BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22130_g2_i5 len=1300 path=[880:0-72 953:73-79 960:80-130
1011:131-627 1508:628-731 1768:732-984 2021:985-1009 2508:1010-1119
2618:1120-1299]

Length=1300
                                                                      Score     E

ref|XP_010644491.1|  PREDICTED: uncharacterized protein LOC104877599  93.2    5e-21   
gb|EYU32544.1|  hypothetical protein MIMGU_mgv1a013885mg              91.7    7e-18   
gb|KDO62104.1|  hypothetical protein CISIN_1g042213mg                 87.0    6e-17   
ref|XP_007212444.1|  hypothetical protein PRUPE_ppa017208mg           86.7    1e-16   
ref|XP_006452440.1|  hypothetical protein CICLE_v10010548mg           87.0    2e-16   
ref|XP_006364233.1|  PREDICTED: uncharacterized protein LOC102606173  76.3    9e-16   
ref|XP_011046751.1|  PREDICTED: uncharacterized protein LOC105141268  84.0    1e-15   
ref|XP_002529465.1|  hypothetical protein RCOM_0753050                84.3    3e-15   Ricinus communis
ref|XP_007020718.1|  Stigma-specific Stig1 family protein, putative   83.2    4e-15   
ref|XP_002300326.2|  hypothetical protein POPTR_0001s36570g           82.4    5e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006858266.1|  hypothetical protein AMTR_s00062p00210870        80.9    1e-14   
gb|KDP39176.1|  hypothetical protein JCGZ_00933                       82.0    1e-14   
ref|XP_004236464.2|  PREDICTED: RNA-binding protein 26                70.1    3e-14   
ref|XP_010064326.1|  PREDICTED: chitin-binding lectin 1-like          75.1    4e-14   
gb|KCW66950.1|  hypothetical protein EUGRSUZ_F00712                   74.7    5e-14   
ref|XP_010096113.1|  hypothetical protein L484_012468                 75.1    8e-14   
ref|XP_004170565.1|  PREDICTED: uncharacterized protein LOC101232665  77.0    6e-13   
ref|XP_003553061.1|  PREDICTED: uncharacterized protein LOC100781140  70.5    7e-11   
ref|XP_004514560.1|  PREDICTED: uncharacterized protein LOC101498480  70.1    1e-10   
ref|XP_003532141.2|  PREDICTED: uncharacterized protein LOC100794169  68.9    2e-10   
ref|NP_001237283.1|  uncharacterized protein LOC100527268             68.6    2e-10   
gb|KHN12522.1|  hypothetical protein glysoja_035329                   68.9    2e-10   
ref|XP_007146507.1|  hypothetical protein PHAVU_006G046600g           68.6    2e-10   
gb|KHM99532.1|  hypothetical protein glysoja_006375                   68.9    3e-10   
ref|XP_006452425.1|  hypothetical protein CICLE_v10010614mg           68.2    4e-10   
ref|XP_004491465.1|  PREDICTED: uncharacterized protein LOC101498346  68.2    6e-10   
ref|XP_002263655.1|  PREDICTED: uncharacterized protein LOC100243449  67.8    8e-10   Vitis vinifera
ref|XP_003519587.1|  PREDICTED: chitin-binding lectin 1-like          67.8    9e-10   
gb|KEH33880.1|  STIG1-like protein                                    67.0    1e-09   
ref|XP_007146513.1|  hypothetical protein PHAVU_006G047200g           67.0    1e-09   
ref|NP_001238582.1|  uncharacterized protein LOC100305653 precursor   67.4    1e-09   
ref|XP_009361100.1|  PREDICTED: uncharacterized protein LOC103951459  67.0    1e-09   
ref|XP_009379655.1|  PREDICTED: uncharacterized protein LOC103968051  67.0    1e-09   
ref|XP_010519264.1|  PREDICTED: uncharacterized protein LOC104798770  63.5    1e-09   
ref|XP_004516940.1|  PREDICTED: uncharacterized protein LOC101514133  66.6    2e-09   
ref|XP_006449772.1|  hypothetical protein CICLE_v10018080mg           66.2    2e-09   
ref|XP_004513882.1|  PREDICTED: uncharacterized protein LOC101495420  65.9    2e-09   
ref|XP_008449121.1|  PREDICTED: uncharacterized protein LOC103491076  65.9    3e-09   
ref|XP_010316576.1|  PREDICTED: uncharacterized protein LOC104645793  65.9    3e-09   
ref|XP_007026144.1|  Stigma-specific Stig1 family protein, putative   65.5    3e-09   
ref|XP_010252477.1|  PREDICTED: uncharacterized protein LOC104594055  65.1    5e-09   
ref|XP_004295839.1|  PREDICTED: uncharacterized protein LOC101305836  64.7    6e-09   
ref|XP_008375590.1|  PREDICTED: uncharacterized protein LOC103438822  64.7    7e-09   
ref|XP_008356860.1|  PREDICTED: uncharacterized protein LOC103420578  64.7    7e-09   
ref|XP_007142306.1|  hypothetical protein PHAVU_008G269500g           66.6    7e-09   
ref|XP_008345814.1|  PREDICTED: uncharacterized protein LOC103408764  64.3    7e-09   
gb|KDP39163.1|  hypothetical protein JCGZ_00920                       64.3    8e-09   
ref|XP_008384254.1|  PREDICTED: uncharacterized protein LOC103446877  64.7    8e-09   
ref|XP_004295285.1|  PREDICTED: uncharacterized protein LOC101301662  64.3    8e-09   
ref|XP_008371164.1|  PREDICTED: uncharacterized protein LOC103434584  64.3    9e-09   
ref|XP_004295286.1|  PREDICTED: uncharacterized protein LOC101301953  63.9    1e-08   
ref|XP_009352632.1|  PREDICTED: uncharacterized protein LOC103943972  64.3    1e-08   
gb|KEH36913.1|  STIG1-like protein                                    63.9    1e-08   
gb|KEH36912.1|  STIG1-like protein                                    63.5    1e-08   
ref|XP_004171090.1|  PREDICTED: uncharacterized LOC101217149          63.5    2e-08   
ref|XP_002317296.1|  stigma-specific Stig1 family protein             63.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008364671.1|  PREDICTED: uncharacterized protein LOC103428338  63.5    2e-08   
gb|KEH36911.1|  STIG1-like protein                                    63.2    2e-08   
ref|XP_010315700.1|  PREDICTED: uncharacterized protein LOC104645570  63.2    2e-08   
ref|XP_004149335.1|  PREDICTED: uncharacterized protein LOC101217149  62.0    2e-08   
ref|XP_004486180.1|  PREDICTED: keratin-associated protein 5-1-like   62.8    2e-08   
ref|XP_010502751.1|  PREDICTED: uncharacterized protein LOC104779986  63.2    3e-08   
ref|XP_008226620.1|  PREDICTED: uncharacterized protein LOC103326199  62.8    3e-08   
ref|XP_011046721.1|  PREDICTED: uncharacterized protein LOC105141248  62.8    3e-08   
ref|XP_010536680.1|  PREDICTED: uncharacterized protein LOC104811623  62.8    3e-08   
gb|KDP34394.1|  hypothetical protein JCGZ_12788                       62.4    3e-08   
ref|XP_004516942.1|  PREDICTED: uncharacterized protein LOC101514783  62.4    3e-08   
ref|XP_003597653.1|  hypothetical protein MTR_2g100600                62.4    4e-08   
ref|XP_002304979.1|  hypothetical protein POPTR_0004s03050g           62.4    4e-08   Populus trichocarpa [western balsam poplar]
gb|KGN64492.1|  hypothetical protein Csa_1G059710                     62.4    4e-08   
ref|XP_006369973.1|  stigma-specific Stig1 family protein             62.4    4e-08   
ref|XP_008782279.1|  PREDICTED: uncharacterized protein LOC103701849  62.4    4e-08   
gb|KEH29539.1|  STIG1-like protein                                    62.4    4e-08   
ref|XP_008440806.1|  PREDICTED: uncharacterized protein LOC103485113  62.0    4e-08   
ref|XP_010244468.1|  PREDICTED: uncharacterized protein LOC104588297  62.8    4e-08   
ref|XP_006383879.1|  hypothetical protein POPTR_0004s00830g           62.4    4e-08   
ref|XP_010252476.1|  PREDICTED: uncharacterized protein LOC104594054  62.4    4e-08   
ref|XP_009355704.1|  PREDICTED: uncharacterized protein LOC103946670  62.4    4e-08   
ref|XP_008367040.1|  PREDICTED: uncharacterized protein LOC103430663  62.0    5e-08   
ref|XP_009356799.1|  PREDICTED: uncharacterized protein LOC103947607  62.0    5e-08   
ref|XP_011046969.1|  PREDICTED: uncharacterized protein LOC105141445  62.0    5e-08   
ref|XP_006586759.1|  PREDICTED: uncharacterized protein LOC102659740  62.0    5e-08   
ref|XP_011016145.1|  PREDICTED: uncharacterized protein LOC105119676  62.0    5e-08   
ref|XP_002518439.1|  conserved hypothetical protein                   62.0    5e-08   Ricinus communis
ref|XP_011003390.1|  PREDICTED: uncharacterized protein LOC105110149  62.0    6e-08   
ref|XP_006847558.1|  hypothetical protein AMTR_s00014p00178050        62.0    6e-08   
ref|XP_006350489.1|  PREDICTED: uncharacterized protein LOC102584178  61.6    6e-08   
ref|XP_007213548.1|  hypothetical protein PRUPE_ppa018122mg           61.6    6e-08   
ref|XP_008440721.1|  PREDICTED: uncharacterized protein LOC103485051  62.0    6e-08   
ref|XP_006383880.1|  hypothetical protein POPTR_0004s00840g           61.6    6e-08   
ref|XP_010252478.1|  PREDICTED: uncharacterized protein LOC104594056  61.6    7e-08   
ref|XP_008385861.1|  PREDICTED: uncharacterized protein LOC103448383  61.6    8e-08   
ref|XP_004145194.1|  PREDICTED: uncharacterized protein LOC101214260  61.6    8e-08   
ref|XP_010465482.1|  PREDICTED: uncharacterized protein LOC104745826  61.6    8e-08   
ref|XP_007214081.1|  hypothetical protein PRUPE_ppa015303mg           61.6    8e-08   
ref|XP_007147699.1|  hypothetical protein PHAVU_006G147300g           61.6    8e-08   
ref|XP_006383881.1|  hypothetical protein POPTR_0004s00850g           61.2    9e-08   
ref|XP_006299155.1|  hypothetical protein CARUB_v10015298mg           61.6    9e-08   
ref|XP_006304799.1|  hypothetical protein CARUB_v10012396mg           61.6    9e-08   
ref|XP_011015444.1|  PREDICTED: uncharacterized protein LOC105119043  61.2    9e-08   
gb|KFK35745.1|  hypothetical protein AALP_AA4G031000                  61.6    1e-07   
gb|KDP20713.1|  hypothetical protein JCGZ_21184                       61.2    1e-07   
ref|NP_200322.1|  Stigma-specific Stig1 family protein                61.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479856.1|  PREDICTED: uncharacterized protein LOC104758650  61.2    1e-07   
ref|XP_010487351.1|  PREDICTED: uncharacterized protein LOC104765356  61.2    1e-07   
gb|EYU20878.1|  hypothetical protein MIMGU_mgv1a022949mg              60.8    1e-07   
ref|XP_009147630.1|  PREDICTED: uncharacterized protein LOC103871154  60.8    1e-07   
emb|CDY24115.1|  BnaA06g01130D                                        60.8    1e-07   
ref|XP_008224753.1|  PREDICTED: uncharacterized protein LOC103324472  60.8    1e-07   
ref|XP_010462174.1|  PREDICTED: uncharacterized protein LOC104742819  60.8    2e-07   
ref|XP_007026145.1|  Stigma-specific Stig1 family protein             60.1    2e-07   
ref|XP_010545231.1|  PREDICTED: uncharacterized protein LOC104817674  60.5    2e-07   
gb|AAQ65153.1|  At1g53130                                             59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795208.1|  PREDICTED: uncharacterized protein LOC104241938  60.5    2e-07   
ref|XP_008782254.1|  PREDICTED: uncharacterized protein LOC103701833  60.5    2e-07   
ref|XP_009409631.1|  PREDICTED: uncharacterized protein LOC103991816  60.1    2e-07   
ref|NP_175721.1|  protein GRIM REAPER                                 60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882925.1|  hypothetical protein ARALYDRAFT_897805           60.1    3e-07   
gb|KCW75256.1|  hypothetical protein EUGRSUZ_E04008                   58.9    3e-07   
ref|XP_006383882.1|  hypothetical protein POPTR_0004s00860g           59.7    3e-07   
ref|XP_011046967.1|  PREDICTED: uncharacterized protein LOC105141442  60.1    3e-07   
ref|XP_010644540.1|  PREDICTED: uncharacterized protein LOC104877613  60.1    3e-07   
ref|XP_009598822.1|  PREDICTED: uncharacterized protein LOC104094565  59.7    3e-07   
ref|XP_002518440.1|  conserved hypothetical protein                   60.1    3e-07   Ricinus communis
ref|XP_009381680.1|  PREDICTED: uncharacterized protein LOC103969755  59.7    3e-07   
gb|KHN33005.1|  hypothetical protein glysoja_009996                   59.3    3e-07   
ref|XP_006443574.1|  hypothetical protein CICLE_v10023606mg           59.7    3e-07   
ref|XP_010252479.1|  PREDICTED: uncharacterized protein LOC104594057  59.7    3e-07   
ref|XP_011079217.1|  PREDICTED: uncharacterized protein LOC105162799  59.7    3e-07   
ref|XP_010057903.1|  PREDICTED: uncharacterized protein LOC104445688  59.7    3e-07   
ref|XP_006383878.1|  hypothetical protein POPTR_0004s00820g           59.3    4e-07   
ref|XP_004297923.1|  PREDICTED: uncharacterized protein LOC101308760  59.7    4e-07   
ref|XP_009764581.1|  PREDICTED: uncharacterized protein LOC104216261  59.7    4e-07   
ref|NP_001236011.1|  uncharacterized protein LOC100500553 precursor   59.3    4e-07   
ref|XP_009609640.1|  PREDICTED: uncharacterized protein LOC104103441  59.3    4e-07   
ref|XP_009358460.1|  PREDICTED: uncharacterized protein LOC103949058  59.3    5e-07   
ref|XP_007020752.1|  Stigma-specific Stig1 family protein, putative   59.3    5e-07   
ref|XP_011046970.1|  PREDICTED: uncharacterized protein LOC105141446  58.9    5e-07   
ref|XP_002864374.1|  stigma-specific Stig1 family protein             59.3    5e-07   
ref|XP_004295840.1|  PREDICTED: uncharacterized protein LOC101306127  59.3    5e-07   
ref|XP_011046966.1|  PREDICTED: uncharacterized protein LOC105141441  58.9    5e-07   
ref|XP_006401494.1|  hypothetical protein EUTSA_v10014856mg           59.3    5e-07   
ref|XP_009127030.1|  PREDICTED: uncharacterized protein LOC103851904  59.3    5e-07   
ref|XP_002263656.1|  PREDICTED: uncharacterized protein LOC100267596  58.9    6e-07   Vitis vinifera
ref|XP_011011344.1|  PREDICTED: uncharacterized protein LOC105115949  58.9    6e-07   
ref|XP_006348208.1|  PREDICTED: uncharacterized protein LOC102600685  58.9    6e-07   
ref|XP_009357594.1|  PREDICTED: keratin-associated protein 5-11-like  58.5    7e-07   
ref|XP_006392825.1|  hypothetical protein EUTSA_v10012399mg           58.9    7e-07   
gb|KGN64480.1|  hypothetical protein Csa_1G058150                     58.2    9e-07   
ref|XP_008440707.1|  PREDICTED: uncharacterized protein LOC103485044  58.2    1e-06   
ref|XP_010060302.1|  PREDICTED: uncharacterized protein LOC104448208  58.2    1e-06   
ref|XP_008371072.1|  PREDICTED: uncharacterized protein LOC103434485  58.2    1e-06   
ref|XP_010916128.1|  PREDICTED: uncharacterized protein LOC105041033  58.2    1e-06   
ref|XP_009632034.1|  PREDICTED: uncharacterized protein LOC104121689  58.2    1e-06   
ref|XP_006377170.1|  hypothetical protein POPTR_0011s01360g           57.0    1e-06   
ref|XP_004145195.1|  PREDICTED: uncharacterized protein LOC101214497  58.2    1e-06   
ref|XP_004161979.1|  PREDICTED: uncharacterized protein LOC101227436  57.8    1e-06   
ref|XP_006281866.1|  hypothetical protein CARUB_v10028061mg           57.8    1e-06   
ref|XP_008226851.1|  PREDICTED: uncharacterized protein LOC103326416  57.8    1e-06   
ref|NP_194418.1|  Stigma-specific Stig1 family protein                57.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451828.1|  hypothetical protein CICLE_v10010456mg           57.8    1e-06   
ref|XP_006377165.1|  hypothetical protein POPTR_0011s01320g           57.8    1e-06   
ref|XP_010438686.1|  PREDICTED: uncharacterized protein LOC104722243  57.8    1e-06   
ref|XP_002529446.1|  conserved hypothetical protein                   57.8    2e-06   Ricinus communis
ref|XP_010449076.1|  PREDICTED: uncharacterized protein LOC104731402  57.8    2e-06   
ref|XP_002317138.2|  hypothetical protein POPTR_0011s01370g           57.4    2e-06   Populus trichocarpa [western balsam poplar]
gb|KDP39166.1|  hypothetical protein JCGZ_00923                       57.0    2e-06   
ref|XP_009598813.1|  PREDICTED: uncharacterized protein LOC104094556  57.8    2e-06   
ref|XP_006345619.1|  PREDICTED: uncharacterized protein LOC102596970  57.4    2e-06   
ref|XP_008226943.1|  PREDICTED: uncharacterized protein LOC103326488  57.4    2e-06   
ref|XP_010666230.1|  PREDICTED: uncharacterized protein LOC104883405  57.4    2e-06   
ref|XP_007213969.1|  hypothetical protein PRUPE_ppa013138mg           57.0    2e-06   
ref|XP_009781545.1|  PREDICTED: uncharacterized protein LOC104230429  57.4    2e-06   
ref|XP_011070191.1|  PREDICTED: uncharacterized protein LOC105155906  57.0    2e-06   
ref|XP_007214134.1|  hypothetical protein PRUPE_ppa018235mg           57.4    2e-06   
ref|XP_011011342.1|  PREDICTED: uncharacterized protein LOC105115947  57.4    2e-06   
ref|XP_010545838.1|  PREDICTED: uncharacterized protein LOC104818082  57.4    2e-06   
ref|XP_006393126.1|  hypothetical protein EUTSA_v10012178mg           57.4    2e-06   
ref|XP_008224703.1|  PREDICTED: uncharacterized protein LOC103324427  57.0    2e-06   
ref|XP_007214115.1|  hypothetical protein PRUPE_ppa017131mg           57.0    2e-06   
ref|XP_010482931.1|  PREDICTED: uncharacterized protein LOC104761531  57.4    2e-06   
ref|XP_010443117.1|  PREDICTED: uncharacterized protein LOC104726044  57.4    2e-06   
ref|XP_006406991.1|  hypothetical protein EUTSA_v10022293mg           57.4    2e-06   
ref|XP_007026141.1|  Stigma-specific Stig1 family protein, putative   57.0    2e-06   
ref|XP_007020751.1|  Stigma-specific Stig1 family protein, putative   57.0    2e-06   
ref|XP_006413129.1|  hypothetical protein EUTSA_v10027097mg           57.0    2e-06   
ref|XP_009603947.1|  PREDICTED: uncharacterized protein LOC104098822  57.4    2e-06   
ref|XP_009120033.1|  PREDICTED: uncharacterized protein LOC103844955  57.0    3e-06   
ref|XP_007021504.1|  Stigma-specific Stig1 family protein, putative   57.0    3e-06   
ref|XP_010438638.1|  PREDICTED: uncharacterized protein LOC104722200  57.0    3e-06   
ref|XP_010448200.1|  PREDICTED: uncharacterized protein LOC104730702  56.6    3e-06   
ref|XP_009132402.1|  PREDICTED: uncharacterized protein LOC103857004  57.0    3e-06   
ref|XP_008776914.1|  PREDICTED: uncharacterized protein LOC103696955  56.6    3e-06   
ref|XP_002961474.1|  hypothetical protein SELMODRAFT_76417            55.8    3e-06   
emb|CDY19914.1|  BnaC09g31800D                                        56.6    3e-06   
ref|XP_006370247.1|  hypothetical protein POPTR_0001s41000g           56.6    3e-06   
gb|AAF87870.1|AC012561_3  Hypothetical protein                        57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347464.1|  PREDICTED: uncharacterized protein LOC102597306  56.6    3e-06   
gb|EYU35629.1|  hypothetical protein MIMGU_mgv1a024160mg              56.6    3e-06   
ref|NP_175480.1|  stigma-specific stig1-like protein                  57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402049.1|  PREDICTED: uncharacterized protein LOC103985921  56.2    3e-06   
ref|XP_011046968.1|  PREDICTED: uncharacterized protein LOC105141444  56.6    3e-06   
ref|XP_010322478.1|  PREDICTED: uncharacterized protein LOC104648025  56.6    4e-06   
gb|KDP39165.1|  hypothetical protein JCGZ_00922                       56.6    4e-06   
gb|KDP39164.1|  hypothetical protein JCGZ_00921                       56.2    4e-06   
ref|XP_010666227.1|  PREDICTED: uncharacterized protein LOC104883402  56.6    4e-06   
ref|XP_009387225.1|  PREDICTED: uncharacterized protein LOC103974188  56.2    4e-06   
ref|XP_010519260.1|  PREDICTED: uncharacterized protein LOC104798766  56.6    4e-06   
ref|XP_006282772.1|  hypothetical protein CARUB_v10006200mg           56.2    4e-06   
ref|XP_011083274.1|  PREDICTED: uncharacterized protein LOC105165809  56.2    4e-06   
ref|XP_011079120.1|  PREDICTED: uncharacterized protein LOC105162717  56.2    4e-06   
ref|XP_010655413.1|  PREDICTED: uncharacterized protein LOC104880473  56.2    4e-06   
ref|XP_010092023.1|  hypothetical protein L484_000949                 56.2    5e-06   
ref|XP_002894266.1|  predicted protein                                56.2    5e-06   
ref|XP_004240267.2|  PREDICTED: uncharacterized protein LOC101267026  56.2    5e-06   
ref|XP_009598824.1|  PREDICTED: uncharacterized protein LOC104094567  57.8    5e-06   
ref|XP_009147818.1|  PREDICTED: uncharacterized protein LOC103871329  56.2    5e-06   
gb|EYU44950.1|  hypothetical protein MIMGU_mgv1a021221mg              56.2    5e-06   
gb|KFK35917.1|  hypothetical protein AALP_AA4G053300                  55.5    5e-06   
ref|XP_010916127.1|  PREDICTED: uncharacterized protein LOC105041032  55.8    5e-06   
ref|XP_002529453.1|  conserved hypothetical protein                   55.8    6e-06   Ricinus communis
ref|XP_004488726.1|  PREDICTED: uncharacterized protein LOC101494412  55.8    6e-06   
ref|XP_004295284.1|  PREDICTED: uncharacterized protein LOC101301373  55.8    6e-06   
ref|XP_011043811.1|  PREDICTED: uncharacterized protein LOC105139155  55.8    6e-06   
ref|XP_008356862.1|  PREDICTED: uncharacterized protein LOC103420580  55.8    6e-06   
ref|XP_007026139.1|  Stigma-specific Stig1 family protein, putative   56.6    6e-06   
emb|CDP05927.1|  unnamed protein product                              55.8    6e-06   
ref|XP_002316893.2|  hypothetical protein POPTR_0011s11940g           55.8    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008780025.1|  PREDICTED: uncharacterized protein LOC103699797  55.5    7e-06   
ref|XP_010481125.1|  PREDICTED: uncharacterized protein LOC104759962  55.1    7e-06   
ref|XP_007153981.1|  hypothetical protein PHAVU_003G081100g           55.5    7e-06   
ref|XP_008355931.1|  PREDICTED: uncharacterized protein LOC103419608  55.5    7e-06   
ref|XP_010092026.1|  hypothetical protein L484_000953                 55.5    7e-06   
ref|XP_010092025.1|  hypothetical protein L484_000952                 55.5    8e-06   
emb|CDY37112.1|  BnaC06g03870D                                        55.8    8e-06   
ref|XP_010252475.1|  PREDICTED: uncharacterized protein LOC104594053  55.5    8e-06   
ref|XP_010451166.1|  PREDICTED: uncharacterized protein LOC104733274  56.2    8e-06   
ref|XP_007212867.1|  hypothetical protein PRUPE_ppa021586mg           55.1    8e-06   
ref|XP_006452427.1|  hypothetical protein CICLE_v10010199mg           55.5    8e-06   
ref|XP_010057905.1|  PREDICTED: uncharacterized protein LOC104445689  55.5    8e-06   
ref|XP_010533795.1|  PREDICTED: uncharacterized protein LOC104809483  55.5    9e-06   
gb|AAG51198.1|AC079279_19  hypothetical protein, 5' partial           54.7    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDO62081.1|  hypothetical protein CISIN_1g039894mg                 55.5    9e-06   
ref|XP_010272879.1|  PREDICTED: uncharacterized protein LOC104608543  55.5    1e-05   
ref|XP_010461926.1|  PREDICTED: uncharacterized protein LOC104742603  55.1    1e-05   
ref|XP_010686797.1|  PREDICTED: uncharacterized protein LOC104900958  55.1    1e-05   
ref|NP_175487.1|  stigma-specific stig1-like protein                  55.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479538.1|  PREDICTED: uncharacterized protein LOC104758378  55.1    1e-05   
gb|KCW75257.1|  hypothetical protein EUGRSUZ_E04009                   55.1    1e-05   
ref|XP_006304485.1|  hypothetical protein CARUB_v10011220mg           55.1    1e-05   
ref|XP_002867536.1|  hypothetical protein ARALYDRAFT_492113           54.7    1e-05   
ref|XP_002529449.1|  conserved hypothetical protein                   55.1    1e-05   Ricinus communis
ref|XP_001764057.1|  predicted protein                                53.5    1e-05   
ref|XP_002317139.2|  hypothetical protein POPTR_0011s01380g           53.9    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010500648.1|  PREDICTED: uncharacterized protein LOC104777996  54.7    1e-05   
ref|XP_009383558.1|  PREDICTED: uncharacterized protein LOC103971289  54.7    1e-05   
ref|XP_010272875.1|  PREDICTED: uncharacterized protein LOC104608539  54.7    1e-05   
ref|XP_010256403.1|  PREDICTED: uncharacterized protein LOC104596806  54.7    1e-05   
emb|CDX89296.1|  BnaA01g15970D                                        54.7    2e-05   
ref|XP_011096152.1|  PREDICTED: uncharacterized protein LOC105175415  54.3    2e-05   
gb|KCW75255.1|  hypothetical protein EUGRSUZ_E04007                   54.3    2e-05   
ref|XP_009402048.1|  PREDICTED: keratin-associated protein 5-4 {E...  54.3    2e-05   
ref|XP_002529448.1|  conserved hypothetical protein                   54.7    2e-05   Ricinus communis
emb|CDY29256.1|  BnaC01g19080D                                        54.3    2e-05   
ref|XP_009605653.1|  PREDICTED: uncharacterized protein LOC104100182  54.3    2e-05   
ref|XP_010500642.1|  PREDICTED: uncharacterized protein LOC104777992  54.7    2e-05   
ref|XP_010059583.1|  PREDICTED: uncharacterized protein LOC104447559  54.3    2e-05   
ref|XP_009767934.1|  PREDICTED: uncharacterized protein LOC104219006  54.3    2e-05   
ref|XP_009142911.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    2e-05   
ref|XP_010252471.1|  PREDICTED: uncharacterized protein LOC104594051  53.9    2e-05   
ref|XP_009757291.1|  PREDICTED: uncharacterized protein LOC104210170  54.3    2e-05   
ref|XP_007026138.1|  Stigma-specific Stig1 family protein, putative   53.9    2e-05   
gb|AFK42574.1|  unknown                                               53.9    3e-05   
gb|KHN35718.1|  hypothetical protein glysoja_039504                   53.5    3e-05   
gb|AFK44311.1|  unknown                                               53.9    3e-05   
ref|XP_010260215.1|  PREDICTED: uncharacterized protein LOC104599399  53.9    3e-05   
ref|XP_010926214.1|  PREDICTED: uncharacterized protein LOC105048570  53.5    3e-05   
ref|XP_010644539.1|  PREDICTED: uncharacterized protein LOC104877612  53.9    3e-05   
ref|XP_010272490.1|  PREDICTED: uncharacterized protein LOC104608259  53.1    3e-05   
ref|XP_002990607.1|  hypothetical protein SELMODRAFT_28606            52.4    4e-05   
ref|XP_007212939.1|  hypothetical protein PRUPE_ppa021968mg           53.5    4e-05   
ref|XP_010109174.1|  hypothetical protein L484_017115                 53.5    4e-05   
ref|XP_010099178.1|  hypothetical protein L484_014177                 53.5    4e-05   
ref|XP_010479530.1|  PREDICTED: uncharacterized protein LOC104758373  53.5    4e-05   
ref|XP_010655412.1|  PREDICTED: uncharacterized protein LOC104880472  53.1    5e-05   
ref|XP_009147809.1|  PREDICTED: uncharacterized protein LOC103871322  53.1    5e-05   
ref|XP_007149468.1|  hypothetical protein PHAVU_005G072700g           53.1    5e-05   
ref|XP_002529450.1|  conserved hypothetical protein                   53.1    5e-05   
gb|KDP20237.1|  hypothetical protein JCGZ_08636                       52.8    6e-05   
ref|XP_010555894.1|  PREDICTED: uncharacterized protein LOC104825288  52.4    6e-05   
ref|XP_009357476.1|  PREDICTED: uncharacterized protein LOC103948204  54.3    6e-05   
ref|XP_008777897.1|  PREDICTED: uncharacterized protein LOC103697748  52.4    7e-05   
ref|XP_002968721.1|  hypothetical protein SELMODRAFT_28701            51.2    7e-05   
ref|XP_002529447.1|  conserved hypothetical protein                   52.4    8e-05   
emb|CDY26007.1|  BnaC06g06170D                                        54.7    8e-05   
ref|XP_006449771.1|  hypothetical protein CICLE_v10017961mg           51.2    8e-05   
ref|XP_009405256.1|  PREDICTED: uncharacterized protein LOC103988453  52.0    8e-05   
ref|XP_003534627.1|  PREDICTED: uncharacterized protein LOC100800556  52.0    9e-05   
ref|XP_009414942.1|  PREDICTED: uncharacterized protein LOC103995...  52.0    9e-05   
ref|XP_004295283.1|  PREDICTED: uncharacterized protein LOC101301090  52.0    1e-04   
ref|XP_006417286.1|  hypothetical protein EUTSA_v10009060mg           52.0    1e-04   
gb|KCW61164.1|  hypothetical protein EUGRSUZ_H03933                   51.6    1e-04   
ref|XP_006304246.1|  hypothetical protein CARUB_v10010456mg           52.4    1e-04   
ref|XP_003634714.1|  PREDICTED: uncharacterized protein LOC100853410  52.0    1e-04   
ref|XP_001763329.1|  predicted protein                                50.8    1e-04   
emb|CDY36729.1|  BnaA03g11570D                                        52.0    1e-04   
ref|XP_009132403.1|  PREDICTED: uncharacterized protein LOC103857005  52.0    1e-04   
ref|XP_009414943.1|  PREDICTED: keratin-associated protein 5-1 {E...  51.2    1e-04   
gb|KFK27112.1|  hypothetical protein AALP_AA8G335900                  52.0    1e-04   
gb|KDO71697.1|  hypothetical protein CISIN_1g046922mg                 51.2    2e-04   
ref|XP_003621922.1|  hypothetical protein MTR_7g025060                52.4    2e-04   
ref|XP_006859017.1|  hypothetical protein AMTR_s00068p00165220        51.2    2e-04   
ref|XP_007147698.1|  hypothetical protein PHAVU_006G147200g           51.2    2e-04   
ref|XP_004308277.1|  PREDICTED: uncharacterized protein LOC101308229  50.8    2e-04   
ref|XP_008782243.1|  PREDICTED: keratin-associated protein 5-9-like   51.2    2e-04   
emb|CDY06610.1|  BnaC02g13340D                                        52.8    3e-04   
ref|XP_010060586.1|  PREDICTED: uncharacterized protein LOC104448461  50.8    3e-04   
ref|XP_009404531.1|  PREDICTED: uncharacterized protein LOC103987836  50.8    3e-04   
gb|EYU27757.1|  hypothetical protein MIMGU_mgv1a023851mg              50.4    3e-04   
ref|XP_002963941.1|  hypothetical protein SELMODRAFT_69384            49.7    3e-04   
ref|XP_009389898.1|  PREDICTED: uncharacterized protein LOC103976431  50.4    3e-04   
ref|XP_003540467.1|  PREDICTED: uncharacterized protein LOC100795151  50.4    3e-04   
gb|ACU17410.1|  unknown                                               50.4    3e-04   
ref|XP_004954616.1|  PREDICTED: keratin-associated protein 5-1-like   50.4    4e-04   
ref|XP_009118158.1|  PREDICTED: uncharacterized protein LOC103843209  50.1    4e-04   
ref|XP_010493530.1|  PREDICTED: uncharacterized protein LOC104770769  50.1    4e-04   
emb|CDY34606.1|  BnaC08g41650D                                        50.1    4e-04   
ref|XP_006393114.1|  hypothetical protein EUTSA_v10012189mg           50.4    4e-04   
ref|XP_004292174.1|  PREDICTED: uncharacterized protein LOC101309702  50.1    4e-04   
ref|XP_001756883.1|  predicted protein                                50.8    4e-04   
gb|KDP27809.1|  hypothetical protein JCGZ_18889                       50.1    5e-04   
ref|XP_009387878.1|  PREDICTED: uncharacterized protein LOC103974729  50.1    5e-04   
ref|XP_003617595.1|  hypothetical protein MTR_5g093340                50.1    5e-04   
ref|XP_006378782.1|  hypothetical protein POPTR_0010s23480g           49.3    5e-04   
emb|CDX98090.1|  BnaA06g08410D                                        49.7    5e-04   
ref|XP_003617597.1|  hypothetical protein MTR_5g093370                50.1    5e-04   
ref|XP_002263583.1|  PREDICTED: uncharacterized protein LOC100248583  50.1    5e-04   
ref|XP_010458610.1|  PREDICTED: uncharacterized protein LOC104739842  49.7    5e-04   
ref|XP_008795209.1|  PREDICTED: uncharacterized protein DDB_G0272...  49.7    6e-04   
ref|XP_003596764.1|  BIP1                                             49.7    7e-04   
ref|XP_008226945.1|  PREDICTED: uncharacterized protein LOC103326490  49.3    7e-04   
ref|XP_001772242.1|  predicted protein                                48.9    7e-04   
ref|NP_683300.2|  stigma-specific stig1 family protein                49.3    9e-04   
ref|XP_003615052.1|  hypothetical protein MTR_5g063040                49.3    9e-04   
ref|XP_006305768.1|  hypothetical protein CARUB_v10010604mg           48.9    0.001   
gb|ABK27973.1|  stigma-specific Stig1 family protein                  48.9    0.001   
ref|XP_006380147.1|  hypothetical protein POPTR_0008s22340g           48.9    0.001   



>ref|XP_010644491.1| PREDICTED: uncharacterized protein LOC104877599 [Vitis vinifera]
Length=201

 Score = 93.2 bits (230),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DV NCGLCG RC F  QCCRG+C+NTN+NPFHCG+C ++CPF +FCVYGMCGYAQ
Sbjct  96   DVYNCGLCGIRCPFTWQCCRGICINTNINPFHCGKCEHKCPFGSFCVYGMCGYAQ  150


 Score = 37.0 bits (84),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = +2

Query  341  GTNSSS*SPCLSKVVRNP*EVGCWDRPWICDEG  439
            GT  S  SP L +V+ NP   GCW+RPWIC+EG
Sbjct  44   GTKRSLSSPWLRRVI-NPRAAGCWNRPWICNEG  75



>gb|EYU32544.1| hypothetical protein MIMGU_mgv1a013885mg [Erythranthe guttata]
Length=207

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DVNNCGLCG RC F  QCCRG+CVNTN NPFHCGRC NRCPF + C +GMCGYAQ
Sbjct  91   DVNNCGLCGIRCPFTRQCCRGLCVNTNRNPFHCGRCDNRCPFPSLCFFGMCGYAQ  145



>gb|KDO62104.1| hypothetical protein CISIN_1g042213mg [Citrus sinensis]
Length=196

 Score = 87.0 bits (214),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            DVNNCGLCG RC+F  QCCRG C NTN  PF+CGRC NRCP+   C+YGMCGYA
Sbjct  92   DVNNCGLCGIRCRFSWQCCRGFCTNTNRGPFNCGRCGNRCPWGVRCIYGMCGYA  145


 Score = 29.3 bits (64),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 3/43 (7%)
 Frame = +2

Query  320  VSLGSLRGTNSSS*SPCLSKVV---RNP*EVGCWDRPWICDEG  439
            V   ++   ++S+ SP L+KV    R P   GCW+R WIC +G
Sbjct  30   VQQNAIGNASTSTSSPWLNKVANGGRRPRPSGCWNRQWICRQG  72



>ref|XP_007212444.1| hypothetical protein PRUPE_ppa017208mg, partial [Prunus persica]
 gb|EMJ13643.1| hypothetical protein PRUPE_ppa017208mg, partial [Prunus persica]
Length=148

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DVNNCGLC  RC F  QCCRG CVNTN++PF+CGRC NRCPF   C+YG+CGYAQ
Sbjct  59   DVNNCGLCRIRCPFSWQCCRGFCVNTNISPFNCGRCGNRCPFGVLCLYGLCGYAQ  113



>ref|XP_006452440.1| hypothetical protein CICLE_v10010548mg [Citrus clementina]
 gb|ESR65680.1| hypothetical protein CICLE_v10010548mg [Citrus clementina]
Length=196

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            DVNNCGLCG RC+F  QCCRG C NTN  PF+CGRC NRCP+   C+YGMCGYA
Sbjct  92   DVNNCGLCGIRCRFSWQCCRGFCTNTNRGPFNCGRCGNRCPWGVRCIYGMCGYA  145



>ref|XP_006364233.1| PREDICTED: uncharacterized protein LOC102606173 [Solanum tuberosum]
Length=189

 Score = 76.3 bits (186),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DVNNCG CG +C F  QCCRG+C+NTN++PFHCG C +RC   + C  GMCGYAQ
Sbjct  81   DVNNCGFCGIKCPFTWQCCRGICINTNMSPFHCGSCVHRCQPPSLCFNGMCGYAQ  135


 Score = 36.2 bits (82),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  LSKVVRNP*EVGCWDRPWICDE  436
            L +VV+NP  +GC +RPWICDE
Sbjct  38   LKRVVKNPRAIGCGNRPWICDE  59



>ref|XP_011046751.1| PREDICTED: uncharacterized protein LOC105141268 [Populus euphratica]
Length=141

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +3

Query  426  YVTREGLPPPPHSrvrriccrnrcvdvMPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPF  605
            ++ REGL P   S  R  CCRN+CVDV  DV+NCG CG RC F  QCCRG CVNTN +PF
Sbjct  62   WICREGLHP---SSARVQCCRNQCVDVSSDVSNCGFCGIRCSFTRQCCRGFCVNTNRSPF  118

Query  606  HCGRCANRCPFFTFCVYGMCGYA  674
            +CG+C NRCP+   CVYGMCGYA
Sbjct  119  NCGQCGNRCPWKVRCVYGMCGYA  141



>ref|XP_002529465.1| hypothetical protein RCOM_0753050 [Ricinus communis]
 gb|EEF32931.1| hypothetical protein RCOM_0753050 [Ricinus communis]
Length=229

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D+NNCG+CG RC F  QCC G C+NTNV+PF+CG C N+CP+   CVYGMCGYA+
Sbjct  96   DINNCGVCGIRCPFTWQCCHGFCINTNVSPFNCGSCGNKCPWGVLCVYGMCGYAE  150



>ref|XP_007020718.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY12243.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=178

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DV +CGLCG RC F  QCCRG+C NTN++PF+CGRC NRCP+   C+YGMCGYA+
Sbjct  86   DVAHCGLCGIRCPFTRQCCRGICTNTNLSPFNCGRCGNRCPWRVRCLYGMCGYAE  140



>ref|XP_002300326.2| hypothetical protein POPTR_0001s36570g [Populus trichocarpa]
 gb|EEE85131.2| hypothetical protein POPTR_0001s36570g [Populus trichocarpa]
Length=150

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DV+NCG CG RC+F  QCC G CV+TN N FHCGRC NRCP    CVYGMCGYAQ
Sbjct  88   DVSNCGFCGIRCRFARQCCHGFCVDTNCNRFHCGRCGNRCPRKVRCVYGMCGYAQ  142



>ref|XP_006858266.1| hypothetical protein AMTR_s00062p00210870 [Amborella trichopoda]
 gb|ERN19733.1| hypothetical protein AMTR_s00062p00210870 [Amborella trichopoda]
Length=139

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCGLCG RC F   CC+G+C++TNVNPFHCG+C++RCP    C YGMC YA
Sbjct  55   DMTNCGLCGVRCPFSWHCCKGICIDTNVNPFHCGKCSHRCPIGALCFYGMCAYA  108



>gb|KDP39176.1| hypothetical protein JCGZ_00933 [Jatropha curcas]
Length=196

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
             D+NNCGLCG RC F   CC+G CV+T +NPF+CG+C N+CP+   C+YGMCGY++
Sbjct  95   SDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHCIYGMCGYSE  150



>ref|XP_004236464.2| PREDICTED: RNA-binding protein 26 [Solanum lycopersicum]
Length=200

 Score = 70.1 bits (170),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
             DVNNCG C  +C F  QCC+G+C++TN++PFHCG C  RC   + C  GMCGYAQ
Sbjct  90   SDVNNCGFCRIKCPFTWQCCQGICIDTNMSPFHCGSCVRRCQPPSLCFNGMCGYAQ  145


 Score = 37.0 bits (84),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  LSKVVRNP*EVGCWDRPWICDEG  439
            L +VV+NP  +GC +RPWIC+EG
Sbjct  48   LKRVVKNPRAIGCGNRPWICNEG  70



>ref|XP_010064326.1| PREDICTED: chitin-binding lectin 1-like [Eucalyptus grandis]
Length=206

 Score = 75.1 bits (183),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+++CGLC  RC +  +CC G+C N N+NP HCGRC NRCPF   C++GMCGYA
Sbjct  91   DIDHCGLCAIRCPYTWKCCFGLCRNININPLHCGRCFNRCPFGVPCLFGMCGYA  144


 Score = 32.0 bits (71),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +2

Query  344  TNSSS*SPCLSKVVR---NP*EVGCWDRPWICDEG  439
            TN+SS S  L KVV    +P  +GCW RPWIC+ G
Sbjct  37   TNASSSSAWLLKVVSKGGDPRPIGCWSRPWICNRG  71



>gb|KCW66950.1| hypothetical protein EUGRSUZ_F00712 [Eucalyptus grandis]
Length=198

 Score = 74.7 bits (182),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+++CGLC  RC +  +CC G+C N N+NP HCGRC NRCPF   C++GMCGYA
Sbjct  83   DIDHCGLCAIRCPYTWKCCFGLCRNININPLHCGRCFNRCPFGVPCLFGMCGYA  136


 Score = 31.6 bits (70),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +2

Query  344  TNSSS*SPCLSKVVR---NP*EVGCWDRPWICDEG  439
            TN+SS S  L KVV    +P  +GCW RPWIC+ G
Sbjct  29   TNASSSSAWLLKVVSKGGDPRPIGCWSRPWICNRG  63



>ref|XP_010096113.1| hypothetical protein L484_012468 [Morus notabilis]
 gb|EXB63278.1| hypothetical protein L484_012468 [Morus notabilis]
Length=238

 Score = 75.1 bits (183),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D NNCGLCG RC F  QCCRG C NTN++P +CG+C N CP    C +GMCGYAQ
Sbjct  87   DPNNCGLCGARCPFTWQCCRGFCSNTNISPLNCGKCGNICPIGVPCFFGMCGYAQ  141


 Score = 30.4 bits (67),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +2

Query  311  RISVSLGSLRGTNSSS*SPCLSKVVRNP*EVGCWDRPWICDEGG  442
              +  LG+    ++ + SP L K ++ P + GCW RPWIC++ G
Sbjct  26   ETTHGLGAKDTKDNLTSSPWLRKTMK-PRDPGCWKRPWICNQPG  68



>ref|XP_004170565.1| PREDICTED: uncharacterized protein LOC101232665 [Cucumis sativus]
 gb|KGN44087.1| hypothetical protein Csa_7G180130 [Cucumis sativus]
Length=176

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D+ NCG CG  C FP QCC+G CV+TN N F+CG+C N+CPF   CVYGMCGY Q
Sbjct  88   DIKNCGYCGKICPFPQQCCKGFCVDTNNNRFNCGKCGNKCPFRVRCVYGMCGYDQ  142



>ref|XP_003553061.1| PREDICTED: uncharacterized protein LOC100781140 [Glycine max]
 gb|KHN12516.1| hypothetical protein glysoja_035323 [Glycine soja]
Length=142

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCGLCG RC F  +CC G+C N N++ F+CG+C +RCPF T C +G CGYA
Sbjct  89   DRNNCGLCGIRCPFNWKCCGGLCRNINLSIFNCGKCGHRCPFGTLCFFGTCGYA  142



>ref|XP_004514560.1| PREDICTED: uncharacterized protein LOC101498480 [Cicer arietinum]
Length=154

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG C  RC F  +CCRG+C +TN + F+CGRC +RCPF  FC +GMCGY 
Sbjct  62   DRNNCGWCHIRCPFNWKCCRGLCRDTNFSIFNCGRCGHRCPFGEFCFFGMCGYG  115



>ref|XP_003532141.2| PREDICTED: uncharacterized protein LOC100794169 [Glycine max]
Length=138

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+    CCRG CVNTN +  HCG C +RC    +CVYGMCGYA
Sbjct  85   DYHNCGACKMKCKLTDACCRGECVNTNFDKRHCGECNHRCEVGAYCVYGMCGYA  138



>ref|NP_001237283.1| uncharacterized protein LOC100527268 [Glycine max]
 gb|ACU16324.1| unknown [Glycine max]
Length=133

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV+TN +  HCG C +RC    +CVYGMCGYA
Sbjct  80   DKHNCGACKMKCKFTEVCCRGECVDTNFDKRHCGECNHRCEVGAYCVYGMCGYA  133



>gb|KHN12522.1| hypothetical protein glysoja_035329 [Glycine soja]
Length=154

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV+TN +  HCG C +RC    +CVYGMCGYA
Sbjct  101  DKHNCGACKMKCKFTEVCCRGECVDTNFDKRHCGECNHRCEVGAYCVYGMCGYA  154



>ref|XP_007146507.1| hypothetical protein PHAVU_006G046600g [Phaseolus vulgaris]
 gb|ESW18501.1| hypothetical protein PHAVU_006G046600g [Phaseolus vulgaris]
Length=138

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D NNCGLCG RC F  QCCRG+C N N +  +CG+C  RCP+   C +G+CGYA
Sbjct  84   SDKNNCGLCGIRCPFNWQCCRGLCRNINFSSSNCGKCGQRCPYRVRCSFGVCGYA  138



>gb|KHM99532.1| hypothetical protein glysoja_006375 [Glycine soja]
Length=159

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+    CCRG CVNTN +  HCG C +RC    +CVYGMCGYA
Sbjct  106  DYHNCGACKMKCKLTDACCRGECVNTNFDKRHCGECNHRCEVGAYCVYGMCGYA  159



>ref|XP_006452425.1| hypothetical protein CICLE_v10010614mg [Citrus clementina]
 ref|XP_006475132.1| PREDICTED: uncharacterized protein LOC102625441 [Citrus sinensis]
 gb|ESR65665.1| hypothetical protein CICLE_v10010614mg [Citrus clementina]
 gb|KDO62080.1| hypothetical protein CISIN_1g037083mg [Citrus sinensis]
Length=147

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C+F   CCRG CVN + +  HCGRC NRC    FCVYGMC YA
Sbjct  93   TDDKNCGACKKKCKFTEACCRGQCVNLSFDKRHCGRCNNRCEKGQFCVYGMCDYA  147



>ref|XP_004491465.1| PREDICTED: uncharacterized protein LOC101498346 [Cicer arietinum]
Length=175

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D+NNCG CG RC+F  QCC  +C+NTN++PF+CG C   C     C++GMC + +
Sbjct  85   DINNCGFCGIRCRFNFQCCNRLCINTNISPFNCGGCGRECSIGRLCLFGMCAFER  139



>ref|XP_002263655.1| PREDICTED: uncharacterized protein LOC100243449 [Vitis vinifera]
Length=171

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG CG +C+    CCRG CVN +V+P +CGRC N+C  +  C+YGMC YA
Sbjct  118  DPNNCGQCGRKCKHGDICCRGHCVNPSVDPLNCGRCGNKCKKWETCLYGMCSYA  171



>ref|XP_003519587.1| PREDICTED: chitin-binding lectin 1-like [Glycine max]
Length=197

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D  NCGLCG RC F  QCC  +C+NTN+N F+CGRC   CPF   CV+G C + Q
Sbjct  87   DRENCGLCGVRCTFNRQCCNRLCLNTNLNLFNCGRCGRVCPFGRLCVFGSCAFEQ  141



>gb|KEH33880.1| STIG1-like protein [Medicago truncatula]
Length=151

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C   C++   CCRG CV+TN +  HCG C NRC    +CVYGMC YA
Sbjct  98   DKHNCGACKKHCKYTQTCCRGQCVDTNYDKRHCGECNNRCEIGQYCVYGMCDYA  151



>ref|XP_007146513.1| hypothetical protein PHAVU_006G047200g [Phaseolus vulgaris]
 gb|ESW18507.1| hypothetical protein PHAVU_006G047200g [Phaseolus vulgaris]
Length=158

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV+TN +  HCG C +RC    +CVYGMC YA
Sbjct  105  DKHNCGTCKKKCKFTETCCRGQCVDTNFDKRHCGECNHRCEVGEYCVYGMCDYA  158



>ref|NP_001238582.1| uncharacterized protein LOC100305653 precursor [Glycine max]
 gb|ACU13446.1| unknown [Glycine max]
 gb|KHN11906.1| hypothetical protein glysoja_019879 [Glycine soja]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D  NCG+CG RC F  QCC  +C+NTNVN F+CGRC   CP    CV+G+C + Q
Sbjct  85   DRENCGVCGVRCTFNRQCCNRLCLNTNVNIFNCGRCGRVCPLGRLCVFGLCAFEQ  139



>ref|XP_009361100.1| PREDICTED: uncharacterized protein LOC103951459 [Pyrus x bretschneideri]
Length=164

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D NNCG C  +C++   CCRG CVNTN +  HCG+C + C F  +CVYG+C YA
Sbjct  110  EDKNNCGACKKKCKYTESCCRGECVNTNYDKRHCGQCNSPCKFGQYCVYGLCNYA  164



>ref|XP_009379655.1| PREDICTED: uncharacterized protein LOC103968051 [Pyrus x bretschneideri]
Length=164

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D NNCG C  +C++   CCRG CVNTN +  HCG+C + C F  +CVYG+C YA
Sbjct  110  EDKNNCGACKKKCKYTESCCRGECVNTNYDKRHCGQCNSPCKFGQYCVYGLCNYA  164



>ref|XP_010519264.1| PREDICTED: uncharacterized protein LOC104798770 [Tarenaya hassleriana]
Length=175

 Score = 63.5 bits (153),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            DVN+C  C   C F   CC G CVN N +PF+CGRC N CP    C +GMCGYAQ
Sbjct  88   DVNHCRFCNRNCPFSWLCCDGNCVNVNTDPFNCGRCGNMCPVGAPCEFGMCGYAQ  142


 Score = 27.7 bits (60),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +2

Query  404  GCWDRPWICDEGGVTSAA  457
            GCW RPWIC +G    A 
Sbjct  57   GCWSRPWICKQGAPPRAV  74



>ref|XP_004516940.1| PREDICTED: uncharacterized protein LOC101514133 [Cicer arietinum]
Length=153

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D++NCGLCG RC F  QCC  +CVNTN+NP +CG C   CP  + C++G C   
Sbjct  82   DIDNCGLCGIRCLFNRQCCNRLCVNTNINPLNCGACGRACPIGSLCLFGRCSLE  135



>ref|XP_006449772.1| hypothetical protein CICLE_v10018080mg [Citrus clementina]
 gb|ESR63012.1| hypothetical protein CICLE_v10018080mg [Citrus clementina]
Length=138

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG++C++   CCRG CVN + +  HCG C N+C    FCVYGMC YA
Sbjct  85   DRLNCGMCGYKCKYTEICCRGKCVNASFDKRHCGGCNNKCKKGEFCVYGMCSYA  138



>ref|XP_004513882.1| PREDICTED: uncharacterized protein LOC101495420 [Cicer arietinum]
Length=153

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C++   CCRG CV+T+ +  HCG C NRC    +CVYGMC YA
Sbjct  100  DKHNCGACKKKCKYTQTCCRGECVDTDYDKRHCGECNNRCKKGEYCVYGMCNYA  153



>ref|XP_008449121.1| PREDICTED: uncharacterized protein LOC103491076 [Cucumis melo]
Length=164

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D +NCG C  +C++  +CCRG CV+   +  HCGRC NRC    FCVYGMC YA
Sbjct  109  MNDRHNCGECKKKCKYTGECCRGECVDVAYDKRHCGRCNNRCKPGKFCVYGMCEYA  164



>ref|XP_010316576.1| PREDICTED: uncharacterized protein LOC104645793 [Solanum lycopersicum]
Length=162

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCGLCG +C++   CCRG CVNT  +  HCG C N+C   + CVYGMC YA
Sbjct  106  LADRQNCGLCGKKCRYNETCCRGKCVNTLFHKKHCGGCGNKCQQGSSCVYGMCSYA  161



>ref|XP_007026144.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY28766.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=157

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC +   CC+G CVN +V+ +HCGRC N C   + C+YG+C YA
Sbjct  101  MTDKGNCGKCGKRCSYSEMCCQGRCVNPSVDEYHCGRCNNACKKGSSCLYGLCSYA  156



>ref|XP_010252477.1| PREDICTED: uncharacterized protein LOC104594055 [Nelumbo nucifera]
Length=163

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++   CCRG CVN  V+  HCG+C N+C   + CVYGMC YA
Sbjct  108  LTDRLNCGMCGRKCKYSQICCRGECVNPLVDKKHCGQCTNKCKKGSKCVYGMCSYA  163



>ref|XP_004295839.1| PREDICTED: uncharacterized protein LOC101305836 [Fragaria vesca 
subsp. vesca]
Length=142

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D +NCG C  +C++   CCRG CV+TN +  HCG C NRC    +CVYGMC YA
Sbjct  88   EDKHNCGACKKKCKYTDTCCRGGCVDTNFDKRHCGGCNNRCEKGQYCVYGMCNYA  142



>ref|XP_008375590.1| PREDICTED: uncharacterized protein LOC103438822 [Malus domestica]
 ref|XP_008351768.1| PREDICTED: uncharacterized protein LOC103415205 [Malus domestica]
Length=160

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  107  DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  160



>ref|XP_008356860.1| PREDICTED: uncharacterized protein LOC103420578 [Malus domestica]
Length=160

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  107  DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  160



>ref|XP_007142306.1| hypothetical protein PHAVU_008G269500g [Phaseolus vulgaris]
 gb|ESW14300.1| hypothetical protein PHAVU_008G269500g [Phaseolus vulgaris]
Length=288

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
             D +NCG+CGFRC F  QCC  +CVNTN N F+CG C   CPF   CV+G+C + Q
Sbjct  80   ADNDNCGICGFRCLFNRQCCNRLCVNTNRNIFNCGGCGRVCPFGRLCVFGVCAFEQ  135



>ref|XP_008345814.1| PREDICTED: uncharacterized protein LOC103408764 [Malus domestica]
Length=127

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  74   DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  127



>gb|KDP39163.1| hypothetical protein JCGZ_00920 [Jatropha curcas]
Length=146

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG C  +C+    CCRG CV  +++  HCGRC NRC    +CV+GMCGYA
Sbjct  93   DNNNCGTCKNKCKHTQACCRGQCVYLSLDKRHCGRCNNRCAKGEYCVFGMCGYA  146



>ref|XP_008384254.1| PREDICTED: uncharacterized protein LOC103446877 [Malus domestica]
Length=160

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  107  DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  160



>ref|XP_004295285.1| PREDICTED: uncharacterized protein LOC101301662 [Fragaria vesca 
subsp. vesca]
Length=147

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D NNCG CG +C++   CC G+CVN +VN  HCG+C N+C   + CV+G+C YA 
Sbjct  93   DTNNCGRCGAKCKYSELCCNGVCVNPSVNGKHCGKCGNKCGNGSSCVFGLCSYAN  147



>ref|XP_008371164.1| PREDICTED: uncharacterized protein LOC103434584 [Malus domestica]
 ref|XP_008355953.1| PREDICTED: uncharacterized protein LOC103419632 [Malus domestica]
Length=160

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  107  DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  160



>ref|XP_004295286.1| PREDICTED: uncharacterized protein LOC101301953 [Fragaria vesca 
subsp. vesca]
Length=138

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG++C++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  84   TDRLNCGMCGYKCKYTEICCRGKCVNASFDKRHCGGCNQKCKRGEFCVYGMCNYA  138



>ref|XP_009352632.1| PREDICTED: uncharacterized protein LOC103943972 [Pyrus x bretschneideri]
Length=160

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG+RC++   CCRG CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  107  DRYNCGICGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGDFCVYGMCHYA  160



>gb|KEH36913.1| STIG1-like protein [Medicago truncatula]
Length=134

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCG CG +C FP  CC G CVN   N  HCG+C N+C     CVYGMC YA
Sbjct  81   DMFNCGRCGKKCSFPKICCEGKCVNPRSNKKHCGKCGNKCESRGSCVYGMCSYA  134



>gb|KEH36912.1| STIG1-like protein [Medicago truncatula]
Length=134

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCG CG +C FP  CC G CVN   N  HCG+C N+C     CVYGMC YA
Sbjct  81   DMFNCGRCGKKCSFPRICCEGKCVNPRSNKKHCGKCGNKCDSKGSCVYGMCSYA  134



>ref|XP_004171090.1| PREDICTED: uncharacterized LOC101217149 [Cucumis sativus]
 gb|KGN56079.1| hypothetical protein Csa_3G067250 [Cucumis sativus]
Length=163

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C++  +CCRG CV+   +  HCGRC NRC    FCVYGMC YA
Sbjct  110  DKHNCGGCKKKCKYTDECCRGQCVDFAYDKRHCGRCNNRCMRGKFCVYGMCEYA  163



>ref|XP_002317296.1| stigma-specific Stig1 family protein [Populus trichocarpa]
 gb|EEE97908.1| stigma-specific Stig1 family protein [Populus trichocarpa]
Length=159

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGY  671
             D +NCG C  +C++   CCRG CV  +++  HCGRC NRC    FCVYGMC Y
Sbjct  105  TDKHNCGSCKRKCKYTEDCCRGECVLLSLDKRHCGRCNNRCQDGEFCVYGMCNY  158



>ref|XP_008364671.1| PREDICTED: uncharacterized protein LOC103428338 [Malus domestica]
Length=164

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C++   CCRG CVNTN +  HCG+C + C F  +CVYG+C YA
Sbjct  110  EDKXNCGACRKKCKYTESCCRGECVNTNYDKRHCGQCNSPCKFGQYCVYGLCNYA  164



>gb|KEH36911.1| STIG1-like protein [Medicago truncatula]
Length=135

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCG CG +C FP  CC G CVN   N  HCG+C N+C     CVYGMC YA
Sbjct  82   DMFNCGRCGKKCSFPKICCEGKCVNPRSNKKHCGKCGNKCESRGSCVYGMCSYA  135



>ref|XP_010315700.1| PREDICTED: uncharacterized protein LOC104645570 [Solanum lycopersicum]
Length=137

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG CG +C++  +CC+G CVN  VN  HCG+C N C   + C YGMC YA
Sbjct  82   LNDRSNCGKCGNKCKYSERCCQGWCVNIYVNKKHCGKCNNECKRGSSCSYGMCNYA  137



>ref|XP_004149335.1| PREDICTED: uncharacterized protein LOC101217149 [Cucumis sativus]
Length=91

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C++  +CCRG CV+   +  HCGRC NRC    FCVYGMC YA
Sbjct  38   DKHNCGGCKKKCKYTDECCRGQCVDFAYDKRHCGRCNNRCMRGKFCVYGMCEYA  91



>ref|XP_004486180.1| PREDICTED: keratin-associated protein 5-1-like [Cicer arietinum]
Length=134

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCG CG +C FP  CC G CVN   N  HCG+C N+C     CVYGMC YA
Sbjct  81   DMFNCGRCGKKCSFPKICCEGKCVNPRSNEKHCGKCGNKCNSKGSCVYGMCSYA  134



>ref|XP_010502751.1| PREDICTED: uncharacterized protein LOC104779986 [Camelina sativa]
Length=169

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C+F  +CC G+C N   NP HCG+C  +C     C YG CGYA
Sbjct  114  LGDMNNCGRCGHKCRFGQRCCGGICTNVGFNPKHCGKCNKKCKSGVKCEYGYCGYA  169



>ref|XP_008226620.1| PREDICTED: uncharacterized protein LOC103326199 [Prunus mume]
Length=151

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+  + CC G C+NT  N  +CG+C  +C +   C YG CGYA
Sbjct  96   LGDKNNCGKCGSKCKLGMHCCNGTCINTTFNANNCGKCGKKCKYGVKCEYGYCGYA  151



>ref|XP_011046721.1| PREDICTED: uncharacterized protein LOC105141248 [Populus euphratica]
Length=161

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGY  671
             D +NCG C  +C+F   CCRG CV  +++  HCG+C NRC    FCVYGMC Y
Sbjct  107  TDKHNCGACKKKCKFTEDCCRGECVLLSLDKRHCGKCNNRCLKGEFCVYGMCNY  160



>ref|XP_010536680.1| PREDICTED: uncharacterized protein LOC104811623 [Tarenaya hassleriana]
Length=150

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  RC+F   CCRG CV    +  HCG+C  RCP   FCVYG+C YA
Sbjct  97   DDKNCGACKNRCKFSQTCCRGQCVYLAYDKRHCGQCTRRCPAGDFCVYGLCNYA  150



>gb|KDP34394.1| hypothetical protein JCGZ_12788 [Jatropha curcas]
Length=136

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C+FP  CC+G CVN   N  HCG C N+C     C YGMC YA
Sbjct  81   MTDKVNCGKCGKKCKFPEICCKGACVNLMSNKNHCGGCNNKCKKGRVCAYGMCSYA  136



>ref|XP_004516942.1| PREDICTED: uncharacterized protein LOC101514783 [Cicer arietinum]
Length=153

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG CG RC F  QCC  +CVNTN+NP +CG C   CP  + C++G C   
Sbjct  82   DRDNCGFCGIRCLFNRQCCNRLCVNTNINPLNCGACGRACPIGSLCLFGRCSLE  135



>ref|XP_003597653.1| hypothetical protein MTR_2g100600 [Medicago truncatula]
 gb|AES67904.1| STIG1-like protein [Medicago truncatula]
Length=134

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D+ NCG CG +C FP  CC G CVN   N  HCG+C N+C     CVYGMC YA
Sbjct  81   DMFNCGRCGKKCSFPKICCEGKCVNPRSNEKHCGKCGNKCDNRGSCVYGMCRYA  134



>ref|XP_002304979.1| hypothetical protein POPTR_0004s03050g [Populus trichocarpa]
 gb|EEE85490.1| hypothetical protein POPTR_0004s03050g [Populus trichocarpa]
Length=146

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG++C++   CC+G CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  92   TDRFNCGMCGYKCKYTETCCKGKCVNPSFDKRHCGGCNKKCKKGEFCVYGMCSYA  146



>gb|KGN64492.1| hypothetical protein Csa_1G059710 [Cucumis sativus]
Length=139

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVNT  N  HCG C N+C   + CVYGMCGYA
Sbjct  86   DRYNCGRCGKKCKYSEVCCKGKCVNTMFNRKHCGGCNNKCNRGSLCVYGMCGYA  139



>ref|XP_006369973.1| stigma-specific Stig1 family protein [Populus trichocarpa]
 gb|ERP66542.1| stigma-specific Stig1 family protein [Populus trichocarpa]
Length=143

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGY  671
             D  NCG C  +C++   CCRG CV  +++  HCG+C NRC    FCVYGMC Y
Sbjct  89   TDKQNCGACKRKCKYTEDCCRGECVLLSLDKRHCGKCNNRCQKGEFCVYGMCNY  142



>ref|XP_008782279.1| PREDICTED: uncharacterized protein LOC103701849 [Phoenix dactylifera]
Length=147

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC++   CC G CVN   +P +CG C NRC   +FC YGMC YA
Sbjct  92   MKDNLNCGQCGLRCRYGTTCCSGRCVNVMFDPQNCGGCKNRCKKGSFCSYGMCNYA  147



>gb|KEH29539.1| STIG1-like protein [Medicago truncatula]
Length=156

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C   C++   CCRG CV+TN +  HCG C  RC    +CVYGMC YA
Sbjct  103  DKHNCGACKKHCKYTQTCCRGACVDTNYDKRHCGGCNVRCEIGQYCVYGMCDYA  156



>ref|XP_008440806.1| PREDICTED: uncharacterized protein LOC103485113 [Cucumis melo]
Length=139

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVNT  N  HCG C N+C   + CVYGMCGYA
Sbjct  86   DRYNCGRCGRKCKYSEVCCKGKCVNTMFNRKHCGGCNNKCNRGSLCVYGMCGYA  139



>ref|XP_010244468.1| PREDICTED: uncharacterized protein LOC104588297 [Nelumbo nucifera]
Length=178

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG C  +C++   CC G CVN + +  HCGRC NRC    +C+YGMC YA
Sbjct  125  DSNNCGACKNKCKYTEACCSGECVNLSFDKRHCGRCNNRCMPGGYCIYGMCDYA  178



>ref|XP_006383879.1| hypothetical protein POPTR_0004s00830g [Populus trichocarpa]
 gb|ERP61676.1| hypothetical protein POPTR_0004s00830g [Populus trichocarpa]
Length=149

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC+G CVN +V+  HCG+C  +C   + C+YG+C YA
Sbjct  93   MSDKLNCGKCGKKCKYSEMCCQGKCVNPSVDEKHCGKCNQKCKKGSSCLYGLCSYA  148



>ref|XP_010252476.1| PREDICTED: uncharacterized protein LOC104594054 [Nelumbo nucifera]
Length=158

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++   CC+G CVN  ++  HCG+C N+C   + CVYGMC YA
Sbjct  103  LTDRLNCGMCGRKCKYSQICCKGECVNPLMDKKHCGQCNNKCKKGSKCVYGMCSYA  158



>ref|XP_009355704.1| PREDICTED: uncharacterized protein LOC103946670 [Pyrus x bretschneideri]
Length=162

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D +NCG C  +C++   CCRG CV+TN +  HCG+C + C    FCVYG+C YA
Sbjct  108  EDKHNCGACKKKCKYTESCCRGGCVDTNYDKRHCGQCNSPCKLGQFCVYGLCNYA  162



>ref|XP_008367040.1| PREDICTED: uncharacterized protein LOC103430663 [Malus domestica]
Length=150

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+F ++CC G C+NT  +  +CG+C  +C +   C YG CGYA
Sbjct  95   LSDKNNCGKCGNKCKFGMRCCNGTCMNTTSDANNCGKCGKKCKYGVKCEYGYCGYA  150



>ref|XP_009356799.1| PREDICTED: uncharacterized protein LOC103947607 [Pyrus x bretschneideri]
Length=150

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+F ++CC G C+NT  +  +CG+C  +C +   C YG CGYA
Sbjct  95   LSDKNNCGKCGNKCKFGMRCCNGTCMNTTSDANNCGKCGKKCKYGVKCEYGYCGYA  150



>ref|XP_011046969.1| PREDICTED: uncharacterized protein LOC105141445 [Populus euphratica]
Length=149

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC+G CVN +V+  HCG+C  +C   + C+YG+C YA
Sbjct  93   MTDKLNCGKCGKKCKYSEMCCQGKCVNPSVDEKHCGKCNQKCKKGSSCLYGLCSYA  148



>ref|XP_006586759.1| PREDICTED: uncharacterized protein LOC102659740 [Glycine max]
Length=156

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG RC++   CC+G CVN   +  HCG+C N+C     CV+G+C YA
Sbjct  103  DRNNCGMCGKRCKYSQVCCKGKCVNPMFDKHHCGKCGNKCNKGDACVFGLCSYA  156



>ref|XP_011016145.1| PREDICTED: uncharacterized protein LOC105119676 [Populus euphratica]
Length=146

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG++C++   CC+G CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  92   TDRFNCGMCGYKCKYTETCCKGTCVNPSFDKRHCGGCNKKCKNGEFCVYGMCSYA  146



>ref|XP_002518439.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43826.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D +NCG CG +C++   CC+G CVN + +  +CG+C NRC   + C YG+C YA
Sbjct  101  MTDESNCGKCGKKCKYSETCCQGKCVNVSNDEKNCGKCNNRCKKGSSCAYGLCSYA  156



>ref|XP_011003390.1| PREDICTED: uncharacterized protein LOC105110149 [Populus euphratica]
Length=146

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG++C++   CC+G CVN + +  HCG C  +C    FCVYGMC YA
Sbjct  92   TDRFNCGMCGYKCKYTETCCKGTCVNPSFDKRHCGGCNKKCKNGEFCVYGMCSYA  146



>ref|XP_006847558.1| hypothetical protein AMTR_s00014p00178050 [Amborella trichopoda]
 gb|ERN09139.1| hypothetical protein AMTR_s00014p00178050 [Amborella trichopoda]
Length=161

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + +NCG CG +C+F   CCRG CV+   +  HCGRC NRC     C+YG+C YA
Sbjct  108  NSHNCGQCGHKCKFIQACCRGQCVDLAFDKRHCGRCNNRCTKSVLCIYGLCNYA  161



>ref|XP_006350489.1| PREDICTED: uncharacterized protein LOC102584178 [Solanum tuberosum]
Length=137

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG CG +C++   CC+G CVN  VN  HCG+C N C   + C YGMC YA
Sbjct  82   LNDRSNCGKCGNKCKYSEICCQGWCVNIYVNKKHCGKCNNECKKGSSCSYGMCNYA  137



>ref|XP_007213548.1| hypothetical protein PRUPE_ppa018122mg [Prunus persica]
 gb|EMJ14747.1| hypothetical protein PRUPE_ppa018122mg [Prunus persica]
Length=151

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+  + CC G C+NT  N  +CG+C  +C +   C YG CGYA
Sbjct  96   LGDKNNCGKCGNKCKLGMHCCNGTCINTTFNANNCGKCGKKCKYGVKCEYGYCGYA  151



>ref|XP_008440721.1| PREDICTED: uncharacterized protein LOC103485051 [Cucumis melo]
Length=157

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG CG +C++   CC+G CVN   N  HCG C   C   +FCVYGMCGYA
Sbjct  104  DRNNCGRCGKKCKYSKICCKGKCVNPLFNRKHCGGCNIECSKGSFCVYGMCGYA  157



>ref|XP_006383880.1| hypothetical protein POPTR_0004s00840g [Populus trichocarpa]
 gb|ERP61677.1| hypothetical protein POPTR_0004s00840g [Populus trichocarpa]
Length=152

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  97   MTDKLNCGMCGKKCKYPEICCKGQCVNPMSNKKNCGGCSNKCKKGSTCQYGMCSYA  152



>ref|XP_010252478.1| PREDICTED: uncharacterized protein LOC104594056 [Nelumbo nucifera]
Length=151

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D +NC +CG++C++P  CC+G CVNT+ +  +CG C N+C     C YG+C YA
Sbjct  96   MTDRSNCWMCGYKCKYPEVCCKGSCVNTSFDRNNCGGCNNKCKKGETCAYGLCNYA  151



>ref|XP_008385861.1| PREDICTED: uncharacterized protein LOC103448383 [Malus domestica]
Length=162

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D +NCG C  +C++   CCRG CV+TN +  HCG+C + C    FCVYG+C YA
Sbjct  108  EDKHNCGACKQKCKYTESCCRGGCVDTNYDKRHCGQCNSPCKLGQFCVYGLCNYA  162



>ref|XP_004145194.1| PREDICTED: uncharacterized protein LOC101214260 [Cucumis sativus]
 ref|XP_004153490.1| PREDICTED: uncharacterized protein LOC101209985 [Cucumis sativus]
 ref|XP_004161980.1| PREDICTED: uncharacterized protein LOC101227666 [Cucumis sativus]
 gb|KGN64481.1| hypothetical protein Csa_1G058155 [Cucumis sativus]
Length=157

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG CG +C++   CC+G CVN   N  HCG C   C   +FCVYGMCGYA
Sbjct  104  DRNNCGRCGKKCKYSKICCKGKCVNPLFNRKHCGGCNIECSKGSFCVYGMCGYA  157



>ref|XP_010465482.1| PREDICTED: uncharacterized protein LOC104745826 [Camelina sativa]
Length=171

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D++NCG CG +C+F  +CC G+C N   NP HCG+C  +C     C YG CGYA
Sbjct  116  LGDMDNCGRCGHKCRFGQRCCGGICTNVGFNPKHCGKCNKKCKSGVKCEYGYCGYA  171



>ref|XP_007214081.1| hypothetical protein PRUPE_ppa015303mg [Prunus persica]
 gb|EMJ15280.1| hypothetical protein PRUPE_ppa015303mg [Prunus persica]
Length=152

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG+RC++   CCRG CVN + +  HCG C  +C    +CV+GMC YA
Sbjct  98   TDRYNCGFCGYRCKYTEICCRGKCVNASFDKRHCGGCNQKCKKGEYCVFGMCNYA  152



>ref|XP_007147699.1| hypothetical protein PHAVU_006G147300g [Phaseolus vulgaris]
 gb|ESW19693.1| hypothetical protein PHAVU_006G147300g [Phaseolus vulgaris]
Length=159

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C++   CC+G CVN   +  HCG+C N+C     CV+G+C YA
Sbjct  106  DRNNCGMCGKKCKYSQVCCKGKCVNPMFDKHHCGKCGNKCVKGDSCVFGLCSYA  159



>ref|XP_006383881.1| hypothetical protein POPTR_0004s00850g [Populus trichocarpa]
 gb|ERP61678.1| hypothetical protein POPTR_0004s00850g [Populus trichocarpa]
Length=155

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  100  MTDRLNCGMCGKKCKYPEICCKGQCVNPMSNKKNCGGCSNKCKKGSKCQYGMCSYA  155



>ref|XP_006299155.1| hypothetical protein CARUB_v10015298mg [Capsella rubella]
 gb|EOA32053.1| hypothetical protein CARUB_v10015298mg [Capsella rubella]
Length=169

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C+F  +CC G+C     NP HCG+C N+C     C YG CGYA
Sbjct  114  LGDMNNCGRCGHKCRFGQRCCGGICTYVGFNPKHCGKCNNKCKSGVKCEYGYCGYA  169



>ref|XP_006304799.1| hypothetical protein CARUB_v10012396mg [Capsella rubella]
 gb|EOA37697.1| hypothetical protein CARUB_v10012396mg [Capsella rubella]
Length=169

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  114  LGDMNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA  169



>ref|XP_011015444.1| PREDICTED: uncharacterized protein LOC105119043 [Populus euphratica]
Length=154

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  99   MTDRLNCGMCGKKCRYPEICCKGQCVNPMTNKKNCGGCSNKCKKGSKCQYGMCSYA  154



>gb|KFK35745.1| hypothetical protein AALP_AA4G031000 [Arabis alpina]
Length=168

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  113  LGDMNNCGQCGHKCGFGQRCCGGVCTYVNFNPNHCGKCKKKCASGVKCEYGYCGYA  168



>gb|KDP20713.1| hypothetical protein JCGZ_21184 [Jatropha curcas]
Length=154

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++P  CC+G CVN   N  HCG C N+C   + C YGMC YA
Sbjct  101  DKTNCGKCGRKCKYPEICCKGACVNPMSNKKHCGGCNNKCKKGSTCSYGMCSYA  154



>ref|NP_200322.1| Stigma-specific Stig1 family protein [Arabidopsis thaliana]
 dbj|BAB08580.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96582.1| Stigma-specific Stig1 family protein [Arabidopsis thaliana]
Length=163

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCGLC  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  110  DDKNCGLCKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCDLGEFCVYGLCNYA  163



>ref|XP_010479856.1| PREDICTED: uncharacterized protein LOC104758650 [Camelina sativa]
Length=169

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  114  LGDMNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA  169



>ref|XP_010487351.1| PREDICTED: uncharacterized protein LOC104765356 [Camelina sativa]
Length=167

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+ NCG CG +C+F  +CC G+C N   NP HCG+C  +C     C YG CGYA
Sbjct  112  LGDMKNCGRCGHKCRFGQRCCGGICTNVGFNPKHCGKCNKKCKSGVKCEYGYCGYA  167



>gb|EYU20878.1| hypothetical protein MIMGU_mgv1a022949mg [Erythranthe guttata]
Length=150

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG C  +C F   CCRG CVN   +  HCG C  RC    FC+YGMC YA
Sbjct  97   DENNCGACKNKCAFTESCCRGKCVNLAFDKRHCGACNKRCMTGGFCIYGMCDYA  150



>ref|XP_009147630.1| PREDICTED: uncharacterized protein LOC103871154 [Brassica rapa]
Length=167

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  112  LGDMNNCGRCGKKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCKSGVECEYGYCGYA  167



>emb|CDY24115.1| BnaA06g01130D [Brassica napus]
Length=167

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  112  LGDMNNCGRCGKKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCKSGVECEYGYCGYA  167



>ref|XP_008224753.1| PREDICTED: uncharacterized protein LOC103324472 [Prunus mume]
Length=152

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMC  665
             D  NCG CG+RC++   CCRG CVN +++  HCG C  +C    +CVYGMC
Sbjct  100  TDRYNCGFCGYRCKYTEICCRGKCVNASLDKRHCGACNQKCKKGEYCVYGMC  151



>ref|XP_010462174.1| PREDICTED: uncharacterized protein LOC104742819 [Camelina sativa]
 ref|XP_010462176.1| PREDICTED: uncharacterized protein LOC104742821 [Camelina sativa]
Length=169

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  114  LGDMNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA  169



>ref|XP_007026145.1| Stigma-specific Stig1 family protein [Theobroma cacao]
 gb|EOY28767.1| Stigma-specific Stig1 family protein [Theobroma cacao]
Length=126

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG++C++   CC+G CVN + +  +CG C  RC    FCVYGMC YA
Sbjct  72   TDRMNCGMCGYKCKYGEICCKGQCVNASFDKRNCGGCNKRCKKGEFCVYGMCNYA  126



>ref|XP_010545231.1| PREDICTED: uncharacterized protein LOC104817674 [Tarenaya hassleriana]
Length=150

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG+C +RCP   FCVYG+C YA
Sbjct  97   DDKNCGSCQNKCKFSQTCCRGQCVYLAYDKRHCGQCNHRCPVGEFCVYGLCNYA  150



>gb|AAQ65153.1| At1g53130 [Arabidopsis thaliana]
Length=89

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  34   LGDRNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA  89



>ref|XP_009795208.1| PREDICTED: uncharacterized protein LOC104241938 [Nicotiana sylvestris]
Length=168

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C++   CC+G CVNT  +  HCG C N+C     CVYGMC YA
Sbjct  113  TDKQNCGFCGKKCRYNETCCKGQCVNTLFHKRHCGGCNNKCQKGNACVYGMCSYA  167



>ref|XP_008782254.1| PREDICTED: uncharacterized protein LOC103701833 [Phoenix dactylifera]
Length=147

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC++   CC G CVN   +P +CG C NRC   +FC +GMC YA
Sbjct  92   MKDNLNCGQCGLRCRYGTTCCSGRCVNVMFDPQNCGGCKNRCKKGSFCSHGMCNYA  147



>ref|XP_009409631.1| PREDICTED: uncharacterized protein LOC103991816 [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYAQ  677
            D  NCG CG RC++   CCRG CVN   +  +CG C  RCP  +FC YGMC YA 
Sbjct  79   DSLNCGRCGRRCRYGWTCCRGRCVNIMYDAKNCGACRRRCPNGSFCRYGMCSYAS  133



>ref|NP_175721.1| protein GRIM REAPER [Arabidopsis thaliana]
 gb|AAF87867.1|AC022520_11 Unknown protein [Arabidopsis thaliana]
 dbj|BAD43803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32894.1| Stigma-specific Stig1 family protein [Arabidopsis thaliana]
Length=168

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C F  +CC G+C   N NP HCG+C  +C     C YG CGYA
Sbjct  113  LGDRNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA  168



>ref|XP_002882925.1| hypothetical protein ARALYDRAFT_897805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59184.1| hypothetical protein ARALYDRAFT_897805 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C+F  +CC G+C     NP HCG+C  +C     C YG CGYA
Sbjct  111  LGDMNNCGRCGHKCRFGQRCCGGICTYVGFNPKHCGKCNKKCKSGIKCEYGYCGYA  166



>gb|KCW75256.1| hypothetical protein EUGRSUZ_E04008 [Eucalyptus grandis]
Length=84

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  RC++   CC+G CVN +V+  HCGRC N+C   + CV+G+C YA
Sbjct  31   DRLNCGACRKRCKYGEMCCQGKCVNPSVDEKHCGRCGNKCSKGSSCVHGLCNYA  84



>ref|XP_006383882.1| hypothetical protein POPTR_0004s00860g [Populus trichocarpa]
 gb|ERP61679.1| hypothetical protein POPTR_0004s00860g [Populus trichocarpa]
Length=144

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  89   ITDRLNCGMCGNKCKYPEICCKGQCVNPMSNKKNCGGCSNKCKKGSTCQYGMCSYA  144



>ref|XP_011046967.1| PREDICTED: uncharacterized protein LOC105141442 [Populus euphratica]
Length=154

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  99   MTDRLNCGMCGKKCRYPEICCKGQCVNPMNNKKNCGGCSNKCKKGSKCQYGMCSYA  154



>ref|XP_010644540.1| PREDICTED: uncharacterized protein LOC104877613 [Vitis vinifera]
Length=158

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVN +V+  HCG C NRC    FCV+G+C YA
Sbjct  105  DRQNCGKCGRKCKYGYICCKGKCVNPSVSKRHCGGCNNRCNTGGFCVFGLCNYA  158



>ref|XP_009598822.1| PREDICTED: uncharacterized protein LOC104094565 [Nicotiana tomentosiformis]
Length=135

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC G CVNT  N  HCG+C N C   + C YGMC YA
Sbjct  80   MTDRFNCGRCGKKCRYSEICCEGWCVNTYFNKRHCGKCNNACKKGSSCSYGMCNYA  135



>ref|XP_002518440.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43827.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++P  CC+G CVN   N  HCG C N+C     CVYGMC YA
Sbjct  104  MTDGLNCGNCGKKCKYPEICCKGGCVNPMSNNKHCGGCNNKCKKGNKCVYGMCSYA  159



>ref|XP_009381680.1| PREDICTED: uncharacterized protein LOC103969755 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C+F   CC G CVN   +P +CG C  RC   +FC YGMC YA
Sbjct  84   MSDNQNCGQCGTKCRFGQACCGGRCVNVMYDPKNCGGCKKRCKKGSFCQYGMCSYA  139



>gb|KHN33005.1| hypothetical protein glysoja_009996 [Glycine soja]
Length=117

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C F   CC G CVN   N  HCG+C N+C     CV+GMC YA
Sbjct  63   TDRLNCGRCGKKCSFGKICCEGKCVNPKTNEKHCGKCGNKCNAKGSCVFGMCSYA  117



>ref|XP_006443574.1| hypothetical protein CICLE_v10023606mg [Citrus clementina]
 ref|XP_006479336.1| PREDICTED: uncharacterized protein LOC102609666 [Citrus sinensis]
 gb|ESR56814.1| hypothetical protein CICLE_v10023606mg [Citrus clementina]
 gb|KDO65965.1| hypothetical protein CISIN_1g044138mg [Citrus sinensis]
Length=151

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG  C++   CCRG CVN   N  HCG C N+C   + C YGMC YA
Sbjct  96   MKDRFNCGKCGRNCKYWQTCCRGRCVNVMSNEKHCGGCNNKCKKGSSCTYGMCSYA  151



>ref|XP_010252479.1| PREDICTED: uncharacterized protein LOC104594057 [Nelumbo nucifera]
Length=168

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++   CC+G C+N + N  HCG C NRC    FC +G+C YA
Sbjct  113  LTDRLNCGMCGRKCKYTEICCKGKCINPSFNRRHCGGCNNRCKTGEFCAFGLCNYA  168



>ref|XP_011079217.1| PREDICTED: uncharacterized protein LOC105162799 [Sesamum indicum]
Length=152

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C F   CCRG CVN   +  HCG C NRC    +C+YGMC YA
Sbjct  99   DSKNCGACKKKCAFTESCCRGECVNLAYDKRHCGSCNNRCMPGGYCIYGMCDYA  152



>ref|XP_010057903.1| PREDICTED: uncharacterized protein LOC104445688 [Eucalyptus grandis]
Length=146

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  RC++   CC+G CVN +V+  HCGRC N+C   + CV+G+C YA
Sbjct  93   DRLNCGACRKRCKYGEMCCQGKCVNPSVDEKHCGRCGNKCSKGSSCVHGLCNYA  146



>ref|XP_006383878.1| hypothetical protein POPTR_0004s00820g [Populus trichocarpa]
 gb|ERP61675.1| hypothetical protein POPTR_0004s00820g [Populus trichocarpa]
Length=145

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG +C++   CC+G CVN + +  +CG C  +C    FCVYGMC YA
Sbjct  91   KDRLNCGMCGHKCKYTEICCKGQCVNASFDKRNCGGCNKKCKKGEFCVYGMCSYA  145



>ref|XP_004297923.1| PREDICTED: uncharacterized protein LOC101308760 [Fragaria vesca 
subsp. vesca]
Length=155

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+F  +CC G C     NP HCG+C  +C     C YG CGYA
Sbjct  100  LGDRNNCGKCGHKCEFSQRCCNGKCTYVAYNPNHCGKCTRKCSAGVKCEYGYCGYA  155



>ref|XP_009764581.1| PREDICTED: uncharacterized protein LOC104216261 [Nicotiana sylvestris]
Length=188

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG  C++   CC+G CVNT  +  HCG C N+C   + C YGMC YA
Sbjct  132  LNDKENCGFCGKNCKYNETCCKGQCVNTLFHKRHCGSCNNKCKSDSSCAYGMCSYA  187



>ref|NP_001236011.1| uncharacterized protein LOC100500553 precursor [Glycine max]
 gb|ACU15667.1| unknown [Glycine max]
Length=131

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C F   CC G CVN   N  HCG+C N+C     CV+GMC YA
Sbjct  77   TDRLNCGRCGKKCSFGKICCEGKCVNPKTNEKHCGKCGNKCNAKGSCVFGMCSYA  131



>ref|XP_009609640.1| PREDICTED: uncharacterized protein LOC104103441 [Nicotiana tomentosiformis]
Length=148

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CVN + +  HCG C NRC    +C YGMC YA
Sbjct  95   DDHNCGTCKKKCRFTETCCRGECVNLSFDKRHCGYCNNRCMTGGYCFYGMCDYA  148



>ref|XP_009358460.1| PREDICTED: uncharacterized protein LOC103949058 [Pyrus x bretschneideri]
Length=150

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG +C++   CC+G CVN   +  +CG C N+C   + CVYGMC YA
Sbjct  96   TDRVNCGMCGKKCKYGETCCKGKCVNPRSDKKNCGSCNNKCKKGSSCVYGMCSYA  150



>ref|XP_007020752.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY12277.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=162

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG C  +C+F   CCRG CV  +++  HCG C +RC    +CVYGMC YA
Sbjct  107  VTDGHNCGACRNKCKFTQVCCRGECVYISMDKRHCGACNHRCKHGEYCVYGMCNYA  162



>ref|XP_011046970.1| PREDICTED: uncharacterized protein LOC105141446 [Populus euphratica]
Length=144

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG +C++   CC+G CVN + +  +CG C  +C    FCVYGMC YA
Sbjct  90   KDRLNCGMCGSKCKYTEICCKGQCVNASFDKRNCGGCNKKCKKGEFCVYGMCNYA  144



>ref|XP_002864374.1| stigma-specific Stig1 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40633.1| stigma-specific Stig1 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  110  DDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCDLGEFCVYGLCNYA  163



>ref|XP_004295840.1| PREDICTED: uncharacterized protein LOC101306127 [Fragaria vesca 
subsp. vesca]
Length=162

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  107  LTDKLNCGKCGKKCKYSEVCCKGKCVNPSFNKSHCGGCNNRCKDGGFCAFGLCNYA  162



>ref|XP_011046966.1| PREDICTED: uncharacterized protein LOC105141441 [Populus euphratica]
 ref|XP_011015443.1| PREDICTED: uncharacterized protein LOC105119042 [Populus euphratica]
Length=155

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG +C++P  CC+G CVN   N  +CG C+N+C   + C YGMC YA
Sbjct  102  DRLNCGMCGKKCKYPEICCKGQCVNPMSNKKNCGGCSNKCKKGSKCQYGMCSYA  155



>ref|XP_006401494.1| hypothetical protein EUTSA_v10014856mg [Eutrema salsugineum]
 gb|ESQ42947.1| hypothetical protein EUTSA_v10014856mg [Eutrema salsugineum]
Length=167

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  114  DDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCDLGEFCVYGLCNYA  167



>ref|XP_009127030.1| PREDICTED: uncharacterized protein LOC103851904 [Brassica rapa]
Length=167

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  114  DDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCELGEFCVYGLCNYA  167



>ref|XP_002263656.1| PREDICTED: uncharacterized protein LOC100267596 [Vitis vinifera]
Length=157

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG RC+F   CC G CVN + N  HCG C N C    FC +GMC Y+
Sbjct  102  DKLNCGACGKRCKFSEICCNGRCVNPSANKNHCGGCGNSCQEGDFCAFGMCSYS  155



>ref|XP_011011344.1| PREDICTED: uncharacterized protein LOC105115949 [Populus euphratica]
Length=157

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++   CC+G CV    N  HCG C N+C     CVYGMC YA
Sbjct  102  LTDRLNCGMCGKKCKYAEICCKGHCVKPMSNKKHCGGCNNKCKKGNACVYGMCSYA  157



>ref|XP_006348208.1| PREDICTED: uncharacterized protein LOC102600685 [Solanum tuberosum]
Length=168

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C++   CC G CVNT  +  HCG C N+C     CVYGMC YA
Sbjct  113  ADRQNCGYCGKKCRYNETCCNGQCVNTLFHKRHCGGCGNKCQKGNACVYGMCSYA  167



>ref|XP_009357594.1| PREDICTED: keratin-associated protein 5-11-like [Pyrus x bretschneideri]
Length=150

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C++   CC+G CVN   +  +CG C N+C   + CVYGMC YA
Sbjct  96   TDRVNCGTCGKKCKYGETCCKGKCVNPRSDKKNCGSCNNKCKKGSSCVYGMCSYA  150



>ref|XP_006392825.1| hypothetical protein EUTSA_v10012399mg [Eutrema salsugineum]
 gb|ESQ30111.1| hypothetical protein EUTSA_v10012399mg [Eutrema salsugineum]
Length=167

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C F  +CC G+C     NP HCG+C  +C     C YG CGYA
Sbjct  112  LGDMNNCGRCGHKCGFGQRCCGGVCTYVGFNPNHCGKCTRKCKSGVKCEYGYCGYA  167



>gb|KGN64480.1| hypothetical protein Csa_1G058150 [Cucumis sativus]
Length=129

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C++   CC G CVN   N  HCG C N C    +C +GMC YA
Sbjct  76   DRNNCGMCGNKCKYSRICCNGRCVNPMFNKKHCGGCNNECSKGNYCAFGMCDYA  129



>ref|XP_008440707.1| PREDICTED: uncharacterized protein LOC103485044 [Cucumis melo]
Length=155

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C++   CC G CVN   N  HCG C N C    +C +GMC YA
Sbjct  102  DRNNCGMCGNKCKYSRICCNGRCVNPMFNKKHCGGCNNECSKGNYCAFGMCDYA  155



>ref|XP_010060302.1| PREDICTED: uncharacterized protein LOC104448208 [Eucalyptus grandis]
 gb|KCW66970.1| hypothetical protein EUGRSUZ_F00736 [Eucalyptus grandis]
Length=155

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGY  671
            D NNCG C  +C++   CC G CV+   +  +CG C NRCP   FC YGMC Y
Sbjct  101  DKNNCGQCKSKCKYTNSCCSGRCVDLTYDKRNCGSCGNRCPTGDFCFYGMCNY  153



>ref|XP_008371072.1| PREDICTED: uncharacterized protein LOC103434485 [Malus domestica]
 ref|XP_008371165.1| PREDICTED: uncharacterized protein LOC103434586 [Malus domestica]
 ref|XP_008355930.1| PREDICTED: uncharacterized protein LOC103419607 [Malus domestica]
Length=150

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C++   CC+G CVN   +  +CG C N+C   + CVYGMC YA
Sbjct  96   TDRVNCGKCGKKCKYGETCCKGKCVNPRSDKKNCGSCNNKCKKGSSCVYGMCSYA  150



>ref|XP_010916128.1| PREDICTED: uncharacterized protein LOC105041033 [Elaeis guineensis]
Length=153

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC++   CC G CVN   +  +CG C NRC    FC YGMC YA
Sbjct  98   MKDNLNCGQCGLRCRYGTTCCGGRCVNVMFDANNCGSCKNRCKKGGFCSYGMCNYA  153



>ref|XP_009632034.1| PREDICTED: uncharacterized protein LOC104121689 [Nicotiana tomentosiformis]
Length=145

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVNT  +  HCG C N+C   + C YGMC YA
Sbjct  89   LNDKQNCGFCGKKCKYNETCCKGKCVNTLFHKRHCGGCNNKCQNGSSCAYGMCNYA  144



>ref|XP_006377170.1| hypothetical protein POPTR_0011s01360g [Populus trichocarpa]
 gb|ERP54967.1| hypothetical protein POPTR_0011s01360g [Populus trichocarpa]
Length=84

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C++   CC+G CV    N  HCG C N+C     CVYGMC YA
Sbjct  29   LTDRLNCGMCGKKCKYAEICCKGDCVKPMSNKKHCGGCNNKCKKGNACVYGMCSYA  84



>ref|XP_004145195.1| PREDICTED: uncharacterized protein LOC101214497 [Cucumis sativus]
 ref|XP_004153489.1| PREDICTED: uncharacterized protein LOC101209742 [Cucumis sativus]
Length=156

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C++   CC G CVN   N  HCG C N C    +C +GMC YA
Sbjct  103  DRNNCGMCGNKCKYSRICCNGRCVNPMFNKKHCGGCNNECSKGNYCAFGMCDYA  156



>ref|XP_004161979.1| PREDICTED: uncharacterized protein LOC101227436 [Cucumis sativus]
Length=156

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C++   CC G CVN   N  HCG C N C    +C +GMC YA
Sbjct  103  DRNNCGMCGNKCKYSRICCNGRCVNPMFNKKHCGGCNNECSKGNYCAFGMCDYA  156



>ref|XP_006281866.1| hypothetical protein CARUB_v10028061mg [Capsella rubella]
 gb|EOA14764.1| hypothetical protein CARUB_v10028061mg [Capsella rubella]
Length=164

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  111  DDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCENGEFCVYGLCNYA  164



>ref|XP_008226851.1| PREDICTED: uncharacterized protein LOC103326416 [Prunus mume]
Length=152

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  97   LTDRLNCGRCGKKCRYNEICCKGKCVNPSFNRKHCGGCKNRCKDGGFCAFGLCNYA  152



>ref|NP_194418.1| Stigma-specific Stig1 family protein [Arabidopsis thaliana]
 emb|CAB36534.1| STIG1 like protein [Arabidopsis thaliana]
 emb|CAB79543.1| STIG1 like protein [Arabidopsis thaliana]
 gb|AEE85264.1| Stigma-specific Stig1 family protein [Arabidopsis thaliana]
Length=152

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D NNCG C  +C+F   CCRG CV    +  HCG+C + C    FCVYG+C YA
Sbjct  98   SDDNNCGACKNKCKFSQTCCRGQCVYVAYDKRHCGQCNHPCELGEFCVYGLCNYA  152



>ref|XP_006451828.1| hypothetical protein CICLE_v10010456mg [Citrus clementina]
 gb|ESR65068.1| hypothetical protein CICLE_v10010456mg [Citrus clementina]
 gb|KDO62519.1| hypothetical protein CISIN_1g042751mg [Citrus sinensis]
Length=155

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+F   CC G C N   N  HCG+C  +CP    C +G CGYA
Sbjct  100  LGDKNNCGKCGSKCKFGQLCCNGTCTNVFDNEAHCGKCNKKCPRGVRCEFGNCGYA  155



>ref|XP_006377165.1| hypothetical protein POPTR_0011s01320g [Populus trichocarpa]
 gb|ERP54962.1| hypothetical protein POPTR_0011s01320g [Populus trichocarpa]
Length=153

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC+G CVN   N  HCG C N+C   + C YGMC YA
Sbjct  98   MTDWFNCGKCGKKCRYTEICCKGKCVNPMYNKNHCGGCNNKCKKGSACQYGMCSYA  153



>ref|XP_010438686.1| PREDICTED: uncharacterized protein LOC104722243 [Camelina sativa]
Length=151

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG C+    +  HCG+C N C    FCVYG+C YA
Sbjct  98   DDKNCGACKNKCKFSQTCCRGQCIYLAYDKRHCGQCNNLCALGEFCVYGLCNYA  151



>ref|XP_002529446.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32912.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C     CCRG CV  +++  HCG+C NRC    +CV+GMC YA
Sbjct  104  TDDKNCGACKKKCLHTQTCCRGQCVYLSLDKRHCGKCNNRCLDGEYCVFGMCSYA  158



>ref|XP_010449076.1| PREDICTED: uncharacterized protein LOC104731402 [Camelina sativa]
Length=164

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    FCVYG+C YA
Sbjct  111  DDKNCGACKAKCKFGQTCCRGQCVYVAYDKRHCGECNHRCNDGEFCVYGLCNYA  164



>ref|XP_002317138.2| hypothetical protein POPTR_0011s01370g [Populus trichocarpa]
 gb|EEE97750.2| hypothetical protein POPTR_0011s01370g [Populus trichocarpa]
Length=153

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC+G CVN   N  HCG C N+C   + C YGMC YA
Sbjct  98   MTDWFNCGKCGKKCRYTEICCKGKCVNPMYNKNHCGGCNNKCKKGSACQYGMCSYA  153



>gb|KDP39166.1| hypothetical protein JCGZ_00923 [Jatropha curcas]
Length=120

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG CG  C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  65   LNDRHNCGACGKECKYNQICCQGKCVNPSSNGRHCGGCNNRCENGGFCAFGLCNYA  120



>ref|XP_009598813.1| PREDICTED: uncharacterized protein LOC104094556 [Nicotiana tomentosiformis]
Length=188

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVNT  +  HCG C  +C   + C YGMC YA
Sbjct  132  LNDKQNCGFCGKKCKYNETCCKGQCVNTLFHKRHCGGCNKKCQKSSSCAYGMCSYA  187



>ref|XP_006345619.1| PREDICTED: uncharacterized protein LOC102596970 [Solanum tuberosum]
Length=138

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG C  +C F   CCRG CVN + +  HCG C NRC    +C YGMC YA
Sbjct  83   LYDDHNCGACKKKCPFTETCCRGECVNLSFDKRHCGYCNNRCMTGGYCFYGMCDYA  138



>ref|XP_008226943.1| PREDICTED: uncharacterized protein LOC103326488 [Prunus mume]
Length=163

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  519  NNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            +NCG C  +C++   CCRG CV+ + +  HCGRC + C    +CVYG+C YA
Sbjct  112  DNCGACKKKCKYTQSCCRGQCVDLSFDKRHCGRCNHPCKNGAYCVYGLCDYA  163



>ref|XP_010666230.1| PREDICTED: uncharacterized protein LOC104883405 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  +CG C  +C+F   CC G CV+   +  HCGRC N+C     CVYGMC YA
Sbjct  106  DKKHCGDCHNKCKFTYDCCNGKCVDKTYDKRHCGRCNNKCLVGQSCVYGMCDYA  159



>ref|XP_007213969.1| hypothetical protein PRUPE_ppa013138mg [Prunus persica]
 gb|EMJ15168.1| hypothetical protein PRUPE_ppa013138mg [Prunus persica]
Length=138

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVN   +  +CG C N+C   + C YGMC YA
Sbjct  85   DRANCGKCGRKCKYAEICCKGKCVNPRSDKKNCGSCNNKCKKGSSCAYGMCSYA  138



>ref|XP_009781545.1| PREDICTED: uncharacterized protein LOC104230429 [Nicotiana sylvestris]
Length=148

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CVN + +  HCG C  RC    +C YGMC YA
Sbjct  95   DDHNCGACKKKCRFTETCCRGECVNLSFDKRHCGYCNKRCMTGGYCFYGMCDYA  148



>ref|XP_011070191.1| PREDICTED: uncharacterized protein LOC105155906 [Sesamum indicum]
Length=138

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG CG +C     CCRG CVN   +  HCG C N+C     CVYG+C YA
Sbjct  85   DGDNCGACGQKCALGESCCRGECVNLGYDKRHCGFCNNKCKIDGSCVYGICDYA  138



>ref|XP_007214134.1| hypothetical protein PRUPE_ppa018235mg [Prunus persica]
 gb|EMJ15333.1| hypothetical protein PRUPE_ppa018235mg [Prunus persica]
Length=152

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  97   LTDRLNCGRCGKKCRYNEICCKGKCVNPSFNKGHCGGCNNRCKDGGFCAFGLCNYA  152



>ref|XP_011011342.1| PREDICTED: uncharacterized protein LOC105115947 [Populus euphratica]
Length=153

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C++   CC+G CVN   N  HCG C N+C   + C YGMC YA
Sbjct  98   MTDWFNCGKCGKKCKYTEICCKGKCVNPMYNRNHCGGCNNKCKKGSACQYGMCSYA  153



>ref|XP_010545838.1| PREDICTED: uncharacterized protein LOC104818082 [Tarenaya hassleriana]
Length=160

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C F  +CC G+C     NP HCG+C  +C     C YG CGYA
Sbjct  105  LGDKNNCGRCGHKCGFGQRCCGGVCTYVGFNPSHCGKCNKKCENGVKCEYGYCGYA  160



>ref|XP_006393126.1| hypothetical protein EUTSA_v10012178mg [Eutrema salsugineum]
 gb|ESQ30412.1| hypothetical protein EUTSA_v10012178mg [Eutrema salsugineum]
Length=177

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C   C+F L CC G CV+TN++P +CG+C N+C     C +G+CGYA
Sbjct  82   LSDPNHCRFCFRSCRFALSCCDGDCVDTNIDPSNCGQCGNKCDSGAPCEFGLCGYA  137



>ref|XP_008224703.1| PREDICTED: uncharacterized protein LOC103324427 [Prunus mume]
Length=149

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVN   +  +CG C N+C   + C YGMC YA
Sbjct  96   DRANCGKCGRKCKYAEICCKGKCVNPRSDKKNCGSCNNKCKKGSSCAYGMCSYA  149



>ref|XP_007214115.1| hypothetical protein PRUPE_ppa017131mg [Prunus persica]
 gb|EMJ15314.1| hypothetical protein PRUPE_ppa017131mg [Prunus persica]
Length=152

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  97   LTDRLNCGRCGKKCRYNEICCKGKCVNPSFNKGHCGGCKNRCRDGGFCAFGLCNYA  152



>ref|XP_010482931.1| PREDICTED: uncharacterized protein LOC104761531 [Camelina sativa]
Length=164

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    +CVYG+C YA
Sbjct  111  DDKNCGACKTKCKFGQTCCRGQCVYVAYDKRHCGECNHRCDNGEYCVYGLCNYA  164



>ref|XP_010443117.1| PREDICTED: uncharacterized protein LOC104726044 [Camelina sativa]
Length=164

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG C +RC    +CVYG+C YA
Sbjct  111  DDKNCGACKTKCKFGQTCCRGQCVYVAYDKRHCGECNHRCDNGEYCVYGLCNYA  164



>ref|XP_006406991.1| hypothetical protein EUTSA_v10022293mg [Eutrema salsugineum]
 gb|ESQ48444.1| hypothetical protein EUTSA_v10022293mg [Eutrema salsugineum]
Length=168

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG CG +C+F  +CC G+C     NP HCG+C  +C     C YG CGYA
Sbjct  113  LGDMNNCGRCGHKCRFGQRCCGGICTCVGFNPEHCGKCNKKCKPGVRCEYGYCGYA  168



>ref|XP_007026141.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY28763.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=156

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG +C++   CC+G CVN   +  HCG C N+C   + C+YGMC YA
Sbjct  103  DRLNCGMCGKKCKYSEICCKGKCVNPMSHKRHCGGCNNQCSKGSKCLYGMCSYA  156



>ref|XP_007020751.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY12276.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=153

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC     CV+G+C YA
Sbjct  98   LMDRLNCGKCGKKCKYNEICCKGKCVNPSFNRKHCGGCNNRCSNGELCVFGLCNYA  153



>ref|XP_006413129.1| hypothetical protein EUTSA_v10027097mg [Eutrema salsugineum]
 gb|ESQ54582.1| hypothetical protein EUTSA_v10027097mg [Eutrema salsugineum]
Length=150

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C+F   CCRG CV    +  HCG+C + C    FCVYG+C YA
Sbjct  96   SDDKNCGACKNKCKFSQTCCRGQCVYLAYDKRHCGQCNHACELGEFCVYGLCNYA  150



>ref|XP_009603947.1| PREDICTED: uncharacterized protein LOC104098822 [Nicotiana tomentosiformis]
Length=187

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D+NNCG+CG +C+F  +CC G+C +   NP HCG+C   C     C YG CGYA
Sbjct  132  LGDMNNCGVCGKKCKFGQRCCGGVCTDVVYNPMHCGKCNKACLPGVPCDYGYCGYA  187



>ref|XP_009120033.1| PREDICTED: uncharacterized protein LOC103844955 [Brassica rapa]
 emb|CDY17302.1| BnaA10g09360D [Brassica napus]
Length=161

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C+F   CCRG CV    +  HCG C +RC     CVYG+C YA
Sbjct  107  ADDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCNLGELCVYGLCNYA  161



>ref|XP_007021504.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY13029.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=163

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG RC+F  +CC G+C +   N  HCG+C N+C     C +G CGYA
Sbjct  108  LGDWNNCGQCGNRCKFGQRCCGGVCTDVMYNADHCGKCDNQCTPGVKCEFGSCGYA  163



>ref|XP_010438638.1| PREDICTED: uncharacterized protein LOC104722200 [Camelina sativa]
Length=151

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG+C N C    FCVYG+C YA
Sbjct  98   DDKNCGACKNKCKFSQTCCRGQCVYLAYDKRHCGQCNNPCEVGEFCVYGLCNYA  151



>ref|XP_010448200.1| PREDICTED: uncharacterized protein LOC104730702 [Camelina sativa]
Length=152

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG+C N C    FCVYG+C YA
Sbjct  99   DDKNCGACKNKCKFSQTCCRGQCVYLAYDKRHCGQCNNPCEVGEFCVYGLCNYA  152



>ref|XP_009132402.1| PREDICTED: uncharacterized protein LOC103857004 [Brassica rapa]
 emb|CDY36731.1| BnaA03g11550D [Brassica napus]
Length=158

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG C  +C++   CC G C N N N  HCG C +RC    +C+YG+C YA
Sbjct  103  LTDKKNCGACNKKCKYTETCCGGQCANLNYNKRHCGECYHRCLPGGYCIYGLCNYA  158



>ref|XP_008776914.1| PREDICTED: uncharacterized protein LOC103696955 [Phoenix dactylifera]
Length=147

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC++   CC G CV    +  +CG C NRC   +FC YGMC YA
Sbjct  92   MKDNLNCGRCGLRCRYGTTCCGGRCVYVMFDHSNCGSCKNRCKKGSFCSYGMCNYA  147



>ref|XP_002961474.1| hypothetical protein SELMODRAFT_76417 [Selaginella moellendorffii]
 ref|XP_002971333.1| hypothetical protein SELMODRAFT_94795 [Selaginella moellendorffii]
 gb|EFJ27931.1| hypothetical protein SELMODRAFT_94795 [Selaginella moellendorffii]
 gb|EFJ36734.1| hypothetical protein SELMODRAFT_76417 [Selaginella moellendorffii]
Length=87

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            DVN+CG C  RC++   CC+G C N + +  +CG C  RCP  T CV+GMCGY 
Sbjct  33   DVNHCGHCFHRCKYSRSCCQGRCKNLDRDVHNCGFCGRRCPKRTKCVFGMCGYG  86



>emb|CDY19914.1| BnaC09g31800D [Brassica napus]
Length=161

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG C  +C+F   CCRG CV    +  HCG C +RC     CVYG+C YA
Sbjct  107  ADDKNCGACKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRCNLGELCVYGLCNYA  161



>ref|XP_006370247.1| hypothetical protein POPTR_0001s41000g [Populus trichocarpa]
 gb|ERP66816.1| hypothetical protein POPTR_0001s41000g [Populus trichocarpa]
Length=151

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG+CG +C+F   CC G C +   N  HCG+C  +C     C YG CGYA
Sbjct  96   LGDKNNCGMCGNKCKFAESCCNGRCTDIISNVNHCGKCNKKCAPGVRCHYGTCGYA  151



>gb|AAF87870.1|AC012561_3 Hypothetical protein [Arabidopsis thaliana]
Length=173

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C   C+F L CC G CV+TN +P +CG+C N C     C +GMCGYA
Sbjct  82   LSDPNHCRFCFKSCRFALSCCDGDCVDTNTDPSNCGQCGNECESGAPCEFGMCGYA  137



>ref|XP_006347464.1| PREDICTED: uncharacterized protein LOC102597306 [Solanum tuberosum]
Length=156

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CVN + +  HCG C NRC    +C YG+C YA
Sbjct  103  DDHNCGACKKKCPFTETCCRGQCVNLSYDKRHCGYCNNRCMTGGYCFYGICDYA  156



>gb|EYU35629.1| hypothetical protein MIMGU_mgv1a024160mg [Erythranthe guttata]
Length=144

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG CG +C F   CCRG CVN   +  HCG C N C     CVYG+C YA
Sbjct  90   DFNNCGACGMKCAFGEICCRGECVNARSDKKHCGFCNNLCVGDGNCVYGVCDYA  143



>ref|NP_175480.1| stigma-specific stig1-like protein [Arabidopsis thaliana]
 gb|AAG51203.1|AC079279_24 hypothetical protein [Arabidopsis thaliana]
 gb|AEE32575.1| stigma-specific stig1-like protein [Arabidopsis thaliana]
Length=174

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C   C+F L CC G CV+TN +P +CG+C N C     C +GMCGYA
Sbjct  83   LSDPNHCRFCFKSCRFALSCCDGDCVDTNTDPSNCGQCGNECESGAPCEFGMCGYA  138



>ref|XP_009402049.1| PREDICTED: uncharacterized protein LOC103985921 [Musa acuminata 
subsp. malaccensis]
Length=125

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C F   CC G CVN   +P +CG C  RC   +FC YGMC YA
Sbjct  70   MTDNQNCGQCGKKCCFGQVCCGGSCVNVMYDPKNCGGCNKRCKKGSFCQYGMCSYA  125



>ref|XP_011046968.1| PREDICTED: uncharacterized protein LOC105141444 [Populus euphratica]
Length=152

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NC +CG +C++P  CC+G CVN   N  +CG C N+C   + C YGMC YA
Sbjct  97   MTDKFNCRMCGKKCKYPEICCKGRCVNPMSNKKNCGGCRNKCKKGSKCQYGMCSYA  152



>ref|XP_010322478.1| PREDICTED: uncharacterized protein LOC104648025 [Solanum lycopersicum]
Length=150

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CVN + +  HCG C NRC    +C YG+C YA
Sbjct  97   DDHNCGACKKKCPFTETCCRGQCVNLSYDKRHCGYCNNRCMTGGYCFYGICDYA  150



>gb|KDP39165.1| hypothetical protein JCGZ_00922 [Jatropha curcas]
Length=144

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC G CVN + N  HCG C+NRC    FC +G+C YA
Sbjct  89   LSDRLNCGACGKKCKYNQICCNGKCVNPSFNRNHCGGCSNRCKNGGFCAFGLCNYA  144



>gb|KDP39164.1| hypothetical protein JCGZ_00921 [Jatropha curcas]
Length=144

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC+G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  89   LNDRLNCGACGKKCKYNQICCKGKCVNPSFNRRHCGGCNNRCKNGGFCAFGLCNYA  144



>ref|XP_010666227.1| PREDICTED: uncharacterized protein LOC104883402 [Beta vulgaris 
subsp. vulgaris]
Length=171

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  +CG C  +C+F   CC G CV+   +  HCGRC ++C    +CVYGMC YA
Sbjct  118  DKKHCGSCHNKCKFTYDCCNGKCVDKFYDKRHCGRCNSKCLIGQYCVYGMCDYA  171



>ref|XP_009387225.1| PREDICTED: uncharacterized protein LOC103974188 [Musa acuminata 
subsp. malaccensis]
Length=141

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG +C F   CC G CV+   +P +CG C  RC   +FC YGMC YA
Sbjct  86   MTDNQNCGQCGKKCWFGQACCGGRCVDVMYDPNNCGGCNKRCTKGSFCQYGMCSYA  141



>ref|XP_010519260.1| PREDICTED: uncharacterized protein LOC104798766 [Tarenaya hassleriana]
Length=157

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV    +  HCG C +RC     CVYG+C YA
Sbjct  104  DNDNCGACNNQCKFTQTCCRGECVYLAYDKRHCGECNHRCQVGELCVYGLCNYA  157



>ref|XP_006282772.1| hypothetical protein CARUB_v10006200mg [Capsella rubella]
 gb|EOA15670.1| hypothetical protein CARUB_v10006200mg [Capsella rubella]
Length=149

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG+C N C     CVYG+C YA
Sbjct  96   DDKNCGACKSKCKFSQTCCRGQCVYLAYDKRHCGQCNNPCELGELCVYGLCNYA  149



>ref|XP_011083274.1| PREDICTED: uncharacterized protein LOC105165809 [Sesamum indicum]
Length=159

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG+CG +C    +CC G+C N   +  +CG+C  RCP    C YG CGYA
Sbjct  104  LGDRNNCGICGRKCGLGERCCGGVCTNVLWSTANCGKCNKRCPGGVRCEYGYCGYA  159



>ref|XP_011079120.1| PREDICTED: uncharacterized protein LOC105162717 [Sesamum indicum]
Length=153

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG C  +C F   CCRG CVN   +  HCG C  +C    +C+YG C YA
Sbjct  100  DSNNCGACKKKCAFTQSCCRGECVNLAYDKRHCGSCNKKCMPGGYCIYGTCDYA  153



>ref|XP_010655413.1| PREDICTED: uncharacterized protein LOC104880473 [Vitis vinifera]
Length=161

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D NNCG C  +C+    CC G CVN  V+P +CG C  +C  +  C+YGMC YA
Sbjct  107  KDPNNCGECRRKCRHNYICCSGHCVNPYVDPLNCGSCGKKCKNWEACLYGMCSYA  161



>ref|XP_010092023.1| hypothetical protein L484_000949 [Morus notabilis]
 gb|EXC37527.1| hypothetical protein L484_000949 [Morus notabilis]
Length=162

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D +NCG C  +C +   CCRG CV    +  HCG C +RC    +C+YGMC YA
Sbjct  108  TDHHNCGACKKKCMYTQACCRGECVYVWFDKRHCGECNHRCHHGKYCLYGMCSYA  162



>ref|XP_002894266.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=173

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C   C+F L CC G CV+TN +P +CG+C N C     C +GMCGYA
Sbjct  83   LSDPNHCRFCFRSCRFALSCCDGDCVDTNNDPSNCGQCGNECESGASCEFGMCGYA  138



>ref|XP_004240267.2| PREDICTED: uncharacterized protein LOC101267026 [Solanum lycopersicum]
Length=154

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CVN + +  HCG C NRC    +C YG+C YA
Sbjct  101  DDHNCGACKKKCPFTETCCRGECVNLSFDKRHCGYCNNRCMTGGYCFYGICDYA  154



>ref|XP_009598824.1| PREDICTED: uncharacterized protein LOC104094567 [Nicotiana tomentosiformis]
Length=284

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG CG +C++   CC+G CVNT  +  +CG C N+C   + CVYGMC YA
Sbjct  229  TDRQNCGFCGKKCRYNETCCKGQCVNTLFHKRNCGGCNNKCQKGSACVYGMCSYA  283



>ref|XP_009147818.1| PREDICTED: uncharacterized protein LOC103871329 [Brassica rapa]
Length=173

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C  RC+F L CC G CV+TN +P +CG+C N+C     C +GMCGYA
Sbjct  82   LSDPNHCRFCFKRCRFALSCCGGNCVDTNNDPSNCGQCGNKCEPGAPCEFGMCGYA  137



>gb|EYU44950.1| hypothetical protein MIMGU_mgv1a021221mg [Erythranthe guttata]
Length=161

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG+CG +C    +CC G+C N   N  +CG+C  +C     C YG CGYA
Sbjct  106  LGDQNNCGVCGRKCGLGQRCCGGVCTNVLKNAANCGKCGKKCKHGVKCEYGYCGYA  161



>gb|KFK35917.1| hypothetical protein AALP_AA4G053300 [Arabis alpina]
Length=114

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C  RC+F   CC G CV+TN +P +CG+C N C     C +GMCGYA
Sbjct  28   LSDPNHCRFCFKRCRFAKSCCDGDCVDTNNDPSNCGQCGNECEAGAPCEFGMCGYA  83



>ref|XP_010916127.1| PREDICTED: uncharacterized protein LOC105041032 [Elaeis guineensis]
Length=150

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC +   CC G CVN   +  +CG C N+C    FC YGMC YA
Sbjct  95   MADNQNCGWCGMRCGYGQTCCGGRCVNVLYDLRNCGGCKNKCKQGGFCNYGMCDYA  150



>ref|XP_002529453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32919.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC G CVN + N  HCG C NRC    FC +G+C YA
Sbjct  103  LTDRLNCGACGKKCKYNQICCNGKCVNPSFNRRHCGGCNNRCNSGEFCAFGLCNYA  158



>ref|XP_004488726.1| PREDICTED: uncharacterized protein LOC101494412 [Cicer arietinum]
Length=157

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG+CG +C    +CC G+C N   N  HCG+C N C     C  G CGYA
Sbjct  102  LSDKNNCGVCGQKCNQGQRCCNGVCTNVLSNVHHCGKCNNECSAGHLCGNGFCGYA  157



>ref|XP_004295284.1| PREDICTED: uncharacterized protein LOC101301373 [Fragaria vesca 
subsp. vesca]
Length=159

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G C+N   +  +CG C N+C   + CVYGMC YA
Sbjct  106  DRVNCGKCGKKCKYSEICCKGKCLNPMSDKKNCGSCNNKCKKGSSCVYGMCSYA  159



>ref|XP_011043811.1| PREDICTED: uncharacterized protein LOC105139155 [Populus euphratica]
Length=151

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D NNCG+CG +C+F   CC G C N   N  HCG+C  +C     C YG CGYA
Sbjct  98   DRNNCGICGNKCKFGESCCNGRCTNIIFNVNHCGKCNKKCAPGVRCQYGTCGYA  151



>ref|XP_008356862.1| PREDICTED: uncharacterized protein LOC103420580 [Malus domestica]
Length=150

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVN   +  +CG C NRC   + C YGMC YA
Sbjct  97   DRVNCGKCGXKCKYAEICCKGKCVNPRSDRKNCGGCNNRCKKGSSCAYGMCSYA  150



>ref|XP_007026139.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
 gb|EOY28761.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao]
Length=215

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG+CG +C++   CC+G CVN   +  HCG C N+C   + C+YGMC YA
Sbjct  162  DRLNCGMCGKKCKYSEICCKGKCVNPMSHKRHCGGCNNQCSKGSKCLYGMCSYA  215



>emb|CDP05927.1| unnamed protein product [Coffea canephora]
Length=153

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+   +CC G C+N   + ++CG+C  RC     C +G CGYA
Sbjct  98   LGDANNCGRCGSKCKLNEKCCGGRCINVMYDRYNCGKCGGRCKKGLKCGHGYCGYA  153



>ref|XP_002316893.2| hypothetical protein POPTR_0011s11940g [Populus trichocarpa]
 gb|EEE97505.2| hypothetical protein POPTR_0011s11940g [Populus trichocarpa]
Length=151

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D NNCG CG +C+    CC G C N   N  +CG+C N+C     C YG CGYA
Sbjct  96   LGDENNCGQCGKKCKLGESCCNGKCTNVIYNASNCGKCNNKCSPGVKCQYGTCGYA  151



>ref|XP_008780025.1| PREDICTED: uncharacterized protein LOC103699797 [Phoenix dactylifera]
Length=142

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            M D  NCG CG RC +   CC G CVN   +  +CG C N+C    FC YGMC YA
Sbjct  87   MNDNQNCGWCGRRCGYGQTCCSGQCVNVLYDLRNCGACKNKCKQGGFCNYGMCNYA  142



>ref|XP_010481125.1| PREDICTED: uncharacterized protein LOC104759962 [Camelina sativa]
Length=109

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CV    +  HCG C + C    FCVYG+C YA
Sbjct  56   DNDNCGACKNKCTFTQTCCRGECVYLAYDKRHCGECNHSCLVDEFCVYGLCNYA  109



>ref|XP_007153981.1| hypothetical protein PHAVU_003G081100g [Phaseolus vulgaris]
 gb|ESW25975.1| hypothetical protein PHAVU_003G081100g [Phaseolus vulgaris]
Length=128

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG CG +C +   CC G CVN   N  HCG+C NRC   + C+YGMC YA
Sbjct  75   DGSNCGRCGKKCSYGKICCEGKCVNPKSNEKHCGKCGNRCNAESSCIYGMCSYA  128



>ref|XP_008355931.1| PREDICTED: uncharacterized protein LOC103419608 [Malus domestica]
Length=150

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C++   CC+G CVN   +  +CG C  +C   + CVYGMC YA
Sbjct  97   DRVNCGKCGKKCKYGETCCKGKCVNPRSDKKNCGSCNXKCKKGSSCVYGMCSYA  150



>ref|XP_010092026.1| hypothetical protein L484_000953 [Morus notabilis]
 ref|XP_010096126.1| hypothetical protein L484_012481 [Morus notabilis]
 gb|EXB63291.1| hypothetical protein L484_012481 [Morus notabilis]
 gb|EXC37530.1| hypothetical protein L484_000953 [Morus notabilis]
Length=141

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG CG +C++   CC G CVN + N  HCG C NRC     C +G+C Y+
Sbjct  86   LRDRHNCGKCGKKCKYSQICCNGKCVNPSFNKRHCGGCNNRCSSGGLCAFGLCSYS  141



>ref|XP_010092025.1| hypothetical protein L484_000952 [Morus notabilis]
 gb|EXC37529.1| hypothetical protein L484_000952 [Morus notabilis]
Length=144

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D +NCG CG +C++   CC G CVN + N  HCG C NRC     C +G+C Y+
Sbjct  89   LRDRHNCGKCGKKCKYSQICCNGKCVNPSFNKKHCGGCNNRCSNGGLCAFGLCSYS  144



>emb|CDY37112.1| BnaC06g03870D [Brassica napus]
Length=173

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D N+C  C  RC+F L CC G CV+TN +P +CG+C N C     C +GMCGYA
Sbjct  82   LSDPNHCRFCFKRCRFALSCCGGNCVDTNNDPSNCGQCGNECEPGAPCEFGMCGYA  137



>ref|XP_010252475.1| PREDICTED: uncharacterized protein LOC104594053 [Nelumbo nucifera]
Length=144

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG RC++   CC G CVN   +  HCG+C NRC   T CVYG C YA
Sbjct  90   DQFNCGKCGKRCKYSEMCCGGECVNPFFSEKHCGQCNNRCVKGTSCVYGFCSYA  143



>ref|XP_010451166.1| PREDICTED: uncharacterized protein LOC104733274 [Camelina sativa]
Length=212

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG C  +C+F   CCRG CV    +  HCG+C+N C     CVYG+C YA
Sbjct  159  DDKNCGACKNKCKFSQTCCRGQCVYLAYDKRHCGQCSNPCVLGELCVYGLCNYA  212



>ref|XP_007212867.1| hypothetical protein PRUPE_ppa021586mg [Prunus persica]
 gb|EMJ14066.1| hypothetical protein PRUPE_ppa021586mg [Prunus persica]
Length=108

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D  NCG CG +C +   CC G CVN N +  +CG C N C   T C +GMC YA
Sbjct  55   DTANCGKCGRKCNYAEICCEGKCVNPNSDNENCGSCNNTCKKGTSCAFGMCSYA  108



>ref|XP_006452427.1| hypothetical protein CICLE_v10010199mg [Citrus clementina]
 ref|XP_006475131.1| PREDICTED: uncharacterized protein LOC102625156 [Citrus sinensis]
 gb|ESR65667.1| hypothetical protein CICLE_v10010199mg [Citrus clementina]
Length=159

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC G CVN + N  HCG C N C    FCV G+C YA
Sbjct  104  LKDRMNCGKCGKKCKYNEICCNGKCVNPSFNRRHCGGCNNSCSNGEFCVLGLCNYA  159



>ref|XP_010057905.1| PREDICTED: uncharacterized protein LOC104445689 [Eucalyptus grandis]
Length=164

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFF-TFCVYGMCGYA  674
            D  NCG+CG +C++   CC+G CVN   +  HCG C N+C    + CVYGMC YA
Sbjct  110  DRLNCGMCGHKCRYSEICCQGQCVNAMFDKKHCGGCNNKCKRKNSACVYGMCSYA  164



>ref|XP_010533795.1| PREDICTED: uncharacterized protein LOC104809483 [Tarenaya hassleriana]
Length=151

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D +NCG CG +C +   CC+G CVN   +  HCG C N+C   + C YGMC YA
Sbjct  97   SDRSNCGKCGKKCGYSEICCKGKCVNPMFDKKHCGVCFNKCKKRSSCSYGMCSYA  151



>gb|AAG51198.1|AC079279_19 hypothetical protein, 5' partial [Arabidopsis thaliana]
Length=104

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV    +  HCG C + C    FCVYG+C YA
Sbjct  51   DNDNCGACKNQCKFTQTCCRGECVYLAYDKRHCGECNHSCLVGEFCVYGLCNYA  104



>gb|KDO62081.1| hypothetical protein CISIN_1g039894mg [Citrus sinensis]
Length=159

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG CG +C++   CC G CVN + N  HCG C N C    FCV G+C YA
Sbjct  104  LKDRMNCGKCGKKCKYNEICCNGKCVNPSFNRRHCGGCNNSCSNGEFCVLGLCNYA  159



>ref|XP_010272879.1| PREDICTED: uncharacterized protein LOC104608543 [Nelumbo nucifera]
Length=158

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  507  MPDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            + D  NCG+CG +C+ P  CC G CVN   +  +CG+C N+C   + C YGMC YA
Sbjct  103  LTDRLNCGMCGRKCRHPEICCEGECVNPLFDKKNCGQCNNKCNKGSSCAYGMCSYA  158



>ref|XP_010461926.1| PREDICTED: uncharacterized protein LOC104742603 [Camelina sativa]
Length=154

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CV    +  HCG C + C    FCVYG+C YA
Sbjct  101  DNDNCGACKNKCTFTQTCCRGECVYLTYDKRHCGECNHSCLVGEFCVYGLCNYA  154



>ref|XP_010686797.1| PREDICTED: uncharacterized protein LOC104900958 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PDVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
             D  NCG+CG RC++P  CC G CVN   +  +CG C N+C   +FC  GMC YA
Sbjct  105  SDKLNCGMCGRRCRYPETCCNGRCVNPFYDKKNCGGCHNKCKRGSFCYRGMCSYA  159



>ref|NP_175487.1| stigma-specific stig1-like protein [Arabidopsis thaliana]
 gb|AAG50782.1|AC079027_5 hypothetical protein [Arabidopsis thaliana]
 gb|AAY78647.1| stigma-specific Stig1 family protein [Arabidopsis thaliana]
 gb|AEE32583.1| stigma-specific stig1-like protein [Arabidopsis thaliana]
Length=154

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV    +  HCG C + C    FCVYG+C YA
Sbjct  101  DNDNCGACKNQCKFTQTCCRGECVYLAYDKRHCGECNHSCLVGEFCVYGLCNYA  154



>ref|XP_010479538.1| PREDICTED: uncharacterized protein LOC104758378 [Camelina sativa]
Length=154

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C F   CCRG CV    +  HCG C + C    FCVYG+C YA
Sbjct  101  DNDNCGACKNKCTFTQTCCRGECVYLAYDKRHCGECNHSCLVDEFCVYGLCNYA  154



>gb|KCW75257.1| hypothetical protein EUGRSUZ_E04009 [Eucalyptus grandis]
Length=138

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFF-TFCVYGMCGYA  674
            D  NCG+CG +C++   CC+G CVN   +  HCG C N+C    + CVYGMC YA
Sbjct  84   DRLNCGMCGHKCRYSEICCQGQCVNAMFDKKHCGGCNNKCKRKNSACVYGMCSYA  138



>ref|XP_006304485.1| hypothetical protein CARUB_v10011220mg [Capsella rubella]
 gb|EOA37383.1| hypothetical protein CARUB_v10011220mg [Capsella rubella]
Length=154

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +3

Query  513  DVNNCGLCGFRCQFPLQCCRGMCVNTNVNPFHCGRCANRCPFFTFCVYGMCGYA  674
            D +NCG C  +C+F   CCRG CV    +  HCG C   C    FCVYG+C YA
Sbjct  101  DNDNCGACKNQCKFSQTCCRGECVYLAYDKRHCGECNRSCLVGEFCVYGLCNYA  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3357008055404