BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22127_g3_i1 len=755 path=[778:0-754]

Length=755
                                                                      Score     E

ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...    202   3e-59   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...    202   4e-59   
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     200   4e-58   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like     199   6e-58   
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          196   1e-56   
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         194   7e-56   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     194   8e-56   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510          192   3e-55   
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             191   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     190   4e-54   
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510          189   6e-54   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     188   1e-53   
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               188   2e-53   Ricinus communis
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    188   2e-53   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                187   2e-53   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     188   2e-53   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...    188   2e-53   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    187   2e-53   
ref|XP_002312071.1|  nodulin MtN21 family protein                       187   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like     187   5e-53   
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     182   1e-51   
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    182   2e-51   
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          182   3e-51   Vitis vinifera
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          182   4e-51   
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     180   1e-50   
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...    178   9e-50   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like     177   2e-49   
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     177   2e-49   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             176   3e-49   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     177   3e-49   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          177   3e-49   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         176   5e-49   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     178   6e-49   
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     176   1e-48   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          175   1e-48   
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     176   2e-48   
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    174   3e-48   
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like         174   3e-48   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     174   5e-48   
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         174   6e-48   
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     172   6e-48   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     174   7e-48   
emb|CDP05672.1|  unnamed protein product                                173   1e-47   
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg             173   1e-47   
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             172   1e-47   
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     172   2e-47   
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       172   2e-47   
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         172   2e-47   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    172   2e-47   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    172   2e-47   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     174   2e-47   
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                    172   2e-47   
ref|XP_003590514.1|  Auxin-induced protein 5NG4                         169   3e-47   
ref|XP_010534681.1|  PREDICTED: WAT1-related protein At1g21890 is...    171   3e-47   
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          172   4e-47   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             171   4e-47   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     171   4e-47   
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          171   5e-47   
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                     171   6e-47   
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    172   7e-47   
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like     171   9e-47   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     172   1e-46   
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         170   1e-46   
emb|CDY00403.1|  BnaC07g14230D                                          170   1e-46   
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     169   1e-46   
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...    170   1e-46   
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    170   1e-46   
ref|XP_002302243.2|  nodulin MtN21 family protein                       170   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890          170   2e-46   
gb|ACJ84240.1|  unknown                                                 166   2e-46   Medicago truncatula
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     170   2e-46   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     169   2e-46   
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         169   2e-46   
emb|CDY53594.1|  BnaA05g34670D                                          169   2e-46   
gb|AFK37217.1|  unknown                                                 169   2e-46   
gb|KHN09434.1|  Auxin-induced protein 5NG4                              169   2e-46   
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     169   3e-46   
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    171   3e-46   
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             169   3e-46   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    169   4e-46   
gb|KHG26265.1|  Auxin-induced 5NG4                                      169   4e-46   
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     169   4e-46   
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like     169   5e-46   
emb|CDY04680.1|  BnaC05g17180D                                          169   5e-46   
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...    168   7e-46   
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         168   7e-46   
emb|CDY01310.1|  BnaA07g10830D                                          168   7e-46   
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     168   8e-46   
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          168   8e-46   
emb|CDY20446.1|  BnaC04g05980D                                          168   8e-46   
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     168   1e-45   
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         167   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     167   2e-45   
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     167   2e-45   
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like     167   2e-45   
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890          167   2e-45   
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg             167   2e-45   
gb|ABK25095.1|  unknown                                                 167   2e-45   Picea sitchensis
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                167   3e-45   
emb|CDY07016.1|  BnaA04g22990D                                          167   3e-45   
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 167   3e-45   
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     167   3e-45   
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like     167   3e-45   
gb|KHG29659.1|  Auxin-induced 5NG4                                      166   3e-45   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     167   3e-45   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     167   3e-45   
ref|XP_002881660.1|  nodulin MtN21 family protein                       166   5e-45   
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     166   5e-45   
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             167   5e-45   Populus trichocarpa [western balsam poplar]
gb|KDO67717.1|  hypothetical protein CISIN_1g045242mg                   162   6e-45   
emb|CDX93255.1|  BnaC04g46410D                                          166   6e-45   
ref|XP_007009431.1|  Nodulin MtN21 /EamA-like transporter family ...    165   7e-45   
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     166   7e-45   
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     165   7e-45   
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             165   8e-45   
ref|XP_002893187.1|  T26F17.11                                          165   9e-45   
ref|NP_173607.1|  WAT1-related protein                                  165   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     165   2e-44   
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     164   2e-44   
gb|KHG11891.1|  Auxin-induced 5NG4                                      165   2e-44   
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    164   2e-44   
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like     164   2e-44   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    164   2e-44   
ref|XP_004494996.1|  PREDICTED: WAT1-related protein At2g37460-li...    161   3e-44   
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         164   3e-44   
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             164   3e-44   
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...    162   3e-44   
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     163   4e-44   
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     164   4e-44   
gb|KHG29332.1|  Auxin-induced 5NG4                                      163   4e-44   
gb|ACU18786.1|  unknown                                                 158   5e-44   Glycine max [soybeans]
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     164   5e-44   
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     164   6e-44   
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     163   6e-44   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    164   6e-44   
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950          164   6e-44   Sorghum bicolor [broomcorn]
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     164   6e-44   Vitis vinifera
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    162   6e-44   
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             163   7e-44   
emb|CDM84603.1|  unnamed protein product                                163   7e-44   
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     163   8e-44   
ref|NP_001148990.1|  nodulin protein                                    163   8e-44   Zea mays [maize]
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    163   9e-44   
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg             163   1e-43   
gb|EMS60728.1|  Auxin-induced protein 5NG4                              163   1e-43   
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     163   1e-43   
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          162   2e-43   
ref|NP_001141126.1|  uncharacterized protein LOC100273211               162   2e-43   Zea mays [maize]
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     162   2e-43   
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          162   2e-43   
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg             162   2e-43   
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...    160   2e-43   
gb|ABS52574.1|  nodulin family protein                                  162   2e-43   Gossypium hirsutum [American cotton]
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                162   2e-43   
emb|CDY29141.1|  BnaA09g53940D                                          162   2e-43   
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                   162   2e-43   
gb|AAL38712.1|  putative nodulin protein                                162   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         162   2e-43   
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative               161   2e-43   Ricinus communis
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    162   2e-43   
dbj|BAB92246.1|  putative nodulin MtN21                                 162   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     162   3e-43   
gb|EEC71658.1|  hypothetical protein OsI_04113                          162   3e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     162   3e-43   
ref|XP_004142736.1|  PREDICTED: auxin-induced protein 5NG4-like         161   3e-43   
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             161   3e-43   Populus trichocarpa [western balsam poplar]
gb|EMT31802.1|  Auxin-induced protein 5NG4                              161   3e-43   
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     161   4e-43   
gb|ACU17518.1|  unknown                                                 156   4e-43   Glycine max [soybeans]
dbj|BAD35697.1|  putative MtN21                                         161   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00107.1|  hypothetical protein OsI_22111                          161   4e-43   Oryza sativa Indica Group [Indian rice]
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         161   4e-43   
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     161   5e-43   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          161   5e-43   
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     161   5e-43   
ref|XP_003601055.1|  Auxin-induced protein 5NG4                         156   5e-43   
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    161   6e-43   
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          161   6e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          160   6e-43   
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    160   6e-43   
ref|XP_008463583.1|  PREDICTED: WAT1-related protein At2g39510-like     161   7e-43   
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     160   7e-43   
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    160   7e-43   
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               160   8e-43   Ricinus communis
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     160   9e-43   
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    159   9e-43   
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     160   9e-43   
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             160   9e-43   
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    160   9e-43   
gb|AAF16542.1|AC013482_16  T26F17.11                                    160   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     160   1e-42   
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          160   1e-42   
gb|KHG24903.1|  Auxin-induced 5NG4                                      160   1e-42   
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    159   1e-42   
emb|CDX75163.1|  BnaC09g25190D                                          160   1e-42   
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     159   1e-42   
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    159   1e-42   Vitis vinifera
ref|XP_010534299.1|  PREDICTED: WAT1-related protein At2g39510-like     159   2e-42   
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    159   2e-42   
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like         159   2e-42   
gb|EMT33815.1|  Auxin-induced protein 5NG4                              159   2e-42   
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     159   2e-42   
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             159   2e-42   
gb|ABR18253.1|  unknown                                                 160   2e-42   Picea sitchensis
emb|CDP15800.1|  unnamed protein product                                159   2e-42   
gb|KHG16518.1|  Auxin-induced 5NG4                                      159   2e-42   
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         159   2e-42   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     159   2e-42   
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     159   2e-42   
dbj|BAK02715.1|  predicted protein                                      159   2e-42   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          160   2e-42   
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                159   2e-42   
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     159   3e-42   
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             159   3e-42   
ref|XP_002312070.1|  hypothetical protein POPTR_0008s05130g             158   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             159   3e-42   
gb|EMT04611.1|  Auxin-induced protein 5NG4                              159   3e-42   
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          159   3e-42   
ref|NP_974519.1|  nodulin MtN21 /EamA-like transporter family pro...    156   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             159   3e-42   
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             159   4e-42   
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g             159   4e-42   Populus trichocarpa [western balsam poplar]
gb|EMS46274.1|  Auxin-induced protein 5NG4                              159   4e-42   
ref|XP_003601054.1|  Auxin-induced protein 5NG4                         156   4e-42   
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     158   4e-42   
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like     159   5e-42   
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     158   5e-42   
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     159   5e-42   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    158   5e-42   
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             157   6e-42   
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             158   6e-42   
ref|XP_011070209.1|  PREDICTED: WAT1-related protein At5g07050-like     154   6e-42   
tpg|DAA57218.1|  TPA: hypothetical protein ZEAMMB73_947627              155   6e-42   
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       156   6e-42   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         158   7e-42   
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          157   7e-42   
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       157   7e-42   
emb|CDX70003.1|  BnaA10g23520D                                          158   8e-42   
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     157   8e-42   
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         158   8e-42   
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     158   8e-42   
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             157   9e-42   
emb|CBI32681.3|  unnamed protein product                                157   9e-42   
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    157   9e-42   
emb|CDX93377.1|  BnaC04g45190D                                          157   9e-42   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     157   1e-41   
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     157   1e-41   
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          157   1e-41   
gb|ACJ84735.1|  unknown                                                 157   1e-41   Medicago truncatula
gb|EEC66707.1|  hypothetical protein OsI_33030                          157   1e-41   Oryza sativa Indica Group [Indian rice]
gb|KHN09198.1|  Auxin-induced protein 5NG4                              157   1e-41   
gb|KHG09563.1|  Auxin-induced 5NG4                                      158   1e-41   
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          157   1e-41   
emb|CDX93378.1|  BnaC04g45180D                                          157   1e-41   
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         157   1e-41   
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     157   1e-41   
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          157   1e-41   
ref|XP_004173847.1|  PREDICTED: auxin-induced protein 5NG4-like         152   1e-41   
ref|NP_001064323.1|  Os10g0210500                                       156   1e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     157   1e-41   
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     157   2e-41   
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     157   2e-41   
emb|CDY18443.1|  BnaA04g21440D                                          157   2e-41   
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          157   2e-41   
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             157   2e-41   
gb|AFK47115.1|  unknown                                                 157   2e-41   
ref|XP_011034692.1|  PREDICTED: WAT1-related protein At5g07050-like     157   2e-41   
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     157   2e-41   
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          157   2e-41   
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     157   2e-41   
gb|AFK34273.1|  unknown                                                 157   2e-41   
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          157   2e-41   Sorghum bicolor [broomcorn]
gb|ABR16695.1|  unknown                                                 157   2e-41   Picea sitchensis
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     156   2e-41   
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          156   2e-41   
gb|KHN05928.1|  Auxin-induced protein 5NG4                              156   2e-41   
ref|NP_001240202.1|  uncharacterized protein LOC100811114               157   2e-41   
emb|CDP06236.1|  unnamed protein product                                157   2e-41   
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             157   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          157   2e-41   
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    157   2e-41   
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             157   2e-41   
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         156   2e-41   
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             156   2e-41   
emb|CDX79735.1|  BnaC03g20710D                                          154   2e-41   
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          157   2e-41   
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     156   2e-41   
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050          157   2e-41   
gb|KDP29854.1|  hypothetical protein JCGZ_18429                         155   2e-41   
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             156   2e-41   
gb|AAM65570.1|  nodulin-like protein                                    156   3e-41   
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         157   3e-41   
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    156   3e-41   
ref|NP_001150619.1|  nodulin-like protein                               157   3e-41   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     156   3e-41   
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    156   3e-41   
gb|EEC79453.1|  hypothetical protein OsI_20446                          156   3e-41   
ref|NP_001055921.1|  Os05g0493800                                       156   3e-41   
ref|XP_002299181.1|  hypothetical protein POPTR_0001s06980g             157   3e-41   
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             156   3e-41   
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     156   3e-41   
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     156   3e-41   
ref|XP_009363179.1|  PREDICTED: WAT1-related protein At1g21890-like     156   3e-41   
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     156   3e-41   
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             156   3e-41   
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               155   3e-41   
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         156   3e-41   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     156   4e-41   
ref|XP_009104012.1|  PREDICTED: WAT1-related protein At3g56620-like     155   4e-41   
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     156   4e-41   
emb|CAA75575.1|  MtN21                                                  156   4e-41   
gb|AFK35679.1|  unknown                                                 156   4e-41   
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    156   4e-41   
emb|CAH58631.1|  nodulin-like protein                                   155   4e-41   
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     155   4e-41   
gb|ACL54205.1|  unknown                                                 156   4e-41   
gb|KHG03072.1|  Auxin-induced 5NG4                                      156   4e-41   
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 156   4e-41   
gb|AFK37263.1|  unknown                                                 155   5e-41   
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    156   5e-41   
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    156   5e-41   
emb|CDY18444.1|  BnaA04g21430D                                          155   5e-41   
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     155   5e-41   
emb|CBI19038.3|  unnamed protein product                                157   5e-41   
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             156   5e-41   
gb|EMT08224.1|  Auxin-induced protein 5NG4                              154   5e-41   
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    155   5e-41   
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     155   6e-41   
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          156   6e-41   
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          155   7e-41   
ref|XP_003566095.1|  PREDICTED: WAT1-related protein At5g07050-like     155   7e-41   
emb|CDY63536.1|  BnaCnng42250D                                          154   7e-41   
gb|KHN12183.1|  Auxin-induced protein 5NG4                              154   7e-41   
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          155   7e-41   
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     158   7e-41   
ref|XP_010516269.1|  PREDICTED: WAT1-related protein At3g56620-like     155   8e-41   
dbj|BAJ98418.1|  predicted protein                                      155   8e-41   
ref|XP_010427495.1|  PREDICTED: WAT1-related protein At3g56620 is...    155   8e-41   
emb|CDY07788.1|  BnaA03g17230D                                          154   8e-41   
gb|EYU18591.1|  hypothetical protein MIMGU_mgv1a007543mg                155   9e-41   
gb|EPS73987.1|  hypothetical protein M569_00767                         153   9e-41   
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     154   9e-41   
ref|XP_010530196.1|  PREDICTED: WAT1-related protein At4g08300-like     154   9e-41   
gb|KHG23400.1|  Auxin-induced 5NG4                                      155   1e-40   
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     155   1e-40   
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                155   1e-40   
gb|ACJ84541.1|  unknown                                                 152   1e-40   
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    155   1e-40   
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     154   1e-40   
gb|ACD56621.1|  putative nodulin-like protein                           154   1e-40   
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     155   1e-40   
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     154   1e-40   
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     154   1e-40   
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    154   1e-40   
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         154   2e-40   
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         154   2e-40   
emb|CDX99012.1|  BnaC09g48230D                                          150   2e-40   
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like     154   2e-40   
gb|KGN51609.1|  hypothetical protein Csa_5G584380                       153   2e-40   
emb|CDX79734.1|  BnaC03g20700D                                          153   2e-40   
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like     154   2e-40   
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     154   2e-40   
ref|XP_010091380.1|  Auxin-induced protein 5NG4                         154   2e-40   
ref|XP_004290851.1|  PREDICTED: auxin-induced protein 5NG4-like         154   2e-40   
ref|NP_001242267.1|  uncharacterized protein LOC100811617               154   2e-40   
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          154   2e-40   
gb|KHG10291.1|  Auxin-induced 5NG4                                      154   2e-40   
gb|KHG10292.1|  Auxin-induced 5NG4                                      154   2e-40   
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     153   3e-40   
dbj|BAK04850.1|  predicted protein                                      154   3e-40   
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     153   3e-40   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     154   3e-40   
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             153   3e-40   
ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like     153   3e-40   
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     153   3e-40   
gb|EEC74071.1|  hypothetical protein OsI_09081                          153   3e-40   
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     153   3e-40   
ref|NP_001048238.1|  Os02g0768300                                       153   4e-40   
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     153   4e-40   
ref|XP_002440000.1|  hypothetical protein SORBIDRAFT_09g024200          153   4e-40   
ref|XP_007137398.1|  hypothetical protein PHAVU_009G123700g             152   4e-40   
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...    153   4e-40   
ref|XP_008391904.1|  PREDICTED: WAT1-related protein At1g21890-like     153   5e-40   
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300          152   5e-40   
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like     153   5e-40   
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             152   5e-40   
ref|XP_010504569.1|  PREDICTED: WAT1-related protein At3g56620-like     152   6e-40   
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     153   6e-40   
gb|AGZ85011.1|  hypothetical protein 6                                  153   6e-40   
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     153   6e-40   
gb|EMS48876.1|  Auxin-induced protein 5NG4                              152   6e-40   
ref|XP_003601059.1|  Auxin-induced protein 5NG4                         150   6e-40   
gb|EPS61790.1|  hypothetical protein M569_13004                         150   7e-40   
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             152   7e-40   
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         152   8e-40   
gb|KHG18008.1|  Auxin-induced 5NG4                                      152   9e-40   
dbj|BAC43205.1|  putative nodulin                                       152   9e-40   
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    150   1e-39   
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     152   1e-39   
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          152   1e-39   
gb|AFK35983.1|  unknown                                                 151   1e-39   
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          152   1e-39   
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         151   1e-39   
dbj|BAK04730.1|  predicted protein                                      151   1e-39   
ref|NP_191221.1|  nodulin MtN21-like transporter family protein         151   2e-39   
ref|XP_006436051.1|  hypothetical protein CICLE_v10033577mg             150   2e-39   
ref|XP_003566093.1|  PREDICTED: uncharacterized protein LOC100824174    155   2e-39   
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...    149   2e-39   
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    150   2e-39   
ref|XP_003628011.1|  Auxin-induced protein 5NG4                         151   2e-39   
gb|KDO67718.1|  hypothetical protein CISIN_1g043160mg                   150   3e-39   
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             151   3e-39   
ref|XP_004500582.1|  PREDICTED: WAT1-related protein At4g08290-like     150   3e-39   
ref|XP_004144320.1|  PREDICTED: auxin-induced protein 5NG4-like         152   3e-39   
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             150   3e-39   
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          151   3e-39   
emb|CDY65991.1|  BnaA10g29860D                                          150   4e-39   
ref|XP_010419331.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    150   4e-39   
gb|KFK34904.1|  hypothetical protein AALP_AA5G208800                    150   4e-39   
gb|EMT18779.1|  Auxin-induced protein 5NG4                              150   4e-39   
ref|XP_009121742.1|  PREDICTED: WAT1-related protein At5g13670          151   4e-39   
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     150   4e-39   
dbj|BAJ92223.1|  predicted protein                                      150   5e-39   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     150   5e-39   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     150   5e-39   
ref|XP_011023643.1|  PREDICTED: WAT1-related protein At5g13670-like     150   5e-39   
ref|XP_002878097.1|  hypothetical protein ARALYDRAFT_486104             150   5e-39   
ref|NP_001151393.1|  nodulin-like protein                               150   5e-39   
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like     150   6e-39   
gb|AFK39842.1|  unknown                                                 149   7e-39   
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    150   7e-39   
ref|XP_010558786.1|  PREDICTED: WAT1-related protein At5g13670          149   7e-39   
ref|NP_001137108.1|  hypothetical protein                               149   9e-39   
ref|XP_008455745.1|  PREDICTED: WAT1-related protein At5g07050-like     150   9e-39   
ref|NP_001055529.2|  Os05g0409500                                       150   9e-39   
ref|XP_006402969.1|  hypothetical protein EUTSA_v10006038mg             149   1e-38   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     150   1e-38   
gb|EAY98030.1|  hypothetical protein OsI_19945                          150   1e-38   
ref|XP_006836228.1|  hypothetical protein AMTR_s00101p00110290          142   1e-38   
emb|CDY22493.1|  BnaC03g23030D                                          144   1e-38   
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          149   1e-38   
gb|ACR34989.1|  unknown                                                 149   1e-38   
ref|XP_006486497.1|  PREDICTED: WAT1-related protein At2g39510-like     148   1e-38   
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    149   1e-38   
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    149   1e-38   
ref|NP_001239827.1|  uncharacterized protein LOC100804390               149   2e-38   
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1            149   2e-38   
emb|CAB45800.1|  nodulin-like protein                                   149   2e-38   
ref|NP_192570.2|  nodulin MtN21 /EamA-like transporter family pro...    149   2e-38   
ref|XP_002872390.1|  nodulin MtN21 family protein                       148   2e-38   
ref|XP_006339251.1|  PREDICTED: WAT1-related protein At5g07050-like     148   2e-38   
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     149   2e-38   
gb|ACU23200.1|  unknown                                                 149   2e-38   
gb|AFW78503.1|  nodulin-like protein                                    149   2e-38   
gb|AAM64766.1|  nodulin-like protein                                    148   2e-38   
gb|AAM62626.1|  nodulin protein, putative                               148   2e-38   
emb|CDX72122.1|  BnaC08g27520D                                          148   2e-38   
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800          148   3e-38   
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     148   3e-38   
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     148   3e-38   
emb|CDX76001.1|  BnaA04g02650D                                          148   3e-38   
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg             147   3e-38   
ref|XP_010096638.1|  Auxin-induced protein 5NG4                         147   4e-38   
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     147   4e-38   
ref|XP_002893995.1|  nodulin MtN21 family protein                       147   5e-38   
ref|XP_009139089.1|  PREDICTED: WAT1-related protein At3g56620-like     147   6e-38   
ref|XP_010312165.1|  PREDICTED: WAT1-related protein At5g07050-li...    145   6e-38   
ref|XP_010906432.1|  PREDICTED: WAT1-related protein At5g07050-like     147   6e-38   
gb|AAM62850.1|  nodulin-like protein                                    147   6e-38   
emb|CDX79964.1|  BnaA05g01920D                                          147   7e-38   
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    147   7e-38   
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative               147   7e-38   
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like     147   7e-38   
gb|EMT14666.1|  Auxin-induced protein 5NG4                              147   8e-38   
ref|XP_010421740.1|  PREDICTED: WAT1-related protein At4g08300-li...    147   8e-38   
ref|XP_010096633.1|  Auxin-induced protein 5NG4                         147   9e-38   
ref|XP_010525433.1|  PREDICTED: WAT1-related protein At2g40900          147   1e-37   
emb|CDY09817.1|  BnaC09g43440D                                          146   1e-37   
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like     147   1e-37   
ref|XP_010455252.1|  PREDICTED: WAT1-related protein At4g08300          146   1e-37   
ref|XP_010436420.1|  PREDICTED: WAT1-related protein At4g08300-like     146   1e-37   
emb|CDX91104.1|  BnaC02g04930D                                          146   1e-37   
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     146   2e-37   
emb|CDX94896.1|  BnaC05g07750D                                          146   2e-37   
ref|XP_006287944.1|  hypothetical protein CARUB_v10001177mg             146   2e-37   
emb|CDY35431.1|  BnaA03g19290D                                          146   2e-37   
ref|XP_010063981.1|  PREDICTED: WAT1-related protein At4g08290-like     145   2e-37   
ref|NP_181622.2|  nodulin MtN21-like transporter family protein         146   2e-37   
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like     147   2e-37   
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...    145   2e-37   
ref|XP_009125930.1|  PREDICTED: WAT1-related protein At5g13670-like     145   2e-37   
emb|CDY49560.1|  BnaAnng10230D                                          145   2e-37   
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...    145   2e-37   
emb|CDX85633.1|  BnaA02g01800D                                          145   2e-37   
gb|AAB86450.1|  putative integral membrane protein nodulin              146   2e-37   
ref|XP_009151420.1|  PREDICTED: WAT1-related protein At4g08300 is...    145   3e-37   
ref|XP_010419959.1|  PREDICTED: WAT1-related protein At5g13670-like     145   3e-37   
ref|XP_006294359.1|  hypothetical protein CARUB_v10023376mg             145   3e-37   
ref|XP_010508790.1|  PREDICTED: WAT1-related protein At2g40900-like     145   3e-37   
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg             145   4e-37   



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            + + L+  +K+++PYLAVILLQFGYAGS+II K AL+ G++H+TF +Y NA A ++FAPF
Sbjct  3    TRERLLKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            A++ ERK RP +T SIFLKI LLG LE V+DQNL+Y G++YTTATFA+A+CN+LPA+TF+
Sbjct  63   AIVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFM  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LAWILRLE VN+R L SQAKI+GT
Sbjct  123  LAWILRLEKVNVRRLSSQAKIVGT  146



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            + + L+  +K+++PYLAVILLQFGYAGS+II K AL+ G++H+TF +Y NA A ++FAPF
Sbjct  3    TRERLLKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            A++ ERK RP +T SIFLKI LLG LE V+DQNL+Y G++YTTATFA+A+CN+LPA+TF+
Sbjct  63   AIVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFM  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LAWILRLE VN+R L SQAKI+GT
Sbjct  123  LAWILRLEKVNVRRLSSQAKIVGT  146



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L+  +K+ KPYLAV LLQFGYAGS+II K AL+ G++H+TF +Y N  A I+FAPFALLF
Sbjct  4    LLKFVKEGKPYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALLF  63

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RPK+T SIFLKI LLG +E V+DQNL+Y G++YTTAT A+A+CN+LPA+TF+LAWI
Sbjct  64   ERKIRPKMTISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWI  123

Query  60   LRLENVNIRALHSQAKILGT  1
            LRLE VNI+ L SQAKI+GT
Sbjct  124  LRLERVNIKRLSSQAKIIGT  143



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            + + ++  +K+++PYLAVILLQFGYAGS+II K AL+ G++H+TF +Y N  A  +FAPF
Sbjct  3    TRERILKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATFVFAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            A++ ERK RP +T SIFLKI LLG LE V+DQNL+Y G++YTTATFA+A+CN+LPA+TF+
Sbjct  63   AMVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFL  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LAWILRLE VNIR L SQAKI+GT
Sbjct  123  LAWILRLEKVNIRRLSSQAKIVGT  146



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            + + L+  LK++KPYLAVI LQFGYAGS+II K AL+ G++HYTF +Y NA A ++FAPF
Sbjct  5    TKECLIKFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYTFAVYRNAFAAVVFAPF  64

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            A LFERK RPK+T SIF KI LLG LE V+DQNL+YAGM++TTATFA+A+CN+LPAITF+
Sbjct  65   AALFERKIRPKMTFSIFWKIMLLGLLEPVIDQNLYYAGMKFTTATFATAMCNVLPAITFL  124

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LAWILRLENVNI  +HSQAKI+GT
Sbjct  125  LAWILRLENVNIWKIHSQAKIVGT  148



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  +S+  +L Q+KP++AVI LQFG+AG SII K+AL++G++ +  V+Y NA+A +  AP
Sbjct  1    MPKESVSQMLTQAKPFVAVIFLQFGFAGMSIITKFALNQGMSQHVLVVYRNAVAFVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FAL+F+RK RPK+T S+F+KI LLG LE V+D NLFY GM+ TTATF +A+CN+LPA  F
Sbjct  61   FALVFDRKLRPKMTLSVFVKILLLGLLEPVIDGNLFYTGMKLTTATFTTAMCNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AWI RLE VNIR LHSQAKILGT
Sbjct  121  IMAWIFRLEMVNIRKLHSQAKILGT  145



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  SMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFA  259
            + + + L+  LK++KPYLAVI LQFGYAGS+II K AL+ G++HY F +Y N+ A ++FA
Sbjct  3    TTTKECLIKFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYAFAVYRNSFAAVVFA  62

Query  258  PFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAIT  79
            PFA + ERK RPK+T SIF KI LLG LE V+DQNL+YAGM+YTTATFA+A+CN+LPAIT
Sbjct  63   PFAAILERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAIT  122

Query  78   FVLAWILRLENVNIRALHSQAKILGT  1
            F+LAWILRLENVNI  +HSQAKI+GT
Sbjct  123  FLLAWILRLENVNIWKIHSQAKIVGT  148



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L   +K+ K YLAV LLQFGYAGS+II K AL+ G++H+TF +Y N  A I+FAPFAL+F
Sbjct  4    LFKFVKEGKAYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALVF  63

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RPK++ SIFLKI LLG +E V+DQNL+Y G++YTTAT A+A+CN+LPA+TF+LAWI
Sbjct  64   ERKIRPKMSISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWI  123

Query  60   LRLENVNIRALHSQAKILGT  1
            LRLE VNI  L SQAKI+GT
Sbjct  124  LRLEKVNIMRLSSQAKIIGT  143



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M+ +S  +   ++KP+LAV+L+QFGYAG SII K+AL++G++ +  V+Y +A+A I+ AP
Sbjct  1    MATESSDSPYDKAKPFLAVVLMQFGYAGMSIISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA +F+RK RPK+T SIF KI L+G LE  +DQNL+Y GM+YTTATFASA+CNILPA  F
Sbjct  61   FAFIFDRKVRPKMTLSIFFKIMLMGLLEPTIDQNLYYTGMKYTTATFASAMCNILPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AW LRLE VNIR +HSQAKI+GT
Sbjct  121  LMAWALRLEKVNIRKMHSQAKIIGT  145



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M+ +S  +   ++KP+LAV+L+QFGYAG S+I K+AL++G++ +  V+Y +A+A I+ AP
Sbjct  1    MATESSDSPYDRAKPFLAVVLMQFGYAGMSLISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA +F+RK RPK+T SIF KI L+G LE  LDQNL+Y GM+YTTATFASA+CN+LPA  F
Sbjct  61   FAFIFDRKVRPKMTLSIFFKIMLMGLLEPTLDQNLYYTGMKYTTATFASAMCNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AW LRLE VNIR +HSQAKI+GT
Sbjct  121  LMAWALRLEKVNIRKMHSQAKIIGT  145



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  SMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFA  259
            S + + L+ LLK+SKPYLAVI LQFG+ GS+II K AL+ G++HYTF +Y N  A ++FA
Sbjct  3    SNTKECLMKLLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAAVVFA  62

Query  258  PFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAIT  79
            PFA L ERK RPK+T SIF KI LLG LE V+DQNL+YAGM+YTTATFA+A+CN+LPAIT
Sbjct  63   PFAALLERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAIT  122

Query  78   FVLAWILRLENVNIRALHSQAKILGT  1
            F+LAWILRLENVN+  + SQAKI+GT
Sbjct  123  FLLAWILRLENVNVWKVSSQAKIIGT  148



>ref|XP_008371417.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S+  +L ++ P++AV  +QFGYAG SII K+AL+ G++ +  V+Y +A+A +  AP
Sbjct  1    MSKGSMAEMLNRAMPFMAVTFMQFGYAGMSIISKFALNHGMSPHVLVVYRHAVATVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+RK RPK+T SIF+KI LLG LE V+DQNLFY GM+ TTATFASA+CN+LPA  F
Sbjct  61   FAVVFDRKVRPKMTLSIFIKIVLLGLLEPVIDQNLFYTGMKLTTATFASAMCNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AWI RLE +N+R+LHS AKILGT
Sbjct  121  IMAWIFRLEKINLRSLHSLAKILGT  145



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  402  QSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRP  223
            ++KP+LAVILLQFGYAG SII K+AL++G++ +  V+Y +A+A I+  PFA+LF+RK RP
Sbjct  12   KAKPFLAVILLQFGYAGLSIISKFALNQGMSQHVLVVYRHAVATIVITPFAILFDRKVRP  71

Query  222  KLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENV  43
            K+T SIFLKI ++G LE  +DQNL+Y GM+YTTATFA+ +CNILPA  F++AWILRLE V
Sbjct  72   KMTISIFLKILMMGLLEPTIDQNLYYTGMKYTTATFAATMCNILPAFAFIMAWILRLEKV  131

Query  42   NIRALHSQAKILGT  1
            N++ +HSQAK+LGT
Sbjct  132  NLKRVHSQAKLLGT  145



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L+++KPYLAVI+LQFG  GS+II K AL+ G++HYTF +Y N +A ++ APFAL+ ERK 
Sbjct  6    LRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLERKI  65

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RP++T SIF KI LL  LE V+DQNL+YAGM+YTTATFASA+CN+LPAITF+LAW L LE
Sbjct  66   RPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALGLE  125

Query  48   NVNIRALHSQAKILGT  1
             VNI+   SQAK+ GT
Sbjct  126  RVNIKRWSSQAKVAGT  141



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L+K+ KPYLA++ +QFGYAG +II K ALD+G+++YT  +Y NAIA ++ APFALL ERK
Sbjct  5    LVKKVKPYLAIVFMQFGYAGFAIIAKTALDQGMSNYTLSIYRNAIATLVVAPFALLLERK  64

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T S+  KI LL FLE V+DQNL+Y GM++TTATF++A+CNILPAITF+LAW LRL
Sbjct  65   IRPKMTVSVLWKIALLAFLEPVIDQNLYYMGMKHTTATFSTAMCNILPAITFLLAWALRL  124

Query  51   ENVNIRALHSQAKILGT  1
            E VN+R  H  AKILGT
Sbjct  125  EKVNVRRAHGYAKILGT  141



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  KNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            K++  S      L  ++KP+LAVI LQ G AG +II K ALD+G++HYTFV+Y NA+A  
Sbjct  2    KDQVSSQSLFCRLFNKAKPFLAVIFLQLGLAGMAIIAKIALDQGLSHYTFVVYRNAVATC  61

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
            + APFA+  ERK RPK+T S+F KI LLG LE V+DQNL+YAGM YTTATF +A+CNILP
Sbjct  62   VIAPFAITLERKVRPKMTYSVFAKIALLGLLEPVIDQNLYYAGMSYTTATFTAAMCNILP  121

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            A+TF+LA++LRLE VNI+ + SQAK++GT
Sbjct  122  ALTFLLAFVLRLEKVNIKNVRSQAKVVGT  150



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L+++KPYLAVI+LQFG  GS+II K AL+ G++HYTF +Y N +A ++ APFAL+ ERK 
Sbjct  6    LRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLERKI  65

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RP++T SIF KI LL  LE V+DQNL+YAGM+YTTATFASA+CN+LPAITF+LAW L LE
Sbjct  66   RPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALGLE  125

Query  48   NVNIRALHSQAKILGT  1
             VNI+   SQAK+ GT
Sbjct  126  RVNIKRWSSQAKVAGT  141



>ref|XP_008233581.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Prunus 
mume]
Length=347

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S+  ++  +KP++AV L+QFGYAG SII K+AL++G++ +  V+Y +A+A +  AP
Sbjct  1    MSKSSMAQMINLAKPFVAVTLMQFGYAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+RK RPK+T S+F KI LLG LE V+DQNLFY GM+ TTATF SA+CN+LPA  F
Sbjct  61   FAIVFDRKVRPKMTFSVFTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AWI RLEN+N R+L S AKILGT
Sbjct  121  IMAWIFRLENINFRSLRSLAKILGT  145



>ref|XP_002312071.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE89438.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=380

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
             ++KP+LAVILLQFGYAG   + K+ALD+G++ +  V+Y +A+A I+ APFAL+F+RK R
Sbjct  9    DRAKPFLAVILLQFGYAGMFTMTKHALDEGMSQHVLVVYRHAVATIVIAPFALVFDRKVR  68

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T SIF KI LLG LE  +DQNL+Y GM+YTTATF SA+CN+LPA  F++AW LR+E 
Sbjct  69   PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWALRIEQ  128

Query  45   VNIRALHSQAKILGT  1
            VNIR +HSQAKI GT
Sbjct  129  VNIRKMHSQAKIFGT  143



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  SMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFA  259
            S S + L+  LK+SKPYLAVI LQFG+ GS+II K AL+ G++HYTF +Y N  A ++FA
Sbjct  3    SNSKECLMKNLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAAVVFA  62

Query  258  PFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAIT  79
            PFA L ERK RPK+T SIF KI LLG LE V+DQNL+YAGM+YTTATFA+A+CN+LPAIT
Sbjct  63   PFAALLERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAIT  122

Query  78   FVLAWILRLENVNIRALHSQAKILGT  1
            F+LAWILRLENVN+  + SQAKI+GT
Sbjct  123  FLLAWILRLENVNVWKVGSQAKIIGT  148



>ref|XP_009347451.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=350

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S+  +L  + P++AV  +QFG+AG SII K+AL+ G++ +  V+Y +A+A +  AP
Sbjct  1    MSKGSMAEMLNWATPFMAVTFMQFGFAGMSIISKFALNHGMSPHVLVVYRHAVASVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+RK RPK+T SIF KI LLG LE VLDQNLFY GM+ TTATF SA+CN+LP   F
Sbjct  61   FAIVFDRKVRPKMTLSIFTKIVLLGLLEPVLDQNLFYTGMKLTTATFTSAMCNVLPTFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AWI R+E +N+R+LHS AKILGT
Sbjct  121  IMAWIFRIEKINLRSLHSLAKILGT  145



>ref|XP_011023754.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g39510-like 
[Populus euphratica]
Length=351

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
             ++KP+LAVILLQFGYAG   I K+ALD+G++ +  V+  +A+A I+  PFAL+F+RK R
Sbjct  9    DRAKPFLAVILLQFGYAGMFTITKHALDEGMSQHVLVVXRHAVATIVITPFALVFDRKVR  68

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T SIF KI LLG LE  +DQNL+Y GM+YTTATF SA+CN+LPA  F++AW+LR+E 
Sbjct  69   PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWVLRIEQ  128

Query  45   VNIRALHSQAKILGT  1
            VNIR  HSQAKI GT
Sbjct  129  VNIRKKHSQAKIFGT  143



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            + Q+ P LAV+LLQFGYAG SII KYAL+ G+NHYTFV+Y + IA  + APFA++ ERKR
Sbjct  12   IMQAMPILAVVLLQFGYAGLSIIAKYALNAGMNHYTFVVYRHVIAAAVIAPFAIVLERKR  71

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
             P++T SIF KI L+G LE V+DQNL+Y GM+ TTATF +A+ NI+PA TF++A +LRLE
Sbjct  72   WPRMTVSIFAKIMLMGLLEPVIDQNLYYVGMKNTTATFTTAMSNIIPAFTFLVALVLRLE  131

Query  48   NVNIRALHSQAKILGT  1
             VN+R LHSQAK++GT
Sbjct  132  KVNLRRLHSQAKVVGT  147



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KPYLAVI +QFG AG +II K+AL+KG++HY+FV+Y  A+A I+ +PFAL+ ERK RP +
Sbjct  8    KPYLAVIFMQFGIAGLAIIAKFALNKGMSHYSFVVYRQAVAAIVISPFALVLERKVRPNM  67

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            + SIF+KI LLG LE V+DQNL+YAGMQYTTATF SAL N +PA+TF++AWI RLE VN+
Sbjct  68   SVSIFIKIALLGLLEPVIDQNLYYAGMQYTTATFVSALSNTVPALTFIMAWIFRLEKVNL  127

Query  36   RALHSQAKILGT  1
            R + S AK+ GT
Sbjct  128  REVRSLAKVGGT  139



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            +V +L Q+ P++AV  +QFG+AG S+I K+AL+ G++ +  V+Y +A+A +  APFA++F
Sbjct  1    MVQMLNQAMPFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIF  60

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            +R  RPK+T SIF KI LLG LE V+DQNLFY GM+ TTATF SA+CN+LPA  F++AWI
Sbjct  61   DRNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWI  120

Query  60   LRLENVNIRALHSQAKILGT  1
             RLE +N+R+LHS AKILGT
Sbjct  121  FRLEKINLRSLHSLAKILGT  140



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S V  ++ +KPY  VI +QFGYAG +I+ K ALDKG++ + FV Y    A ++ APFA+
Sbjct  2    ESFVRFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI LLGFLE V+DQNLFY GM+YTTATFA+A+CN+LPA  F++A
Sbjct  62   IFERKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE VNI    SQAKILGT
Sbjct  122  WACRLEKVNIMKRGSQAKILGT  143



>ref|XP_011080962.1| PREDICTED: WAT1-related protein At2g39510-like [Sesamum indicum]
Length=379

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L K+ + YL+++++QFG  G +I+ K AL++G +HYTF +Y NAIA +LFAPFA++ ER
Sbjct  6    GLKKKLQVYLSLVVVQFGNVGFAIVAKAALNQGTSHYTFSVYRNAIAALLFAPFAMVLER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S+F+KI LLG L+ V  QN+FY+G+ YT+ATFASA+CN+LPAITFV+AWILR
Sbjct  66   KIRPKMTFSVFVKIMLLGLLDPVFGQNMFYSGLNYTSATFASAMCNLLPAITFVMAWILR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E VN+R + S AKI+GT
Sbjct  126  IEKVNLREVRSHAKIVGT  143



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -3

Query  423  SLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALL  244
            S+V  +K +KP+ AV+ LQFG AG  I+ K AL++G+++Y  V+Y + +A  + APFA++
Sbjct  2    SIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVI  61

Query  243  FERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAW  64
             ++K RPK+T SIF+KI LL  LE VLDQNL++ GM+YTTATFA+A+CNILPA+TFV+AW
Sbjct  62   LDKKVRPKMTLSIFIKIMLLALLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAW  121

Query  63   ILRLENVNIRALHSQAKILGT  1
            +LRLE VN++++ SQ+K++GT
Sbjct  122  VLRLEKVNLKSIRSQSKLVGT  142



>ref|XP_007218251.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
 gb|EMJ19450.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
Length=347

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S+  ++ ++KP +AV L+QFG+AG SII K+AL++G++ +  V+Y +A+A +  AP
Sbjct  1    MSKSSMAQMINRAKPSVAVTLMQFGFAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+RK RPK+T S+  KI LLG LE V+DQNLFY GM+ TTATF SA+CN+LPA  F
Sbjct  61   FAVVFDRKVRPKMTFSVLTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AWI RLEN+N R+LHS AKILGT
Sbjct  121  IMAWIFRLENINFRSLHSLAKILGT  145



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -3

Query  423  SLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALL  244
            S+V  +K +KP+ AV+ LQFG AG  I+ K AL++G+++Y  V+Y + +A  + APFA++
Sbjct  2    SIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVI  61

Query  243  FERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAW  64
             ++K RPK+T SIF+KI LLG LE VLDQNL++ GM+YTTATFA+A+CNILPA+TFV+AW
Sbjct  62   LDKKVRPKMTLSIFIKIMLLGLLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAW  121

Query  63   ILRLENVNIRALHSQAKILGT  1
            +LRLE V ++++ SQ+K++GT
Sbjct  122  VLRLEKVKLKSIRSQSKLVGT  142



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L N+  ++KP++A++ LQFG+AG  II    L +G+NHY  V+Y N  A +  APFAL F
Sbjct  10   LCNIFYKAKPFVAMVSLQFGFAGMYIITMLCLKRGLNHYVLVVYRNGTATLAIAPFALYF  69

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RPK+T S+FLKI +LGFLE VLDQNL+Y GM+YT+ATF+SA+ N+LPAITF++A I
Sbjct  70   ERKIRPKMTLSVFLKIMVLGFLEPVLDQNLYYVGMRYTSATFSSAMFNVLPAITFIMAII  129

Query  60   LRLENVNIRALHSQAKILGT  1
             RLE V I+ LHSQAKI+GT
Sbjct  130  FRLEKVKIKNLHSQAKIIGT  149



>ref|XP_004302750.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS   LV   K +KP+LAV+ LQFG AG  I+ K AL++GV++Y  V+Y +A+A ++  P
Sbjct  1    MSGHELVERFKAAKPFLAVVFLQFGLAGMDILCKAALNEGVSNYVLVVYRHAVATLVVGP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++ ++K RPK+T +IF KI +LG LE VLDQNL+Y GM+YTTATFA+A+ NILPA+TF
Sbjct  61   FAVVLDKKVRPKMTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+AWILRLE V +  + SQ K+LGT
Sbjct  121  VMAWILRLEKVKLTCIRSQCKLLGT  145



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 124/165 (75%), Gaps = 5/165 (3%)
 Frame = -3

Query  489  HIDTTQEKEALGSRK--NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKG  316
            +I +++  E  G+ K  +R+M  K L + LK   P+LAV+ LQFG+AG  I+ K AL+KG
Sbjct  41   YISSSKHTEGEGTDKIESRAMDAKRLFHKLK---PFLAVVFLQFGFAGMDILCKAALNKG  97

Query  315  VNHYTFVLYANAIAGILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGM  136
            +++Y  V+Y +A+A I+  PFA++ +RK RP++T  IF+++ +L  LE V+DQNL+Y GM
Sbjct  98   MSNYVLVVYRHAVATIVIVPFAVIMDRKTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGM  157

Query  135  QYTTATFASALCNILPAITFVLAWILRLENVNIRALHSQAKILGT  1
            + TTATFA+A+CNILPAITFV+AWI+RLE V ++++ SQAK+ GT
Sbjct  158  KQTTATFAAAMCNILPAITFVIAWIMRLEKVKLKSIRSQAKVFGT  202



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L  ++KP+LAVI LQFG AG  I+ K AL++G+++Y FV+Y +A+A ++ APFA++ ++
Sbjct  6    ELYNRAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAIILDK  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+TPSIF K+ LL  LE V+DQNL+  G++YTTATFA+A+CNILPAITF++AWI R
Sbjct  66   KVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFR  125

Query  54   LENVNIRALHSQAKILGT  1
            LE V + ++ SQAKI+GT
Sbjct  126  LEKVKLTSIRSQAKIVGT  143



>ref|XP_009337582.1| PREDICTED: WAT1-related protein At2g39510 [Pyrus x bretschneideri]
Length=350

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S   +L +  P++AV  LQFGYAG  II K+AL++G++   FV Y +A+A +  AP
Sbjct  1    MSKCSKAQMLTRLMPFMAVTFLQFGYAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+R+ RPK+T SIF KI LLG LE VLDQNL Y GM+ TTATF SAL N+LPA  F
Sbjct  61   FAIIFDRRVRPKMTLSIFCKIVLLGLLEPVLDQNLTYTGMKLTTATFTSALYNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AW+ RLE +N+R+LHSQAKILGT
Sbjct  121  IMAWVFRLEKINLRSLHSQAKILGT  145



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  +S   L  ++KP+LAVI LQ G AG +II K ALD+G+NHYTFV+Y N IA  + +P
Sbjct  5    MPIQSPSRLFSKAKPFLAVIFLQLGLAGMAIIAKLALDEGLNHYTFVVYRNFIATCVISP  64

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA+  ERK RPK+T +IF KI LLG LE V+DQNL+Y+GM+ T+ATF +A+CNILPA+TF
Sbjct  65   FAITLERKVRPKMTFTIFAKIALLGLLEPVIDQNLYYSGMRITSATFTTAMCNILPALTF  124

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A+I RLE V I+ + SQAK++GT
Sbjct  125  LMAFICRLEKVKIKKVRSQAKVVGT  149



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            +  +  Q+KP+LAVI LQFGYAG SII K+AL++G++ + FV+Y +AIA ++ APFA++ 
Sbjct  1    MAGIFNQAKPFLAVIFLQFGYAGMSIIAKFALNQGMSQHVFVMYRHAIAFLVIAPFAIVL  60

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            +RK RPK+T SIF+K+ LLG LE  +DQNL++ GM+YT+ATF +A+CN+LPA  FVLAWI
Sbjct  61   DRKVRPKMTLSIFVKLLLLGLLEPTIDQNLYFTGMKYTSATFTAAMCNVLPAFAFVLAWI  120

Query  60   LRLENVNIRALHSQAKILGT  1
             +LE V+I+ LHSQAKILGT
Sbjct  121  FKLEKVHIKKLHSQAKILGT  140



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S +  L+ +KPY  VI +QFGYAG +I+ K ALDKG++ + FV Y    A ++ APFA+
Sbjct  2    ESFIRFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI LLGFLE V+DQNL+Y GM+YTTATFA+A+CN+LPA  F++A
Sbjct  62   IFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE V I    SQAKILGT
Sbjct  122  WACRLEKVKIMKRGSQAKILGT  143



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -3

Query  429  NKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFA  250
            N  +      +KP+ AV+ LQFG AG  I+ K AL++G+++Y  V+Y +A+A I+ APFA
Sbjct  2    NSQVSQWCVSAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFA  61

Query  249  LLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVL  70
            L+F++K RPK+T  +F K+ +L  LE V+DQNL++ GM+YTTATFA+A+CNILPAITFV+
Sbjct  62   LIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFLGMKYTTATFAAAMCNILPAITFVM  121

Query  69   AWILRLENVNIRALHSQAKILGT  1
            AWILRLE V I+++ SQAKI+GT
Sbjct  122  AWILRLEKVRIKSIRSQAKIVGT  144



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -3

Query  429  NKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFA  250
            N  +      +KP+ AV+ LQFG AG  I+ K AL++G+++Y  V+Y +A+A I+ APFA
Sbjct  2    NPQVSQWCVSAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFA  61

Query  249  LLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVL  70
            L+F++K RPK+T  +F K+ +L  LE V+DQNL++ GM+YTTATFA+A+CNILPAITFV+
Sbjct  62   LIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVM  121

Query  69   AWILRLENVNIRALHSQAKILGT  1
            AWILRLE V I+++ SQAKI+GT
Sbjct  122  AWILRLEKVRIKSIRSQAKIVGT  144



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  393  PYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKLT  214
            P++AV  +QFG+AG S+I K+AL+ G++ +  V+Y +A+A +  APFA++F+R  RPK+T
Sbjct  2    PFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNVRPKMT  61

Query  213  PSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNIR  34
             SIF KI LLG LE V+DQNLFY GM+ TTATF SA+CN+LPA  F++AWI RLE +N+R
Sbjct  62   LSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEKINLR  121

Query  33   ALHSQAKILGT  1
            +LHS AKILGT
Sbjct  122  SLHSLAKILGT  132



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -3

Query  402  QSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRP  223
            ++KP+LAVI LQFG AG  I+ K AL++G+++Y FV+Y +A+A ++ APFA++ ++K RP
Sbjct  10   RAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAIILDKKVRP  69

Query  222  KLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENV  43
            K+TPSIF K+ LL  LE V+DQNL+  G++YTTATFA+A+CNILPAITF++AWI RLE V
Sbjct  70   KMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFRLEKV  129

Query  42   NIRALHSQAKILGT  1
             + ++ SQAK++GT
Sbjct  130  KLTSIRSQAKLVGT  143



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  417  VNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFE  238
            ++L KQ+KPYLAVI +QFGYAGS+II K AL+KG++HY F +Y N  A  +FAPFA++ E
Sbjct  1    MDLFKQAKPYLAVIFMQFGYAGSAIISKSALNKGMSHYAFAIYRNLFAAAVFAPFAVVLE  60

Query  237  RKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWIL  58
            RK RP++T S+  KI LLG LE V+DQNL+YA M+YTTATFA ++ N+LPA+TF+LAWIL
Sbjct  61   RKVRPRMTISVLWKIILLGLLEPVIDQNLYYAAMKYTTATFAVSMTNMLPALTFLLAWIL  120

Query  57   RLENVNIRALHSQAKILGT  1
            RLE VN R LHSQ KI GT
Sbjct  121  RLEEVNTRRLHSQIKIAGT  139



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +SL NL++++K  LAV LLQ  YAG +IIV+ A++KG++HY F++Y  A A +L APFAL
Sbjct  2    ESLTNLIRRAKLILAVALLQGAYAGQAIIVRMAMNKGMSHYIFLVYRMAFATVLIAPFAL  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + +RK RPK+T SI +K  LL   + +LDQNL+Y  M Y+TATF SA+ NILPAI F +A
Sbjct  62   ILDRKSRPKMTSSILVKTMLLSLFDPLLDQNLYYMAMSYSTATFTSAMFNILPAIAFFMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI RLE VNIR LHSQAK+LGT
Sbjct  122  WIFRLETVNIRKLHSQAKVLGT  143



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP+L V+ LQFGYAG SII K+ALD+G++ +    Y + +A IL APFA + +RK 
Sbjct  3    LKTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATILMAPFAFILDRKV  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI +LG LE  LDQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILVLGLLEPTLDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VNIR +HSQAKI+GT
Sbjct  123  KVNIRKIHSQAKIIGT  138



>ref|XP_008370940.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS  S   +L +  P++AV LLQFG+AG  II K+AL++G++   FV Y +A+A +  AP
Sbjct  1    MSKCSTAQMLIRLMPFMAVTLLQFGFAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+R+ RPK+T SIF KI LLG LE V+DQNL Y GM+ TTAT  SAL N+LPA  F
Sbjct  61   FAIIFDRRVRPKMTLSIFFKIVLLGLLEPVMDQNLAYTGMKLTTATVTSALYNVLPAFAF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++AW+ RLE VN+R+LHSQAKILGT
Sbjct  121  IMAWVFRLEKVNLRSLHSQAKILGT  145



>gb|KGN51272.1| hypothetical protein Csa_5G505820 [Cucumis sativus]
Length=376

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             LL Q+KPY+AVIL QF  AG  II K+AL++G+N +  V+Y   IA I+ APFA +FER
Sbjct  6    GLLSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF K+ LLG LE  LDQNL+Y GM+YTTATFASA+ N+ P + F++AW+ R
Sbjct  66   KVRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVAR  125

Query  54   LENVNIRALHSQAKILGT  1
            LE V++R L SQAKILGT
Sbjct  126  LEKVDVRQLSSQAKILGT  143



>ref|XP_004149823.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
 ref|XP_004166635.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=384

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             LL Q+KPY+AVIL QF  AG  II K+AL++G+N +  V+Y   IA I+ APFA +FER
Sbjct  14   GLLSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFER  73

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF K+ LLG LE  LDQNL+Y GM+YTTATFASA+ N+ P + F++AW+ R
Sbjct  74   KVRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVAR  133

Query  54   LENVNIRALHSQAKILGT  1
            LE V++R L SQAKILGT
Sbjct  134  LEKVDVRQLSSQAKILGT  151



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            K++  L  +SKP++AVI LQFG AG  I+ K AL++G+++Y FV+Y +A+A +  APFA+
Sbjct  2    KAVSELFIRSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + ++K RPK+T SIF K+ LL  LE V+DQNL+  G++YTTATFA+A+CNILPAITF++A
Sbjct  62   ILDKKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI RLE V + ++ SQAKI+GT
Sbjct  122  WIFRLERVKLTSIRSQAKIIGT  143



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            K++  L  +SKP++AVI LQFG AG  I+ K AL++G+++Y FV+Y +A+A +  APFA+
Sbjct  2    KAVRELFIRSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAM  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + ++K RPK+T SIF K+ LL  LE V+DQNL+  G++YTTATFA+A+CNILPAITF++A
Sbjct  62   ILDKKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI RLE V + ++ SQAKI+GT
Sbjct  122  WIFRLERVKLTSIRSQAKIIGT  143



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  489  HIDTTQEKEALGSRK--NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKG  316
            +I +++  E  G+ K  +++M  K+L + LK   P+LAV+ LQFG AG  I+ K AL+KG
Sbjct  41   YISSSKHTEGEGTDKIESKAMDAKTLFHKLK---PFLAVVFLQFGLAGMDILCKAALNKG  97

Query  315  VNHYTFVLYANAIAGILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGM  136
            +++Y  V+Y NA+A I+ APFA++ ERK RP++T  IF+++ +L  LE V+DQNL+Y GM
Sbjct  98   MSNYVLVVYRNAVATIVIAPFAVIMERKTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGM  157

Query  135  QYTTATFASALCNILPAITFVLAWILRLENVNIRALHSQAKILGT  1
            + TTATFA+A+CNILPAI  V+AWI+ LE V ++++ SQAK+ GT
Sbjct  158  KQTTATFAAAMCNILPAIALVMAWIMGLETVKMKSIRSQAKVFGT  202



>gb|KFK44291.1| hypothetical protein AALP_AA1G239100 [Arabis alpina]
Length=391

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K L  L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APF
Sbjct  3    SQKMLGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATLVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL +ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALYYERKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>ref|XP_003590514.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=261

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N ++++KP++AV+ LQFGYA   ++ K AL++G+++Y FV+Y +A+A I+  PFAL F+R
Sbjct  9    NWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFALYFDR  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF+KI LL  LE V+DQNL++ GM+YTTATFA+A+ N+LPAITF+LA I+R
Sbjct  69   KIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVR  128

Query  54   LENVNIRALHSQAKILGT  1
            LE + I+++ SQAK+LGT
Sbjct  129  LEKIKIKSMRSQAKVLGT  146



>ref|XP_010534681.1| PREDICTED: WAT1-related protein At1g21890 isoform X2 [Tarenaya 
hassleriana]
Length=361

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            K  +  +K+ KPY+A++ +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APFAL
Sbjct  27   KMWLGFIKRVKPYVAMVSMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATLVIAPFAL  86

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            L+ERK RPK+T  +FL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITF++A
Sbjct  87   LYERKIRPKMTVGVFLRIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFIMA  146

Query  66   WILRLENVNIRALHSQAKILGT  1
             I RLE+VN++ + S AK++GT
Sbjct  147  LIFRLESVNMKKVRSIAKVVGT  168



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            +  + K YL ++ LQFGYAG  II   +L  G+NHY  V+Y +A+A ++ APFAL+ ERK
Sbjct  13   MFSKVKAYLGIVSLQFGYAGMYIITMVSLKHGMNHYVLVVYRHAVATLVIAPFALVLERK  72

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T S FLKI +LGFLE VLDQNL+Y GM+YT+ATFASA  N+LPAITF+LA I RL
Sbjct  73   VRPKMTLSTFLKIMVLGFLEPVLDQNLYYVGMKYTSATFASATVNVLPAITFILAIIFRL  132

Query  51   ENVNIRALHSQAKILGT  1
            E +NI+ + SQAK++GT
Sbjct  133  EKINIKKIPSQAKVIGT  149



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = -3

Query  435  MSN--KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILF  262
            MSN    L+  +K +KP+ AVI LQFG AG  I+ K AL++G+++Y  V+Y + +A  + 
Sbjct  1    MSNFGHGLLERVKAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVV  60

Query  261  APFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAI  82
            APFAL+ ++K RPK+T  IF+KI LLG LE V+DQNL++ GM+YTTATFA+A+CNILPA+
Sbjct  61   APFALILDKKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPAL  120

Query  81   TFVLAWILRLENVNIRALHSQAKILGT  1
            TF +AWILRLE V ++ + SQ+K+ GT
Sbjct  121  TFAMAWILRLEKVKLKCIRSQSKVFGT  147



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = -3

Query  435  MSN--KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILF  262
            MSN    L+  +K +KP+ AVI LQFG AG  I+ K AL++G+++Y  V+Y + +A  + 
Sbjct  1    MSNFGHGLLERVKAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVV  60

Query  261  APFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAI  82
            APFAL+ ++K RPK+T  IF+KI LLG LE V+DQNL++ GM+YTTATFA+A+CNILPA+
Sbjct  61   APFALILDKKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPAL  120

Query  81   TFVLAWILRLENVNIRALHSQAKILGT  1
            TF +AWILRLE V ++ + SQ+K+ GT
Sbjct  121  TFAMAWILRLEKVKLKCIRSQSKVFGT  147



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP+L VI LQFGYAG SII K+ALD+G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LKTWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKV  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VNIR +HSQAKILGT
Sbjct  123  KVNIRKIHSQAKILGT  138



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  SMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFA  259
            S + + ++ +L + KPYLAV+LLQFG+AG +I+ K++L++G+N + FV+Y +A A  + A
Sbjct  2    SRNGERVIRVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVA  61

Query  258  PFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAIT  79
            PFA+LFERK RPK+T S+FLKI LLG LE V+DQNLFY GM+YTTA+F +A+ N+LPA T
Sbjct  62   PFAILFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFT  121

Query  78   FVLAWILRLENVNIRALHSQAKILGT  1
            F++AW  RLE ++IR+ HSQAKILGT
Sbjct  122  FLMAWFFRLERLSIRSKHSQAKILGT  147



>ref|XP_010534673.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Tarenaya 
hassleriana]
Length=414

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            K  +  +K+ KPY+A++ +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APFAL
Sbjct  27   KMWLGFIKRVKPYVAMVSMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATLVIAPFAL  86

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            L+ERK RPK+T  +FL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITF++A
Sbjct  87   LYERKIRPKMTVGVFLRIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFIMA  146

Query  66   WILRLENVNIRALHSQAKILGT  1
             I RLE+VN++ + S AK++GT
Sbjct  147  LIFRLESVNMKKVRSIAKVVGT  168



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -3

Query  438  SMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFA  259
            S + + ++ +L + KPYLAV+LLQFG+AG +I+ K++L++G+N + FV+Y +A A  + A
Sbjct  2    SRNGERVIRVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVA  61

Query  258  PFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAIT  79
            PFA+LFERK RPK+T S+FLKI LLG LE V+DQNLFY GM+YTTA+F +A+ N+LPA T
Sbjct  62   PFAILFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFT  121

Query  78   FVLAWILRLENVNIRALHSQAKILGT  1
            F++AW  RLE ++IR+ HSQAKILGT
Sbjct  122  FLMAWFFRLERLSIRSKHSQAKILGT  147



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = -3

Query  489  HIDTTQEKEALGSRK--NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKG  316
            +I +++  E  G+ K  +++M  K L + LK   P+LAV+ LQFG AG  I+ K AL+KG
Sbjct  67   YISSSKHTEGEGTDKIESKAMDAKRLFHKLK---PFLAVVFLQFGLAGMDILCKAALNKG  123

Query  315  VNHYTFVLYANAIAGILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGM  136
            +++Y  V+Y NA+A I+ APFA++ +RK+RP++T  IF+++ +L  LE V+DQNL+Y GM
Sbjct  124  MSNYVLVVYRNAVATIVIAPFAVIMDRKKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGM  183

Query  135  QYTTATFASALCNILPAITFVLAWILRLENVNIRALHSQAKILGT  1
            + TTATFA+A+CNILPAI  V+AWI+ LE V ++++ SQAK+ GT
Sbjct  184  KQTTATFAAAMCNILPAIALVMAWIMGLETVKMKSIRSQAKVFGT  228



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  SKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPK  220
            S+ + AV+ LQFG AG  I+ K AL++G+++Y  V+Y +A+A I+ APFAL+F++K RPK
Sbjct  5    SQAFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIFDKKVRPK  64

Query  219  LTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVN  40
            +T  +F K+ +L  LE V+DQNL++ GM+YTTATFA+A+CNILPAITFV+AWILRLE V 
Sbjct  65   MTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVMAWILRLEKVR  124

Query  39   IRALHSQAKILGT  1
            I+++ SQAKI+GT
Sbjct  125  IKSIRSQAKIVGT  137



>emb|CDY00403.1| BnaC07g14230D [Brassica napus]
Length=379

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVIGT  146



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            +  +L ++ P++AV  +Q G+AG S+I K+AL+ G++ +  V+Y +A+A +  APFA++F
Sbjct  1    MAQMLNRAVPFMAVTFMQIGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIF  60

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            +R  RPK+T SIF KI LLG LE V+DQNLFY GM+ TTATF SA+CN+LPA  F++AWI
Sbjct  61   DRNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWI  120

Query  60   LRLENVNIRALHSQAKILGT  1
             R E +N+R+LHS A ILGT
Sbjct  121  FRFEKINLRSLHSLAMILGT  140



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S V  ++ +KPY  VI +QFGYAG +I+ K ALDKG++ + FV Y    A ++ APFA+
Sbjct  2    ESFVRFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  246  LFER----------KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCN  97
            +FER          K R K+T S+  KI LLGFLE V+DQNLFY GM+YTTATFA+A+CN
Sbjct  62   IFERLSVFGVFACRKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCN  121

Query  96   ILPAITFVLAWILRLENVNIRALHSQAKILGT  1
            +LPA  F++AW  RLE VNI    SQAKILGT
Sbjct  122  VLPAFVFLMAWACRLEKVNIMKRGSQAKILGT  153



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S +  L+ +KPY  VI +QFGYAG +I+ K ALDKG++ +    Y    A ++ APFA+
Sbjct  2    ESFIRFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVLXAYRQVAATLVIAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI LLGFLE V+DQNL+Y GM+YTTATFA+A+CN+LPA  F++A
Sbjct  62   IFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE V I    SQAKILGT
Sbjct  122  WACRLEKVKIMKRGSQAKILGT  143



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ KPYLA++ LQFGYAG  II   +L  G++HY   +Y + +A I+ APFAL+ ERK 
Sbjct  14   LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFALVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  IFL+I  LGFLE VLDQNL+Y GM+YT+ATFASA  N LPAITF++A I RLE
Sbjct  74   RPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN + LHS AK++GT
Sbjct  134  TVNFKKLHSAAKVVGT  149



>ref|XP_009103277.1| PREDICTED: WAT1-related protein At1g21890 [Brassica rapa]
Length=389

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>gb|ACJ84240.1| unknown [Medicago truncatula]
Length=247

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N ++++KP++AV+ LQFGYA   ++ K AL++G+++Y FV+Y +A+A I+  PFAL F+R
Sbjct  9    NWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFALYFDR  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF+KI LL  LE V+DQNL++ GM+YTTATFA+A+ N+LPAITF+LA I+R
Sbjct  69   KIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVR  128

Query  54   LENVNIRALHSQAKILG  4
            LE + I+++ SQAK+LG
Sbjct  129  LEKIKIKSMRSQAKVLG  145



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP+LAV+ LQFG+AG  I+ K AL+KG+++Y  V+Y +A+A I+  PFA++ +RK
Sbjct  6    LFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATIVIVPFAVIMDRK  65

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RP++T  IF+++ +L  LE V+DQNL+Y GM+ TTATFA+A+CNILPAITFV+AWI+RL
Sbjct  66   TRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIMRL  125

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK+ GT
Sbjct  126  EKVKLKSIRSQAKVFGT  142



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP++ V+ LQFGYAG  I+ K AL+KG+++Y FV+Y +  A ++ APFAL+ E+K
Sbjct  8    LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEKK  67

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+KI +L  LE V+DQNL++ GM+YTTATFA ++ N+LPAITFV+AWILRL
Sbjct  68   VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILRL  127

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK++GT
Sbjct  128  EKVKLKSIRSQAKVVGT  144



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KP++AV+LLQFGYAG  I+ K AL+KG++ Y  V+Y +A+A ++  PFA++ E+K RPK+
Sbjct  13   KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFAVILEKKVRPKM  72

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T SIFLK+  L  LE V+DQNL++ GM+YTTATFA A+ N+LPAITFV+AWIL++E + +
Sbjct  73   TLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWILKMEKIKM  132

Query  36   RALHSQAKILGT  1
            R++HSQAKI+GT
Sbjct  133  RSVHSQAKIVGT  144



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L   KP+L V+ LQFGYAG SII K+ALD+G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LNTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VNIR +HSQAKILGT
Sbjct  123  KVNIRKIHSQAKILGT  138



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KP++AV+LLQFGYAG  I+ K AL+KG++ Y  V+Y +A+A ++  PFA++ E+K RPK+
Sbjct  13   KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFAVILEKKVRPKM  72

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T SIFLK+  L  LE V+DQNL++ GM+YTTATFA A+ N+LPAITFV+AWIL++E + +
Sbjct  73   TLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWILKMEKIKM  132

Query  36   RALHSQAKILGT  1
            R++HSQAKI+GT
Sbjct  133  RSVHSQAKIVGT  144



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP++ V+ LQFGYAG  I+ K AL+KG+++Y FV+Y +  A ++ APFAL+ E+K
Sbjct  8    LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEKK  67

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+KI +L  LE V+DQNL++ GM+YTTATFA ++ N+LPAITFV+AWILRL
Sbjct  68   VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILRL  127

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK++GT
Sbjct  128  EKVKLKSIRSQAKVVGT  144



>ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis]
 gb|KDO80699.1| hypothetical protein CISIN_1g016580mg [Citrus sinensis]
Length=387

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L + KPYLA+I LQFGYAG  II   +L  G++HY   +Y + +A I+ APFA + ERK 
Sbjct  14   LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  +FL+I  LGFLE VLDQNL+Y GM+YTTATFASA  NILPA+TF+LA I RLE
Sbjct  74   RPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAIIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN+R L S AK++GT
Sbjct  134  TVNVRRLQSLAKVIGT  149



>ref|XP_007009429.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18239.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=436

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 8/150 (5%)
 Frame = -3

Query  450  RKNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAG  271
              + SM NK++        PYLA++ ++FG AG  I+ K+AL++G++ +  V+Y  AIA 
Sbjct  2    EASASMYNKAM--------PYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIAT  53

Query  270  ILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNIL  91
            ++FAPFA++F+RK RPK+T S+F++I LLG LE  +DQNL+Y G++YTTAT A+ALCN+L
Sbjct  54   LVFAPFAIVFDRKVRPKMTFSVFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVL  113

Query  90   PAITFVLAWILRLENVNIRALHSQAKILGT  1
            PA  F+LAW  RLE V++R LH QAKILGT
Sbjct  114  PAFVFLLAWACRLEKVDMRKLHCQAKILGT  143



>ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
 gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
Length=387

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L + KPYLA+I LQFGYAG  II   +L  G++HY   +Y + +A I+ APFA + ERK 
Sbjct  14   LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  +FL+I  LGFLE VLDQNL+Y GM+YTTATFASA  NILPA+TF+LA I RLE
Sbjct  74   RPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAIIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN+R L S AK++GT
Sbjct  134  TVNVRRLQSLAKVIGT  149



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L + KP+L VI LQFGYAG SII K+ALD+G++ +    Y + +A +  APFA   +RK 
Sbjct  3    LNKWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLASYRHIVATLFIAPFAYFLDRKV  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYMGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
            NVN++ +HSQAKILGT
Sbjct  123  NVNVKKIHSQAKILGT  138



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L + KPY A I LQ G AG  I+ K AL++G+++Y  V+Y +AIA ++ APFA++ E+K 
Sbjct  4    LGKFKPYFAAIFLQVGLAGMDILSKAALNQGMSNYVLVVYRHAIATLVMAPFAVILEKKV  63

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T SIF+KI LL  LE V+DQNL+Y GM+YTTATFA+A+ NILPAITF++AWILRLE
Sbjct  64   RPKMTISIFIKIMLLSLLEPVIDQNLYYVGMKYTTATFAAAMYNILPAITFLMAWILRLE  123

Query  48   NVNIRALHSQAKILGT  1
             VN R++ S AK+ GT
Sbjct  124  KVNFRSIRSHAKVFGT  139



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L   KP+L V+ LQFGYAG SII K+ALD+G++ +    Y + +A +  APFA   +RK 
Sbjct  3    LNTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATVFIAPFAFFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VNIR +HSQAKILGT
Sbjct  123  KVNIRKIHSQAKILGT  138



>ref|XP_008233580.1| PREDICTED: WAT1-related protein At2g39510-like [Prunus mume]
Length=378

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +SL NL++ +K  LAV LLQ  YAG +IIV+ A+++G++HY F++Y  A A +L APFAL
Sbjct  2    ESLANLIRPAKLILAVALLQGAYAGQAIIVRMAMNQGMSHYIFLVYRMAFATVLIAPFAL  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + +RK RPK+T SI +K  LL   + VLDQNL+Y    Y+TATF SA+ NILPAI F +A
Sbjct  62   ILDRKLRPKMTSSILVKTMLLSLFDPVLDQNLYYMATSYSTATFTSAMFNILPAIAFFMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI RLE VNIR LHSQAK+LGT
Sbjct  122  WIFRLETVNIRKLHSQAKVLGT  143



>emb|CDY04680.1| BnaC05g17180D [Brassica napus]
Length=396

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K   +L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA ++ APF
Sbjct  3    SEKMWGSLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>ref|XP_008463490.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=376

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             +L Q++PY+AVIL QF  AG  II K+AL++G+N +  V+Y   IA I+ APFA +FER
Sbjct  6    GMLSQARPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RP++T SIF K+ LLG LE  LDQNL+Y GM+YTTATFASA+ N+ P + F++AW +R
Sbjct  66   KVRPRMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMTPGLVFLMAWAVR  125

Query  54   LENVNIRALHSQAKILGT  1
            LE V++R L SQAKILGT
Sbjct  126  LEIVDVRQLSSQAKILGT  143



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N ++++KP++AV+ LQFGYA   ++ K AL++G+++Y FV+Y +A+A I+  PFAL F+R
Sbjct  9    NWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFALYFDR  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF+KI LL  LE V+DQNL++ GM+YTTATFA+A+ N+LPAITF+LA I+R
Sbjct  69   KIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVR  128

Query  54   LENVNIRALHSQAKILGT  1
            LE + I+++ SQAK+LGT
Sbjct  129  LEKIKIKSMRSQAKVLGT  146



>emb|CDY01310.1| BnaA07g10830D [Brassica napus]
Length=388

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA ++  PF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIVPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>ref|XP_011069552.1| PREDICTED: WAT1-related protein At1g21890-like [Sesamum indicum]
Length=384

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KPYLA++ LQFGYAG  II   +L +G +H+  V+Y +A+A ++FAPFA   E+K RPK+
Sbjct  18   KPYLAMVALQFGYAGMYIITLVSLKRGFSHWILVVYRHAVATLVFAPFAYFLEKKIRPKM  77

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T SIFLKI +L FLE VLDQNL+Y GMQYT+ATFASA+ N+LPAITF++A I RLE +N+
Sbjct  78   TKSIFLKIVVLAFLEPVLDQNLYYVGMQYTSATFASAMVNVLPAITFIMAVIFRLETINL  137

Query  36   RALHSQAKILGT  1
            + + S AK++GT
Sbjct  138  KKISSIAKVVGT  149



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP+L V+ LQFGYAG SII K+AL++G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LKTWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN+R +HSQAKILGT
Sbjct  123  KVNVRKIHSQAKILGT  138



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L   KP+L V+ LQFGYAG SII K+ALD+G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LNTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF +I LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFEILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VNIR +HSQAKILGT
Sbjct  123  KVNIRKIHSQAKILGT  138



>ref|XP_011027560.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=391

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ KPYLA++ LQFGYAG  II   +L  G++HY   +Y + +A I+ APFA + ERK 
Sbjct  14   LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFAFVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  IFL+I  LGFLE VLDQNL+Y GM+YT+ATFASA  N LPAITF++A I RLE
Sbjct  74   RPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN + LHS AK++GT
Sbjct  134  TVNFKKLHSAAKVVGT  149



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP++ V+ LQFGYAG SII K+AL++G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LKTWKPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLASYRHIVATIFIAPFAYFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T SIF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLSIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HSQAKILGT
Sbjct  123  KVNVKKIHSQAKILGT  138



>ref|XP_010669710.1| PREDICTED: WAT1-related protein At4g08300-like [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  KS+ + L ++K YLA+I LQFGY+G  I+    L +G+NHY   +Y +  A +  AP
Sbjct  1    MGIKSISDSLVKAKAYLAIISLQFGYSGMYIVTAVCLKRGMNHYILSVYRHVFATLAIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FAL+FERK R K+T S+FLKI +L FLE VLDQNL+Y G+QYT+AT  SA  NILPAITF
Sbjct  61   FALIFERKTRSKMTLSVFLKIMVLAFLEPVLDQNLYYVGLQYTSATLTSASVNILPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A I RLE V+IR L SQAKI+GT
Sbjct  121  IMATIFRLEKVDIRKLPSQAKIIGT  145



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L+  KP+L V+ LQFGYAG SII K+AL++G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LETWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAFFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN+R +HSQAKILGT
Sbjct  123  KVNVRKIHSQAKILGT  138



>ref|XP_010498646.1| PREDICTED: WAT1-related protein At1g21890-like [Camelina sativa]
Length=393

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>ref|XP_010459911.1| PREDICTED: WAT1-related protein At1g21890 [Camelina sativa]
Length=393

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>ref|XP_006416254.1| hypothetical protein EUTSA_v10007890mg [Eutrema salsugineum]
 gb|ESQ34607.1| hypothetical protein EUTSA_v10007890mg [Eutrema salsugineum]
Length=387

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+ + KPYLA+I +QFGYAG  II   +L+ G+NHY   +Y +AIA ++ APFAL  ER
Sbjct  4    GLMNRVKPYLAMISMQFGYAGMYIITMVSLNHGMNHYILAVYRHAIATVVIAPFALFHER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA I R
Sbjct  64   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMSYTSATFASATANVLPAITFVLAIIFR  123

Query  54   LENVNIRALHSQAKILGT  1
            LE++N + + S AK++GT
Sbjct  124  LESLNFKKVRSIAKVVGT  141



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L+++SKPY+A+I LQFGYAG +II K +L++G+NH+  V+Y +A A ++ APFA   ERK
Sbjct  4    LIERSKPYVAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFIERK  63

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPKLT SIF +IF+LG L  V+DQN +Y G++ T+ T+A AL N+LPA+TFV+A + R+
Sbjct  64   VRPKLTFSIFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRM  123

Query  51   ENVNIRALHSQAKILGT  1
            ENVNI+ L SQAKI+GT
Sbjct  124  ENVNIKKLRSQAKIVGT  140



>gb|EYU23896.1| hypothetical protein MIMGU_mgv1a008243mg [Erythranthe guttata]
Length=380

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             +  + KPYLA+I LQFGYAG  I+   +  +G +H+ FV+Y +A+A ++FAPFA   E+
Sbjct  5    GVFNKMKPYLAMIFLQFGYAGMYIVTLVSFKRGFSHWVFVVYRHAVATLVFAPFAFFLEK  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            KRRPK+T SIF KI +L FLE VLDQNL+  G+QYT+ATFASA  N+LPAITF++A I R
Sbjct  65   KRRPKMTISIFFKIMVLAFLEPVLDQNLYGVGIQYTSATFASATVNVLPAITFIMALIFR  124

Query  54   LENVNIRALHSQAKILGT  1
            LE VN++ ++S AK++GT
Sbjct  125  LEKVNLKKMYSLAKVIGT  142



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFE-RK  232
            LK  KP+L VI LQFGYAG SII K+ALD+G++ +    Y + +A I  APFA   + RK
Sbjct  3    LKTWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRK  62

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RL
Sbjct  63   VRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRL  122

Query  51   ENVNIRALHSQAKILGT  1
            E VNIR +HSQAKILGT
Sbjct  123  EKVNIRKIHSQAKILGT  139



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP++ V+ LQFGYAG  I+ K AL+KG+++Y FV+Y +  A ++ APFAL+ E+K
Sbjct  8    LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVTAPFALILEKK  67

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+KI +L  LE V+DQNL++ GM+YTTATFA ++ N+LPAITFV+AWI RL
Sbjct  68   VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIFRL  127

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK++GT
Sbjct  128  EKVKLKSIRSQAKVVGT  144



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP+L V+ LQFGYAG SII K+AL++G++ +    Y +  A I  APFA   +RK 
Sbjct  3    LKTWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIFATIFIAPFAYFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN+R +HSQAKILGT
Sbjct  123  KVNVRKIHSQAKILGT  138



>ref|XP_010477438.1| PREDICTED: WAT1-related protein At1g21890-like [Camelina sativa]
Length=393

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S K    L+ + KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APF
Sbjct  3    SEKMWGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL  ERK RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFV
Sbjct  63   ALFHERKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            LA I RLE+VN + + S AK++GT
Sbjct  123  LAIIFRLESVNFKKVRSIAKVVGT  146



>gb|KHG29659.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L ++KPYL +  LQFG+AG  +I   +L  G+NHY   +Y + +A I+ APFAL+ ERK 
Sbjct  9    LNKAKPYLTMTSLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVLERKI  68

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  IFL+I +LGFLE V+DQNL+Y GM+YTTAT ASA  N++PAITFVLA I RLE
Sbjct  69   RPKLTVPIFLRILVLGFLEPVIDQNLYYLGMKYTTATLASATVNVIPAITFVLALIFRLE  128

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HS AKI+GT
Sbjct  129  KVNLKKVHSIAKIIGT  144



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L  + KP+LAV+ LQFG AG  I+ K AL+KG+++Y  V+Y NA+A I+ APFA++ ER
Sbjct  5    TLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMER  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RP++T  IF+++ +L  LE V+DQNL+Y GM+ TTATFA+A+CNILPAI  V+AWI+ 
Sbjct  65   KTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMG  124

Query  54   LENVNIRALHSQAKILGT  1
            LE V ++++ SQAK+ GT
Sbjct  125  LETVKMKSIRSQAKVFGT  142



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP+LAV+ LQFG AG  I+ K AL+KG+++Y  V+Y NA+A I+ APFA++ +RK
Sbjct  6    LFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMDRK  65

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
            +RP++T  IF+++ +L  LE V+DQNL+Y GM+ TTATFA+A+CNILPAI  V+AWI+ L
Sbjct  66   KRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMGL  125

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK+ GT
Sbjct  126  ETVKMKSIRSQAKVFGT  142



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK  KP++ V+ LQFGYAG SII K+AL++G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LKTWKPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HSQAKILGT
Sbjct  123  KVNVKKIHSQAKILGT  138



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP++ V+ LQFGYAG  ++ K AL+KG+++Y FV+Y +  A ++ APFAL+ E+K
Sbjct  8    LFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVTAPFALILEKK  67

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+KI +L  LE V+DQNL++ GM+YTTATFA ++ N+LPAITFV+AWI RL
Sbjct  68   VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIFRL  127

Query  51   ENVNIRALHSQAKILGT  1
            E V ++++ SQAK++GT
Sbjct  128  EKVKLKSIRSQAKVVGT  144



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -3

Query  441  RSMSNKSLVNL--LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            RS+S   +V++    ++KP++AVI LQ G+AG  I+ K AL++G+++Y  V+Y +A+A +
Sbjct  57   RSLSLSCVVDMNSFDRAKPFVAVIFLQVGFAGMDILSKAALNQGMSNYVLVVYRHAVATV  116

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
            + APFA + ++K RPK+T SIF+K+  L  LE V+DQNL++ GM+YTTATFA+A+ N+LP
Sbjct  117  VIAPFAAILDKKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLP  176

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            AITF++AWI+RLE V I +LHSQAK+ GT
Sbjct  177  AITFIIAWIVRLEKVKIGSLHSQAKLAGT  205



>gb|KDO67717.1| hypothetical protein CISIN_1g045242mg, partial [Citrus sinensis]
Length=243

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S      ++KP+LAVILLQFGYAG SI  K+AL+KG++ + F +Y +A+A I+ APFAL
Sbjct  2    ESFARFYIRAKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFAL  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + +RK RPK+T SIF+KI LLG LE  +DQNLFY GM+YTTATF +A+ N+LPA  F++A
Sbjct  62   ILDRKVRPKMTLSIFVKILLLGLLEPTIDQNLFYTGMKYTTATFTTAMANVLPAFAFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI+RLE VN R  HS AK+ GT
Sbjct  122  WIIRLEKVNFRKFHSWAKVFGT  143



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFE-RK  232
            LK  KP+L VI LQFGYAG SII K+ALD+G++ +    Y + +A I  APFA   + RK
Sbjct  3    LKTWKPFLIVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRK  62

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RL
Sbjct  63   VRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRL  122

Query  51   ENVNIRALHSQAKILGT  1
            E VNIR +HSQAKILGT
Sbjct  123  EKVNIRKVHSQAKILGT  139



>ref|XP_007009431.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18241.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  429  NKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFA  250
              SL  L   +KP+LAVIL+QFGYA  SII K+AL++G++ +  V Y  A+A  L APFA
Sbjct  2    ESSLPQLFNNAKPFLAVILVQFGYAVMSIIAKFALNQGMSPHVLVAYRMAVASALIAPFA  61

Query  249  LLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVL  70
            ++ ERK RPK+T +IF KI L+   E VLD NL+Y G++YTTATF +A+CN+LP  TF +
Sbjct  62   IVLERKSRPKMTLTIFAKIMLISLFEPVLDHNLYYTGLKYTTATFTTAMCNMLPTFTFAM  121

Query  69   AWILRLENVNIRALHSQAKILGT  1
            A I +LE V IR +HSQAK++GT
Sbjct  122  ACIFKLERVEIRRVHSQAKVVGT  144



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L  +  + KP++A++ LQFGYAG  I+    L +G++HY   +Y +A A +  APFAL F
Sbjct  11   LCTIFNKVKPFMAMVSLQFGYAGMYIVTMLCLRRGMSHYVLAVYRHAAATLAIAPFALFF  70

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RPK+T S+FLKI +L FLE VLDQNL+Y GM+ T+ATF+SA+ N+LP ITF++A I
Sbjct  71   ERKIRPKMTVSVFLKIMVLAFLEPVLDQNLYYVGMKSTSATFSSAIFNVLPGITFIMAII  130

Query  60   LRLENVNIRALHSQAKILGT  1
             RLE+V I+ +HSQAKI+GT
Sbjct  131  FRLEHVKIKKIHSQAKIIGT  150



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KPYLAV+LLQFG+AG +II K++L++G+N + FV+Y +A A  + APFA+LFERK RPK+
Sbjct  7    KPYLAVVLLQFGFAGMAIITKFSLNRGMNQHVFVVYRHAFATAVVAPFAILFERKTRPKM  66

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T S+FLKI LLG LE V+DQNL+Y GM+YTTA+F +A+ N+LPA  F++AW  RLE ++I
Sbjct  67   TRSVFLKILLLGLLEPVIDQNLYYTGMKYTTASFTAAMSNMLPAFAFLMAWFFRLERLSI  126

Query  36   RALHSQAKILGT  1
            R+ HSQAKILGT
Sbjct  127  RSKHSQAKILGT  138



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L+  KP+L V+ LQFGYAG SII K+AL++G++ +    Y + +A I  APFA   +RK 
Sbjct  3    LETWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE  +DQNL+Y GM+YT+ATF +A+ N+LPA  F++AWI RLE
Sbjct  63   RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HSQAKILGT
Sbjct  123  KVNVKKIHSQAKILGT  138



>ref|XP_002893187.1| T26F17.11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69446.1| T26F17.11 [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APFAL  ER
Sbjct  4    GLMNSVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATAVIAPFALFHER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA I R
Sbjct  64   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIFR  123

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK++GT
Sbjct  124  LESVNFKKVRSIAKVVGT  141



>ref|NP_173607.1| WAT1-related protein [Arabidopsis thaliana]
 sp|F4HZQ7.1|WTR5_ARATH RecName: Full=WAT1-related protein At1g21890 [Arabidopsis thaliana]
 gb|AEE30169.1| WAT1-related protein [Arabidopsis thaliana]
Length=389

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APFAL  ER
Sbjct  4    GLMNSLKPYLAMISMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATAVIAPFALFHER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA I R
Sbjct  64   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIFR  123

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK++GT
Sbjct  124  LESVNFKKVRSIAKVVGT  141



>ref|XP_010682440.1| PREDICTED: WAT1-related protein At4g08300-like [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  KS+   L  +K YLA+I LQFGY+G  II    L KG+NHY   +Y +  A +  AP
Sbjct  1    MGIKSISKGLITAKAYLAIIALQFGYSGMHIITAVCLKKGMNHYILSVYRHVFATLAIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FAL+FERK R K+T SIFLKI +L FLE VLDQNL+Y G+QYT+A+  SA  NILPAITF
Sbjct  61   FALIFERKTRSKMTLSIFLKIMVLAFLEPVLDQNLYYVGLQYTSASITSASVNILPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A I RLE V+IR + SQAKI+GT
Sbjct  121  IMATIFRLEKVDIRKIPSQAKIIGT  145



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  QSKP+LAVI LQ G AG  I+ K AL+ G+++Y  V+Y +A+A I+  PFAL F++K
Sbjct  7    LYNQSKPFLAVIFLQVGLAGMDILSKVALNHGMSNYVLVVYRHAVATIVITPFALFFDKK  66

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+K+ LL  LE V+DQNL+Y GM+YT+ATFA+ + N+LPAITFV+AWILRL
Sbjct  67   VRPKMTLSIFIKLLLLSLLEPVIDQNLYYMGMKYTSATFAATMVNVLPAITFVMAWILRL  126

Query  51   ENVNIRALHSQAKILGT  1
            E V  R++ SQAKI+GT
Sbjct  127  ERVKCRSIRSQAKIVGT  143



>gb|KHG11891.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            MS KS  +   Q+ PY+A++L++FG AG  I+ KYAL++G++ +  V+Y   IA ++ AP
Sbjct  1    MSLKSSASFYNQALPYVAMVLMRFGSAGMPIVAKYALNRGMSQHVLVVYRFIIATLVLAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++F+RK RPK+T S+F++I LLG LE  +DQNL+Y G++YTTAT A+AL N+LPA  F
Sbjct  61   FAIVFDRKVRPKMTLSVFVQIALLGLLEPAIDQNLYYTGIKYTTATVATALSNVLPAFVF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            +LAW+ RLE V++R +  QAKILGT
Sbjct  121  LLAWVCRLEKVDVRKVKCQAKILGT  145



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L ++K Y A+I LQFG+AG  +I  ++L +G+NHY   +Y + +A I+ APFAL+ ERK 
Sbjct  14   LTRAKSYSAMIFLQFGFAGMYVITMFSLQQGMNHYILAVYRHLVATIVIAPFALVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  +FL+I +LGFLE V+DQN++Y GM+YTTAT ASA  N+LPAITFV+A I RLE
Sbjct  74   RPKLTLPVFLRILVLGFLEPVIDQNVYYLGMKYTTATLASATVNVLPAITFVMALIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HS AKI+GT
Sbjct  134  RVNLKKVHSIAKIIGT  149



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +  V  L  +KPY  V+ +Q G AG +II K+AL+KG++ Y FV Y   IA ++ APFA+
Sbjct  2    EGFVRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATLIMAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI +LG LE V+D NL++ GM+YTTATFA A+CN+LPA  F++A
Sbjct  62   IFERKVRTKMTISLVFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE VNIR   SQAKI+GT
Sbjct  122  WACRLEKVNIRKRGSQAKIVGT  143



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KP++AV+ LQFGYAG  ++ K AL+KG+++Y  V+Y +A+A I+ APFAL+ E+K RPK+
Sbjct  13   KPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALILEKKVRPKM  72

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T SIF+K+  L  LE V+DQNL++ GM+YTTATFA A+ N+LPAITFV+A IL+LE + +
Sbjct  73   TFSIFMKLVTLAVLEPVIDQNLYFLGMKYTTATFAVAMINVLPAITFVMACILKLEKIKM  132

Query  36   RALHSQAKILGT  1
            ++ HSQAK++GT
Sbjct  133  KSTHSQAKVVGT  144



>ref|XP_004494996.1| PREDICTED: WAT1-related protein At2g37460-like isoform X3 [Cicer 
arietinum]
Length=271

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N +++  P++AV+ LQFGYA   ++ K AL+KG+++Y FV+Y +A+A I+  PFAL F++
Sbjct  12   NCIEKIMPFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIVVTPFALYFDK  71

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF+KI  L  LE V+DQNL++ GM++TTATFA+++ NILPAITF+LA ILR
Sbjct  72   KVRPKMTISIFIKIVALSLLEPVIDQNLYFLGMKFTTATFAASMSNILPAITFILASILR  131

Query  54   LENVNIRALHSQAKILGT  1
            +E + IR++ +QAK++GT
Sbjct  132  IEKIKIRSIRTQAKVVGT  149



>ref|XP_004290852.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=368

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ KPYLA++ LQFGYAG  II   +   G++H+   +Y + +A  + APFAL+ ERK 
Sbjct  15   LKKIKPYLAMVSLQFGYAGMYIISMVSFKHGMSHFVLSVYRHVVALCVIAPFALVLERKI  74

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RP++T  IFL+I LLGFLE VLDQNL++ GM+YT+ATFASA+ N+LPAITF+LA   RLE
Sbjct  75   RPRMTLPIFLRIMLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFILALCFRLE  134

Query  48   NVNIRALHSQAKILGT  1
             VN++ LHS AK++GT
Sbjct  135  TVNVKKLHSLAKVIGT  150



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +SL     ++KP+LAVILLQFGYAG SI  K+AL+KG++ + F +Y +A+A I+ APFAL
Sbjct  2    ESLARFYIRAKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFAL  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + +RK RPK+T SIF+KI LLG LE  +DQNLFY GM+YTTATF +A+ N+LPA  F++A
Sbjct  62   ILDRKVRPKMTLSIFVKILLLGLLEPTIDQNLFYTGMKYTTATFTTAMANVLPAFAFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WI+RLE VN R  HS AK+ GT
Sbjct  122  WIIRLEKVNFRKFHSWAKVFGT  143



>ref|XP_011019905.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Populus 
euphratica]
Length=313

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = -3

Query  417  VNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFE  238
            +N   ++KP++AV+ LQ G AG  I+ K AL++G+++Y  V+Y +A+A ++ APFA + +
Sbjct  1    MNSFDRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILD  60

Query  237  RKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWIL  58
            +K RPK+T SIF+K+  L  LE V+DQNL++ GM+YTTATFA+A+ N+LPAITF++AWI+
Sbjct  61   KKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIV  120

Query  57   RLENVNIRALHSQAKILGT  1
            RLE V I +LHSQAK+ GT
Sbjct  121  RLEKVKIGSLHSQAKVAGT  139



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ KPYLA++ LQFGYAG  II   +L+ G+NHY   +Y + +A +L APFA + ERK 
Sbjct  11   LKKVKPYLAMVSLQFGYAGMYIITLVSLNHGMNHYVLAVYRHVVATLLIAPFAFVLERKI  70

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  IFL+I  LGFLE VLDQNL+Y GM+ T+ATFASA  NILPAITF++A   RLE
Sbjct  71   RPKLTLPIFLRIMALGFLEPVLDQNLYYVGMKSTSATFASATVNILPAITFIMALAFRLE  130

Query  48   NVNIRALHSQAKILGT  1
             VN++ + S +K++GT
Sbjct  131  KVNVKKIQSLSKVIGT  146



>ref|XP_010064999.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
Length=381

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            + N++  + LK++KPYLA++ LQFGYAG +II   +L+ G+NHY   +Y   +A +L AP
Sbjct  2    VENRAFWSGLKKAKPYLAMVSLQFGYAGMNIITLVSLNHGMNHYVLAVYRYVVATLLIAP  61

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA + ERKRRPKLT  IFL+I  LGFLE VLDQNL+  GM+ T+ATFASA  N LPAITF
Sbjct  62   FAFVLERKRRPKLTLPIFLRIMALGFLEPVLDQNLYCVGMKSTSATFASATINDLPAITF  121

Query  75   VLAWILRLENVNIRALHSQAKILG  4
            ++A   RLE VN++ + S AK++G
Sbjct  122  IMALTFRLEKVNVKKIQSLAKVIG  145



>gb|KHG29332.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L ++KPYL++I LQFG+AG  +I   +L  G+NHY   +Y + +A I+ APFAL+ ERK 
Sbjct  7    LNKAKPYLSMISLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVLERKI  66

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT  I L+I +LGFLE V+DQNL+Y GM+YTTAT ASA  N++PAITFV+A I RLE
Sbjct  67   RPKLTLPILLRILVLGFLEPVVDQNLYYLGMKYTTATLASATVNVIPAITFVMALIFRLE  126

Query  48   NVNIRALHSQAKILGT  1
             V ++ +HS AKI+GT
Sbjct  127  KVKLKKVHSIAKIIGT  142



>gb|ACU18786.1| unknown [Glycine max]
Length=179

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L++ KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A I+  PFAL+ ERK 
Sbjct  14   LRKVKPYLAILSLQFGYSGMYIITMVSFKHGMSHWILSVYRHVVAAIIIVPFALVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFL+I  LGFLE VLDQNL+  GM+ T+ TFASA  N+LPAITFV+A + RLE
Sbjct  74   RPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTSTTFASATVNVLPAITFVMALVFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN+R  HS AK++GT
Sbjct  134  KVNLRKFHSVAKVIGT  149



>ref|XP_008346651.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=395

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +AIA  + APFA  FER
Sbjct  9    SFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFFER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K++PK+T S+F++IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFVLA I R
Sbjct  69   KKQPKMTFSMFIQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVIFR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E ++I+ +  QAK+LGT
Sbjct  129  MEVLDIKKVRCQAKVLGT  146



>ref|XP_008375333.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=392

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M      + L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +AIA  + AP
Sbjct  1    MEKAGFGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA  FERK++PK+T S+F++IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TF
Sbjct  61   FAFFFERKKQPKMTFSMFMQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            VLA I R+E ++I+ +  QAK++GT
Sbjct  121  VLAVICRMEVLDIKKVRCQAKVIGT  145



>ref|XP_006339335.1| PREDICTED: WAT1-related protein At5g07050-like, partial [Solanum 
tuberosum]
Length=358

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +  ++SKPY+A+I LQFGYAG +II K +L++G++HY  V+Y NA A I+ APFAL+ ER
Sbjct  11   SFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATIVIAPFALILER  70

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  +FL+IF+LG L  V+DQN +YAG++ T+ TF+ A+ N+LPA+TFV+A + R
Sbjct  71   KIRPKMTLMMFLQIFVLGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVMAVLCR  130

Query  54   LENVNIRALHSQAKILGT  1
            +E V+I+ +  QAK+LGT
Sbjct  131  MEKVDIKKIRCQAKVLGT  148



>ref|XP_007009430.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18240.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=394

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 110/150 (73%), Gaps = 8/150 (5%)
 Frame = -3

Query  450  RKNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAG  271
              + SM NK++        PYLA++ ++FG AG  I+ K+AL++G++ +  V+Y  AIA 
Sbjct  2    ESSGSMYNKAM--------PYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIAT  53

Query  270  ILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNIL  91
            ++ APFA++F+RK RPK+T SIF++I LLG LE  +DQNL+Y G++YTTAT A+ALCN+L
Sbjct  54   LVLAPFAIVFDRKVRPKMTFSIFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVL  113

Query  90   PAITFVLAWILRLENVNIRALHSQAKILGT  1
            PA  F+LA   RLE V++R LH QAKILGT
Sbjct  114  PAFVFLLALACRLEKVDMRKLHCQAKILGT  143



>ref|XP_002436678.1| hypothetical protein SORBIDRAFT_10g006950 [Sorghum bicolor]
 gb|EER88045.1| hypothetical protein SORBIDRAFT_10g006950 [Sorghum bicolor]
Length=395

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA++LLQ G++G  I+   +L +G+NH+  V+Y N +A ++ APFAL+FER
Sbjct  5    KLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFALIFER  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
              RPK+TP IFLKI  L  LE VLDQN++Y G + T+ATF SAL NILPAITF+LA ++R
Sbjct  65   GVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFGSALVNILPAITFLLALVMR  124

Query  54   LENVNIRALHSQAKILGT  1
            +E + +R+LHSQAK++GT
Sbjct  125  MEKLRLRSLHSQAKVVGT  142



>ref|XP_002274909.2| PREDICTED: WAT1-related protein At2g37460-like [Vitis vinifera]
Length=396

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            +S+KS   LL + KP+LAV  LQFG+AG  +  K AL++GV++Y  V+Y +AIA    AP
Sbjct  5    ISSKSTYRLLYRVKPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAFIAP  64

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA++ ++K RPK+T SIF K+ LL  LE V+DQNL+Y G++YTTATFA+A+ NILPAITF
Sbjct  65   FAVILDKKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITF  124

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A I  LE V ++++HSQAK++GT
Sbjct  125  LMACIFGLEKVTLKSIHSQAKVVGT  149



>ref|XP_011019904.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Populus 
euphratica]
Length=348

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = -3

Query  417  VNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFE  238
            +N   ++KP++AV+ LQ G AG  I+ K AL++G+++Y  V+Y +A+A ++ APFA + +
Sbjct  1    MNSFDRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILD  60

Query  237  RKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWIL  58
            +K RPK+T SIF+K+  L  LE V+DQNL++ GM+YTTATFA+A+ N+LPAITF++AWI+
Sbjct  61   KKLRPKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIV  120

Query  57   RLENVNIRALHSQAKILGT  1
            RLE V I +LHSQAK+ GT
Sbjct  121  RLEKVKIGSLHSQAKVAGT  139



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            L  + KP++ V+ LQFGYAG  ++ K AL+KG+++Y FV+Y +  A ++ APFA+  E+K
Sbjct  8    LFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVMAPFAVFLEKK  67

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T SIF+K+ +L  LE V+DQNL++ GM+YTTATFA ++ N+LPAITF++AWILRL
Sbjct  68   VRPKMTFSIFMKLVILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFLMAWILRL  127

Query  51   ENVNIRALHSQAKILGT  1
            E + ++++ SQAK++GT
Sbjct  128  EKIKLKSIRSQAKVVGT  144



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +L +++KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +  APFAL+FER
Sbjct  6    DLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALIFER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S FL+IF+L  L  V+DQN +Y G++YT  TFA A+ NILPA+TFV+A+I R
Sbjct  66   KVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAFIFR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E V++R +  QAK+ GT
Sbjct  126  MEKVDLRKVRCQAKVAGT  143



>ref|XP_006655900.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=379

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L  +KPY A++LLQ G+AG  I+   +L +G+NH+  V+Y N +A +L APFALLFER  
Sbjct  7    LSDAKPYAAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLFERGV  66

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF+KI  L  LE VLDQNL+Y G + T+A FASAL NILPA+TF+LA +LR+E
Sbjct  67   RPKMTVRIFIKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRME  126

Query  48   NVNIRALHSQAKILGT  1
             V +R+LHSQAKI+GT
Sbjct  127  RVRLRSLHSQAKIVGT  142



>ref|NP_001148990.1| nodulin protein [Zea mays]
 gb|ACG33741.1| nodulin protein [Zea mays]
 gb|AFW76688.1| nodulin protein [Zea mays]
Length=383

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA++LLQ G++G  I+   +L +G+NH+  V+Y N +A ++ APFALLFER
Sbjct  5    KLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFALLFER  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            + RPK+TP IFLKI  L  LE VLDQN++Y G + T+ATFASAL NILPAITF+LA  LR
Sbjct  65   RVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFASALVNILPAITFLLALALR  124

Query  54   LENVNIRALHSQAKILGT  1
            +E + +R+L SQAK++GT
Sbjct  125  MERLRLRSLRSQAKVVGT  142



>ref|XP_007027104.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY07606.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=391

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M N      L + KPY A I LQ G +G  ++ K AL++G+++Y  V+Y +AIA ++  P
Sbjct  1    MENNQGHGSLGRFKPYFAAIFLQVGLSGMDVLSKAALNQGMSNYALVVYRHAIATVVMVP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA + ++K RP++T  IF+KI +LG LE V+DQNL+Y GM+YTTATFASA+ NILPAITF
Sbjct  61   FAAVLDKKVRPRMTLPIFIKIMVLGLLEPVIDQNLYYVGMKYTTATFASAMYNILPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+AW+LRLE VN+R++    K++GT
Sbjct  121  VMAWVLRLEKVNLRSIRGHGKVVGT  145



>ref|XP_006307681.1| hypothetical protein CARUB_v10009309mg, partial [Capsella rubella]
 gb|EOA40579.1| hypothetical protein CARUB_v10009309mg, partial [Capsella rubella]
Length=409

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              +   KPYL++I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APFAL  ER
Sbjct  25   GFMNSVKPYLSMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPFALFHER  84

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA I R
Sbjct  85   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIFR  144

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK++GT
Sbjct  145  LESVNFKKVRSIAKVVGT  162



>gb|EMS60728.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             +L   KPYLA++LLQ G+AG +I+   +L  G++H+  V+Y N +A    APFAL FER
Sbjct  6    RVLNDVKPYLAMVLLQVGFAGMNIVAVSSLKAGMSHFVLVVYRNIVATAFMAPFALYFER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            +RRPK+T +IF+KI  L FLE VLDQNL++ G + T+A FA+AL N LPA+TFVLA ILR
Sbjct  66   ERRPKMTTTIFIKIMWLAFLEPVLDQNLYFMGAKLTSAGFATALLNTLPAVTFVLALILR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E V +R+LHSQAKI GT
Sbjct  126  MEKVRLRSLHSQAKIAGT  143



>ref|XP_009361913.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=396

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +AIA  + APFA  FER
Sbjct  9    SFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFFER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K++PK+T S+F++IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFVLA I R
Sbjct  69   KKQPKMTFSMFMQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVICR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E ++I+ +  QAK++GT
Sbjct  129  MEVLDIKKVRCQAKVIGT  146



>ref|XP_009151422.1| PREDICTED: WAT1-related protein At4g08290 [Brassica rapa]
Length=383

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + +  ++K  +P+L +I LQFG AG+ I++   L++G N Y  ++Y NA+A ++ APFA+
Sbjct  2    EGVSTIIKNFRPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
             FERK RPK+T S+F KI LLGFLE +LDQ   Y GM  T+AT+ SA+ N+LP++TF++A
Sbjct  62   FFERKVRPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WILR+E VNI  + SQAKI+GT
Sbjct  122  WILRMEKVNIAEVRSQAKIIGT  143



>ref|NP_001141126.1| uncharacterized protein LOC100273211 [Zea mays]
 gb|ACF85451.1| unknown [Zea mays]
 gb|AFW85362.1| hypothetical protein ZEAMMB73_886591 [Zea mays]
Length=390

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA++LLQ G++G  I+   +L +G+NH+  V+Y N +A ++ APFALLFER
Sbjct  5    KLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVLAPFALLFER  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            + RPK+TP IFLKI  L  LE VLDQN++Y G + T+ATFASAL NILPAITF++A +LR
Sbjct  65   RVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFASALVNILPAITFLMALVLR  124

Query  54   LENVNIRALHSQAKILGT  1
            +E + +R+L SQAK+ GT
Sbjct  125  MERLRLRSLRSQAKVAGT  142



>ref|XP_006364778.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=382

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  KNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            +N  +    L N  ++ KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +
Sbjct  2    ENNKVGGGCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATL  61

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
              APFALL ERK RPK+T  +FL+IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LP
Sbjct  62   AIAPFALLLERKLRPKMTFMMFLQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLP  121

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            A+TFV+A + R+E V+I+ L  QAK++GT
Sbjct  122  AMTFVMAVLCRMEKVHIKKLRCQAKVIGT  150



>ref|XP_010421738.1| PREDICTED: WAT1-related protein At4g08290 [Camelina sativa]
Length=386

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +++ +PY  +I LQFG AG+ I++   L++G N Y F++Y N +A ++ APFAL+FERK 
Sbjct  8    MQKCRPYFLMIFLQFGAAGAYIVIMATLNQGQNRYVFIVYRNLVAALVLAPFALIFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+F KI  LGFLE VLDQ   Y GM  T+AT+ASA+ NILP++TF++AWILR+E
Sbjct  68   RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRME  127

Query  48   NVNIRALHSQAKILGT  1
             VNI  + S+AKI+GT
Sbjct  128  KVNIAEVRSKAKIIGT  143



>ref|XP_006436052.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
 ref|XP_006486061.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49292.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
Length=383

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  SKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPK  220
            +KPYL VI +QF Y+  S+I K AL++G++ Y  V Y   +A IL APFA + ERK RPK
Sbjct  14   AKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLERKTRPK  73

Query  219  LTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVN  40
            +T  IF KI L+   E V+ QNL+Y GM+YTTATF  A+CNILPA+TF++AWI RLE V 
Sbjct  74   MTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIFRLEKVK  133

Query  39   IRALHSQAKILGT  1
            I++ HSQAKILGT
Sbjct  134  IKSTHSQAKILGT  146



>ref|XP_004494995.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=314

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N +++  P++AV+ LQFGYA   ++ K AL+KG+++Y FV+Y +A+A I+  PFAL F++
Sbjct  12   NCIEKIMPFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIVVTPFALYFDK  71

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIF+KI  L  LE V+DQNL++ GM++TTATFA+++ NILPAITF+LA ILR
Sbjct  72   KVRPKMTISIFIKIVALSLLEPVIDQNLYFLGMKFTTATFAASMSNILPAITFILASILR  131

Query  54   LENVNIRALHSQAKILGT  1
            +E + IR++ +QAK++GT
Sbjct  132  IEKIKIRSIRTQAKVVGT  149



>gb|ABS52574.1| nodulin family protein [Gossypium hirsutum]
Length=385

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            +++ S  +L ++L ++KPYLA+I LQFGYAG  I+    +  G++++    Y + +A I+
Sbjct  3    DQTSSASALSDVLNKAKPYLAIISLQFGYAGMYILSTICMKHGMSNFILATYRHVVATIV  62

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFA + ERK RPK+T  IFL+I +LGFLE VLDQNL+Y GM++TTAT++SA  N+LPA
Sbjct  63   IAPFAFVLERKIRPKMTLPIFLRIVVLGFLEPVLDQNLYYLGMKFTTATYSSAFVNMLPA  122

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            +TF++A I RLE +N++ +HS AK++GT
Sbjct  123  VTFIMAMIFRLEKINLKKIHSIAKVVGT  150



>gb|EYU20823.1| hypothetical protein MIMGU_mgv1a008005mg [Erythranthe guttata]
Length=388

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N ++++KPY+A+I LQFGYAG +II K +L+ G++HY  V+Y +A A    APFALL ER
Sbjct  7    NFMEKAKPYIAMICLQFGYAGMNIITKVSLNSGMSHYVLVVYRHAFATAAIAPFALLLER  66

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T +IF+++F+LG L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TFV+A + R
Sbjct  67   KVRPKITFTIFMQLFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLCR  126

Query  54   LENVNIRALHSQAKILGT  1
            +E V+I+ +  QAK++GT
Sbjct  127  MEKVDIKKVRCQAKVIGT  144



>emb|CDY29141.1| BnaA09g53940D [Brassica napus]
Length=383

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + +  ++K  +P+L +I LQFG AG+ I++   L++G N Y  ++Y NA+A ++ APFA+
Sbjct  2    EGVSTIIKNFRPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
             FERK RPK+T S+F KI LLGFLE +LDQ   Y GM  T+AT+ SA+ N+LP++TF++A
Sbjct  62   FFERKVRPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WILR+E VNI  + SQAKI+GT
Sbjct  122  WILRMEKVNIAEVRSQAKIIGT  143



>gb|KDO67719.1| hypothetical protein CISIN_1g042257mg [Citrus sinensis]
Length=383

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  SKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPK  220
            +KPYL VI +QF Y+  S+I K AL++G++ Y  V Y   +A IL APFA + ERK RPK
Sbjct  14   AKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLERKTRPK  73

Query  219  LTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVN  40
            +T  IF KI L+   E V+ QNL+Y GM+YTTATF  A+CNILPA+TF++AWI RLE V 
Sbjct  74   MTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIFRLEKVK  133

Query  39   IRALHSQAKILGT  1
            I++ HSQAKILGT
Sbjct  134  IKSTHSQAKILGT  146



>gb|AAL38712.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAM91775.1| putative nodulin protein [Arabidopsis thaliana]
Length=389

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APFAL  ER
Sbjct  4    GLMNSLKPYLAMISMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATAVIAPFALFHER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA   R
Sbjct  64   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAINFR  123

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK++GT
Sbjct  124  LESVNFKKVRSIAKVVGT  141



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L ++KP+LA++ LQFGYAG  I+   +   G++HY   LY + +A ++ APFAL+ ERK 
Sbjct  14   LIKAKPFLAMVSLQFGYAGMYIVTMVSFKHGMSHYILALYRHIVATLVIAPFALVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFL+I +LGFLE VLDQNL+Y GM+ T+ATFASA  N+LPAITF+LA I RLE
Sbjct  74   RPKMTLPIFLRITVLGFLEPVLDQNLYYVGMKSTSATFASASVNVLPAITFILAIIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VNI+ +H  AKI+GT
Sbjct  134  KVNIKRVHDIAKIMGT  149



>ref|XP_002513792.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF48375.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=370

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  435  MSNKSLVNLLKQS----KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            M  +SL   L Q     KP++A++ LQFGYAG  II   +L +G++HY   +Y + +A +
Sbjct  1    MEEQSLCKKLCQGIIKVKPFIAIVSLQFGYAGMYIITMVSLKRGMSHYILAVYRHVVATL  60

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
            + APFAL+ ERK RPK+T  IFL+I  LGFLE VLDQN++Y G+QYT+ATFASA  N+LP
Sbjct  61   VIAPFALVLERKTRPKMTLPIFLRIAALGFLEPVLDQNMYYVGLQYTSATFASASINVLP  120

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            AITF++A + RLE VNI+ +   AK++GT
Sbjct  121  AITFIMAIVFRLERVNIKRVRDVAKVIGT  149



>ref|XP_007019027.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY16252.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=386

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  423  SLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALL  244
            +L N L + KPYLA++ LQFGYAG  II   +L  G++++    Y + +A I+ APFA +
Sbjct  9    ALSNTLNKVKPYLAMVSLQFGYAGMYIISMVSLKHGMSNFILATYRHVVATIVIAPFAFV  68

Query  243  FERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAW  64
             ERK RPK+T  IFL+I LLGFLE VLDQNL+Y GM+YTTAT+ASA  N+LPA+TF+LA 
Sbjct  69   LERKIRPKMTLPIFLRIVLLGFLEPVLDQNLYYLGMKYTTATYASAFVNMLPAVTFILAM  128

Query  63   ILRLENVNIRALHSQAKILGT  1
            I RLE +N++ + S AK++GT
Sbjct  129  IFRLEKINVKKIRSLAKVVGT  149



>dbj|BAB92246.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ13862.1| hypothetical protein OsJ_03785 [Oryza sativa Japonica Group]
Length=398

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M++      L+++KPY A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A I  AP
Sbjct  1    MASSPCGGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FALL ERK RPK+T S+FL+IF+L  L  V+DQN +YAG+++T  TFA A+ NILPA+TF
Sbjct  61   FALLLERKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+A I R+E V+++ +  QAK+ GT
Sbjct  121  VMAVIFRMEKVDLKKVRCQAKVAGT  145



>ref|XP_009370627.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=395

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFA  FER
Sbjct  9    SFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAIIAPFAFFFER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K++PK+T S+F++IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFVLA I R
Sbjct  69   KKQPKMTFSMFIQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVIFR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E ++I+ +  QAK+LGT
Sbjct  129  MEVLDIKKVRCQAKVLGT  146



>gb|EEC71658.1| hypothetical protein OsI_04113 [Oryza sativa Indica Group]
Length=398

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M++      L+++KPY A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A I  AP
Sbjct  1    MASSPCGGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FALL ERK RPK+T S+FL+IF+L  L  V+DQN +YAG+++T  TFA A+ NILPA+TF
Sbjct  61   FALLLERKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+A I R+E V+++ +  QAK+ GT
Sbjct  121  VMAVIFRMEKVDLKKVRCQAKVAGT  145



>ref|XP_011070079.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=404

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            +++KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A    APFAL+ ERK R
Sbjct  14   EKAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALILERKVR  73

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T +IF+++F+LG L  V+DQNL+YAG+++T+ TF+ A+ N+LPA+TFV+A I R+E 
Sbjct  74   PKITFTIFMQLFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICRMEK  133

Query  45   VNIRALHSQAKILGT  1
            VN++ L  QAK++GT
Sbjct  134  VNLKKLRCQAKVVGT  148



>ref|XP_004142736.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN51278.1| hypothetical protein Csa_5G512850 [Cucumis sativus]
Length=374

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            +++KPYL  I L+F  AG SII K AL++G+N    ++Y  +I  I+ APFA + +RK R
Sbjct  9    EKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDRKIR  68

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T  IF KI LLG LE V+ Q+L Y+G +YTTATFA+A+CNILPA  F++AWI R+E 
Sbjct  69   PKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICRMEK  128

Query  45   VNIRALHSQAKILGT  1
            VNIR+L SQAKILGT
Sbjct  129  VNIRSLRSQAKILGT  143



>ref|XP_002306626.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
 gb|EEE93622.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
Length=387

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ K YLA++ LQFGYAG  II   +L  G++HY   +Y + +A ++ APFA + ERK 
Sbjct  14   LKKVKHYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATLVIAPFAFVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPKLT SIFL+I +LGFLE VLDQNL+Y GM+YT+ATF+SA  N LPAITF++A   RLE
Sbjct  74   RPKLTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMALCFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN + LHS AK +GT
Sbjct  134  TVNFKKLHSAAKAIGT  149



>gb|EMT31802.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=387

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +L +++KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +  APFAL+ ER
Sbjct  6    DLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALILER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S FL+IF+L  L  V+DQN +Y G++YT  TFA A+ NILPA+TFV+A+I R
Sbjct  66   KVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAFIFR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E V++R L  QAK+ GT
Sbjct  126  MEKVDLRNLRCQAKVAGT  143



>ref|XP_010999364.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=387

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            LK+ K YLA++ LQFGYAG  II   +L  G++HY   +Y + +A ++ APFA + ERK 
Sbjct  14   LKKVKHYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVAALVIAPFAFVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T SIFL+I +LGFLE VLDQNL+Y GM+YT+ATF+SA  N LPAITF++A   RLE
Sbjct  74   RPKMTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMALCFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN + LHS AK +GT
Sbjct  134  TVNFKKLHSAAKAIGT  149



>gb|ACU17518.1| unknown [Glycine max]
Length=204

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L++ KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A I+  PFAL+ ERK 
Sbjct  14   LRKVKPYLAILSLQFGYSGMYIITMVSFKHGMSHWILSVYRHVVAAIIIVPFALVLERKI  73

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFL+I  LGFLE VLDQNL+  G++ T+ TFASA  N+LPAITFV+A I RLE
Sbjct  74   RPKMTLPIFLRIVALGFLEPVLDQNLYNMGIKMTSTTFASATVNVLPAITFVMALIFRLE  133

Query  48   NVNIRALHSQAKILGT  1
             VN+R  HS AK++GT
Sbjct  134  KVNLRKFHSVAKVIGT  149



>dbj|BAD35697.1| putative MtN21 [Oryza sativa Japonica Group]
Length=389

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L  +KPY+A++LLQ G+AG  I+   +L +G+NH+  V+Y N +A +L APFALL ER  
Sbjct  7    LSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGV  66

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFLKI  L  LE VLDQNL+Y G + T+A FASAL NILPA+TF+LA +LR+E
Sbjct  67   RPKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRME  126

Query  48   NVNIRALHSQAKILGT  1
             V +R+LHSQAKI GT
Sbjct  127  KVRLRSLHSQAKIAGT  142



>gb|EAZ00107.1| hypothetical protein OsI_22111 [Oryza sativa Indica Group]
Length=389

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L  +KPY+A++LLQ G+AG  I+   +L +G+NH+  V+Y N +A +L APFALL ER  
Sbjct  7    LSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGV  66

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFLKI  L  LE VLDQNL+Y G + T+A FASAL NILPA+TF+LA +LR+E
Sbjct  67   RPKMTVRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRME  126

Query  48   NVNIRALHSQAKILGT  1
             V +R+LHSQAKI GT
Sbjct  127  KVRLRSLHSQAKIAGT  142



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            KP++AVI +Q G AG  ++ K AL+ G+++Y  V+Y +A+A I+ APFA   ++K RPK+
Sbjct  13   KPFIAVIFMQIGLAGMDVMSKAALNGGMSNYVLVVYRHAVATIVIAPFAFFLDKKVRPKM  72

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T SIF+KI +L  LE V+DQNL++ GM+YTTATFA+A+ NILPAITFV+A I+RLE V +
Sbjct  73   TRSIFIKILVLSLLEPVIDQNLYFLGMKYTTATFAAAIINILPAITFVMACIVRLEKVKM  132

Query  36   RALHSQAKILGT  1
             +LHSQAK++GT
Sbjct  133  TSLHSQAKVVGT  144



>ref|XP_010455250.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=387

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +++ +PY+ +I LQFG AG+ I++   L++G N Y  ++Y N +A ++ APFAL+FERK 
Sbjct  8    MQKCRPYILMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+F KI  LGFLE VLDQ   Y GM  T+AT+ASA+ NILP++TF++AWILR+E
Sbjct  68   RPKMTISVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRIE  127

Query  48   NVNIRALHSQAKILGT  1
             VNI  + S+AKI+GT
Sbjct  128  KVNIVEVRSKAKIIGT  143



>ref|XP_010244423.1| PREDICTED: WAT1-related protein At5g07050 [Nelumbo nucifera]
Length=397

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N +++ KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFAL+ ER
Sbjct  6    NFIQRCKPYVAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALVLER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  +FL+IF+LG L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TFV+A + R
Sbjct  66   KVRPKMTLPVFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLCR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E ++++ +  QAK++GT
Sbjct  126  MEKIDMKKVRCQAKVVGT  143



>ref|XP_011074856.1| PREDICTED: WAT1-related protein At1g44800-like [Sesamum indicum]
Length=389

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -3

Query  459  LGSRKNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANA  280
            +GS +N   S   + N   + KPYLA+I LQFGYAG  I+   +   G +H+ FV+Y +A
Sbjct  1    MGSEQNLCASMSVVFN---KMKPYLAMISLQFGYAGMYIVTLVSFKHGFSHWIFVVYRHA  57

Query  279  IAGILFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALC  100
            IA ++FAPFA   E+K RP++T S+F KI +L FLE VLDQNL+  G+QYT+ATFA+   
Sbjct  58   IATLVFAPFAYFLEKKIRPQMTKSVFFKIMVLAFLEPVLDQNLYGVGIQYTSATFAAVSL  117

Query  99   NILPAITFVLAWILRLENVNIRALHSQAKILGT  1
            N+LPA+TF++A I RLE VN++ +HS AK++GT
Sbjct  118  NVLPAVTFIMAVIFRLEKVNLKKVHSLAKVIGT  150



>ref|XP_003601055.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|KEH34829.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=220

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            LL++ KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A I+  PFAL+ ERK
Sbjct  15   LLRKIKPYLAILSLQFGYSGMYIITMVSFKHGMSHWILSVYRHVVAAIIITPFALVLERK  74

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T  IFL+I  LGFLE VLDQNL+  GM+ T+ TFASA  N+LPAITF++A   RL
Sbjct  75   TRPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTSTTFASATVNVLPAITFIMALTFRL  134

Query  51   ENVNIRALHSQAKILGT  1
            E+VN R  HS AK++GT
Sbjct  135  ESVNWRKFHSVAKVIGT  151



>gb|KFK25097.1| hypothetical protein AALP_AA8G066000 [Arabis alpina]
Length=406

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -3

Query  438  SMSNKSLVN-LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILF  262
            SM N S  +  LK SKPY A+I LQFGYAG +II K +L+ G++HY  V+Y +AIA  + 
Sbjct  2    SMENLSGCDSFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVI  61

Query  261  APFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAI  82
            APFA  FERK +PK+T +IF+++F+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+
Sbjct  62   APFAFFFERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAM  121

Query  81   TFVLAWILRLENVNIRALHSQAKILGT  1
            TF+LA I R+E ++++ L  QAKI+GT
Sbjct  122  TFILAVIFRMEMLDVKKLWCQAKIIGT  148



>gb|EAZ36228.1| hypothetical protein OsJ_20548 [Oryza sativa Japonica Group]
Length=393

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L  +KPY+A++LLQ G+AG  I+   +L +G+NH+  V+Y N +A +L APFALL ER  
Sbjct  7    LSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGV  66

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFLKI  L  LE VLDQNL+Y G + T+A FASAL NILPA+TF+LA +LR+E
Sbjct  67   RPKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRME  126

Query  48   NVNIRALHSQAKILGT  1
             V +R+LHSQAKI GT
Sbjct  127  KVRLRSLHSQAKIAGT  142



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  KNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            +N  +    L N  ++ KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +
Sbjct  2    ENNKVGGGCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATL  61

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
              APFALL ERK RPK+T  +F +IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LP
Sbjct  62   AIAPFALLLERKLRPKMTFMMFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLP  121

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            A+TFV+A + R+E V+I+ L  QAK++GT
Sbjct  122  AMTFVMAVLCRMEKVHIKKLRCQAKVIGT  150



>gb|KFK32145.1| hypothetical protein AALP_AA6G204100 [Arabis alpina]
Length=383

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +++ +PYL +I LQFG AG+ I++   L++G N Y  ++Y NAIA ++ APFAL FERK 
Sbjct  8    IQKIRPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVIIVYRNAIAALVLAPFALFFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+F KI LLGFLE +LDQ   Y GM  T+AT+ SA+ N+LP++TFV+AWILR+E
Sbjct  68   RPKMTLSVFWKIMLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFVIAWILRME  127

Query  48   NVNIRALHSQAKILGT  1
             V I  + SQAKI GT
Sbjct  128  RVTIVEVRSQAKIAGT  143



>ref|XP_008463583.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=432

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             + +++KPYL  I L+F  AG SII K AL++G+N    ++Y  +I  I+ APFA + +R
Sbjct  67   KIFEKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDR  126

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IF KI LLG LE V+ Q+L Y+G +YTTATFA+A+CNILPA  F++AWI R
Sbjct  127  KIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICR  186

Query  54   LENVNIRALHSQAKILGT  1
            +E VNIR+L SQAKILGT
Sbjct  187  MEKVNIRSLRSQAKILGT  204



>ref|XP_006644860.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=394

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              L+++KPY A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A I  APFALL ER
Sbjct  6    GFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S+FL+IF+L  L  V+DQN +YAG+++T  TFA A+ NILPA+TFV+A I R
Sbjct  66   KVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E V+++ +  QAK+ GT
Sbjct  126  MEKVDLKKVRCQAKVAGT  143



>gb|KFK36632.1| hypothetical protein AALP_AA4G149800 [Arabis alpina]
Length=370

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +++++P++ ++LLQ G AG  I+ K  L+KG+++Y  V+Y +A+A ++ APFA+ F++K 
Sbjct  1    MEKARPFICMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAIYFDKKV  60

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IF KI LLG LE V+DQNL+Y GM+YTTATFA+A+ N+LPAITFVLA+I  LE
Sbjct  61   RPKMTMMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  120

Query  48   NVNIRALHSQAKILGT  1
             VN+R + S  KI+GT
Sbjct  121  RVNLRCIRSAGKIIGT  136



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
             N  L + +++ KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A +  APF
Sbjct  3    GNGCLGSFIQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAIAPF  62

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL+ ERK RPK+T  +F++IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFV
Sbjct  63   ALVLERKVRPKITFPMFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            +A + R+E V+I+ +  QAK++GT
Sbjct  123  MAVLCRMEKVDIKKVRCQAKVIGT  146



>ref|XP_009800321.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=399

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  +   +  +++KPY+A+I LQFGYAG +II K +L++G++HY  V+Y NA A  + AP
Sbjct  1    MEGECSCSFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATAVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FAL+ ERK RPK++  +FL+IF+LG L  V+D+N +YAG++YT+ TF+ A+ N+LPA+TF
Sbjct  61   FALILERKIRPKMSLMMFLQIFVLGLLGPVIDENFYYAGLKYTSPTFSCAMSNMLPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+A++ R+E V+++    QAK+LGT
Sbjct  121  VMAFLCRMEKVDLKKFRCQAKVLGT  145



>ref|XP_010664225.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Vitis vinifera]
Length=345

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S  S +  L + KPYL ++ LQFG AG  II    L  G++ Y  V+Y NA+A +  APF
Sbjct  5    SGNSCIVYLNKMKPYLLMVALQFGSAGMYIICMATLTHGMSRYVLVVYRNAVATLAIAPF  64

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            ALL ERK RPKLT SIFLKI  LGFLE ++DQNL Y GMQYT+A++ASA+ N +PA+TFV
Sbjct  65   ALLLERKGRPKLTFSIFLKIMALGFLEPIVDQNLSYLGMQYTSASYASAIMNAVPAVTFV  124

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            +A I RLE++ I+   +QAKI+GT
Sbjct  125  MAIIFRLEHIKIKETRTQAKIIGT  148



>ref|XP_009788498.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=389

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +  +++KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFAL+ ER
Sbjct  10   SFFQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALILER  69

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK++  +FL+IF+LG L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TFV+A I R
Sbjct  70   KIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVICR  129

Query  54   LENVNIRALHSQAKILGT  1
            +E V+I+ +  QAK+LGT
Sbjct  130  MEKVDIKKVRCQAKVLGT  147



>ref|XP_007133643.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
 gb|ESW05637.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
Length=391

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M+ +      + SKPYLA+I LQFGYAG +II K +L++G++HY  V+Y +A A I  AP
Sbjct  1    MAMEGCSKFFRSSKPYLAMISLQFGYAGMTIITKISLNQGMSHYVLVVYRHAFATIAIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA +FERK +PK+T  IF++IF+L  L  V+DQNLFYAG++ T+ TF+ A+ N+LPA+TF
Sbjct  61   FAFIFERKHQPKITFPIFMQIFILALLGPVIDQNLFYAGLKLTSPTFSCAMSNMLPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+A   R+E +NI+ + S AKI+GT
Sbjct  121  VIALFCRMEKINIKEVSSIAKIVGT  145



>ref|XP_004249327.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Solanum 
lycopersicum]
Length=393

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            + ++  K   N  ++SKPY+A+I LQFGYAG +II K +L+KG++HY  V+Y NA A ++
Sbjct  2    DGNIKGKCNCNFFQRSKPYIAMISLQFGYAGMNIITKVSLNKGMSHYVLVVYRNAFATLV  61

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFAL+ ERK RPK+T  +FL+IF+L  L  V+DQN +YAG++ T+ TF+ A+ N+LPA
Sbjct  62   IAPFALILERKIRPKMTLMMFLQIFVLSLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPA  121

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            + FV+A + R+E V+I+ +  QAK+LGT
Sbjct  122  MIFVMAVLCRMEKVDIKKIRCQAKVLGT  149



>gb|AAF16542.1|AC013482_16 T26F17.11 [Arabidopsis thaliana]
Length=391

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             L+   KPYLA+I +QFGYAG  II   +L  G+NHY   +Y +AIA  + APFAL  ER
Sbjct  4    GLMNSLKPYLAMISMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATAVIAPFALFHER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IFL+I LLGF+E VLDQNL+Y GM YT+ATFASA  N+LPAITFVLA I R
Sbjct  64   KIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIFR  123

Query  54   --LENVNIRALHSQAKILGT  1
              LE+VN + + S AK++GT
Sbjct  124  FKLESVNFKKVRSIAKVVGT  143



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            N L++ KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFALL ER
Sbjct  9    NFLQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALLLER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IF+++F+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFV+A + R
Sbjct  69   KVRPKITFPIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E V I+ +  QAK++GT
Sbjct  129  MEKVEIKKIRCQAKMVGT  146



>ref|XP_003564421.1| PREDICTED: WAT1-related protein At5g07050 [Brachypodium distachyon]
Length=392

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +  +++KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +  APFALL ER
Sbjct  6    DFFEKAKPYIAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALLLER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S FL+IF+L  L  V+DQN +YAG+++T  TFA A+ NILPA+TFV+A I R
Sbjct  66   KVRPKMTWSSFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E V+IR +  QAK+ GT
Sbjct  126  MEKVDIRKVRCQAKVAGT  143



>gb|KHG24903.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=373

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M N+   +L    KP+ A + LQ GYAG  I+ K AL+ G+++Y  V+Y +AIA ++ AP
Sbjct  1    MENQVDGSLGGTYKPFFAAVFLQVGYAGMDILSKTALNLGMSNYVLVVYRHAIATLVMAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA   ++K RPK+T  IF++I +LG LE V+DQNL++ GM+YTTATFA+A+ NILPAITF
Sbjct  61   FAAFLDKKVRPKMTMRIFIQIMVLGLLEPVIDQNLYFLGMKYTTATFATAMYNILPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+AWI RLE V +R++ S  KI+GT
Sbjct  121  VMAWIFRLEKVKLRSIRSHGKIIGT  145



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M    L   L + KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A  + AP
Sbjct  1    MGESKLSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA + ERK RP++T  IFL+I LLGFLE VLDQNL++ GM+YT+ATFASA+ N+LPAITF
Sbjct  61   FAFVLERKVRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A   RLE VN++ LHS AK++GT
Sbjct  121  IMALCFRLETVNVKKLHSLAKVIGT  145



>emb|CDX75163.1| BnaC09g25190D [Brassica napus]
Length=384

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + +  ++K  +P+L +I LQFG AG+ I++   L++G N Y  ++Y NA+A ++  PFA+
Sbjct  2    EGVSTIIKNFRPFLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLGPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
              ERK RPK+T S+FLKI LLGFLE +LDQ   Y GM  T+AT+ SA+ N+LP++TF++A
Sbjct  62   FCERKVRPKMTLSVFLKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            WILR+E VNI  + SQAKI+GT
Sbjct  122  WILRMEKVNIAEVRSQAKIIGT  143



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L    ++ KPY+A++ LQFG+AG  +I   +L +G++HY  V+Y NA+A ++ APFAL F
Sbjct  3    LAGTWRKVKPYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWF  62

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RPK+T SIF KI  LG LE VLDQN  Y G+  T+A+F+SAL NILPA+TFV A I
Sbjct  63   ERKTRPKMTLSIFFKILALGLLEPVLDQNFIYMGVNNTSASFSSALTNILPAVTFVNAII  122

Query  60   LRLENVNIRALHSQAKILGT  1
            LR+E +NI+   SQAKI GT
Sbjct  123  LRMERINIKERRSQAKIAGT  142



>ref|XP_002284458.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Vitis vinifera]
Length=381

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            S  S +  L + KPYL ++ LQFG AG  II    L  G++ Y  V+Y NA+A +  APF
Sbjct  5    SGNSCIVYLNKMKPYLLMVALQFGSAGMYIICMATLTHGMSRYVLVVYRNAVATLAIAPF  64

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            ALL ERK RPKLT SIFLKI  LGFLE ++DQNL Y GMQYT+A++ASA+ N +PA+TFV
Sbjct  65   ALLLERKGRPKLTFSIFLKIMALGFLEPIVDQNLSYLGMQYTSASYASAIMNAVPAVTFV  124

Query  72   LAWILRLENVNIRALHSQAKILGT  1
            +A I RLE++ I+   +QAKI+GT
Sbjct  125  MAIIFRLEHIKIKETRTQAKIIGT  148



>ref|XP_010534299.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=386

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            + ++ K  +AVILLQFGYAG SI   +AL +G++ +  ++Y +AIA +   PFAL F+RK
Sbjct  1    MWREWKAPMAVILLQFGYAGLSITANFALRQGMSPHVLIVYRHAIATLFITPFALFFDRK  60

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T  IF+KI  LG LE  + QNLFY GM+YT+ TF SA+ N+LPA  F++AWI RL
Sbjct  61   VRPKMTWPIFIKIVFLGLLEPTIGQNLFYTGMKYTSPTFTSAMSNVLPAFAFLMAWIFRL  120

Query  51   ENVNIRALHSQAKILGT  1
            E V+IR +HSQA I+GT
Sbjct  121  EKVDIRRVHSQAMIMGT  137



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + L   L  +KPY  V+ +Q G AG +II K+AL+KG++ Y FV Y   IA ++ APFA+
Sbjct  2    EGLRRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI +LG LE V+D NL++ GM+YTTATFA A+CN+LPA  F++A
Sbjct  62   IFERKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE VNI    SQAKI+GT
Sbjct  122  WACRLERVNIWKRGSQAKIVGT  143



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + L   L  +KPY  V+ +Q G AG +II K+AL+KG++ Y FV Y   IA ++ APFA+
Sbjct  2    EGLRRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK R K+T S+  KI +LG LE V+D NL++ GM+YTTATFA A+CN+LPA  F++A
Sbjct  62   IFERKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
            W  RLE VNI    SQAKI+GT
Sbjct  122  WACRLERVNIWKRGSQAKIVGT  143



>gb|EMT33815.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            ++   KPYLA++LLQ G+AG  I+   +L +G++H+  V+Y N +A  + APFAL FER 
Sbjct  5    VVSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERG  64

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T +IF+KI  L FLE VLDQNL+Y G + T+A FA+AL NILPA+TFVLA ILR+
Sbjct  65   LRPKMTITIFIKIMGLAFLEPVLDQNLYYMGAKLTSAGFAAALINILPAVTFVLALILRM  124

Query  51   ENVNIRALHSQAKILGT  1
            E V +R+LHSQAKI GT
Sbjct  125  EKVRLRSLHSQAKIAGT  141



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M    L   L + KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A  + AP
Sbjct  1    MGESKLSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA + ERK RP++T  IFL+I LLGFLE VLDQNL++ GM+YT+ATFASA+ N+LPAITF
Sbjct  61   FAFVLERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            ++A   RLE VN++ LHS AK++GT
Sbjct  121  IMALCFRLETVNVKKLHSLAKVIGT  145



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M N+   +  +++KP  AV+ +QFGYA   II K A++KG+++Y FV+Y +A+A  + AP
Sbjct  1    MENQQKQSWFEKAKPLAAVVSIQFGYALMDIISKAAMNKGMSNYVFVVYRHAVAFFVMAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
             A  FERK + K+T SIF+KI +L  LE V+DQNL++ GM+YTTATFA  + N+LPAITF
Sbjct  61   LAWFFERKVKQKMTLSIFMKILVLSLLEPVIDQNLYFLGMKYTTATFAVTMTNMLPAITF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V A ILRLE +NIR++ SQAK++GT
Sbjct  121  VFACILRLEKINIRSIRSQAKVVGT  145



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            ++SKPY+A+I LQFGYAG +II K +L  G++HY  V+Y +A+A  + APFA   ERK R
Sbjct  17   ERSKPYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAVATAVIAPFAFFVERKVR  76

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PKLT S+F +IF LG L  V+DQN +YAG++YT+ TFA A+ N+LPA+TFV+A + R+E 
Sbjct  77   PKLTFSVFCQIFALGLLGPVIDQNFYYAGLKYTSPTFACAMSNVLPAMTFVMAALFRMEK  136

Query  45   VNIRALHSQAKILGT  1
            V+I+ + SQ KI GT
Sbjct  137  VDIKKVRSQTKIAGT  151



>emb|CDP15800.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            ++S   ++L     ++K YLA++ LQFGYAG  II   A  +G++H+  V+Y +A+A ++
Sbjct  3    DQSGLCRALSVFFDKAKCYLAMVSLQFGYAGMYIICMVAFKRGMSHWVLVVYRHAVATVV  62

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFA   ERK RPKLT  +FLKI  LG LE VLDQNL+Y GM+ T+ATFASA  N+LPA
Sbjct  63   MAPFAYFVERKIRPKLTLRVFLKILALGLLEPVLDQNLYYVGMKSTSATFASAFVNVLPA  122

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            +TFV+A   RLE VN++ +HS AK++GT
Sbjct  123  VTFVMAIAFRLETVNLKKIHSLAKVIGT  150



>gb|KHG16518.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=385

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            +++ S  +L ++L +++PYLA+I LQFGYAG  I+    +  G++++    Y +  A I+
Sbjct  3    DQTSSASALSDVLNKARPYLAIISLQFGYAGMYILSTICMKHGMSNFILATYRHVAATIV  62

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFA + ERK RPK+T  IFL+I +LGFLE VLDQNL+Y GM++TTAT++SA  N+LPA
Sbjct  63   IAPFAFVLERKIRPKMTLPIFLRIVVLGFLEPVLDQNLYYLGMKFTTATYSSAFVNMLPA  122

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            +TF++A I RLE +N++ +HS AK++GT
Sbjct  123  VTFIMAMIFRLEKINLKKIHSIAKVVGT  150



>ref|XP_004290853.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=385

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  432  SNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPF  253
            SN+ +   L + KPYLA++ LQFGYAG  II    L +G+NH+    Y + IA  + APF
Sbjct  6    SNERVSMFLNKIKPYLAMVSLQFGYAGMYIISMVGLKRGMNHFVLATYRHFIAFAVIAPF  65

Query  252  ALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFV  73
            AL+ ERK RPKLT  IFL+I +LGFLE VL QNL++ GM YT+ATFASA  NILPAITF+
Sbjct  66   ALVLERKVRPKLTLPIFLRIMVLGFLEPVLAQNLYFVGMTYTSATFASATANILPAITFI  125

Query  72   LAWILRLENVNIRALHSQAKILGT  1
             A I RLE VN + + S AK++GT
Sbjct  126  FALIFRLEKVNFKKIPSVAKVIGT  149



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             ++++ KPYLA++ LQFGYAG  II    L KG+NHY   +Y + +A I+  PFA++ ER
Sbjct  12   GIIQKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATIVIVPFAIVLER  71

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T +IF ++ LLGFLE VLDQNL+Y G++ T+ATF S   NILPA+TF++A I R
Sbjct  72   KIRPKMTLAIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIFR  131

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK++GT
Sbjct  132  LESVNFKKIRSIAKVVGT  149



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              +++++P++AV+ LQ G AG  I+ K  L+KG+++Y  V+Y +A+A  + APFA  F++
Sbjct  10   ECMERARPFMAVVFLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATFIIAPFAFYFDK  69

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K R K+T  IF++I LLG LE V+DQNL+Y GM+YTTATFA+A+ N+LPAITFVLA+I R
Sbjct  70   KVRTKMTMRIFIQITLLGLLEPVIDQNLYYLGMKYTTATFAAAMYNVLPAITFVLAYIFR  129

Query  54   LENVNIRALHSQAKILGT  1
            LE VN+R + S AKI+GT
Sbjct  130  LERVNLRCIRSAAKIIGT  147



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +L +++KPY+A+I LQFGYAG ++I K +L+ G++HY  V+Y +  A +  APFAL+ ER
Sbjct  10   DLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHVFATVSIAPFALILER  69

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T S FL+IF+L  L  V+DQN +Y G++YT  TFA A+ NILPA+TFV+A+I R
Sbjct  70   KVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAFIFR  129

Query  54   LENVNIRALHSQAKILGT  1
            +E V++R +  QAK+ GT
Sbjct  130  MEKVDLRKVRCQAKVAGT  147



>ref|XP_010673090.1| PREDICTED: WAT1-related protein At5g07050 [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              L++SKPY+A+I LQFGYAG +I+ K +L+ G++HY  V+Y +A A  + APFAL+ ER
Sbjct  11   TFLEKSKPYIAMICLQFGYAGMNIVTKVSLNGGMSHYVLVVYRHAFATAVIAPFALVLER  70

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
              RPK+T  IFL+IF+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+TFV+A I R
Sbjct  71   GIRPKMTFPIFLQIFVLGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFVMAVICR  130

Query  54   LENVNIRALHSQAKILGT  1
            +E V+I+ L  QAK++GT
Sbjct  131  MEKVDIKKLRCQAKVVGT  148



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  KNRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGI  268
            K   +S +++  L  ++KP+LAVI LQ G AG  II K AL++G++ Y FV+Y + IA +
Sbjct  2    KKIQVSRENIQLLFVKAKPFLAVIFLQLGVAGLDIICKAALNEGMSSYVFVVYRHVIATV  61

Query  267  LFAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILP  88
              APFAL+ E+K RPK+T S+F KI LL  LE ++DQNL++ GM+YTTATFA+A+ N+LP
Sbjct  62   FIAPFALVLEKKIRPKMTTSVFAKIVLLSLLEPIIDQNLYFLGMKYTTATFAAAMGNVLP  121

Query  87   AITFVLAWILRLENVNIRALHSQAKILGT  1
            AITF++A + RLE V   + HS AK++GT
Sbjct  122  AITFIMACLFRLEKVKFTSKHSLAKMVGT  150



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + +++++P+++V+LLQ G AG  I+ K  L+KG+++Y  V+Y +A+A ++ APFA  F++
Sbjct  8    DCMEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDK  67

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IF KI LLG LE V+DQNL+Y GM+YTTATFA+A+ N+LPAITFVLA++  
Sbjct  68   KVRPKMTWMIFGKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYLFG  127

Query  54   LENVNIRALHSQAKILGT  1
            LE VN+R + S  KI+GT
Sbjct  128  LERVNLRCIRSAGKIIGT  145



>ref|XP_006289117.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
 gb|EOA22015.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
Length=388

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            + + +PYL +I LQFG AG+ I+V   L++G N Y  ++Y N +A ++ APFAL+FERK 
Sbjct  8    MHKCRPYLLMIFLQFGAAGTYIVVMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+F KI  LGFLE VLDQ   Y GM  T+AT+ SA+ NILP++TF++AWILR+E
Sbjct  68   RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRME  127

Query  48   NVNIRALHSQAKILGT  1
             VN+  + S+AKI+GT
Sbjct  128  KVNLAEIRSKAKIIGT  143



>ref|XP_002312070.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
 gb|EEE89437.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
Length=368

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S ++L  Q++ YL VI +QFGY+  SI+ K AL+ G+  +  V Y  A+A ILF PFAL
Sbjct  2    ESFISLYNQARAYLLVIFVQFGYSVMSILAKLALNLGMKPHVLVAYRMAVASILFTPFAL  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            + ER  RPK+T  +F KI LL F E VLDQNLFYAGM+ TT TF  A+CNILPA+TFV+A
Sbjct  62   VLERNSRPKMTWWMFAKIALLSFFEPVLDQNLFYAGMKITTPTFVLAMCNILPAMTFVMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
             I +LE V++R LH QAK++GT
Sbjct  122  CIFKLEKVDMRRLHFQAKVVGT  143



>ref|XP_006397315.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
 gb|ESQ38768.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
Length=382

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            +PYL +I LQFG AG+ I++   L++G N Y  ++Y NA+A ++ APFAL FERK RPK+
Sbjct  12   RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFALFFERKVRPKM  71

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T S+F KI LLGFLE +LDQ   Y GM  T+AT+ SA+ N+LP++TF++AWILR+E V I
Sbjct  72   TLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRMEKVKI  131

Query  36   RALHSQAKILGT  1
                SQAKI+GT
Sbjct  132  VEARSQAKIIGT  143



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +  +KPYLA++LLQ G+AG  II   +L +G++H+  V+Y N +A  + APFAL FER  
Sbjct  8    VNDAKPYLAMVLLQVGFAGMYIIAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERGV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T +IF+KI  L  LE VLDQNL+Y G   T+A FA+AL NILPA+TFVLA ILR+E
Sbjct  68   RPKMTITIFIKIMGLALLEPVLDQNLYYMGANLTSAGFATALVNILPAVTFVLALILRME  127

Query  48   NVNIRALHSQAKILGT  1
             V +R+LHSQAKI GT
Sbjct  128  KVRLRSLHSQAKIAGT  143



>ref|XP_011020462.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=406

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFAL FER
Sbjct  9    KFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALFFER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K +PK+T  +F++IF+L  L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TFV+A I R
Sbjct  69   KMQPKITFPVFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVIFR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E ++I+ +  QAK+LGT
Sbjct  129  MEKLDIKKVRCQAKLLGT  146



>ref|NP_974519.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 gb|AEE82621.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=282

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            + + +PYL +I LQFG AG+ I++   L++G N Y  ++Y N +A ++ APFAL+FERK 
Sbjct  8    MHKLRPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+  KI  LGFLE VLDQ   Y GM  T+AT+ SA+ NILP++TF++AWILR+E
Sbjct  68   RPKMTLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRME  127

Query  48   NVNIRALHSQAKILGT  1
             VNI  + S+AKI+GT
Sbjct  128  KVNIAEVRSKAKIIGT  143



>ref|XP_006399183.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
 gb|ESQ40636.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
Length=406

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -3

Query  438  SMSNKSLV-NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILF  262
            SM N S   + LK SKPY A++ LQFGYAG +II K +L+ G++HY  V+Y +AIA  + 
Sbjct  2    SMENLSCCESFLKSSKPYFAMVSLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVI  61

Query  261  APFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAI  82
            APFA  FERK +PK+T +IF+++F+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+
Sbjct  62   APFAFFFERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAM  121

Query  81   TFVLAWILRLENVNIRALHSQAKILGT  1
            TF+LA + R+E ++++ L  QAKI GT
Sbjct  122  TFILAVLFRMEMLDVKKLWCQAKIAGT  148



>ref|XP_002872388.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48647.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  KPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRRPKL  217
            +PYL +I LQFG AG+ I++   L++G N Y  ++Y N +A ++ APFAL+FERK RPK+
Sbjct  12   RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  71

Query  216  TPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLENVNI  37
            T S+F KI  LGFLE VLDQ   Y GM  T+AT+ SA+ NILP++TF++AWILR+E VNI
Sbjct  72   TLSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  36   RALHSQAKILGT  1
              + S+AKI+GT
Sbjct  132  AEIRSKAKIIGT  143



>ref|XP_002303952.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
 gb|EEE78931.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
Length=406

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
              L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFAL FER
Sbjct  9    KFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALFFER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K +PK+T  +F++IF+L  L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TFV+A I R
Sbjct  69   KMQPKITFPVFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVIFR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E ++I+ +  QAK+LGT
Sbjct  129  MEKLDIKKVRCQAKLLGT  146



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             +L   KPYLA++LLQ G+AG  I+   +L +G++H+  V+Y N +A  + APFAL FER
Sbjct  4    KVLSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFER  63

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
              RPK+T +IF+KI  L FLE VLDQNL+Y G + T+A F +AL NILPA+TFVLA I+R
Sbjct  64   GLRPKMTITIFIKIMGLAFLEPVLDQNLYYMGAKLTSAGFGAALINILPAVTFVLALIMR  123

Query  54   LENVNIRALHSQAKILGT  1
            +E V +R+LHSQAKI GT
Sbjct  124  MEKVRLRSLHSQAKIAGT  141



>ref|XP_003601054.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES71305.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=281

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            LL++ KPYLA++ LQFGY+G  II   +   G++H+   +Y + +A I+  PFAL+ ERK
Sbjct  15   LLRKIKPYLAILSLQFGYSGMYIITMVSFKHGMSHWILSVYRHVVAAIIITPFALVLERK  74

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
             RPK+T  IFL+I  LGFLE VLDQNL+  GM+ T+ TFASA  N+LPAITF++A   RL
Sbjct  75   TRPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTSTTFASATVNVLPAITFIMALTFRL  134

Query  51   ENVNIRALHSQAKILGT  1
            E+VN R  HS AK++GT
Sbjct  135  ESVNWRKFHSVAKVIGT  151



>ref|XP_009620098.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=371

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M  +   +  +++KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + AP
Sbjct  1    MEGECSCSFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FAL+ ERK RPK++  +FL+IF+LG L  V+DQN +YAG++YT+ TF+ A+ N+LPA+TF
Sbjct  61   FALILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            V+A + R+E V+++    QAK+LGT
Sbjct  121  VMAVLCRMEKVDLKKFRCQAKVLGT  145



>ref|XP_003570554.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=398

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -3

Query  411  LLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERK  232
            +L   KPYLA++LLQ G+AG  ++   +L  G++H+  V+Y N +A  + APFAL FER 
Sbjct  6    VLNDVKPYLAMVLLQVGFAGMYVVAVASLKGGMSHFVLVVYRNLVATAVMAPFALYFERG  65

Query  231  RRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRL  52
            +RP +T  +FLKI  L FLE VLDQNL++ G + T+A+FASAL NILPA+TFVLA ILR+
Sbjct  66   QRPPMTIKVFLKIMGLAFLEPVLDQNLYFMGAKLTSASFASALINILPAVTFVLALILRM  125

Query  51   ENVNIRALHSQAKILGT  1
            E V +R+LHSQAKI GT
Sbjct  126  EKVRLRSLHSQAKIAGT  142



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            +++ PY+A++ LQFG+AG  +I   +L +G++HY  V+Y NA+A ++ APFAL FERK R
Sbjct  8    RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKTR  67

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T S+F KI  LG LE VLDQN FY G + T+A+F+SAL NILPA+TFV A ILR+E 
Sbjct  68   PKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILRMER  127

Query  45   VNIRALHSQAKILGT  1
            ++I+   SQAKI+GT
Sbjct  128  ISIKERRSQAKIVGT  142



>ref|XP_009620096.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=411

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +  +++KPY+A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFAL+ ER
Sbjct  10   SFFQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALILER  69

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK++  +FL+IF+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFV+A I R
Sbjct  70   KIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICR  129

Query  54   LENVNIRALHSQAKILGT  1
            +E V+I+ +  QAK+LGT
Sbjct  130  MEKVDIKKVRCQAKVLGT  147



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             ++ ++KPYLA++ LQ GYAG  +I   +L +G+NHY  V+Y NA+A    APFAL FER
Sbjct  5    EVVSKAKPYLAMVFLQVGYAGMYVISVASLKRGMNHYVLVVYRNAVAVAAIAPFALWFER  64

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T SIFLK   L  LE VLDQN +Y G   T+A FASAL NILPAITF++A +LR
Sbjct  65   KVRPKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSAGFASALFNILPAITFLMAIVLR  124

Query  54   LENVNIRALHSQAKILGT  1
            +E VN+R   SQAK++GT
Sbjct  125  MEKVNLRQRRSQAKLVGT  142



>ref|XP_007223359.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
 gb|EMJ24558.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
Length=367

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            ++S +   L  +L + KPYLA++ LQFGYAG  II   +   G++++   +Y + +A  +
Sbjct  3    DQSPTGSKLSPVLIKIKPYLAMVSLQFGYAGMYIISMVSFKHGMSNFVLSVYRHVVAFCV  62

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFA + ERK RP++T  IFL+I LLGFLE VLDQNL++ GM+YT+ATFASA+ N+LPA
Sbjct  63   IAPFAFVLERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPA  122

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            ITF++A   RLE+VN++ LHS AK++GT
Sbjct  123  ITFIMAVFFRLESVNVKKLHSLAKVVGT  150



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + +++++P+++V+LLQ G AG  I+ K  L+KG+++Y  V+Y +A+A ++ APFA  F++
Sbjct  8    DCMEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDK  67

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IF KI LLG LE V+DQNL+Y GM+YTTATFA+A+ N+LPAITFVLA+I  
Sbjct  68   KVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFG  127

Query  54   LENVNIRALHSQAKILGT  1
            LE V +R + S  K++GT
Sbjct  128  LERVKLRCIRSAGKVVGT  145



>ref|XP_011070209.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=248

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  LVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLF  241
            L N L ++KPY+A+ILLQFG+A  +II K +L++G++HY  V+Y +A A    APFAL+ 
Sbjct  8    LWNSLDKAKPYIAMILLQFGHAAMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALIL  67

Query  240  ERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWI  61
            ERK RP +T +IF+++F+L  L  V+DQNL+YAG+++T+ TFA A+ N+LPA+TF++A I
Sbjct  68   ERKARPNITCTIFMQLFVLALLGPVIDQNLYYAGLKFTSPTFAIAMANMLPALTFLMAVI  127

Query  60   LRLENVNIRALHSQAKILGT  1
             R+E V+++ +  QAK++GT
Sbjct  128  CRMEKVDMKKVRCQAKVVGT  147



>tpg|DAA57218.1| TPA: hypothetical protein ZEAMMB73_947627 [Zea mays]
Length=283

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            +   ++KPYLA+I LQFGYAG ++I K +L+ G++HY  V+Y +A A +  APFAL+ ER
Sbjct  9    DFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALILER  68

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RP +T S+FL+IF+L  L  V+DQN +YAG+++T  TFA A+ NILPA+TFV+A I R
Sbjct  69   KVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFR  128

Query  54   LENVNIRALHSQAKILGT  1
            +E V+++ +  QAK+ GT
Sbjct  129  MEKVDLKKVRCQAKVAGT  146



>gb|ABB47055.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=310

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            +++ PY+A++ LQFG+AG  +I   +L +G++HY  V+Y NA+A ++ APFAL FERK R
Sbjct  8    RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKTR  67

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T S+F KI  LG LE VLDQN FY G + T+A+F+SAL NILPA+TFV A ILR+E 
Sbjct  68   PKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILRMER  127

Query  45   VNIRALHSQAKILGT  1
            ++I+   SQAKI GT
Sbjct  128  ISIKERRSQAKIAGT  142



>gb|KDP40571.1| hypothetical protein JCGZ_24570 [Jatropha curcas]
Length=407

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  423  SLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALL  244
            S +  L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +AIA  + APFA +
Sbjct  7    SCLKFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFAFI  66

Query  243  FERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAW  64
            FER+ +P++T  IFL++F+LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFV+A 
Sbjct  67   FERRAQPRITFPIFLQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAV  126

Query  63   ILRLENVNIRALHSQAKILGT  1
            I R+E ++++ +  QAK++GT
Sbjct  127  IFRMEKLDLKKVRCQAKLIGT  147



>ref|XP_008219763.1| PREDICTED: WAT1-related protein At4g08300 [Prunus mume]
Length=367

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
            ++S +   L  +L + KPYLA++ LQFGYAG  II   +   G++++   +Y + +A  +
Sbjct  3    DQSPTGSKLSPVLIKIKPYLAMVSLQFGYAGMYIISMVSFKHGMSNFVLSVYRHVVAFCV  62

Query  264  FAPFALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPA  85
             APFA + ERK RP++T  IFL+I LLGFLE VLDQNL++ GM+YT+ATFASA+ N+LPA
Sbjct  63   IAPFAFVLERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPA  122

Query  84   ITFVLAWILRLENVNIRALHSQAKILGT  1
            ITF++A   RLE+VN++ LHS AK++GT
Sbjct  123  ITFIMAVFFRLESVNVKKLHSLAKVVGT  150



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
             ++++ KPYLA++ LQFGYAG  II    L KG+NHY   +Y + +A I+  PFA++ ER
Sbjct  12   GMIQKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATIVITPFAIVLER  71

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K RPK+T  IF ++ LLGFLE VLDQNL+Y G++ T+ATF S   NILPA+TF++A I R
Sbjct  72   KIRPKMTLGIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIFR  131

Query  54   LENVNIRALHSQAKILGT  1
            LE+VN + + S AK+ GT
Sbjct  132  LESVNFKKIRSIAKVAGT  149



>emb|CDX70003.1| BnaA10g23520D [Brassica napus]
Length=399

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + LK SKPY A+I LQFGYAG +II K +L+ G++HY  V+Y +AIA  + APFA  FER
Sbjct  11   SFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFER  70

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K +PK+T +IF+++F+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+TF+LA + R
Sbjct  71   KAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFILAVLFR  130

Query  54   LENVNIRALHSQAKILGT  1
            +E ++++ L  QAKI GT
Sbjct  131  MEVLDVKKLWCQAKIAGT  148



>ref|XP_009419851.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            NL +  KPYLA+I LQFGYAG +II K +L+ G++HY  V+Y +A A +  APFAL+FER
Sbjct  6    NLFRSCKPYLAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALIFER  65

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
              RPK+T  IFL+IF+LG L  V+DQN +Y G++ T+ TF+ AL N+LPA+TFVLA I R
Sbjct  66   NVRPKITFPIFLQIFVLGLLGPVIDQNFYYVGLRLTSPTFSCALSNMLPAMTFVLAVICR  125

Query  54   LENVNIRALHSQAKILGT  1
            +E +++R +  QAK+ GT
Sbjct  126  MEKLHMRKVRCQAKVAGT  143



>ref|XP_010096006.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB62699.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=406

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            + L N L+ SKPY A+I LQFGYAG +II K +L++G++HY  V+Y +A A  + APFA+
Sbjct  2    EKLSNFLEVSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAI  61

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
             FER+ +PK+T  +F++IF+L  L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFV+A
Sbjct  62   FFERRAQPKITLPVFMQIFMLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMA  121

Query  66   WILRLENVNIRALHSQAKILGT  1
             I R+E V+++ +  QAK++GT
Sbjct  122  VICRMEKVDMKRVRCQAKVVGT  143



>ref|XP_003526345.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN26401.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=396

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
            +S  N L+ SKPY A+I +QFGYAG +II K +L++G++HY  V+Y +A A  + APFA 
Sbjct  7    RSCANFLENSKPYFAMIAIQFGYAGMNIITKISLNRGMSHYVLVVYRHAFATAVVAPFAF  66

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
            +FERK +P++T  IF++IF+L  L  V+DQN +YAG++ T+ TF+ A+ N+LPA+TFV+A
Sbjct  67   IFERKAQPRITFPIFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNVLPAMTFVMA  126

Query  66   WILRLENVNIRALHSQAKILGT  1
             + R+E +N++ +  QAK++GT
Sbjct  127  VLCRMEKINMKKVRCQAKVVGT  148



>ref|XP_006289728.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
 gb|EOA22626.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
Length=391

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  KSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFAL  247
             S  + L  SKPY A+I LQFGYAG +II K +L+ G++HY  V+Y +AIA  + APFA 
Sbjct  7    SSCESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAF  66

Query  246  LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLA  67
             FERK +PK+T SIF+++F+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+TFVLA
Sbjct  67   FFERKAQPKITISIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFVLA  126

Query  66   WILRLENVNIRALHSQAKILGT  1
             + R+E ++++ L  QAKI GT
Sbjct  127  VLFRMEMLDVKKLWCQAKIGGT  148



>emb|CBI32681.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = -3

Query  444  NRSMSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGIL  265
               +S+KS   LL + KP+LAV  LQFG+AG  +  K AL++GV++Y  V+Y +AIA   
Sbjct  2    ENEISSKSTYRLLYRVKPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAF  61

Query  264  FAPFAL------LFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASAL  103
             APFA        F RK RPK+T SIF K+ LL  LE V+DQNL+Y G++YTTATFA+A+
Sbjct  62   IAPFAKTEYKIHFFNRKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAM  121

Query  102  CNILPAITFVLAWILRLENVNIRALHSQAKILGT  1
             NILPAITF++A I  LE V ++++HSQAK++GT
Sbjct  122  YNILPAITFLMACIFGLEKVTLKSIHSQAKVVGT  155



>ref|XP_009141664.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Brassica 
rapa]
Length=374

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M     ++ +K++ P++ VILLQ G AG  I+ K  L++G+++Y  V+Y + +A I+ AP
Sbjct  1    MEEVKKISCMKKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIVMAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA  F++  RPK+TP IF KI LLG  E V+DQNLF  GM+YTTATFA+AL N LPA+TF
Sbjct  61   FAFYFDKAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            VLA I+RLE V +R++ S +K++GT
Sbjct  121  VLALIVRLEKVKLRSIRSASKVIGT  145



>emb|CDX93377.1| BnaC04g45190D [Brassica napus]
Length=374

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  435  MSNKSLVNLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAP  256
            M     ++ +K++ P++ VILLQ G AG  I+ K  L++G+++Y  V+Y + +A I+ AP
Sbjct  1    MEEVKKISCMKKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIIMAP  60

Query  255  FALLFERKRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITF  76
            FA  F++  RPK+TP IF KI LLG  E V+DQNLF  GM+YTTATFA+AL N LPA+TF
Sbjct  61   FAFYFDKAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTF  120

Query  75   VLAWILRLENVNIRALHSQAKILGT  1
            +LA I+RLE V +R++ S +K++GT
Sbjct  121  ILALIVRLEKVKLRSMRSASKVIGT  145



>ref|XP_009391606.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            ++ KPY+A+I LQFGYAG +II K +L+ G++HY  V+Y +A A +  APFAL+ ERK R
Sbjct  9    QKCKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFALILERKVR  68

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T SIF++IF LG L  V+DQN +YAG+++T+ TF+ A+ N+LPA+TFVLA I R+E 
Sbjct  69   PKMTFSIFMQIFALGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVICRMEK  128

Query  45   VNIRALHSQAKILGT  1
            V+++ +  QAK++GT
Sbjct  129  VHLKKVRCQAKVVGT  143



>ref|XP_010438422.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=386

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            +++ +PY  +I LQFG AG+ I++   L++G N Y  ++Y N +A ++ APFAL+FERK 
Sbjct  8    MQKCRPYFLMIFLQFGSAGNYIVILATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKV  67

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T S+F KI  LGFLE VLDQ   Y GM  T+AT+ASA+ NILP++TF++AWILR+E
Sbjct  68   RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRME  127

Query  48   NVNIRALHSQAKILGT  1
             V+I  + S+AKI+GT
Sbjct  128  KVSIAEVRSKAKIIGT  143



>ref|XP_009122385.1| PREDICTED: WAT1-related protein At5g07050 [Brassica rapa]
Length=399

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  NLLKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFER  235
            + LK SKPY A+I LQFGYAG +II K +L+ G++HY  V+Y +AIA  + APFA  FER
Sbjct  11   SFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFER  70

Query  234  KRRPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILR  55
            K +PK+T +IF+++F+LG L  V+DQN +Y G++YT+ TF+ A+ N+LPA+TF+LA + R
Sbjct  71   KAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAISNMLPAMTFILAVLFR  130

Query  54   LENVNIRALHSQAKILGT  1
            +E ++++ L  QAKI GT
Sbjct  131  MEVLDVKKLWCQAKIAGT  148



>gb|ACJ84735.1| unknown [Medicago truncatula]
Length=372

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  408  LKQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKR  229
            L++ KPYLA++ LQFGYAG  II   +   G++H+   +Y + IA I  APFAL+ ERK 
Sbjct  12   LRKIKPYLAMVSLQFGYAGMYIITMVSFKHGMSHWVLSVYRHVIATIFMAPFALVLERKI  71

Query  228  RPKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLE  49
            RPK+T  IFL++ +LGFLE VLDQNL+  GM+ T+ TFASA  NILPAITF++A I RLE
Sbjct  72   RPKMTLPIFLRLAVLGFLEPVLDQNLYNLGMKNTSTTFASATVNILPAITFIMAIIFRLE  131

Query  48   NVNIRALHSQAKILGT  1
             VN++ +HS AKI+GT
Sbjct  132  TVNLKKIHSIAKIVGT  147



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  KQSKPYLAVILLQFGYAGSSIIVKYALDKGVNHYTFVLYANAIAGILFAPFALLFERKRR  226
            +++ PY+A++ LQFG+AG  +I   +L +G++HY  V+Y NA+A ++ APFAL FERK R
Sbjct  8    RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKTR  67

Query  225  PKLTPSIFLKIFLLGFLEAVLDQNLFYAGMQYTTATFASALCNILPAITFVLAWILRLEN  46
            PK+T S+F KI  LG LE VLDQN FY G + T+A+F+SAL NILPA+TFV A ILR+E 
Sbjct  68   PKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILRMER  127

Query  45   VNIRALHSQAKILGT  1
            ++I+   SQAKI GT
Sbjct  128  ISIKERRSQAKIAGT  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340246911422