEMIAFANVF  245

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AF K G  +S +ELE EML GQKLQ  
Sbjct  246   CKDSVSIATFLESCGVADLITTCYGGRNRKVAEAFVKTG--KSIEELEKEMLNGQKLQGP  303

Query  649   QTA  641
             QT+
Sbjct  304   QTS  306



>ref|XP_008152122.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Eptesicus fuscus]
Length=351

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 218/300 (73%), Gaps = 9/300 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE++  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFSSTVKMWVFEEMV-DGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L+ A +DA+MLVFV PHQF+  IC ++ GK+ K A  I+LIKG++
Sbjct  66    LPGHKLPDNVVAVPNLQEAVQDADMLVFVIPHQFIHRICDEITGKVPKKARGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                +G  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPQGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V+D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  183   LQTPNFRITVVEDADTVELCGALKNIVAVGAGFCDGLHSGDNTKAAVIRLGLMEMIAFAK  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300



>gb|EKC29995.1| Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic [Crassostrea 
gigas]
Length=351

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 215/307 (70%), Gaps = 6/307 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTL-KLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             +K +V VVGSGNWGS  AK++ +N L + + F  EVRMWVFEE +  G KL+E+IN  + 
Sbjct  3     SKKKVCVVGSGNWGSAIAKIVGNNVLAQTDQFDTEVRMWVFEETV-EGRKLTEIINNDHV  61

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPGIQL KNV+A PD++ AA +A++L+FV PHQF+ G+CK+L GK+   A A+SLI
Sbjct  62    NVKYLPGIQLPKNVVAIPDVKDAAENADILIFVLPHQFVRGVCKQLDGKVNPGAIAVSLI  121

Query  1198  KGMEV-KMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             KG +V    G  +IS +I E L I C  LMGANIANE+A E + EAT+G +  KE     
Sbjct  122   KGFDVADGGGILLISDVIREMLKIPCAALMGANIANEVAKENYCEATIGIKV-KEHGPLL  180

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
               LF T YF +    D   VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM  
Sbjct  181   KDLFQTDYFRIVVCDDETTVEVCGALKNIVAVGAGFADGLGYGDNTKAAVIRLGLMEMIK  240

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F ++ +P   +STF ESCGVAD++TTC GGRNRK A+AF K G  +S + LEAEML GQK
Sbjct  241   FCEVFYPESNQSTFLESCGVADLVTTCYGGRNRKVAEAFVKTG--KSIEALEAEMLNGQK  298

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  299   LQGPPTA  305



>ref|NP_001030431.1| glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic [Bos 
taurus]
 gb|AAX08698.1| glycerol-3-phosphate dehydrogenase 1 (soluble) [Bos taurus]
Length=349

 Score =   319 bits (817),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGLD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N+   Q   +L  
Sbjct  124   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NQAHGQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_004692821.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Condylura cristata]
Length=349

 Score =   319 bits (817),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK++ SN  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     RVCIVGSGNWGSAIAKIVGSNAAQLTRFDPRVTMWVFEEDV-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++LVFV PHQF+  IC +L G ++ D   ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILVFVVPHQFIGKICDQLKGNLKADTIGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N+   Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCK-NQAQGQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_008102172.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Anolis carolinensis]
Length=349

 Score =   319 bits (817),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 219/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  KL+ F + V MWVFEE +  G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAAKLDKFDNTVNMWVFEEEV-GGKKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  A+  A++L+FV PHQF+  +C +L   I+KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDILKASEGADILMFVVPHQFIGKLCDQLKDHIKKDAIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I EQLGI   VLMGANIANE+A EKF E T+G + N E  Q   +L  
Sbjct  124   EGPDGLKLISDIIREQLGIEMSVLMGANIANEVAEEKFCETTIGCK-NIEHGQILKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V++ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVKEADTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGSVTSATFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_308279.2| AGAP007593-PB [Anopheles gambiae str. PEST]
 gb|EAA03917.3| AGAP007593-PB [Anopheles gambiae str. PEST]
Length=350

 Score =   318 bits (816),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 224/307 (73%), Gaps = 5/307 (2%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K RV +VGSGNWGS  AK++ +N  +L +F D V M+V+EE++  G+KL+E+IN T+E
Sbjct  2     SDKVRVCIVGSGNWGSAIAKIVGANAKRLATFEDRVTMYVYEEMI-DGKKLTEIINTTHE  60

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPG +L +NV+A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLI
Sbjct  61    NVKYLPGHKLPENVVAVPDVVEAAKDADILIFVVPHQFIRGLGTQLLGKIKPTAVGLSLI  120

Query  1198  KGMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             KG +V   G   +IS LIT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ  
Sbjct  121   KGFDVAEGGGMELISHLITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTL  179

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
               LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  
Sbjct  180   RDLFLTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIK  239

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F  + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++  ELE EML GQK
Sbjct  240   FVDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIVELENEMLNGQK  297

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  298   LQGPITA  304



>ref|XP_001687881.1| AGAP007593-PA [Anopheles gambiae str. PEST]
 gb|EDO64530.1| AGAP007593-PA [Anopheles gambiae str. PEST]
Length=354

 Score =   319 bits (817),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 224/307 (73%), Gaps = 5/307 (2%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K RV +VGSGNWGS  AK++ +N  +L +F D V M+V+EE++  G+KL+E+IN T+E
Sbjct  2     SDKVRVCIVGSGNWGSAIAKIVGANAKRLATFEDRVTMYVYEEMI-DGKKLTEIINTTHE  60

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPG +L +NV+A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLI
Sbjct  61    NVKYLPGHKLPENVVAVPDVVEAAKDADILIFVVPHQFIRGLGTQLLGKIKPTAVGLSLI  120

Query  1198  KGMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             KG +V   G   +IS LIT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ  
Sbjct  121   KGFDVAEGGGMELISHLITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTL  179

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
               LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  
Sbjct  180   RDLFLTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIK  239

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F  + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++  ELE EML GQK
Sbjct  240   FVDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIVELENEMLNGQK  297

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  298   LQGPITA  304



>ref|XP_004529381.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Ceratitis capitata]
Length=486

 Score =   323 bits (828),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 218/306 (71%), Gaps = 7/306 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K  V +VGSGNWGS  AK++ +N   L  F   V M+V+EE++  G+KL+E+IN T+ENV
Sbjct  4     KISVCIVGSGNWGSAIAKIVGNNCATLPQFEKCVTMYVYEEMI-EGKKLTEIINTTHENV  62

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L +NV+A PDL  A ++A++L+FV PHQF+   CK L+GKI+ +A AISLIKG
Sbjct  63    KYLPGHKLPENVVAVPDLIEACKNADILIFVVPHQFIPNFCKTLLGKIKPNAVAISLIKG  122

Query  1192  MEVKMEGPC--MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
              + K EG    +IS +IT  L I C VLMGAN+ANE+A+  F E T+G R+ K  A+   
Sbjct  123   FD-KAEGGGIDLISHIITRHLKIPCSVLMGANLANEVALGNFCETTIGCRDIK-YAKPLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF  PYF V  V+D + VE+CG LKN+VA  AGFVDGL +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQAPYFRVVVVEDSDAVEVCGALKNIVATGAGFVDGLGLGDNTKAAVIRLGLMEMVRF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEKEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPPTA  304



>ref|NP_989027.1| glycerol-3-phosphate dehydrogenase 1-like protein [Xenopus (Silurana) 
tropicalis]
 sp|Q6P824.1|GPD1L_XENTR RecName: Full=Glycerol-3-phosphate dehydrogenase 1-like protein 
[Xenopus (Silurana) tropicalis]
 gb|AAH61407.1| glycerol-3-phosphate dehydrogenase 1-like [Xenopus (Silurana) 
tropicalis]
Length=352

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N   L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  8     KVCIVGSGNWGSAVAKIIGHNVKNLKKFASTVNMWVFEENI-NGRKLTEIINTEHENVKY  66

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++L+FV PHQF+  IC+++ GK+ ++A  I+LIKG++
Sbjct  67    LPGYKLPENVVAVPNLSDAVKDADLLIFVIPHQFIHKICQEISGKVHRNALGITLIKGID  126

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++ I+  VLMGANIANE+A EKF E T+G + NKE    + +L  
Sbjct  127   EGPEGLRLISDIIREKMDIDVSVLMGANIANEVAAEKFCETTIGSK-NKEHGLLFKELLQ  185

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V+D + VELCG LKN+VA+AAGF DGL  G+NTKAA++R+GL EM AF+ + 
Sbjct  186   TPNFRITVVEDADTVELCGALKNIVAVAAGFCDGLGCGDNTKAAVIRLGLMEMIAFANVF  245

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK ++AF K+G  +S +ELE EML GQKLQ  
Sbjct  246   CKGPVSIATFLESCGVADLITTCYGGRNRKVSEAFVKSG--KSIEELEKEMLNGQKLQGP  303

Query  649   QTA  641
             QT+
Sbjct  304   QTS  306



>ref|XP_003770927.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform 1 [Sarcophilus harrisii]
Length=349

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 220/303 (73%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L  F  +V MWVFEE + +G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNVTQLVQFDPQVAMWVFEEEV-SGQKLTEIINTKHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++++A  +SLIKG++
Sbjct  64    LPGHKLPLNVVAIPDVIQAAADADILIFVVPHQFIGKICDQLKGHLKRNAIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N    Q   +L  
Sbjct  124   EGPDGLKLISEVIHERLGIPISVLMGANIASEVADEKFCETTIGCK-NLAQGQLLKELLQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AFSKL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFSKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCG+AD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVSSTTFLESCGIADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_005892079.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Bos mutus]
 ref|XP_010856093.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Bison bison bison]
 sp|Q5EA88.3|GPDA_BOVIN RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; 
Short=GPD-C; Short=GPDH-C [Bos taurus]
 tpg|DAA29919.1| TPA: glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic [Bos 
taurus]
Length=349

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N+   Q   +L  
Sbjct  124   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NQAHGQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>gb|KGG52613.1| hypothetical protein DI09_151p60 [Microsporidia sp. UGP3]
Length=370

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 223/321 (69%), Gaps = 16/321 (5%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLK-LNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             R+ ++GSGNWGS  AK+I +N  K L  F  +++MWVFEE++  G+KL+E+IN  + NVK
Sbjct  7     RICIIGSGNWGSTIAKIIGNNVSKNLEKFDPKIKMWVFEEMV-EGKKLTEIINTEHVNVK  65

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI+L +NV ADPDL  A +DA +LVFV PHQF++  C+ + G + K+A AISLIKG+
Sbjct  66    YLPGIKLPENVRADPDLVSAVKDATLLVFVIPHQFVKRSCETIRGHLHKNARAISLIKGV  125

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             +   +G  +IS LI   L I+ CV+MGANIANE++ E+F E+T+GYR+    A  +  + 
Sbjct  126   DASSKGISLISDLIASTLSIDVCVMMGANIANEVSKEQFCESTIGYRDAGN-AAIFKLVM  184

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
              T YF+++ V DVEGVELCG LKNVVA+AAG VDGL  G NTKAAI+RIGL EMK FS +
Sbjct  185   ETNYFLINCVPDVEGVELCGALKNVVAVAAGLVDGLGFGENTKAAIIRIGLVEMKRFSSI  244

Query  829   L-FPSVKES----------TFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEA  683
               F S  E           T+FESCGVAD+ITTC GGRNR+ ++ F  +G  +SF++LE 
Sbjct  245   FRFLSTSEPAAEDQPSNWETYFESCGVADLITTCFGGRNRRISELFVASG--KSFEQLEV  302

Query  682   EMLQGQKLQVHQTAMGYIELF  620
             E L GQKLQ   T+    E+ 
Sbjct  303   EHLNGQKLQGPSTSKEVYEIL  323



>ref|XP_006075841.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Bubalus bubalis]
Length=349

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N+   Q   +L  
Sbjct  124   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NQAHGQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_006629312.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Lepisosteus oculatus]
Length=351

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 216/299 (72%), Gaps = 6/299 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +  +VGSGNWGS  AK++ +N  + + F   V MWVFEE++  G KL+E+IN  +ENVKY
Sbjct  6     KACIVGSGNWGSAIAKIVGANAAEKDGFDTTVNMWVFEEMV-NGRKLTEIINTDHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA  A++LVFV PHQF+  IC  L GKI+KDA  ISLIKG++
Sbjct  65    LPGHKLPPNVVAIPDIVDAATGADILVFVIPHQFIGKICDTLKGKIKKDAIGISLIKGVD  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G R NKE      +LF 
Sbjct  125   EGPDGLKLISEVIREKLGIAVSVLMGANIASEVAEEKFCETTIGCR-NKEQGALLKELFQ  183

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ V++ + VE+CG LKNVVA+ AGF DGL MG+NTKAA++R+GL EM AF++L 
Sbjct  184   TPNFRVTVVEEADVVEICGALKNVVAVGAGFCDGLGMGDNTKAAVIRLGLMEMIAFARLF  243

Query  826   FPS--VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
               S  V  +TF ESCGVAD+ITTC GGRNRK A+AFAK G  ++ ++LE EML GQKLQ
Sbjct  244   CTSSQVSSATFLESCGVADLITTCYGGRNRKVAEAFAKTG--KTIEQLEKEMLNGQKLQ  300



>ref|XP_005717176.1| glycerol-3-phosphate dehydrogenase [Chondrus crispus]
 emb|CDF37357.1| glycerol-3-phosphate dehydrogenase [Chondrus crispus]
Length=347

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/309 (51%), Positives = 219/309 (71%), Gaps = 2/309 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VG+GNWGS A+ +IA N  + + F + V MWV+EE++  G KL+E+IN  + NVKY
Sbjct  3     RVCIVGAGNWGSAASMIIARNMKRYDHFENTVNMWVYEEMI-DGRKLTEIINTEHRNVKY  61

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LP  +L +NV+A P+L  A  D N+LVFV PHQF+   CK L G++  D  AISLIKG++
Sbjct  62    LPDHELPENVVAVPELLDAVCDCNVLVFVLPHQFLHRTCKTLKGRLPPDTIAISLIKGID  121

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +++ +I  +L I+  VL GANIANEIA  KF E+T+GY + +E A  + ++FN
Sbjct  122   FNEEGVVLMTDMIKNELDIDVSVLSGANIANEIAAGKFCESTIGYAD-EENATTFYEMFN  180

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
                F +S V D+E V++ G +KNV+AL AGF D LEMGNNTKAA++RIGL E++ F++  
Sbjct  181   EKNFRISIVNDIESVQVFGAIKNVIALGAGFCDALEMGNNTKAALIRIGLLEIQRFARKY  240

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQ  647
             F  + ++   ESCG+AD+ITTCLGGRNR+CA+AF +  GKRS++ELEAEML GQKLQ   
Sbjct  241   FGPINDAAMLESCGLADLITTCLGGRNRRCAEAFGRADGKRSWEELEAEMLNGQKLQGTS  300

Query  646   TAMGYIELF  620
             T +  +++ 
Sbjct  301   TCLEVMKIL  309



>gb|KFP21935.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Egretta garzetta]
Length=348

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_001653596.1| glycerol-3-phosphate dehydrogenase [Aedes aegypti]
 gb|EAT47334.1| AAEL001593-PC [Aedes aegypti]
Length=350

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K +V +VGSGNWGS  AK++  N  +L +F D V M+VFEE++  G+KL+E+IN T+EN
Sbjct  3     DKVKVCIVGSGNWGSAIAKIVGVNAKRLPNFEDRVTMYVFEEMI-DGKKLTEIINTTHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +NV+A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLIK
Sbjct  62    VKYLPGHKLPENVVAVPDVVEAAKDADILIFVVPHQFIRGLGAQLLGKIKTSAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G +V   G   +IS +IT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ   
Sbjct  122   GFDVAEGGGMELISHIITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  +S  +LE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KSIKQLEDEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPITA  304



>ref|XP_009644405.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Egretta garzetta]
Length=349

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_009881479.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Charadrius vociferus]
 gb|KGL91822.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic [Charadrius 
vociferus]
Length=349

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAAQLSTFENQVNMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIRKVCDQLKGHVKKDAVGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVADEKFCETTIGCK-NTQHGQMLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGSVSPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_010711197.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Meleagris gallopavo]
Length=353

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     RVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAVPNLNEAVKDADLLVFVIPHQFIHKVCDEITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>ref|XP_006755507.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Myotis davidii]
 gb|ELK36315.1| Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic [Myotis 
davidii]
Length=349

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V ++GSGNWGS  AK++  N  KL  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCILGSGNWGSAIAKIVGGNAAKLAHFDPRVTMWVFEEDV-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  ISLIKG++
Sbjct  64    LPGHKLPSNVVAVPDVVQAAVDADILIFVVPHQFISKICDQLKGHLKANAIGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPVNVLMGANIANEVADEKFCETTIGCKDQAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK ADAFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVSSATFLESCGVADLITTCYGGRNRKVADAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>gb|KFB42472.1| glycerol-3-phosphate dehydrogenase [Anopheles sinensis]
Length=350

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 223/307 (73%), Gaps = 5/307 (2%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             ++K RV +VGSGNWGS  AK++  N  +L +F D V M+V+EE++  G+KL+E+IN T+E
Sbjct  2     SDKVRVCIVGSGNWGSAIAKIVGVNAKRLPNFDDRVTMYVYEEMI-DGKKLTEIINTTHE  60

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             NVKYLPG +L +N++A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLI
Sbjct  61    NVKYLPGHKLPENIVAVPDVVEAAKDADILIFVVPHQFIRGLGTQLLGKIKPTAVGLSLI  120

Query  1198  KGMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKW  1022
             KG +V   G   +IS LIT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ  
Sbjct  121   KGFDVAEGGGMELISHLITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTL  179

Query  1021  VQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKA  842
               LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  
Sbjct  180   RDLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIK  239

Query  841   FSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQK  662
             F  + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++  +LE EML GQK
Sbjct  240   FVDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIKQLEDEMLNGQK  297

Query  661   LQVHQTA  641
             LQ   TA
Sbjct  298   LQGPITA  304



>ref|XP_418763.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like isoform 
X2 [Gallus gallus]
Length=353

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     RVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAVPNLNEAVQDADLLVFVVPHQFIHKVCDEITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>ref|XP_954425.1| glycerol-3-phosphate dehydrogenase (gpdh) [Theileria annulata]
 emb|CAI73748.1| glycerol-3-phosphate dehydrogenase (gpdh), putative [Theileria 
annulata]
Length=380

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 214/299 (72%), Gaps = 4/299 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +VTVVG GNWG+ AAK+I+ NT K N F+  VRMWV EE +  G  LSE+IN T+EN KY
Sbjct  31    KVTVVGCGNWGTAAAKVISENTPKFNLFNPTVRMWVLEEKV-DGVNLSELINTTHENKKY  89

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKL--VGKIRKDAEAISLIKG  1193
             LPGI+L  N++A PDL    +DA++ +FV PHQF++    K+   G ++K+A A++L+KG
Sbjct  90    LPGIKLPDNLLAVPDLNECVKDADLFIFVIPHQFVKSTAMKIKDSGLLKKEAVALTLVKG  149

Query  1192  MEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             + +    P ++S +I  +LGI C  L GAN+AN IA E+FSEATV Y   KE  + W +L
Sbjct  150   IMILDNKPVLVSDVIERELGIPCSALSGANVANCIAREEFSEATVAYT-TKEEGKVWQRL  208

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F+ PYF +  ++DV G+++ G +KNVVAL+AGF DGL +G+NTKAA+MRIGL E+  F+K
Sbjct  209   FDRPYFKIRCIKDVAGIQVYGAIKNVVALSAGFCDGLGLGSNTKAAVMRIGLVEIHKFAK  268

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             L FP+V E   FES GVAD+ITTC+GGRN +CA  FA   G RS++E+E E L GQKLQ
Sbjct  269   LFFPTVSEEVVFESAGVADLITTCIGGRNVRCAAEFAAKHGSRSWNEIEQEFLNGQKLQ  327



>gb|KGL82655.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Tinamus guttatus]
Length=348

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L +F   V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAARLGTFESHVSMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G I+KDA  +SLIKG++
Sbjct  64    LPGRKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHIKKDAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E+L I   VLMGANIANE+A E+F E T+G + N +  Q   +L  
Sbjct  124   EGPEGLKLISDIIREKLSIEMSVLMGANIANEVADEEFCETTIGCK-NTQQGQILKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQ+ + VE+CG LKNVVA+AAGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVSVVQEADTVEICGALKNVVAVAAGFCDGLGFGDNTKAAVIRMGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_009052905.1| hypothetical protein LOTGIDRAFT_231803 [Lottia gigantea]
 gb|ESO96552.1| hypothetical protein LOTGIDRAFT_231803 [Lottia gigantea]
Length=351

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 214/305 (70%), Gaps = 6/305 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKL-NSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             R+ +VGSGNWGS  AK+I +N + + + FH EVRMWVFEE +    KL+++IN  +ENVK
Sbjct  6     RICIVGSGNWGSAIAKIIGNNVVTMPDKFHKEVRMWVFEETV-NDRKLTDIINNDHENVK  64

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPGI L +NV+A PD+  A +DA++ +FV PHQF+  + K L G I+KDA A++LIKG 
Sbjct  65    YLPGIALPENVVAIPDVADAGKDADIFIFVLPHQFVRKVGKSLQGTIKKDAIAVTLIKGF  124

Query  1189  EVKMEGPCM-ISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQL  1013
             +VK  G  + IS +I E L I C +LMGANIANE+A E + EAT+G ++  E+      +
Sbjct  125   DVKEGGGILLISDVIRELLNIPCAILMGANIANEVAKENYCEATIGCKD-PEMGPLLKDV  183

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
             F   YF +  V D   VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM  F +
Sbjct  184   FQADYFRIVVVPDETTVEVCGALKNIVAVGAGFADGLGYGDNTKAAVIRLGLMEMIKFCE  243

Query  832   LLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
             + +P   ESTF ESCGVAD++TTC GGRNR+ A+AFAK G  +S +ELE EML GQKLQ 
Sbjct  244   VFYPGSNESTFLESCGVADLVTTCYGGRNRRVAEAFAKTG--KSIEELETEMLNGQKLQG  301

Query  652   HQTAM  638
               TA 
Sbjct  302   PPTAF  306



>ref|XP_010220821.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Tinamus guttatus]
Length=349

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L +F   V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAARLGTFESHVSMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G I+KDA  +SLIKG++
Sbjct  64    LPGRKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHIKKDAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E+L I   VLMGANIANE+A E+F E T+G + N +  Q   +L  
Sbjct  124   EGPEGLKLISDIIREKLSIEMSVLMGANIANEVADEEFCETTIGCK-NTQQGQILKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQ+ + VE+CG LKNVVA+AAGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVSVVQEADTVEICGALKNVVAVAAGFCDGLGFGDNTKAAVIRMGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|ELR59039.1| Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, partial 
[Bos mutus]
Length=388

 Score =   318 bits (816),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  44    KVCIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  102

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++
Sbjct  103   LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGVD  162

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N+   Q   +L  
Sbjct  163   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NQAHGQLLKELMQ  221

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  222   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  281

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  282   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  339

Query  649   QTA  641
             QTA
Sbjct  340   QTA  342



>ref|XP_001653595.1| glycerol-3-phosphate dehydrogenase [Aedes aegypti]
 gb|EAT47333.1| AAEL001593-PA [Aedes aegypti]
Length=356

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K +V +VGSGNWGS  AK++  N  +L +F D V M+VFEE++  G+KL+E+IN T+EN
Sbjct  3     DKVKVCIVGSGNWGSAIAKIVGVNAKRLPNFEDRVTMYVFEEMI-DGKKLTEIINTTHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +NV+A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLIK
Sbjct  62    VKYLPGHKLPENVVAVPDVVEAAKDADILIFVVPHQFIRGLGAQLLGKIKTSAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G +V   G   +IS +IT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ   
Sbjct  122   GFDVAEGGGMELISHIITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  +S  +LE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KSIKQLEDEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPITA  304



>ref|XP_006635606.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein-like 
isoform X1 [Lepisosteus oculatus]
Length=351

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 219/304 (72%), Gaps = 6/304 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  A++I  N  K+  F   V MWVFEE + +G  L+++IN  +ENVKY
Sbjct  6     KVCIVGSGNWGSAIARIIGQNVQKVQKFAATVHMWVFEEDI-SGRNLTDIINTDHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L+ AA++A++LVFV PHQF+  +C ++VG + + A  ISLIKG++
Sbjct  65    LPGYKLPENVVAVPNLQDAAQNADLLVFVVPHQFIRRLCDEMVGCVSQKARGISLIKGID  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G + N E    + +L  
Sbjct  125   EGPEGLKLISDIIREKMGIDVSVLMGANIANEVAAEKFCETTIGSK-NMENGLLFKELLQ  183

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++L 
Sbjct  184   TPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARLF  243

Query  826   FP--SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
                 +V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE +ML GQKLQ 
Sbjct  244   SKDGAVTSATFLESCGVADLITTCYGGRNRKVAEAFARTG--QSIEELEGQMLNGQKLQG  301

Query  652   HQTA  641
              QT+
Sbjct  302   PQTS  305



>gb|KFM04261.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Aptenodytes forsteri]
Length=348

 Score =   317 bits (812),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G++L+++INK +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGQRLTDIINKEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G  +N +  Q   +L  
Sbjct  124   EGPGGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGC-QNMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNIVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_001653594.1| glycerol-3-phosphate dehydrogenase [Aedes aegypti]
 gb|EAT47332.1| AAEL001593-PB [Aedes aegypti]
Length=359

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K +V +VGSGNWGS  AK++  N  +L +F D V M+VFEE++  G+KL+E+IN T+EN
Sbjct  3     DKVKVCIVGSGNWGSAIAKIVGVNAKRLPNFEDRVTMYVFEEMI-DGKKLTEIINTTHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +NV+A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLIK
Sbjct  62    VKYLPGHKLPENVVAVPDVVEAAKDADILIFVVPHQFIRGLGAQLLGKIKTSAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G +V   G   +IS +IT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ   
Sbjct  122   GFDVAEGGGMELISHIITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+ +G+NTKAA++R+GL EM  F
Sbjct  181   DLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGLGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  +S  +LE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KSIKQLEDEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPITA  304



>ref|XP_009272675.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Aptenodytes forsteri]
Length=349

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G++L+++INK +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGQRLTDIINKEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G  +N +  Q   +L  
Sbjct  124   EGPGGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGC-QNMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNIVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_010309022.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Balearica regulorum gibbericeps]
Length=349

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F  +V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFEKQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIASEVAEEKFCETTIGCK-NMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_004414668.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Odobenus rosmarus divergens]
Length=351

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 220/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLKKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K+A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFINRICDEITGRVPKEALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDVSVLMGANIASEVAAEKFCETTIGSKIMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHSGDNTKAAVIRLGLMEMIAFAK  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_005999356.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Latimeria chalumnae]
Length=350

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N  KL  F   VRMWVFEE++  G KL+E+IN  +ENVKY
Sbjct  6     KVCIVGSGNWGSAIAKIIGENAAKLPQFDSTVRMWVFEEMV-NGRKLTEIINMDHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PDL  A++ A++LVFV PHQF++ +C ++   I+ DA  +SLIKG++
Sbjct  65    LPGYKLPPNVLAVPDLVEASKGADILVFVVPHQFIDKLCGQMKDHIKCDAIGVSLIKGID  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + NKE      +L  
Sbjct  125   EGPEGLKLISDIIREKLGIEMSVLMGANIANEVADEKFCETTIGSK-NKEHGAILKELMQ  183

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             T  F ++ V++ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AFSKL 
Sbjct  184   TSNFRITVVEEADTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFSKLF  243

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                +V  +TF ESCGVAD+ITTC GGRNRK A+AFAK+G  ++ ++LE EML GQKLQ  
Sbjct  244   CKGTVTSATFLESCGVADLITTCYGGRNRKIAEAFAKSG--KTIEQLEKEMLNGQKLQGP  301

Query  649   QTA  641
             QT+
Sbjct  302   QTS  304



>ref|XP_008119603.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Anolis carolinensis]
Length=350

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N   +  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  6     KVCIVGSGNWGSAVAKIIGKNVKAMQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L+ A +DA++LVFV PHQF+  IC  + G++ K A  I+LIKG++
Sbjct  65    LPGYKLPENVVAIPNLKEAVQDADLLVFVIPHQFIHKICDDITGRVAKKAVGITLIKGID  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  125   EGPEGLRLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGCKILENGVL---FKEL  181

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL+ G+NTKAA++R+GL EM AF+K
Sbjct  182   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLQCGDNTKAAVIRLGLMEMIAFAK  241

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  242   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  299

Query  655   VHQTA  641
               QT+
Sbjct  300   GPQTS  304



>gb|KFO03680.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Balearica regulorum gibbericeps]
Length=348

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SN  +L++F  +V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNAARLSTFEKQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIASEVAEEKFCETTIGCK-NMQHGQTLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_004599029.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Ochotona princeps]
Length=349

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L  F   V MWVFEE +  G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAAQLARFDPRVTMWVFEEDI-GGKKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +   ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLRGHLKANTIGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGCKDLAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|NP_001005934.1| glycerol-3-phosphate dehydrogenase 1-like protein [Danio rerio]
 ref|XP_009290808.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Danio rerio]
 sp|Q5XIZ6.1|GPD1L_DANRE RecName: Full=Glycerol-3-phosphate dehydrogenase 1-like protein 
[Danio rerio]
 gb|AAH83522.1| Glycerol-3-phosphate dehydrogenase 1-like [Danio rerio]
Length=351

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 218/301 (72%), Gaps = 10/301 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  A++I SN  KL  F   V+MWV+EE++  G+KLSE+IN  +ENVKY
Sbjct  6     KVCIVGSGNWGSAIARIIGSNAQKLQCFATTVKMWVYEEMV-NGKKLSEIINTEHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P L  AA  A++LVFV PHQF+  +C +++G + + A  I+LIKG++
Sbjct  65    LPGYKLPENVVAVPQLRDAADGADLLVFVVPHQFIRKLCDEMMGCVSERARGITLIKGID  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E+T+G +  EN  +   +  L
Sbjct  125   EGPEGLKLISDIIREKMGIDVSVLMGANIANEVAAEKFCESTIGSKVLENGLL---FKDL  181

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL+ G+NTKAA++R+GL EM AF+K
Sbjct  182   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLQCGDNTKAAVIRLGLMEMIAFAK  241

Query  832   LLFP--SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             L     SV  +TF ESCGVAD+ITTC GGRNR+ A+AFAK G  +S +ELE EML GQKL
Sbjct  242   LFSKDDSVSSATFLESCGVADLITTCYGGRNRRVAEAFAKTG--KSIEELEKEMLNGQKL  299

Query  658   Q  656
             Q
Sbjct  300   Q  300



>ref|XP_003939204.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Saimiri boliviensis boliviensis]
Length=349

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAQFDSRVTMWVFEEDI-GGKKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  ISLIKG++
Sbjct  64    LPGHKLPSNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI+  VLMGANIA+E+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGISMSVLMGANIASEVADEKFCETTIGCKDPAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_422110.3| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X2 [Gallus gallus]
Length=349

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  A+++  N  + N F   V+MWVFEE++  G +LSE+IN+ +ENVKY
Sbjct  5     RVCIVGSGNWGSAIARIVGKNVQQSNRFDSTVKMWVFEEII-NGRRLSEIINQEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++ KNV+A PD+  A R  ++LVFV PHQF+  +C+++ G I+  A  ISLIKG++
Sbjct  64    LPGYKIPKNVVAVPDVAEAVRGTDILVFVLPHQFIGRVCEQMAGHIKPGAFGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS LI E+L I   VLMGANIA E+A EKF E T+G +  K+  Q + +L  
Sbjct  124   EGPEGLKLISDLIREKLKIEISVLMGANIAKEVADEKFCETTIGCKNEKQ-GQIFKELLQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+++ 
Sbjct  183   TPNFRITVVPDTDTVEICGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMVAFAQIF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CRGPVSISTFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELENEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_004754360.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Mustela putorius furo]
Length=351

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 220/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLKKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K+A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKEALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDVSVLMGANIASEVASEKFCETTIGSKIMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHSGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFAK G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFAKTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_005278761.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Chrysemys picta bellii]
Length=353

 Score =   317 bits (811),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK+I +N   +  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     RVCIVGSGNWGSAVAKIIGNNVKNMQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NVIA P+L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPENVIAIPNLNEAVQDADLLVFVIPHQFIHKICDEITGRVPKKAVGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAFAK  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSIATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>gb|ETB57845.1| glycerol-3-phosphate dehydrogenase (NAD( )) [Plasmodium yoelii 
17X]
Length=395

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 219/303 (72%), Gaps = 4/303 (1%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             N   +V+++GSG+WG+V +K+I+ NT + N FH  VRM+V EE++   EKLS++INKT E
Sbjct  39    NGPLKVSIIGSGSWGTVISKIISENTQRSNIFHPIVRMYVNEEII-DNEKLSDIINKTKE  97

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAIS  1205
             NVKY+ G++L  N++A PD++    DA++LVFV PHQ++E    +++    ++  A+AIS
Sbjct  98    NVKYMKGMKLPNNIVAIPDIDKVIEDADLLVFVVPHQYLETTLSEILKNKNLKSSAKAIS  157

Query  1204  LIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQK  1025
             L+KG+++    P ++S +I   L I C VL G+NIA+E++ E FSEAT+G+ EN E A+ 
Sbjct  158   LMKGIKICDYKPMLLSNIIENMLNIECSVLSGSNIASELSTESFSEATIGF-ENLETAEI  216

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             W +LF+  YF ++ +QD  GVE+CG LKNVVAL  GF +  +   NTK+AI+RIGL EMK
Sbjct  217   WRELFDRNYFKINCIQDKSGVEMCGALKNVVALGVGFSEAFKKSYNTKSAIIRIGLEEMK  276

Query  844   AFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQ  665
              F+KL FP+V + TF +SCGVADVI TCLGGRN KCA  FA   G+ S+D++E+E+L GQ
Sbjct  277   KFAKLFFPNVLDETFLDSCGVADVIATCLGGRNVKCATEFAFRNGQDSWDKIESELLNGQ  336

Query  664   KLQ  656
             KLQ
Sbjct  337   KLQ  339



>ref|XP_003781817.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Otolemur garnettii]
Length=351

 Score =   316 bits (810),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 220/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFAPTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K+A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKEALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVIENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM +F++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMISFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_010181705.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Mesitornis unicolor]
Length=349

 Score =   316 bits (810),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  IC +L G ++K A  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKICDQLKGHVKKGAVGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEISVLMGANIANEVAEEKFCETTIGCK-NPQHGQVLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM +FSKL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNIVAVGAGFCDGLGYGDNTKAAVIRLGLMEMISFSKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|KFQ34684.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Mesitornis unicolor]
Length=348

 Score =   316 bits (810),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  IC +L G ++K A  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKICDQLKGHVKKGAVGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEISVLMGANIANEVAEEKFCETTIGCK-NPQHGQVLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM +FSKL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNIVAVGAGFCDGLGYGDNTKAAVIRLGLMEMISFSKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_005021619.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Anas platyrhynchos]
 gb|EOA99825.1| Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, partial 
[Anas platyrhynchos]
Length=349

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 218/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F + V MWV EE +  G +L+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENLVSMWVLEEEV-GGRRLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C++L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCEQLKGHVKKDAIGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NAQYGQILKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKN+VA+AAGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNIVAVAAGFCDGLGFGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>dbj|BAD38675.1| glycerol-3-phosphate dehydrogenase-2 [Bombyx mori]
Length=353

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 218/305 (71%), Gaps = 5/305 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K++V +VGSGNWGS  AK++  N   L++F D V MWV+EE++  G+KL+E+IN+T+ENV
Sbjct  7     KNKVCIVGSGNWGSAIAKIVGRNAASLSNFEDRVTMWVYEEII-EGKKLTEIINETHENV  65

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L  NV+A PD+  AA+DA++L+FV PHQF+  IC  L+GKI+  A A+SLIKG
Sbjct  66    KYLPGHKLPSNVVAVPDVVEAAKDADLLIFVVPHQFVRTICSTLLGKIKPTAAALSLIKG  125

Query  1192  MEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
              ++   G   +IS +IT  L I C VLMGANIA+E+A EKF E T+G R+   +A     
Sbjct  126   FDIAEGGGIDLISHIITRCLKIPCAVLMGANIASEVAEEKFCETTIGCRDVM-LAPLMRD  184

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +  T YF V  V D + VE+CG LKN+VA+ AGFVDGL  G+NTKAA++R+GL EM  F 
Sbjct  185   IIQTDYFRVVVVDDEDAVEICGALKNIVAVGAGFVDGLGYGDNTKAAVIRLGLMEMIKFV  244

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
              + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  RS  ELE EML GQKLQ
Sbjct  245   DVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--RSIKELEDEMLNGQKLQ  302

Query  655   VHQTA  641
                TA
Sbjct  303   GPITA  307



>gb|AAI05514.1| GPD1 protein [Bos taurus]
Length=343

 Score =   316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 214/300 (71%), Gaps = 5/300 (2%)
 Frame = -1

Query  1537  VVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKYLPG  1358
             +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKYLPG
Sbjct  2     IVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKYLPG  60

Query  1357  IQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGMEVKM  1178
              +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++   
Sbjct  61    HKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGVDEGP  120

Query  1177  EGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFNTPY  998
             +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N+   Q   +L  TP 
Sbjct  121   KGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NQAHGQLLKELMQTPN  179

Query  997   FMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLLFP-  821
             F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL    
Sbjct  180   FRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSG  239

Query  820   SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQTA  641
             SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  QTA
Sbjct  240   SVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGPQTA  297



>gb|ETN67939.1| glycerol-3-phosphate dehydrogenase [Anopheles darlingi]
Length=350

 Score =   316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 220/306 (72%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K RV +VGSGNWGS  AK++  N  +L  F D V M+V+EE++  G+KL+E+IN T+EN
Sbjct  3     DKVRVCIVGSGNWGSAIAKIVGVNAKRLPEFEDRVTMYVYEEMI-DGKKLTEIINTTHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L +N++A PD+  AA+DA++L+FV PHQF+ G+  +L+GKI+  A  +SLIK
Sbjct  62    VKYLPGHKLPENIVAVPDVVEAAKDADILIFVVPHQFIRGLGTQLLGKIKPTAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G +V   G   +IS LIT+ L I C VLMGAN+A E+A EKF E T+G R+ K IAQ   
Sbjct  122   GFDVAEGGGMELISHLITKHLKIPCSVLMGANLAGEVAEEKFCETTIGCRDMK-IAQTLR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              LF TP F V  V DV+ VE+CG LKN+VA  AGFVDG+  G+NTKAA++R+GL EM  F
Sbjct  181   DLFQTPNFRVVVVDDVDAVEICGALKNIVACGAGFVDGMGSGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + +P  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++  +LE EML GQKL
Sbjct  241   VDVFYPGSKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIKQLEDEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPITA  304



>ref|NP_001036970.1| glycerol-3-phosphate dehydrogenase-1 [Bombyx mori]
 dbj|BAD38674.1| glycerol-3-phosphate dehydrogenase-1 [Bombyx mori]
Length=362

 Score =   317 bits (811),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 218/305 (71%), Gaps = 5/305 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K++V +VGSGNWGS  AK++  N   L++F D V MWV+EE++  G+KL+E+IN+T+ENV
Sbjct  7     KNKVCIVGSGNWGSAIAKIVGRNAASLSNFEDRVTMWVYEEII-EGKKLTEIINETHENV  65

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L  NV+A PD+  AA+DA++L+FV PHQF+  IC  L+GKI+  A A+SLIKG
Sbjct  66    KYLPGHKLPSNVVAVPDVVEAAKDADLLIFVVPHQFVRTICSTLLGKIKPTAAALSLIKG  125

Query  1192  MEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
              ++   G   +IS +IT  L I C VLMGANIA+E+A EKF E T+G R+   +A     
Sbjct  126   FDIAEGGGIDLISHIITRCLKIPCAVLMGANIASEVAEEKFCETTIGCRDVM-LAPLMRD  184

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +  T YF V  V D + VE+CG LKN+VA+ AGFVDGL  G+NTKAA++R+GL EM  F 
Sbjct  185   IIQTDYFRVVVVDDEDAVEICGALKNIVAVGAGFVDGLGYGDNTKAAVIRLGLMEMIKFV  244

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
              + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  RS  ELE EML GQKLQ
Sbjct  245   DVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--RSIKELEDEMLNGQKLQ  302

Query  655   VHQTA  641
                TA
Sbjct  303   GPITA  307



>ref|XP_006030269.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Alligator sinensis]
Length=365

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/300 (54%), Positives = 216/300 (72%), Gaps = 9/300 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK+I SN  K+  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     RVCIVGSGNWGSAVAKIIGSNVKKMQKFASTVKMWVFEENV-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA+MLVFV PHQF+  IC ++ G++ + A  I+LIKG++
Sbjct  68    LPGYKLPENVVAIPNLNEAVQDADMLVFVIPHQFIHKICDEIRGRVPRRAVGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  + +   +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLLFK---EL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAFAK  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K+G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKSG--KSIEELEQEMLNGQKLQ  302



>ref|XP_003507879.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Cricetulus griseus]
 ref|XP_007646607.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Cricetulus griseus]
 ref|XP_007646608.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Cricetulus griseus]
 ref|XP_007634865.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Cricetulus griseus]
Length=349

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAARLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +   ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDIVQAAVDADILIFVVPHQFIGKICDQLKGHLKANTIGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G +++ +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDSAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CRGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>emb|CDU18121.1| glycerol-3-phosphate dehydrogenase [Plasmodium yoelii]
 emb|CDZ12394.1| glycerol-3-phosphate dehydrogenase [Plasmodium yoelii]
Length=400

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 219/303 (72%), Gaps = 4/303 (1%)
 Frame = -1

Query  1558  NNKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             N   +V+++GSG+WG+V +K+I+ NT + N FH  VRM+V EE++   EKLS++INKT E
Sbjct  44    NGPLKVSIIGSGSWGTVISKIISENTQRSNIFHPIVRMYVNEEII-DNEKLSDIINKTKE  102

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAIS  1205
             NVKY+ G++L  N++A PD++    DA++LVFV PHQ++E    +++    ++  A+AIS
Sbjct  103   NVKYMKGMKLPNNIVAIPDIDKVIEDADLLVFVVPHQYLETTLSEILKNKNLKSTAKAIS  162

Query  1204  LIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQK  1025
             L+KG+++    P ++S +I   L I C VL G+NIA+E++ E FSEAT+G+ EN E A+ 
Sbjct  163   LMKGIKICDYKPMLLSNIIENMLNIECSVLSGSNIASELSTESFSEATIGF-ENLETAEI  221

Query  1024  WVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMK  845
             W +LF+  YF ++ +QD  GVE+CG LKNVVAL  GF +  +   NTK+AI+RIGL EMK
Sbjct  222   WRELFDRNYFKINCIQDKSGVEMCGALKNVVALGVGFSEAFKKSYNTKSAIIRIGLEEMK  281

Query  844   AFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQ  665
              F+KL FP+V + TF +SCGVADVI TCLGGRN KCA  FA   G+ S+D++E+E+L GQ
Sbjct  282   KFAKLFFPNVLDETFLDSCGVADVIATCLGGRNVKCATEFAFRNGQDSWDKIESELLNGQ  341

Query  664   KLQ  656
             KLQ
Sbjct  342   KLQ  344



>ref|XP_004006413.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform 1 [Ovis aries]
Length=372

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             ++ +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  28    KICIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  86

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ DA  +SLIKG++
Sbjct  87    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADAIGVSLIKGVD  146

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N    Q   +L  
Sbjct  147   EGPKGLKLISEVIGERLGIPISVLMGANIANEVADEKFCETTIGSK-NMAHGQLLKELMQ  205

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  206   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  265

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  266   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  323

Query  649   QTA  641
              TA
Sbjct  324   LTA  326



>emb|CDS14221.1| hypothetical protein LRAMOSA06391 [Absidia idahoensis var. thermophila]
Length=365

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 212/335 (63%), Gaps = 25/335 (7%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNE  1379
             NK RV+++GSGNWGS   K+I  N LK    F  EVR WVFEE    GEKL+ +IN+ +E
Sbjct  7     NKERVSIIGSGNWGSAVGKIIGQNVLKHKDIFETEVRQWVFEETF-KGEKLTTLINRDHE  65

Query  1378  NVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLI  1199
             N KYLPGI+   N+ A PDL  A RDA +LVFV PHQF+  +C  L GKI  +A AISLI
Sbjct  66    NPKYLPGIKFTDNIKATPDLLEACRDATVLVFVLPHQFVREVCDDLAGKISPNARAISLI  125

Query  1198  KGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             KG+++K +   + S  I ++LG+    L GANIA+E+A EKF E T+G     E    + 
Sbjct  126   KGLDIKPDQVVLFSEEIAKRLGLRVAALSGANIADEVAQEKFCETTIG--STLEDGDLFY  183

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGL-------------------EM  896
             +LFNTPYF V+ +QD  GV+LCG LKNVVA+ AGF DGL                     
Sbjct  184   KLFNTPYFRVNVIQDAVGVQLCGALKNVVAVGAGFSDGLGSVVGGRSCMLLKDGIFLIRY  243

Query  895   GNNTKAAIMRIGLREMKAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKN  716
             G+NTKAAI+R GL EM+ F +  F +V+  TFFESCGVAD+ITTC GGRNR+ A+AF K 
Sbjct  244   GSNTKAAIIRRGLLEMRKFGQTFFGTVENETFFESCGVADLITTCAGGRNRRVAEAFVKT  303

Query  715   GGKRSFDELEAEMLQGQKLQVHQTAMGYIELFLPR  611
             G  +  D LE E+L GQKLQ   TA    +   PR
Sbjct  304   G--KPIDVLEQELLHGQKLQGTLTAKEVHDFLAPR  336



>ref|XP_009673116.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Struthio camelus australis]
Length=349

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ +N  +L +F + V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGTNAARLGTFENRVSMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLKLISDIIREKLGIEMSVLMGANIANEVADEKFCETTIGCK-NTQHGQMLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVSVVQEADTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIDFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|EIE84166.1| glycerol-3-phosphate dehydrogenase [NAD+] [Rhizopus delemar RA 
99-880]
Length=342

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 215/315 (68%), Gaps = 5/315 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             K +V VVGSGNWGS   K+++ N L+    F  +VR WVFEE    GEKL+ +IN+  EN
Sbjct  2     KEKVCVVGSGNWGSAIGKIVSENVLRYPEVFEPQVRQWVFEEDF-RGEKLTTIINREREN  60

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
              KYLPGIQ   N++A PDL  A+RDA++LVFV PHQF+ G+C+++   I   A AISLIK
Sbjct  61    PKYLPGIQFPSNLVAVPDLVQASRDASLLVFVLPHQFVRGVCEQMKAHIAPHARAISLIK  120

Query  1195  GMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
             G+E++ +   + S  I  +LGI    L GANIA+E+A EKF E T+G ++  +  + + +
Sbjct  121   GLEIEPDKVTLFSEEIARKLGIRVSALSGANIADEVAQEKFCETTIGSQDEAD-GRLFHK  179

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             LF+T YF V+ ++D  GVELCG LKNVVA+ AG  DGL  G+NTKAAI+R+GL EM+ F 
Sbjct  180   LFHTHYFKVNVIRDYVGVELCGALKNVVAVGAGISDGLGYGSNTKAAIIRLGLMEMRKFG  239

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +  F +V++STFFESCGVAD+ITTC GGRNRK A+AF K   ++  D LE E+L GQKLQ
Sbjct  240   QTFFGTVQDSTFFESCGVADLITTCSGGRNRKVAEAFVKT--RQPIDVLEKELLNGQKLQ  297

Query  655   VHQTAMGYIELFLPR  611
                TA    +    R
Sbjct  298   GTLTAQEVYQFLSAR  312



>ref|XP_010560718.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Haliaeetus leucocephalus]
Length=353

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     RVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAVPNLNEAVQDADLLVFVIPHQFIHKVCDEITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLCCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>gb|KFV81244.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Struthio camelus australis]
Length=348

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ +N  +L +F + V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGTNAARLGTFENRVSMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADILLFVVPHQFIGKVCDQLKGHVKKDAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLKLISDIIREKLGIEMSVLMGANIANEVADEKFCETTIGCK-NTQHGQMLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVSVVQEADTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIDFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_009462557.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Nipponia nippon]
Length=349

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N +  Q    L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIASEVAEEKFCETTIGCK-NMQHGQTLKDLMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|KFQ96352.1| Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic, partial 
[Nipponia nippon]
Length=348

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L++F ++V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSTFENQVNMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++KDA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKDAVGVSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G + N +  Q    L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIASEVAEEKFCETTIGCK-NMQHGQTLKDLMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVTVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|EPB86832.1| glycerol-3-phosphate dehydrogenase [NAD+] [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=355

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 215/304 (71%), Gaps = 5/304 (2%)
 Frame = -1

Query  1564  PDNNKSRVTVVGSGNWGSVAAKLIASNTLKLNS-FHDEVRMWVFEEVLPTGEKLSEVINK  1388
             P   K +VT++GSGNWGS  A++ A NT++    F  EVRMWVFEE +  G+ L+++IN+
Sbjct  2     PGLPKQKVTIIGSGNWGSSIARVCAQNTIRHPELFEREVRMWVFEEQI-DGKNLTDIINE  60

Query  1387  TNENVKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAI  1208
              +ENVKYLPGI LG+NV+A PD++ AA+ AN+LVFV PHQF+  +C+ L G   KD  AI
Sbjct  61    KHENVKYLPGINLGENVVAVPDVQEAAKGANVLVFVLPHQFVYKVCESLRGVTDKDCRAI  120

Query  1207  SLIKGMEVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQ  1028
             SLIKG++ K     + S  I + LGI+C  L GANIA+E+A E+F E T+  R+ K+  +
Sbjct  121   SLIKGLDYKNNNLLIFSEEIEKILGIHCAALSGANIASEVAEEQFGETTIACRDPKD-GE  179

Query  1027  KWVQLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREM  848
              + +LF+T YF V+ + D  G+++CG LKNVVAL AG  DGL  GNNTK+A++R GL EM
Sbjct  180   IFYRLFHTDYFDVNVIGDWRGLQVCGALKNVVALGAGICDGLHYGNNTKSAVIRRGLLEM  239

Query  847   KAFSKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQG  668
             + F K  F  V   T+FESCGVAD+ITTC GGRNRK A AF K+G  +S +E+E EML G
Sbjct  240   RKFGKTFFGGVHTETYFESCGVADLITTCAGGRNRKVAAAFIKSG--KSIEEIEKEMLNG  297

Query  667   QKLQ  656
             QKLQ
Sbjct  298   QKLQ  301



>ref|XP_009002017.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
[Callithrix jacchus]
Length=349

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDI-GGKKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E LGI   VLMGANIA+E+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGEHLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_009896624.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Picoides pubescens]
Length=353

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  +L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     KVCIVGSGNWGSAVAKIIGNNVKQLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPENVVAVPNLNEAVQDADLLVFVIPHQFIHKVCDQITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>gb|KFV65669.1| Glycerol-3-phosphate dehydrogenase 1-like, partial [Picoides 
pubescens]
Length=360

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  +L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  16    KVCIVGSGNWGSAVAKIIGNNVKQLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  74

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  75    LPGYKLPENVVAVPNLNEAVQDADLLVFVIPHQFIHKVCDQITGRVPKKALGITLIKGID  134

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  135   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  191

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  192   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAFAR  251

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  252   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  309

Query  655   VHQTA  641
               QT+
Sbjct  310   GPQTS  314



>ref|XP_005062139.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Ficedula albicollis]
Length=349

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+  SN  +L+SF  +V MWV +E +  G +L+++IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIAGSNAARLSSFESQVNMWVLQEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++K+A  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKEAVGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q   +L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCK-NMKHGQMLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQD + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  FSKL 
Sbjct  183   TPNFRVSVVQDADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFSKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTPATFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_005488006.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Zonotrichia albicollis]
Length=349

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  A++I  N  K N F   V+MWVFEE++  G KLSE+INK +ENVKY
Sbjct  5     RVCIVGSGNWGSAIARIIGKNVQKSNRFDPTVKMWVFEEII-NGRKLSEIINKEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++  NV+A PD+  AA  A++LVFV PHQF+  IC ++ G+I+     ISLIKG++
Sbjct  64    LPGYKIPHNVVAVPDVAEAANGADILVFVLPHQFIGRICGQIAGQIKPGTFGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I EQL I   VLMGANIA E+A EKF E T+G + N+   + + +L  
Sbjct  124   EGPDGLKLISDIIREQLKIEISVLMGANIAKEVADEKFCETTIGCK-NEAQGEIFKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  183   TPNFRITVVLDSDTVELCGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMVAFAKMF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CKGPVSIATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_003397689.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic-like 
[Bombus terrestris]
Length=368

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K RV ++GSGNWGS  AK++ +N  KLN+F D V M+V+EE +  G+KL+E+IN+T+EN
Sbjct  3     DKQRVCIIGSGNWGSAIAKIVGANAAKLNNFEDRVTMYVYEETI-NGKKLTEIINETHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L  NVIA PD+  AA DA++L+FV PHQF+  IC  L+GKI+  A  +SL+K
Sbjct  62    VKYLPGHKLPPNVIAVPDVVKAAEDADILIFVIPHQFINKICSTLLGKIKPTAVGLSLVK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G + K  G   +IS +IT+QL I   VLMGAN+A+E+A E F E T+G ++ K +A    
Sbjct  122   GFDKKEGGGIELISHIITKQLHIPVSVLMGANLASEVAEEMFCETTIGCKD-KNMASILR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              +  TPYF V  V+DV+ VE CG LKN+VA AAGFVDGL +G+NTKAA++R+GL EM  F
Sbjct  181   DIIQTPYFRVVVVEDVDSVECCGALKNIVACAAGFVDGLGLGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + FP  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++ +ELE EML GQKL
Sbjct  241   VDVFFPGGKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIEELEKEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPFTA  304



>ref|XP_006970317.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Peromyscus maniculatus bairdii]
Length=351

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N   L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKNLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHKICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  +     + +L  
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMQN-GLLFKELLQ  184

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  185   TPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIF  244

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  ++ +ELE EML GQKLQ  
Sbjct  245   CKGQVSTATFLESCGVADLITTCYGGRNRKVAEAFARTG--KTIEELEKEMLNGQKLQGP  302

Query  649   QTA  641
             QT+
Sbjct  303   QTS  305



>gb|ADB28156.1| glycerol-3-phosphate dehydrogenase 1 [Sus scrofa]
Length=349

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAGRLAHFDPRVTMWVFEEDV-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  A+ DA++L+FV PHQF+  IC +L G ++ DA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQASADADILIFVVPHQFIGKICDQLKGHLKADAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ--L  1013
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G    K++AQ  +Q  L
Sbjct  124   EGPDGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGC---KDLAQGQLQKEL  180

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ VQ+V+ VE CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  181   MQTPNFRITVVQEVDTVEFCGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK  240

Query  832   LL-FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             L     V  +TF ESCG+AD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ
Sbjct  241   LFCHGPVSSATFLESCGIADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQ  298

Query  655   VHQTA  641
               QTA
Sbjct  299   GPQTA  303



>ref|XP_010815754.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Bos taurus]
Length=330

 Score =   314 bits (804),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVRKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ KDA  I+LIKG++
Sbjct  66    LPGHKLPENVVAVANLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKDALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A  KF E T+G +  EN  + +   +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAGKFCETTIGSKIMENGLLFK---EL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLLCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRKVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_005242319.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Falco peregrinus]
Length=353

 Score =   315 bits (806),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEENV-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAVPNLNEAVQDADLLVFVIPHQFIHKVCDEITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKIVENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLCCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             L     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   LFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>ref|XP_009097270.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Serinus canaria]
Length=349

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V VVGSGNWGS  AK+  SNT +L SF  +V MWV EE +  G +L+++IN  +ENVKY
Sbjct  5     KVCVVGSGNWGSAIAKIAGSNTARLGSFESQVNMWVLEEEV-GGRRLTDIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A+PDL  A   A++L+FV PHQF+  +C +L G ++K+A  +SLIKG++
Sbjct  64    LPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKEAIGMSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N +  Q    L  
Sbjct  124   EGPDGLRLISDIIHEKLGIEMNVLMGANIANEVAEEKFCETTIGCK-NMKHGQMLKDLMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F VS VQ+ + VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM  F+KL 
Sbjct  183   TPNFRVSVVQEADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  STF ESCGVAD+ITTC GGRNRK A+AFAK G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVTSSTFLESCGVADLITTCYGGRNRKVAEAFAKTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|KFW80215.1| Glycerol-3-phosphate dehydrogenase 1-like, partial [Manacus vitellinus]
Length=348

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  A++I  N  K N F   V+MWVFEE++  G KL+E+IN+ +ENVKY
Sbjct  5     RVCIVGSGNWGSAIARIIGKNVQKSNRFDPTVKMWVFEEII-NGRKLTEIINQEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++  NV+A PD+  AA  A++LVFV PHQF+  IC+++ G+I+     ISLIKG++
Sbjct  64    LPGYKIPHNVVAVPDVAEAANGADILVFVLPHQFIGRICEQIAGQIKPGTFGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS LI E L I   VLMGANIA E+A EKF E T+G + NK   + + +L  
Sbjct  124   DGPDGLKLISDLIREHLKIEISVLMGANIAKEVADEKFCETTIGCK-NKTQGEIFKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  183   TPNFRITVVPDSDTVELCGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMVAFAKMF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CKGPVSIATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELENEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>gb|AGW15345.1| glycerol-3-phosphate dehydrogenase, partial [Spodoptera exigua]
Length=353

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 218/305 (71%), Gaps = 5/305 (2%)
 Frame = -1

Query  1552  KSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENV  1373
             K+RV ++GSGNWGS  AK++  N  +L +F D V MWV+EE++  G+KL+E+IN+T+ENV
Sbjct  7     KNRVCIIGSGNWGSAIAKIVGRNAARLPNFEDRVTMWVYEEMI-EGKKLTEIINETHENV  65

Query  1372  KYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKG  1193
             KYLPG +L  NV+A P++  AA+DA++L+FV PHQF+  IC  L+GKI+  A A+SLIKG
Sbjct  66    KYLPGHKLPPNVVAIPEVVDAAKDADLLIFVVPHQFVRTICSTLLGKIKPTAAALSLIKG  125

Query  1192  MEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQ  1016
              ++   G   +IS +IT  L I C VLMGANIA+E+A EKF E T+G R+   +A     
Sbjct  126   FDIAEGGGIDLISHIITRCLKIPCAVLMGANIASEVAEEKFCETTIGCRDVM-LAPMMRD  184

Query  1015  LFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFS  836
             +  T YF V  V D + VE+CG LKN+VA+ AGFVDGL  G+NTKAA++R+GL EM  F 
Sbjct  185   IIQTEYFRVVVVDDEDAVEICGALKNIVAVGAGFVDGLGFGDNTKAAVIRLGLMEMIKFV  244

Query  835   KLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
              + +P  K STFFESCGVAD+ITTC GGRNR+ A+AF K G  RS  ELE EML GQKLQ
Sbjct  245   DVFYPGSKLSTFFESCGVADLITTCYGGRNRRVAEAFVKTG--RSIKELEDEMLNGQKLQ  302

Query  655   VHQTA  641
                TA
Sbjct  303   GPITA  307



>ref|XP_007251891.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Astyanax mexicanus]
Length=351

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 215/301 (71%), Gaps = 10/301 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  A++I SN  KL  F   V+MWV+EE +  G KL+++IN  +ENVKY
Sbjct  6     KVCIVGSGNWGSAIARIIGSNAQKLQHFATTVKMWVYEENI-NGRKLTDIINTEHENVKY  64

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P L  AA  A++LVFV PHQF+  +C ++VG + + A  I+LIKG++
Sbjct  65    LPGYKLPENVVAVPQLRDAAEGADLLVFVVPHQFIRKLCDEMVGCVSQKARGITLIKGID  124

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN    Q + +L
Sbjct  125   EGPEGLKLISDIIREKMGIDVSVLMGANIANEVAAEKFCETTIGSKILEN---GQLFKEL  181

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               T  F ++ V D + VELCG LKN+VA+ AGF DGL+ G+NTKAA++R+GL EM AF+K
Sbjct  182   LQTSNFRITVVDDADTVELCGALKNIVAVGAGFCDGLQCGDNTKAAVIRLGLMEMIAFAK  241

Query  832   LLFP--SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
             L     SV  +TF ESCGVAD+ITTC GGRNR+ A+AFAK G  +S +ELE EML GQKL
Sbjct  242   LFSKDGSVSSATFLESCGVADLITTCYGGRNRRVAEAFAKTG--KSIEELENEMLNGQKL  299

Query  658   Q  656
             Q
Sbjct  300   Q  300



>ref|XP_008921195.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Manacus vitellinus]
Length=349

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  A++I  N  K N F   V+MWVFEE++  G KL+E+IN+ +ENVKY
Sbjct  5     RVCIVGSGNWGSAIARIIGKNVQKSNRFDPTVKMWVFEEII-NGRKLTEIINQEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++  NV+A PD+  AA  A++LVFV PHQF+  IC+++ G+I+     ISLIKG++
Sbjct  64    LPGYKIPHNVVAVPDVAEAANGADILVFVLPHQFIGRICEQIAGQIKPGTFGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS LI E L I   VLMGANIA E+A EKF E T+G + NK   + + +L  
Sbjct  124   DGPDGLKLISDLIREHLKIEISVLMGANIAKEVADEKFCETTIGCK-NKTQGEIFKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  183   TPNFRITVVPDSDTVELCGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMVAFAKMF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CKGPVSIATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELENEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_009286908.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Aptenodytes forsteri]
Length=353

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 216/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     KVCIVGSGNWGSAVAKIIGGNVKKLQKFASTVKMWVFEENV-NGRKLTDIINSEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G+I K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAVPNLNEAVQDADLLVFVIPHQFIHKVCDEITGRIPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLCCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEQEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>ref|XP_005067290.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Mesocricetus auratus]
Length=349

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 217/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ SN  +L  F   V +WVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGSNAARLAHFDPRVTIWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +   ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLRGHLKANTIGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G +++ +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDSAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCG+AD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGSVSSATFLESCGIADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|NP_001177169.1| glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic [Sus scrofa]
Length=349

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAGRLAHFDPRVTMWVFEEDV-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  A+ DA++L+FV PHQF+  IC +L G ++ DA  +SLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQASADADILIFVVPHQFIGKICDQLKGHLKADAIGLSLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPDGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGCKDLAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F V+ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRVTVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   -FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCG+AD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CHGPVSSATFLESCGIADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_004603906.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Sorex araneus]
Length=351

 Score =   314 bits (805),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N   LN F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKNLNKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHRVCDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV--QL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G   +K +A   +  +L
Sbjct  126   EGPEGLKLISNIIREKMGIDISVLMGANIASEVAAEKFCETTIG---SKVMANGLLFKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFSDGLGCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFAK G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFAKTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_006004372.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Latimeria chalumnae]
Length=348

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 218/313 (70%), Gaps = 4/313 (1%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV ++GSGNWGS  AK+I  N    N F   ++MWVFEE++  G+KL+E+IN  +ENVKY
Sbjct  5     RVCIIGSGNWGSAIAKIIGRNAAGSNRFDPIIKMWVFEEII-NGKKLTEIINTEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L KNV+A PD+  A+  A++L+FV PHQF+  IC ++   I+  A  ISLIKG++
Sbjct  64    LPGRKLPKNVVAVPDVVEASVGADILIFVLPHQFIGRICDQMASHIKPGAYGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  ++S +I E+L I   VLMGANIANE+A EKF E T+G + N+   Q + +L  
Sbjct  124   EGPDGLKLVSDIIREKLNIEVSVLMGANIANEVADEKFCETTIGCK-NENHGQIFKELLQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V+D + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVKDCDTVEMCGALKNIVAVGAGFSDGLGFGDNTKAAVIRLGLMEMVAFAKLF  242

Query  826   FPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVHQ  647
                V  +TF ESCGVAD+ITTC GGRNRK ++AF K G  +S +ELE EML GQKLQ  Q
Sbjct  243   CGEVSSATFLESCGVADLITTCYGGRNRKVSEAFVKTG--KSIEELEKEMLNGQKLQGPQ  300

Query  646   TAMGYIELFLPRT  608
             T+    ++   R+
Sbjct  301   TSAEVYKILRQRS  313



>ref|NP_001126675.1| glycerol-3-phosphate dehydrogenase 1-like protein [Pongo abelii]
 sp|Q5R5V3.1|GPD1L_PONAB RecName: Full=Glycerol-3-phosphate dehydrogenase 1-like protein 
[Pongo abelii]
 emb|CAH92863.1| hypothetical protein [Pongo abelii]
Length=351

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAISNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_003483187.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Sus scrofa]
Length=351

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGDNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ KDA  I+LIKG++
Sbjct  66    LPGHKLPENVVAVANLGEAVKDADLLVFVIPHQFIHRICDEITGRVPKDALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A  KF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAGKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QTA
Sbjct  301   GPQTA  305



>ref|XP_005877362.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Myotis brandtii]
 gb|EPQ14607.1| Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic [Myotis 
brandtii]
Length=349

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V ++GSGNWGS  AK++  N  KL  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCILGSGNWGSAIAKIVGGNAAKLAHFDPRVTMWVFEEDV-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  +SLIKG++
Sbjct  64    LPGHKLPSNVVAVPDVVQAAVDADILIFVVPHQFISKICDQLKGHLKANAIGMSLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPVNVLMGANIANEVADEKFCETTIGCKDQAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FPS-VKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CKGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_003252212.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform 1 [Nomascus leucogenys]
Length=349

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G+KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDI-GGKKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G ++  +  Q   +L  
Sbjct  124   KGPSGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKNVVA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             +TA
Sbjct  301   ETA  303



>ref|NP_001083978.1| glycerol-3-phosphate dehydrogenase 1 (soluble) [Xenopus laevis]
 gb|AAH77965.1| Gpd1 protein [Xenopus laevis]
 gb|AAH43631.2| Gpd1 protein [Xenopus laevis]
Length=348

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 219/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F + V+MWVFEE++  G+KL+E+IN  +ENVKY
Sbjct  4     KVCIVGSGNWGSAIAKIVGDNAARLPQFDNIVKMWVFEELI-GGKKLTEIINSEHENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PDL  A+  A++L+FV PHQF+  +C +L   ++K+A  +SLIKG++
Sbjct  63    LPGHKLPANVVAVPDLLEASAGADILIFVVPHQFIGKLCDQLKSHVKKEAFGMSLIKGVD  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E+LGI   VLMGANIANE+A  KF E T+G + NKE  +   +LF 
Sbjct  123   EGPEGLRLISDIIQERLGIQMSVLMGANIANEVADGKFCETTIGCK-NKEQGKILKELFQ  181

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V++ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AFSKL 
Sbjct  182   TPNFRITVVEEKDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFSKLF  241

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK  +AFA+ G  +S ++LE EML GQKLQ  
Sbjct  242   CTGSVTSATFLESCGVADLITTCYGGRNRKVGEAFARTG--KSIEQLEQEMLNGQKLQGP  299

Query  649   QTA  641
             QT+
Sbjct  300   QTS  302



>ref|XP_003895264.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Papio anubis]
 ref|XP_008007558.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X2 [Chlorocebus sabaeus]
 ref|XP_010352763.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Rhinopithecus roxellana]
Length=351

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAISNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_008060463.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Tarsius syrichta]
Length=349

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  5     KVCIVGSGNWGSAIAKIVGGNAAQLARFDPRVAMWVFEEDI-GGRKLTEIINTQHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ +A  ISLIKG++
Sbjct  64    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVD  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS +I E+LGI   VLMGANIA+E+A EKF E T+G ++  +  Q   +L  
Sbjct  124   EGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQ-GQLLKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  183   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  243   CSGQVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  300

Query  649   QTA  641
             QTA
Sbjct  301   QTA  303



>ref|XP_005981015.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic 
isoform X1 [Pantholops hodgsonii]
Length=372

 Score =   315 bits (806),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             ++ +VGSGNWGS  AK++  N  +L  F   V MWVFEE +  G KL+E+IN  +ENVKY
Sbjct  28    KICIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDI-GGRKLTEIINTQHENVKY  86

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PD+  AA DA++L+FV PHQF+  IC +L G ++ D   +SLIKG++
Sbjct  87    LPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIKGVD  146

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS +I E+LGI   VLMGANIANE+A EKF E T+G + N    Q   +L  
Sbjct  147   EGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSK-NMAHGQLLKELMQ  205

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ VQ+V+ VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  206   TPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  265

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S ++LE EML GQKLQ  
Sbjct  266   CSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEQLEKEMLNGQKLQGP  323

Query  649   QTA  641
              TA
Sbjct  324   PTA  326



>ref|XP_008828690.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X1 [Nannospalax galili]
 ref|XP_008828691.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X2 [Nannospalax galili]
Length=351

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N   L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKNLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHKICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  +     + +L  
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMQN-GLLFKELLQ  184

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+++ 
Sbjct  185   TPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIF  244

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  ++ +ELE EML GQKLQ  
Sbjct  245   CKGQVSTATFLESCGVADLITTCYGGRNRKVAEAFARTG--KTIEELEKEMLNGQKLQGP  302

Query  649   QTA  641
             QT+
Sbjct  303   QTS  305



>ref|XP_004676412.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Condylura cristata]
Length=351

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  +L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKQLKKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFSDGLCCGDNTKAAVIRLGLMEMIAFAK  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFAK G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFAKTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_003486248.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic-like 
[Bombus impatiens]
Length=350

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 221/306 (72%), Gaps = 5/306 (2%)
 Frame = -1

Query  1555  NKSRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNEN  1376
             +K RV ++GSGNWGS  AK++ +N  KLN+F D V M+V+EE +  G+KL+E+IN+T+EN
Sbjct  3     DKQRVCIIGSGNWGSAIAKIVGANAAKLNNFEDRVTMYVYEETI-NGKKLTEIINETHEN  61

Query  1375  VKYLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIK  1196
             VKYLPG +L  NVIA PD+  AA DA++L+FV PHQF+  IC  L+GKI+  A  +SLIK
Sbjct  62    VKYLPGHKLPPNVIAVPDVVKAAEDADILIFVIPHQFINKICSTLLGKIKPTAVGLSLIK  121

Query  1195  GMEVKMEGPC-MISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWV  1019
             G + K  G   +IS +I +QL I   VLMGAN+A+E+A E F E T+G ++ K +A    
Sbjct  122   GFDKKEGGGIELISHIINKQLHIPVSVLMGANLASEVAEEMFCETTIGCKD-KNMASILR  180

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
              +  TPYF V  V+DV+ VE CG LKN+VA AAGFVDGL +G+NTKAA++R+GL EM  F
Sbjct  181   DIIQTPYFRVVVVEDVDSVECCGALKNIVACAAGFVDGLGLGDNTKAAVIRLGLMEMIKF  240

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + FP  K STFFESCGVAD+ITTC GGRNRK ++AF K G  ++ +ELE EML GQKL
Sbjct  241   VDVFFPGGKLSTFFESCGVADLITTCYGGRNRKVSEAFVKTG--KTIEELEKEMLNGQKL  298

Query  658   QVHQTA  641
             Q   TA
Sbjct  299   QGPFTA  304



>emb|CEG68204.1| Putative Glycerol-3-phosphate dehydrogenase [NAD ] [Rhizopus 
microsporus]
Length=343

 Score =   313 bits (803),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 226/328 (69%), Gaps = 9/328 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNT-LKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             +V ++GSGNWGS  AK++ +NT +  + F   VR WVFEE +  G KL+++IN  +ENVK
Sbjct  5     KVCIIGSGNWGSAIAKIVGTNTAVHSDQFEPTVRQWVFEEQI-DGRKLTDIINTEHENVK  63

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YL GI+L +NV+A PD+  A   A+++VFV PHQF++G+C+K+ G +  +A AISLIKG+
Sbjct  64    YLKGIKLPENVVAIPDVVKACEGASLVVFVVPHQFLKGVCEKMKGHLAPNARAISLIKGL  123

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             E+  EG  + S  IT  L I C  L GANIANE+A+EKF E+T+G  +N E    + +LF
Sbjct  124   EITAEGTRLFSEEITRILNIPCAALSGANIANEVAMEKFCESTIGC-QNMEDGMVFKKLF  182

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             NTPYF +S +QD  GV+LCG LKNVVA+ AG  DGL  G+NTKAAI+R+GL EM+ F + 
Sbjct  183   NTPYFRISVIQDHVGVQLCGALKNVVAVGAGLSDGLGHGSNTKAAIIRLGLMEMRKFGQT  242

Query  829   LF-PSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
              F  +V+  TFFESCG AD+ITTC GGRNRK A+AF + G  +  ++LE E+L GQKLQ 
Sbjct  243   FFGDAVQTETFFESCGAADLITTCNGGRNRKVAEAFVQTG--KPIEQLEEELLNGQKLQG  300

Query  652   HQTAMGYIELFLPRT*KE--PLTKNTAY  575
               TA    E    R+ ++  PL  NT Y
Sbjct  301   TLTAQEVNEFLSARSMQKEFPLF-NTVY  327



>ref|XP_002372025.1| glycerol-3-phosphate dehydrogenase, putative [Toxoplasma gondii 
ME49]
Length=401

 Score =   316 bits (809),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 217/312 (70%), Gaps = 5/312 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV V+GSGNWGSV  K+ A N  +   FHD+VRMWVFEE++  G+KL+++IN+ +ENVKY
Sbjct  24    RVAVIGSGNWGSVIGKICAQNAERSYVFHDQVRMWVFEEMI-EGQKLTDIINQKHENVKY  82

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGK--IRKDAEAISLIKG  1193
             LPG +L  N++A PD+  A R A++LVFV PHQF+  +C +L     +   A AISL+KG
Sbjct  83    LPGHKLPDNLVAVPDVVEACRGADLLVFVMPHQFVAKVCDQLAKANVVPSHARAISLLKG  142

Query  1192  MEVKMEGPCMISTLITEQLGI-NCCVLMGANIANEIAVEKFSEATVGYRENK-EIAQKWV  1019
             + V+   P + S  I  +L I  C  L GAN+AN++A E+F+EAT+G+  ++ + A  W 
Sbjct  143   LYVEGGRPQLFSDTIRSKLNIVECAALSGANVANDVAREEFAEATIGHSPDETDTALIWQ  202

Query  1018  QLFNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAF  839
             QLF+ PYF V+ + DV GV+LCG +KNVVALAAGF DGL +G NTK+AI+R+G+ EMK F
Sbjct  203   QLFDKPYFKVNTLPDVAGVQLCGAVKNVVALAAGFCDGLGLGTNTKSAIIRLGVEEMKQF  262

Query  838   SKLLFPSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKL  659
               + F +V   TFF+S G ADVITT  GGRN +CA  F +  G +++D++EAEML GQKL
Sbjct  263   GMIFFDNVIAETFFDSAGYADVITTVFGGRNARCAAEFVRQKGSKTWDQIEAEMLNGQKL  322

Query  658   QVHQTAMGYIEL  623
             Q   TA    E+
Sbjct  323   QGTLTAREVFEV  334



>ref|NP_055956.1| glycerol-3-phosphate dehydrogenase 1-like protein [Homo sapiens]
 ref|XP_003826185.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Pan paniscus]
 sp|Q8N335.1|GPD1L_HUMAN RecName: Full=Glycerol-3-phosphate dehydrogenase 1-like protein; 
Short=GPD1-L [Homo sapiens]
 gb|AAH28726.1| Glycerol-3-phosphate dehydrogenase 1-like [Homo sapiens]
 gb|EAW64422.1| glycerol-3-phosphate dehydrogenase 1-like, isoform CRA_b [Homo 
sapiens]
 dbj|BAF85497.1| unnamed protein product [Homo sapiens]
 dbj|BAG11131.1| glycerol-3-phosphate dehydrogenase 1-like protein [synthetic 
construct]
Length=351

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>pdb|2PLA|A Chain A, Crystal Structure Of Human Glycerol-3-Phosphate Dehydrogenase 
1-Like Protein
 pdb|2PLA|B Chain B, Crystal Structure Of Human Glycerol-3-Phosphate Dehydrogenase 
1-Like Protein
Length=349

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_004279734.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Orcinus orca]
Length=351

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I  N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGDNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC+++ G++ KDA  I+LIKG++
Sbjct  66    LPGHKLPENVVAVANLSEAVQDADLLVFVIPHQFIHRICEEITGRVPKDALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A  KF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAGKFCETTIGSKVIENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_005387582.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Chinchilla lanigera]
Length=351

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P+L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAIPNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A +KF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAADKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM +F+K
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMISFAK  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|NP_001093833.1| glycerol-3-phosphate dehydrogenase 1-like protein [Bos taurus]
 gb|AAI49967.1| GPD1L protein [Bos taurus]
 tpg|DAA17151.1| TPA: glycerol-3-phosphate dehydrogenase 1-like protein [Bos taurus]
Length=351

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVRKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ KDA  I+LIKG++
Sbjct  66    LPGHKLPENVVAVANLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKDALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A  KF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAGKFCETTIGSKIMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLLCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRKVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>emb|CEJ02460.1| Putative Glycerol-3-phosphate dehydrogenase [NAD ] [Rhizopus 
microsporus]
Length=343

 Score =   313 bits (803),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 226/328 (69%), Gaps = 9/328 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNT-LKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             +V ++GSGNWGS  AK++ +NT +  + F   VR WVFEE +  G KL+++IN  +ENVK
Sbjct  5     KVCIIGSGNWGSAIAKIVGTNTAVHSDQFEPTVRQWVFEEQI-DGRKLTDIINTEHENVK  63

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YL GI+L +NV+A PD+  A   A+++VFV PHQF++G+C+K+ G +  +A AISLIKG+
Sbjct  64    YLKGIKLPENVVAIPDVVKACEGASLVVFVVPHQFLKGVCEKMKGHLAPNARAISLIKGL  123

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             E+  EG  + S  IT  L I C  L GANIANE+A+EKF E+T+G  +N E    + +LF
Sbjct  124   EITAEGTRLFSEEITRILDIPCAALSGANIANEVAMEKFCESTIGC-QNMEDGMVFKKLF  182

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
             NTPYF +S +QD  GV+LCG LKNVVA+ AG  DGL  G+NTKAAI+R+GL EM+ F + 
Sbjct  183   NTPYFRISVIQDHVGVQLCGALKNVVAVGAGLSDGLGHGSNTKAAIIRLGLMEMRKFGQT  242

Query  829   LF-PSVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
              F  +V+  TFFESCG AD+ITTC GGRNRK A+AF + G  +  ++LE E+L GQKLQ 
Sbjct  243   FFGDAVQTETFFESCGAADLITTCNGGRNRKVAEAFVQTG--KPIEQLEEELLNGQKLQG  300

Query  652   HQTAMGYIELFLPRT*KE--PLTKNTAY  575
               TA    E    R+ ++  PL  NT Y
Sbjct  301   TLTAQEVNEFLSARSMQKEFPLF-NTVY  327



>ref|XP_005545608.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
isoform X2 [Macaca fascicularis]
 gb|EHH51737.1| hypothetical protein EGM_11173 [Macaca fascicularis]
Length=351

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAISNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAR  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTIEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_004588312.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Ochotona princeps]
Length=351

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 218/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVQKLQKFASTVKMWVFEETV-NGRKLTDIINHDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A  +L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKQALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  EN  +   + +L
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMENGLL---FKEL  182

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K
Sbjct  183   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAK  242

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             L     V  +TF ESCGVAD+ITTC GGRNR+ A+AFA+ G  ++ +ELE EML GQKLQ
Sbjct  243   LFCRGPVATATFLESCGVADLITTCYGGRNRRVAEAFARTG--KTLEELEKEMLNGQKLQ  300

Query  655   VHQTA  641
               QT+
Sbjct  301   GPQTS  305



>ref|XP_005075092.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Mesocricetus auratus]
Length=351

 Score =   313 bits (803),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 215/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK+I +N   L  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  7     KVCIVGSGNWGSAVAKIIGNNVKNLQKFASTVKMWVFEETV-NGRKLTDIINNDHENVKY  65

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L +NV+A P L  A +DA++LVFV PHQF+  IC ++ G++ K A  I+LIKG++
Sbjct  66    LPGHKLPENVVAVPSLSEAVQDADLLVFVIPHQFIHKICDEITGRVPKKALGITLIKGID  125

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E++GI+  VLMGANIA+E+A EKF E T+G +  +     + +L  
Sbjct  126   EGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMQN-GLLFKELLQ  184

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  185   TPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIF  244

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  ++ +ELE EML GQKLQ  
Sbjct  245   CKGQVSMATFLESCGVADLITTCYGGRNRKVAEAFARTG--KTIEELEKEMLDGQKLQGP  302

Query  649   QTA  641
             QT+
Sbjct  303   QTS  305



>ref|XP_002187049.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein-like 
isoform 1 [Taeniopygia guttata]
Length=349

 Score =   313 bits (803),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV ++GSGNWGS  A++I  N  K N F   V+MWVFEE++  G KLSE+IN+ +ENVKY
Sbjct  5     RVCIIGSGNWGSAIARIIGKNVQKSNRFDPTVKMWVFEEII-NGRKLSEIINQEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++  NV+A PD+  AA  A++LVFV PHQF+  +C+++ G+I+     ISLIKG++
Sbjct  64    LPGYKIPHNVVAVPDVAEAANGADVLVFVLPHQFIGRVCEQIAGQIKPGTFGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                 G  +IS LI EQL I   VLMGANIA E+A EKF E T+G + N+   + + +L  
Sbjct  124   EGPHGLKLISDLIREQLKIEISVLMGANIAKEVADEKFCETTIGCK-NETQGEIFKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+K+ 
Sbjct  183   TPNFRITVVLDSDTVELCGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMVAFAKMF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CKGPVSIATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELEKEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_010567308.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
isoform X1 [Haliaeetus leucocephalus]
Length=349

 Score =   313 bits (803),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 216/303 (71%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             RV +VGSGNWGS  A++I  N  K N F   V+MWVFEE++  G KLSE+IN+ +ENVKY
Sbjct  5     RVCIVGSGNWGSAIARIIGKNVQKSNRFDPTVKMWVFEEII-NGRKLSEIINQEHENVKY  63

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG ++ KNV+A PD+  A   A++LVFV PHQF+  IC+++ G+I+     ISLIKG++
Sbjct  64    LPGYKIPKNVVAVPDVVEATNGADILVFVLPHQFVGRICEQIAGQIKSGTFGISLIKGID  123

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                +G  +IS LI E+L I   VLMGANIA E+A EKF E T+G +  K+  + + +L  
Sbjct  124   EGPDGLKLISDLIREKLKIEISVLMGANIAKEVADEKFCETTIGCKNEKQ-GEIFKELMQ  182

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V D + VE+CG LKN+VA+ AGF DGL+ G+NTKAA++R+GL EM AF+K+ 
Sbjct  183   TPNFRITVVLDSDTVEICGALKNIVAVGAGFCDGLDFGDNTKAAVIRLGLMEMVAFAKMF  242

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                 V  +TF ESCGVAD+ITTC GGRNRK A+AFA+ G  +S +ELE EML GQKLQ  
Sbjct  243   CRGPVSIATFLESCGVADLITTCYGGRNRKVAEAFARTG--KSIEELENEMLNGQKLQGP  300

Query  649   QTA  641
             QT+
Sbjct  301   QTS  303



>ref|XP_010184375.1| PREDICTED: glycerol-3-phosphate dehydrogenase 1-like protein 
[Mesitornis unicolor]
Length=353

 Score =   313 bits (803),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 217/305 (71%), Gaps = 9/305 (3%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++ +N  KL  F   V+MWVFEE +  G KL+++IN  +ENVKY
Sbjct  9     KVCIVGSGNWGSAVAKIVGNNVKKLQKFASTVKMWVFEENI-NGRKLTDIINNEHENVKY  67

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A P+L  A +DA++LVFV PHQF+  +C ++ G++ K A  I+LIKG++
Sbjct  68    LPGYKLPDNVVAIPNLNEAVQDADLLVFVIPHQFIHKVCDEITGRVPKKALGITLIKGID  127

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYR--ENKEIAQKWVQL  1013
                EG  +IS +I E++GI+  VLMGANIANE+A EKF E T+G +  EN  +   + +L
Sbjct  128   EGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKILENGLL---FKEL  184

Query  1012  FNTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSK  833
               TP F ++ V D + VELCG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF++
Sbjct  185   LQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLCCGDNTKAAVIRLGLMEMIAFAR  244

Query  832   LLFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQ  656
             +     V  +TF ESCGVAD+ITTC GGRNR+ A+AF K G  +S +ELE EML GQKLQ
Sbjct  245   IFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFVKTG--KSIEELEKEMLNGQKLQ  302

Query  655   VHQTA  641
               QT+
Sbjct  303   GPQTS  307



>ref|XP_006017970.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like 
[Alligator sinensis]
Length=349

 Score =   313 bits (803),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 216/304 (71%), Gaps = 5/304 (2%)
 Frame = -1

Query  1549  SRVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVK  1370
             +RV ++GSGNWGS  AK+I  N  + N F   V+MWVFEE++  G+KL+E+INK +ENVK
Sbjct  4     TRVCIIGSGNWGSAIAKIIGKNVQRSNRFDPIVKMWVFEEII-NGKKLTEIINKDHENVK  62

Query  1369  YLPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGM  1190
             YLPG +L  NV+A PD   AA  A++LVFV PHQF+  IC ++   ++  A  ISLIKG+
Sbjct  63    YLPGHKLPHNVVAVPDTVEAATGADILVFVLPHQFISRICDQIAAHMKPGAFGISLIKGV  122

Query  1189  EVKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLF  1010
             +   EG  +IS +I E+L I   VLMGANIA+E+A EKF E T+G + N++  Q + +L 
Sbjct  123   DEGPEGLKLISDIIREKLKIEVSVLMGANIASEVADEKFCETTIGCK-NEKHGQIFKELM  181

Query  1009  NTPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKL  830
              TP F ++ V D + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL
Sbjct  182   QTPNFRITVVDDCDTVEICGALKNIVAVGAGFCDGLNFGDNTKAAVIRLGLMEMVAFAKL  241

Query  829   LFP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQV  653
                 SV  +TF ESCGVAD+ITTC GGRNRK A+AF + G  +S +ELE EML GQKLQ 
Sbjct  242   FCRGSVSIATFLESCGVADLITTCYGGRNRKVAEAFVRTG--KSIEELEKEMLNGQKLQG  299

Query  652   HQTA  641
              QT+
Sbjct  300   PQTS  303



>ref|NP_001006808.1| glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic [Xenopus 
(Silurana) tropicalis]
 gb|AAH76683.1| glycerol-3-phosphate dehydrogenase 1-like [Xenopus (Silurana) 
tropicalis]
 emb|CAJ81811.1| glycerol-3-phosphate dehydrogenase 1 (soluble) [Xenopus (Silurana) 
tropicalis]
Length=348

 Score =   313 bits (803),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 219/303 (72%), Gaps = 5/303 (2%)
 Frame = -1

Query  1546  RVTVVGSGNWGSVAAKLIASNTLKLNSFHDEVRMWVFEEVLPTGEKLSEVINKTNENVKY  1367
             +V +VGSGNWGS  AK++  N  +L  F + V+MWVFEE++  G+KL+E+IN  +ENVKY
Sbjct  4     KVCIVGSGNWGSAIAKIVGDNAARLPQFDNVVKMWVFEELI-GGKKLTEIINSDHENVKY  62

Query  1366  LPGIQLGKNVIADPDLEHAARDANMLVFVTPHQFMEGICKKLVGKIRKDAEAISLIKGME  1187
             LPG +L  NV+A PDL  A+  A++L+FV PHQF+  +C +L   ++K+A  +SLIKG++
Sbjct  63    LPGHKLPANVVAVPDLLEASAGADILIFVVPHQFIGKLCDQLKAHVKKEAFGMSLIKGVD  122

Query  1186  VKMEGPCMISTLITEQLGINCCVLMGANIANEIAVEKFSEATVGYRENKEIAQKWVQLFN  1007
                EG  +IS +I E+LGI   VLMGANIANE+A  KF E T+G + NKE  +   +LF 
Sbjct  123   EGPEGLRLISDIIQERLGIQMSVLMGANIANEVADGKFCETTIGCK-NKEHGKILKELFQ  181

Query  1006  TPYFMVSAVQDVEGVELCGTLKNVVALAAGFVDGLEMGNNTKAAIMRIGLREMKAFSKLL  827
             TP F ++ V++ + VE+CG LKN+VA+ AGF DGL  G+NTKAA++R+GL EM AF+KL 
Sbjct  182   TPNFRITVVEEKDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLF  241

Query  826   FP-SVKESTFFESCGVADVITTCLGGRNRKCADAFAKNGGKRSFDELEAEMLQGQKLQVH  650
                SV  +TF ESCGVAD+ITTC GGRNRK  +AFA+ G  +S ++LE EML GQKLQ  
Sbjct  242   CSGSVTSATFLESCGVADLITTCYGGRNRKVGEAFARTG--KSIEQLEQEMLNGQKLQGP  299

Query  649   QTA  641
             QT+
Sbjct  300   QTS  302



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5003565261950