BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22127_g1_i1 len=996 path=[1555:0-475 5333:476-477 2033:478-995]

Length=996
                                                                      Score     E

ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             257   9e-79   
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     255   4e-78   
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          254   9e-78   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510          252   3e-77   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             250   1e-76   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     251   2e-76   
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         249   3e-76   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     250   5e-76   
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    249   9e-76   
ref|XP_010067382.1|  PREDICTED: WAT1-related protein At2g39510-like     246   1e-75   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    249   1e-75   
gb|EYU41683.1|  hypothetical protein MIMGU_mgv1a009185mg                247   3e-75   
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     247   4e-75   
ref|XP_008233583.1|  PREDICTED: WAT1-related protein At2g37460-li...    243   8e-75   
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like     246   9e-75   
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     245   1e-74   
emb|CDP05672.1|  unnamed protein product                                246   2e-74   
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          245   2e-74   Vitis vinifera
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...    243   3e-74   
gb|KHG11891.1|  Auxin-induced 5NG4                                      245   4e-74   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    244   4e-74   
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     244   5e-74   
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     245   5e-74   
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     243   6e-74   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     243   7e-74   
ref|XP_010096638.1|  Auxin-induced protein 5NG4                         244   7e-74   
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...    243   8e-74   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     244   1e-73   
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               243   2e-73   Ricinus communis
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     243   2e-73   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     243   3e-73   
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          242   3e-73   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...    242   4e-73   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like     242   4e-73   
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...    241   5e-73   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    242   5e-73   
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     241   7e-73   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...    242   7e-73   
emb|CDP00045.1|  unnamed protein product                                241   8e-73   
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             241   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...    240   2e-72   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     240   2e-72   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    241   2e-72   
ref|XP_002312071.1|  nodulin MtN21 family protein                       240   2e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         240   3e-72   
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                239   3e-72   
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     239   4e-72   
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    239   4e-72   
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         239   5e-72   
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     239   5e-72   
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like     239   7e-72   
emb|CBI32681.3|  unnamed protein product                                239   8e-72   
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     239   8e-72   Vitis vinifera
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     238   1e-71   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     238   1e-71   
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     237   4e-71   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     237   4e-71   
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    236   4e-71   
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like     236   5e-71   
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         236   6e-71   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         236   8e-71   
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     236   9e-71   
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     236   1e-70   
gb|AFK43964.1|  unknown                                                 233   1e-70   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like     236   1e-70   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                235   1e-70   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     238   2e-70   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    235   2e-70   
gb|KDP29854.1|  hypothetical protein JCGZ_18429                         234   2e-70   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     237   2e-70   
emb|CDY53594.1|  BnaA05g34670D                                          235   2e-70   
emb|CDY20446.1|  BnaC04g05980D                                          235   3e-70   
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...    234   3e-70   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     235   4e-70   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    234   4e-70   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             234   7e-70   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     233   9e-70   
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     232   3e-69   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     235   3e-69   
gb|KHG29314.1|  Auxin-induced 5NG4                                      229   4e-69   
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             231   5e-69   
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     231   5e-69   
ref|XP_010097389.1|  Auxin-induced protein 5NG4                         231   6e-69   
gb|KHG12592.1|  Auxin-induced 5NG4                                      226   7e-69   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          230   8e-69   
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             231   1e-68   
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         230   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881660.1|  nodulin MtN21 family protein                       230   2e-68   
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          230   2e-68   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     229   4e-68   
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          229   6e-68   
emb|CDY07016.1|  BnaA04g22990D                                          229   7e-68   
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     229   8e-68   
gb|AFK37263.1|  unknown                                                 229   8e-68   
emb|CDP06652.1|  unnamed protein product                                227   1e-67   
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 228   1e-67   
emb|CDX93255.1|  BnaC04g46410D                                          228   1e-67   
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    229   1e-67   
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         227   3e-67   
gb|AFK37217.1|  unknown                                                 227   3e-67   
emb|CDX79734.1|  BnaC03g20700D                                          226   3e-67   
gb|KHN09434.1|  Auxin-induced protein 5NG4                              226   5e-67   
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             226   8e-67   
emb|CDY07788.1|  BnaA03g17230D                                          225   1e-66   
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     225   1e-66   
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         225   2e-66   
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    223   5e-66   
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     224   6e-66   
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     223   6e-66   
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like     223   1e-65   
ref|XP_006410931.1|  hypothetical protein EUTSA_v10017814mg             219   2e-65   
gb|KHN48995.1|  Auxin-induced protein 5NG4                              221   5e-65   
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             221   6e-65   
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    221   7e-65   
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like         221   7e-65   
ref|XP_010419331.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    221   9e-65   
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             220   1e-64   
ref|XP_008461651.1|  PREDICTED: WAT1-related protein At2g39510-li...    219   1e-64   
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...    220   1e-64   
ref|XP_006410932.1|  hypothetical protein EUTSA_v10016799mg             218   2e-64   
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...    220   2e-64   
gb|KDO67718.1|  hypothetical protein CISIN_1g043160mg                   218   2e-64   
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    219   3e-64   
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     219   3e-64   
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             218   8e-64   
ref|XP_006294396.1|  hypothetical protein CARUB_v10023413mg             218   1e-63   
ref|XP_002881508.1|  predicted protein                                  216   1e-63   
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like     218   1e-63   
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     218   1e-63   
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510          217   1e-63   
ref|XP_010939364.1|  PREDICTED: WAT1-related protein At2g37450 is...    215   2e-63   
ref|XP_009141665.1|  PREDICTED: WAT1-related protein At2g37460-li...    215   2e-63   
emb|CDX75163.1|  BnaC09g25190D                                          217   2e-63   
gb|AAM62850.1|  nodulin-like protein                                    216   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         217   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             218   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     217   3e-63   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    216   5e-63   
ref|XP_011023643.1|  PREDICTED: WAT1-related protein At5g13670-like     216   5e-63   
ref|XP_002312070.1|  hypothetical protein POPTR_0008s05130g             215   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    215   8e-63   
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     215   1e-62   
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          215   1e-62   
emb|CDY18443.1|  BnaA04g21440D                                          214   2e-62   
ref|XP_002534331.1|  conserved hypothetical protein                     209   2e-62   Ricinus communis
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       214   2e-62   
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    215   2e-62   
emb|CDY18444.1|  BnaA04g21430D                                          214   2e-62   
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         214   2e-62   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          214   2e-62   
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     214   2e-62   
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    214   2e-62   
gb|KDO40046.1|  hypothetical protein CISIN_1g019311mg                   212   2e-62   
ref|XP_008463491.1|  PREDICTED: WAT1-related protein At2g39510-li...    213   3e-62   
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    213   3e-62   
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          214   4e-62   
gb|KHG03072.1|  Auxin-induced 5NG4                                      214   5e-62   
emb|CDX93378.1|  BnaC04g45180D                                          213   6e-62   
gb|KHN05928.1|  Auxin-induced protein 5NG4                              213   6e-62   
gb|KDO40045.1|  hypothetical protein CISIN_1g019311mg                   212   6e-62   
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290          213   7e-62   
emb|CDX93377.1|  BnaC04g45190D                                          213   7e-62   
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...    213   7e-62   
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     212   9e-62   
ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...    211   1e-61   
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like     212   1e-61   
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg             212   1e-61   
emb|CDY29141.1|  BnaA09g53940D                                          212   2e-61   
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     211   3e-61   
ref|XP_010534299.1|  PREDICTED: WAT1-related protein At2g39510-like     212   3e-61   
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     211   3e-61   
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             211   3e-61   
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    211   3e-61   
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     211   5e-61   
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like         211   5e-61   
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    209   1e-60   
gb|EMT13376.1|  Auxin-induced protein 5NG4                              214   1e-60   
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like     209   1e-60   
ref|XP_007009431.1|  Nodulin MtN21 /EamA-like transporter family ...    209   1e-60   
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          209   2e-60   
gb|EMS57240.1|  Auxin-induced protein 5NG4                              208   2e-60   
ref|XP_004167845.1|  PREDICTED: auxin-induced protein 5NG4-like         208   3e-60   
gb|ABG65997.1|  nodulin MtN21 family protein, putative, expressed       205   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         209   3e-60   
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     208   3e-60   
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like         208   3e-60   
gb|KGN61714.1|  hypothetical protein Csa_2G231960                       208   5e-60   
ref|XP_004142736.1|  PREDICTED: auxin-induced protein 5NG4-like         208   5e-60   
gb|KHG26265.1|  Auxin-induced 5NG4                                      207   7e-60   
ref|XP_008463583.1|  PREDICTED: WAT1-related protein At2g39510-like     209   7e-60   
gb|EMS60728.1|  Auxin-induced protein 5NG4                              208   8e-60   
gb|ABG65998.1|  nodulin MtN21 family protein, putative, expressed       205   8e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AAM01041.1|AC091735_14  Putative nodulin-like protein                206   9e-60   Oryza sativa [red rice]
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          207   1e-59   Vitis vinifera
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...    205   1e-59   
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             206   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     207   2e-59   
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     206   2e-59   
gb|EMT18534.1|  Auxin-induced protein 5NG4                              205   2e-59   
ref|NP_001064323.1|  Os10g0210500                                       206   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|KHG24903.1|  Auxin-induced 5NG4                                      206   3e-59   
gb|EMS60727.1|  Auxin-induced protein 5NG4                              206   4e-59   
ref|NP_565861.1|  nodulin MtN21 /EamA-like transporter family pro...    203   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg             205   7e-59   
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110        205   8e-59   Sorghum bicolor [broomcorn]
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     211   1e-58   
dbj|BAJ98418.1|  predicted protein                                      205   1e-58   
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like     204   1e-58   
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     204   1e-58   
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like     205   2e-58   
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          204   2e-58   
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     203   2e-58   
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                   204   2e-58   
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             204   2e-58   
gb|EMT07558.1|  Auxin-induced protein 5NG4                              203   2e-58   
dbj|BAF00152.1|  nodulin-like protein                                   202   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078016.1|  nodulin MtN21 /EamA-like transporter family ...    202   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436051.1|  hypothetical protein CICLE_v10033577mg             202   3e-58   
ref|XP_006486497.1|  PREDICTED: WAT1-related protein At2g39510-like     202   3e-58   
dbj|BAK04730.1|  predicted protein                                      203   3e-58   
gb|EMT04611.1|  Auxin-induced protein 5NG4                              203   4e-58   
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     203   4e-58   
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg             202   6e-58   
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         202   7e-58   
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    202   8e-58   
gb|EEC66707.1|  hypothetical protein OsI_33030                          202   1e-57   Oryza sativa Indica Group [Indian rice]
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       202   1e-57   
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    202   1e-57   
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     202   1e-57   
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     202   1e-57   
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          202   2e-57   Sorghum bicolor [broomcorn]
gb|EMS46274.1|  Auxin-induced protein 5NG4                              202   2e-57   
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    201   2e-57   
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             201   2e-57   
gb|EYU28757.1|  hypothetical protein MIMGU_mgv1a023410mg                199   3e-57   
gb|ABR16695.1|  unknown                                                 201   4e-57   Picea sitchensis
ref|XP_010096633.1|  Auxin-induced protein 5NG4                         200   5e-57   
gb|EMS45454.1|  Auxin-induced protein 5NG4                              200   5e-57   
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               200   6e-57   
gb|AAM65570.1|  nodulin-like protein                                    200   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     199   7e-57   
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             200   8e-57   
gb|AES71306.2|  nodulin MtN21/EamA-like transporter family protein      197   9e-57   
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                     199   1e-56   
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg             199   1e-56   
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290          199   1e-56   
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     199   1e-56   
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    199   1e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43205.1|  putative nodulin                                       199   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     199   2e-56   
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     199   2e-56   
gb|KDO40047.1|  hypothetical protein CISIN_1g019311mg                   194   2e-56   
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          199   2e-56   
ref|XP_010910818.1|  PREDICTED: WAT1-related protein At4g08290-like     197   3e-56   
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          198   3e-56   
ref|XP_010911519.1|  PREDICTED: WAT1-related protein At5g07050-like     195   4e-56   
gb|AFK47115.1|  unknown                                                 197   5e-56   
ref|XP_002302243.2|  nodulin MtN21 family protein                       197   6e-56   Populus trichocarpa [western balsam poplar]
gb|AFK35679.1|  unknown                                                 197   6e-56   
ref|NP_001137108.1|  hypothetical protein                               197   7e-56   Zea mays [maize]
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...    195   9e-56   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     197   1e-55   
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         197   1e-55   
emb|CDP15800.1|  unnamed protein product                                197   1e-55   
ref|XP_006343755.1|  PREDICTED: WAT1-related protein At2g39510-like     194   1e-55   
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         197   1e-55   
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         196   1e-55   
gb|AFK39842.1|  unknown                                                 196   2e-55   
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         196   2e-55   
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         195   2e-55   
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     196   2e-55   
gb|EEC74071.1|  hypothetical protein OsI_09081                          196   3e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001048238.1|  Os02g0768300                                       196   3e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    195   4e-55   Vitis vinifera
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             195   5e-55   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     196   5e-55   
gb|ACJ84735.1|  unknown                                                 195   5e-55   Medicago truncatula
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like     195   5e-55   
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     195   6e-55   
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             195   6e-55   
ref|XP_004500562.1|  PREDICTED: WAT1-related protein At4g08300-li...    193   6e-55   
gb|EMT33815.1|  Auxin-induced protein 5NG4                              195   7e-55   
ref|XP_009363179.1|  PREDICTED: WAT1-related protein At1g21890-like     195   8e-55   
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     194   9e-55   
ref|XP_008782344.1|  PREDICTED: WAT1-related protein At1g21890-like     195   1e-54   
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     194   1e-54   
gb|AFK34273.1|  unknown                                                 194   1e-54   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     194   1e-54   
gb|KHG10291.1|  Auxin-induced 5NG4                                      194   2e-54   
emb|CDX91104.1|  BnaC02g04930D                                          194   2e-54   
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             193   2e-54   
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             194   2e-54   
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         194   2e-54   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     194   2e-54   
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     194   2e-54   
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...    193   2e-54   
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          193   3e-54   
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...    193   3e-54   
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               193   3e-54   
gb|AAO41946.1|  unknown protein                                         191   3e-54   
gb|AGZ85011.1|  hypothetical protein 6                                  193   4e-54   
ref|XP_008391904.1|  PREDICTED: WAT1-related protein At1g21890-like     193   5e-54   
ref|XP_010558786.1|  PREDICTED: WAT1-related protein At5g13670          192   5e-54   
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     192   5e-54   
ref|XP_006399861.1|  hypothetical protein EUTSA_v10013837mg             192   7e-54   
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                192   7e-54   
emb|CBI19038.3|  unnamed protein product                                194   8e-54   
gb|KHN09193.1|  Auxin-induced protein 5NG4                              192   9e-54   
ref|XP_010453454.1|  PREDICTED: WAT1-related protein At5g13670-like     192   1e-53   
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     192   1e-53   
ref|NP_196871.1|  nodulin MtN21-like transporter UMAMIT 15              191   1e-53   
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     191   1e-53   
ref|XP_006289509.1|  hypothetical protein CARUB_v10003044mg             191   1e-53   
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     191   1e-53   
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like     191   2e-53   
gb|KHG16518.1|  Auxin-induced 5NG4                                      191   2e-53   
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     191   2e-53   
emb|CAH58631.1|  nodulin-like protein                                   190   2e-53   
emb|CDY65991.1|  BnaA10g29860D                                          191   3e-53   
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             191   3e-53   
gb|KHG29659.1|  Auxin-induced 5NG4                                      190   3e-53   
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like     192   3e-53   
gb|KHN47037.1|  Auxin-induced protein 5NG4-like protein                 190   3e-53   
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          191   4e-53   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     190   4e-53   
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         190   4e-53   
emb|CDY09817.1|  BnaC09g43440D                                          189   5e-53   
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       190   5e-53   
ref|XP_003601062.1|  Auxin-induced protein 5NG4                         190   5e-53   
gb|ABK25095.1|  unknown                                                 190   5e-53   
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     190   5e-53   
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     189   9e-53   
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     189   1e-52   
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like     190   1e-52   
gb|AFK38638.1|  unknown                                                 185   1e-52   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          189   2e-52   
gb|ABS52574.1|  nodulin family protein                                  189   2e-52   
ref|XP_009610630.1|  PREDICTED: WAT1-related protein At5g07050-li...    188   2e-52   
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     189   2e-52   
gb|ACD56621.1|  putative nodulin-like protein                           188   3e-52   
ref|NP_001242267.1|  uncharacterized protein LOC100811617               188   4e-52   
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          187   4e-52   
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     187   5e-52   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     187   5e-52   
ref|XP_009121742.1|  PREDICTED: WAT1-related protein At5g13670          188   5e-52   
ref|XP_008463486.1|  PREDICTED: WAT1-related protein At2g39510-li...    185   5e-52   
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         187   6e-52   
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          187   6e-52   
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    187   7e-52   
gb|KHN09198.1|  Auxin-induced protein 5NG4                              187   7e-52   
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     187   7e-52   
ref|XP_008463485.1|  PREDICTED: WAT1-related protein At2g39510-li...    186   7e-52   
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          187   8e-52   
ref|XP_009621490.1|  PREDICTED: WAT1-related protein At5g07050-li...    186   8e-52   
ref|XP_009790910.1|  PREDICTED: WAT1-related protein At5g07050-li...    186   8e-52   
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like     187   8e-52   
ref|XP_010063982.1|  PREDICTED: WAT1-related protein At4g08290-like     186   9e-52   
gb|KHN33840.1|  Auxin-induced protein 5NG4                              186   9e-52   
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     186   1e-51   
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     186   1e-51   
gb|ADN33888.1|  nodulin-like protein                                    186   1e-51   
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             186   1e-51   
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     186   1e-51   
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     187   1e-51   
ref|XP_003543089.1|  PREDICTED: WAT1-related protein At4g08290-li...    186   1e-51   
ref|XP_007019026.1|  Nodulin MtN21 /EamA-like transporter family ...    185   1e-51   
gb|AFK35983.1|  unknown                                                 186   2e-51   
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         186   2e-51   
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    185   2e-51   
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     186   2e-51   
gb|KHG23400.1|  Auxin-induced 5NG4                                      186   2e-51   
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             186   3e-51   
ref|XP_010525695.1|  PREDICTED: WAT1-related protein At2g37460-like     186   3e-51   
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    186   3e-51   
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         186   4e-51   
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             186   4e-51   
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          186   4e-51   
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    185   4e-51   
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like         183   5e-51   
ref|XP_004493328.1|  PREDICTED: WAT1-related protein At5g07050-li...    182   6e-51   
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             185   6e-51   
gb|KHG18008.1|  Auxin-induced 5NG4                                      184   6e-51   
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     185   6e-51   
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 184   7e-51   
ref|NP_001240202.1|  uncharacterized protein LOC100811114               184   7e-51   
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             185   8e-51   
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    185   8e-51   
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     184   1e-50   
gb|ACU23200.1|  unknown                                                 184   1e-50   
emb|CDP06236.1|  unnamed protein product                                184   1e-50   
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             183   1e-50   
ref|XP_010063981.1|  PREDICTED: WAT1-related protein At4g08290-like     183   2e-50   
ref|XP_006339251.1|  PREDICTED: WAT1-related protein At5g07050-like     183   2e-50   
ref|NP_001148990.1|  nodulin protein                                    183   2e-50   
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          183   2e-50   
ref|XP_004136770.1|  PREDICTED: auxin-induced protein 5NG4-like         182   2e-50   
gb|KHG29332.1|  Auxin-induced 5NG4                                      182   2e-50   
gb|EMT18779.1|  Auxin-induced protein 5NG4                              183   2e-50   
gb|KGN59419.1|  hypothetical protein Csa_3G818280                       180   2e-50   
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     182   2e-50   
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    183   3e-50   
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       181   3e-50   
ref|XP_003544696.1|  PREDICTED: WAT1-related protein At4g08290-like     182   3e-50   
ref|NP_001241603.1|  uncharacterized protein LOC100812537               182   3e-50   
gb|KHN47036.1|  Auxin-induced protein 5NG4-like protein                 182   4e-50   
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     182   4e-50   
gb|KGN59420.1|  hypothetical protein Csa_3G819280                       182   5e-50   
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    182   5e-50   
gb|EMS48876.1|  Auxin-induced protein 5NG4                              182   5e-50   
gb|EMS45468.1|  Auxin-induced protein 5NG4                              182   5e-50   
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             182   5e-50   
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    182   6e-50   
ref|XP_007010782.1|  Nodulin MtN21 /EamA-like transporter family ...    183   6e-50   
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          182   7e-50   
ref|XP_004151019.1|  PREDICTED: auxin-induced protein 5NG4-like         181   7e-50   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          182   7e-50   
emb|CDX70003.1|  BnaA10g23520D                                          182   8e-50   
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          182   9e-50   
ref|XP_007133644.1|  hypothetical protein PHAVU_011G1969001g            179   1e-49   
dbj|BAJ92223.1|  predicted protein                                      181   1e-49   
gb|KHN04117.1|  Auxin-induced protein 5NG4                              180   1e-49   
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    179   1e-49   
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          181   1e-49   
gb|KHG09563.1|  Auxin-induced 5NG4                                      181   2e-49   
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like     181   2e-49   
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     181   2e-49   
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    181   2e-49   
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     180   2e-49   
gb|EPS73987.1|  hypothetical protein M569_00767                         178   3e-49   
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     181   3e-49   
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    179   3e-49   
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             180   4e-49   
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                180   4e-49   
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     180   4e-49   
gb|EEC79453.1|  hypothetical protein OsI_20446                          180   5e-49   
ref|NP_001055921.1|  Os05g0493800                                       180   5e-49   
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     180   5e-49   
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     180   5e-49   
gb|ABR18253.1|  unknown                                                 180   6e-49   
emb|CBI35062.3|  unnamed protein product                                178   7e-49   
ref|XP_007141063.1|  hypothetical protein PHAVU_008G164200g             178   9e-49   
ref|XP_004170561.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    179   1e-48   
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     179   1e-48   
emb|CDY00403.1|  BnaC07g14230D                                          178   1e-48   
ref|XP_008231618.1|  PREDICTED: WAT1-related protein At5g07050          177   1e-48   
emb|CDX85633.1|  BnaA02g01800D                                          178   2e-48   
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800          177   2e-48   
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     178   2e-48   
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     178   2e-48   
gb|KHG12908.1|  Auxin-induced 5NG4                                      175   2e-48   
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     178   2e-48   
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         178   2e-48   
gb|EMS52511.1|  Auxin-induced protein 5NG4                              172   2e-48   
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     177   3e-48   
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          178   3e-48   
ref|XP_009125930.1|  PREDICTED: WAT1-related protein At5g13670-like     177   3e-48   
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             177   3e-48   
ref|XP_004498329.1|  PREDICTED: WAT1-related protein At1g44800-li...    175   3e-48   
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     177   3e-48   
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         178   3e-48   
gb|KHG10292.1|  Auxin-induced 5NG4                                      177   3e-48   
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                177   3e-48   
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          177   4e-48   
dbj|BAK04850.1|  predicted protein                                      177   5e-48   
emb|CDM84603.1|  unnamed protein product                                177   5e-48   
gb|EAZ00107.1|  hypothetical protein OsI_22111                          176   6e-48   
gb|AAM62626.1|  nodulin protein, putative                               176   7e-48   
ref|NP_001183198.1|  uncharacterized protein LOC100501578               174   8e-48   
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     176   9e-48   
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             176   1e-47   
dbj|BAD35697.1|  putative MtN21                                         176   1e-47   
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like     176   1e-47   
ref|NP_001044551.1|  Os01g0803300                                       174   1e-47   
ref|XP_002873622.1|  nodulin MtN21 family protein                       176   1e-47   
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     176   1e-47   
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          176   2e-47   
ref|XP_002280977.1|  PREDICTED: WAT1-related protein At5g07050          175   2e-47   
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1            175   2e-47   
ref|NP_001055529.2|  Os05g0409500                                       176   2e-47   
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...    175   2e-47   
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300          175   2e-47   
gb|EAY98030.1|  hypothetical protein OsI_19945                          176   2e-47   
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         175   2e-47   
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     175   3e-47   
ref|XP_002893995.1|  nodulin MtN21 family protein                       174   3e-47   
gb|KFK36195.1|  hypothetical protein AALP_AA4G090300                    174   4e-47   
gb|KCW70586.1|  hypothetical protein EUGRSUZ_F03775                     170   4e-47   
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative               175   4e-47   
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like     174   4e-47   
gb|AFK33380.1|  unknown                                                 171   5e-47   
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     173   5e-47   
ref|XP_003566085.1|  PREDICTED: WAT1-related protein At5g07050-like     174   5e-47   
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          174   5e-47   
dbj|BAB92246.1|  putative nodulin MtN21                                 174   5e-47   
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     174   6e-47   
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     173   6e-47   
gb|EMT31802.1|  Auxin-induced protein 5NG4                              174   6e-47   
ref|XP_011029842.1|  PREDICTED: WAT1-related protein At5g07050-like     173   1e-46   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     174   1e-46   
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     173   1e-46   



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK+ GT+VTVGGAM MTL+KGP + LPWT    H +ST+ ++ Q PIKGA+MIT GC  W
Sbjct  138  AKVFGTIVTVGGAMFMTLIKGPVLDLPWTNHNYHQESTSNSSVQSPIKGALMITIGCFSW  197

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F +LQAITL+SYP  LSLT+LICLMG ++  ++ L +ER N AVW+++ D KLLA VY
Sbjct  198  AGFMVLQAITLKSYPTELSLTALICLMGTIEGTIVALFLERGNAAVWSIHLDSKLLAAVY  257

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G+ICSG+GYY+SGV+MK++GP FV+AFNPL ++IVAIMGSFLL+E + LG V+GA II 
Sbjct  258  SGVICSGIGYYVSGVVMKDRGPVFVTAFNPLCMIIVAIMGSFLLSEIMYLGRVVGAIIIV  317

Query  451  VGLYLVIWSKSDNQDS  404
            VGLYLV+W KS +Q++
Sbjct  318  VGLYLVLWGKSKDQNT  333



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT VT GGAMIMTL+ GP I LPWT+   +I  ++  T   PIKGA+ I AGC  
Sbjct  137  QAKIIGTTVTFGGAMIMTLIGGPTIGLPWTRHHLNIIPSSP-TDLQPIKGALFIAAGCIC  195

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF+ LQAITL++YPA LSLT LIC  GALQ  +LTL VER NT++WA+ WD   L+ V
Sbjct  196  WACFYNLQAITLKTYPATLSLTCLICSAGALQGTLLTLVVERGNTSIWAIQWDTSFLSYV  255

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G++ SGVGYY+SG+IMKEKGP FV+AFNPL++VIVAI+GSF+L+E+L LG VLG  II
Sbjct  256  YSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFILSEELNLGRVLGGAII  315

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLYLVIW KS +Q S    ++EE
Sbjct  316  VIGLYLVIWGKSKDQQSSTSFSSEE  340



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK+ GT+VT+GGA IMTLVKGP + LPW + R +   T  + HQ PIKGAIMIT+GC  W
Sbjct  134  AKVGGTMVTIGGATIMTLVKGPGVKLPWIK-RDYNHVTNTSYHQDPIKGAIMITSGCMGW  192

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F ILQAITLRSYPA +SLT+L+C  GA++ G++ L +ER NT++W+L+WD KLLA +Y
Sbjct  193  AAFVILQAITLRSYPAEMSLTALMCFAGAVEGGIIALIMER-NTSIWSLHWDPKLLAYIY  251

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CS +G++L G IM+EKGP FV+AFNPLS+VIVAI+GSF+LAEQL LG + GA +I 
Sbjct  252  SGVVCSAIGFFLQGKIMQEKGPVFVTAFNPLSMVIVAILGSFILAEQLTLGRITGAVVIV  311

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
             GLY+VIW KS ++D    +  E+
Sbjct  312  SGLYIVIWGKSKDKDQTSHNTTEQ  335



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-HPIKGAIMITAGCC  818
            QAKI+GT VT GGAMIMTLV GP I LPWT+   HI    ++T    PIKGA+ I AGC 
Sbjct  137  QAKIIGTTVTFGGAMIMTLVGGPTIGLPWTRHD-HINIIPSSTTDLQPIKGALFIAAGCI  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF+ LQAITL++YPA LSLT LIC  GALQ  +LTL VER NT++WA+ WD   L+ 
Sbjct  196  CWACFYNLQAITLKTYPASLSLTCLICSAGALQGTLLTLVVERGNTSIWAIQWDTTFLSY  255

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G++ SGVGYY+SG+IMKEKGP FV+AFNPL++VIVAI+GSF+L+E+L LG VLG  I
Sbjct  256  VYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFILSEELNLGRVLGGAI  315

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLYLVIW KS +Q S
Sbjct  316  IVIGLYLVIWGKSKDQQS  333



>ref|XP_007218251.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
 gb|EMJ19450.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
Length=347

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP + LPWT+   H +ST+A  HQ PIKGA+MI AGC  W
Sbjct  140  AKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATDHQDPIKGALMIGAGCFCW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F  LQAITL+SYPA LSL + ICLMG +Q  V+ L  E  N A W+++WD KLLA VY
Sbjct  200  AGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHWDSKLLAAVY  259

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSGV YY+ G++MKE+GP FV+AF+PLS++IVA+M SF+LAE + LG V+GA +I 
Sbjct  260  SGIICSGVAYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLGRVIGAMVIV  319

Query  451  VGLYLVIWSKSDNQ  410
            +GLY+V+W KS +Q
Sbjct  320  IGLYMVLWGKSKDQ  333



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 157/198 (79%), Gaps = 5/198 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH---QHPIKGAIMITAG  824
            QAK++GTLVTVGGAM+MTL+KGP + LPWT  +G + +T+   H   Q PIKGA+MI  G
Sbjct  144  QAKVVGTLVTVGGAMLMTLIKGPTMDLPWT--KGTVNNTSQTGHPVQQDPIKGALMIATG  201

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF ILQAITL++YPAGLSLT+L+C MG ++   + LA++  NT+ WA++WD K L
Sbjct  202  CFCWSCFIILQAITLKAYPAGLSLTALLCFMGTIEGAAVALAMQWGNTSSWAIHWDAKFL  261

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY GI+CSGV YY+ GVIMKE+GP FV+AF+PL ++IVAI+GSF+LAE++ LGSV+GA
Sbjct  262  AAVYGGIMCSGVAYYVQGVIMKERGPVFVTAFSPLCMIIVAILGSFILAEEMYLGSVIGA  321

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I VGLYLV+W KS + 
Sbjct  322  TVIVVGLYLVVWGKSKDH  339



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 152/205 (74%), Gaps = 0/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+VTVGGAM+MTLV GP + LPWT+   H Q T +   Q PIKGA+MITAGC  
Sbjct  139  QAKILGTIVTVGGAMLMTLVNGPMLTLPWTRSTSHHQYTGSTASQDPIKGALMITAGCFC  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQA+TL+ YPA LSLT+ ICLMG L+  V  +A+E  NTA WA++ D KLL  V
Sbjct  199  WASFMILQAVTLKVYPAELSLTAWICLMGTLEGTVAAVAIEWHNTAAWAIHLDYKLLPAV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y G+ICSGV YY+ G++MKE+GP FV+AFNPLS+VIVAI+ S  L+E L LG V+GA +I
Sbjct  259  YGGVICSGVAYYIQGIVMKERGPVFVTAFNPLSMVIVAILSSIALSEILYLGRVMGAMVI  318

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLY+V+W KS +  S   S A +
Sbjct  319  IIGLYMVLWGKSKDHHSQTDSEAAD  343



>ref|XP_011094815.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
 ref|XP_011094816.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GTL TV GAMIMTLV+GP + LPWT+      +  +    QH IKGA+MIT GC 
Sbjct  141  QAKIIGTLATVAGAMIMTLVRGPNLDLPWTKVMTDPARQQSEVNLQHSIKGALMITVGCF  200

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQA+TLR+YPA LSLT+ ICL+G  Q   + L +E+ N+A WA+ WD K LA 
Sbjct  201  SWACFMILQAVTLRTYPAELSLTAWICLLGTAQGAAVALVMEKGNSAAWAIKWDTKFLAA  260

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI CSG+ YY+ GVIMKE+GP FV+AF+PLS+VIVAIM SF+LAEQ+ LG V+GA +
Sbjct  261  AYSGIFCSGIAYYVQGVIMKERGPVFVTAFSPLSMVIVAIMSSFILAEQMFLGRVVGAIV  320

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W K  +  SP  S  EE
Sbjct  321  IVMGLYLVVWGKKKDYGSP--SEGEE  344



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 165/233 (71%), Gaps = 8/233 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQS------TTAATHQHPIKGAIMI  833
            QAK+ GTLVTV GAMIMTLV+G  I LPWT+   HI S        A +HQ+P++GA+MI
Sbjct  135  QAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRH-SHINSQLTAADADANSHQNPVRGALMI  193

Query  832  TAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDI  653
            TAGC  W+ F+ILQAITL+SYPAGLSLT+LIC+ GALQ   LTL  E+SNTA+W +  D 
Sbjct  194  TAGCFCWSIFYILQAITLKSYPAGLSLTALICMGGALQGTALTLVAEKSNTAIWTIRGDT  253

Query  652  KLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSV  473
            KLLA VY+G++ SG+ YY++GV+ KEKGP F ++FNPLS+V VA+M SF+LAEQL +G V
Sbjct  254  KLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVMSSFILAEQLDVGKV  313

Query  472  LGACIIAVGLYLVIWSKS-DNQDSPVLSNAEEGsss*SATVYNYQSNSC*RRQ  317
             GA +I VGLYL IW K+ D ++S  L+   E       +  N  +N+    Q
Sbjct  314  SGAIVIVVGLYLFIWGKAKDKKESLTLNAQSEMVVEKQGSATNSSTNASKDNQ  366



>ref|XP_010067382.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=308

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 158/206 (77%), Gaps = 3/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGTLVT+GGAMIMTL KGP + LPWT+    H+     A  Q PI+GA+MITAGC 
Sbjct  67   QAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSASAHVDLDGVA--QKPIEGALMITAGCF  124

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA L+LT+LIC+ G  Q  V   A+ERSN+A W++ +D++LLAI
Sbjct  125  CWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAAWSIQFDVRLLAI  184

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ICSGVGYY+ GV+M+ KGP F++AFNPL +V+VAI+GSF+L E L LG V+GA +
Sbjct  185  VYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCLGRVIGALV  244

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W KS +Q +   S  +E
Sbjct  245  IVLGLYLVLWGKSKDQVAAGSSEKQE  270



>ref|XP_007009430.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18240.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=394

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 154/206 (75%), Gaps = 0/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGTL TVGGAMIMTLV GP + LPWT+     QST +AT   P+KGA+MI AGC  
Sbjct  137  QAKILGTLGTVGGAMIMTLVNGPILPLPWTKVTNEHQSTVSATKDDPLKGALMILAGCVC  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL+SYPA LSLT+L+C MGA++  ++ L +E  N A W+++WD KL A V
Sbjct  197  WACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAAWSIHWDSKLFAAV  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ICSGV YY+  ++++ KGP F +AFNPL++VIVAIM SF+ +E + LG V+GA +I
Sbjct  257  YSGVICSGVAYYVGAMVIQAKGPVFYAAFNPLTMVIVAIMSSFIFSEIMYLGRVIGAIVI  316

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEEG  377
             VGLYLV+W K+ +Q S    + EE 
Sbjct  317  VVGLYLVLWGKNKDQHSSDSDSNEEA  342



>gb|EYU41683.1| hypothetical protein MIMGU_mgv1a009185mg [Erythranthe guttata]
Length=350

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER-GHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GTL TV GAMIMTLV+GP I LPWT+    H       +  H IKGAIMIT GC 
Sbjct  99   QAKIIGTLATVAGAMIMTLVQGPHINLPWTRSGIDHAHHHGEVSLHHTIKGAIMITIGCL  158

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  +   L L +E+ N++ WA+ WD K LA 
Sbjct  159  AWACFMILQAITLKTYPAELSLTAWICLLGTAEGAALALVMEKGNSSAWAIKWDTKFLAA  218

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI CSG+ YY+ GV+MKE+GP FV+AF+PLS+V+VAIM SF+LAEQ+ LG ++GA +
Sbjct  219  AYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMVMVAIMSSFILAEQMFLGRIVGAIV  278

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I +GLY V+W K+ +  SP+  + E
Sbjct  279  IVLGLYFVVWGKAKDYKSPLGEDQE  303



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 158/206 (77%), Gaps = 3/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGTLVT+GGAMIMTL KGP + LPWT+    H+     A  Q PI+GA+MITAGC 
Sbjct  132  QAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSASAHVDLDGVA--QKPIEGALMITAGCF  189

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA L+LT+LIC+ G  Q  V   A+ERSN+A W++ +D++LLAI
Sbjct  190  CWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAAWSIQFDVRLLAI  249

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ICSGVGYY+ GV+M+ KGP F++AFNPL +V+VAI+GSF+L E L LG V+GA +
Sbjct  250  VYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCLGRVIGALV  309

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W KS +Q +   S  +E
Sbjct  310  IVLGLYLVLWGKSKDQVAAGSSEKQE  335



>ref|XP_008233583.1| PREDICTED: WAT1-related protein At2g37460-like isoform X3 [Prunus 
mume]
Length=282

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP + LPWT+   H +ST+A  HQ PIKG ++I AGC  W
Sbjct  75   AKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATDHQDPIKGTLLIGAGCFCW  134

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F  LQAITL+SYPA LSL + ICLMG +Q  V+ L  E  N A W+++WD KLLA VY
Sbjct  135  AGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHWDSKLLAAVY  194

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSGV YY+ G++MKE+GP FV+AF+PLS++IVA+M SF+LAE + LG V+GA +I 
Sbjct  195  SGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLGRVIGAMVIV  254

Query  451  VGLYLVIWSKSDNQ  410
            +GLY+V+W KS ++
Sbjct  255  IGLYMVLWGKSKDR  268



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 157/206 (76%), Gaps = 3/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGTLVT+GGAMIMTL KGP + LPWT+    H+     A  Q PI+GA+MITAGC 
Sbjct  141  QAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTSAHVDLDGVA--QKPIEGALMITAGCF  198

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA L+LT+LIC+ G  Q  V   A+ERSN A W++ +D++LLA+
Sbjct  199  CWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERSNFAAWSIQFDVRLLAV  258

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GIICSGVGYY+ GV+M+ KGP F++AFNPL +V+VAI+GSF+L E L LG V+GA +
Sbjct  259  VYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCLGRVIGALV  318

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W KS +Q +   S  +E
Sbjct  319  IVLGLYLVLWGKSKDQVAAGSSEKQE  344



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP +  PWT+   H +ST +  HQ PIKGAIMI AGC  W
Sbjct  135  AKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVSTVHQDPIKGAIMIAAGCFCW  194

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            +CF ILQAITL+SYPA LSLT+ ICL+G +Q     LA E +N   W++++D KLLA VY
Sbjct  195  SCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSIHFDYKLLAAVY  254

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+ YY+ G++MKE+GP FV+AF+PL+++I A+M SF+LAE + LG V+GA +I 
Sbjct  255  SGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAEIMYLGRVIGAMVIV  314

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
            +GLY+V+W KS +Q    L   ++
Sbjct  315  IGLYMVLWGKSKDQLPSELEKDDK  338



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            Q KI GT++TVGGAMIMTLV+GP I LPWT+   ++QS  AA  Q PIKGA+MI+AGC  
Sbjct  133  QIKIAGTIITVGGAMIMTLVRGPAINLPWTRADANVQSPAAANPQDPIKGALMISAGCFC  192

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQA+T++SYPA LSLTS+IC  GALQ  ++TL  ER N +VW++++D  L++ V
Sbjct  193  WASFHILQAMTVKSYPACLSLTSMICTAGALQGTIVTLVAERGNPSVWSIHFDTILMSYV  252

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G++ SGVGY +SG+IM+ KGP FV+AF+PLS+VIVA M +F+LAE+L  G V GA  I
Sbjct  253  YSGVVTSGVGYCISGIIMRAKGPVFVTAFSPLSMVIVAFMSTFILAERLTFGRVFGAISI  312

Query  454  AVGLYLVIWSKSDNQDSPVLS-NAEE  380
              GLYLVIW K  +Q SP  S N +E
Sbjct  313  VTGLYLVIWGKCKDQISPSKSTNVDE  338



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVTVGGAM+MTLVKGP   LPWT+ R + QS+T+   QHPIKGA+MITAGC  
Sbjct  141  QAKVVGTLVTVGGAMLMTLVKGPAPDLPWTKGRHYHQSSTS-QQQHPIKGALMITAGCVC  199

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF  LQA T++SYPA LSLT+LICLMGAL+  ++TL +E  N ++W +     L A++
Sbjct  200  WACFLNLQARTVKSYPAQLSLTTLICLMGALEGAMVTLIIEHGNASIWVIPKGPTLCAVL  259

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+CS + YY+ GVIM EKGP FVS+FNPLS++IVAI+ SF+ AE L LG VLGA +I
Sbjct  260  YGGIVCSAIAYYIQGVIMGEKGPVFVSSFNPLSMIIVAILSSFIFAEALYLGMVLGAVVI  319

Query  454  AVGLYLVIWSKSDNQDSPV  398
             +GLYL++W KS +Q   V
Sbjct  320  IIGLYLILWGKSKDQPEGV  338



>ref|XP_008233582.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Prunus 
mume]
Length=321

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP + LPWT+   H +ST+A  HQ PIKG ++I AGC  W
Sbjct  114  AKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATDHQDPIKGTLLIGAGCFCW  173

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F  LQAITL+SYPA LSL + ICLMG +Q  V+ L  E  N A W+++WD KLLA VY
Sbjct  174  AGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHWDSKLLAAVY  233

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSGV YY+ G++MKE+GP FV+AF+PLS++IVA+M SF+LAE + LG V+GA +I 
Sbjct  234  SGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLGRVIGAMVIV  293

Query  451  VGLYLVIWSKSDNQ  410
            +GLY+V+W KS ++
Sbjct  294  IGLYMVLWGKSKDR  307



>gb|KHG11891.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 154/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTT--AATHQHPIKGAIMITAGC  821
            QAKILGT+ TV GAMIMT+V GP + LPWT+   H QST   A  ++  +KGA+MI  GC
Sbjct  139  QAKILGTIGTVAGAMIMTIVYGPMLPLPWTKVNNHHQSTNTDAKNNEDALKGAVMILVGC  198

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF ILQAITL+SYPA LSLT+L+C MGA++ G++ L +ER N A WA++WD KL A
Sbjct  199  VCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGGIVALVMERGNAAAWAIHWDSKLFA  258

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
            +VY+GIICSGV YY+  ++++ KGP F ++FNPL++VIVAIM SF+ +E + LG V+GA 
Sbjct  259  VVYSGIICSGVAYYIGAMVIQAKGPVFFASFNPLTMVIVAIMSSFIFSEIMYLGRVIGAM  318

Query  460  IIAVGLYLVIWSKSDNQDSPVLSN  389
            +I VGLY+V+W KS +Q S   SN
Sbjct  319  VIVVGLYMVLWGKSKDQISSDSSN  342



>ref|XP_008233581.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Prunus 
mume]
Length=347

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP + LPWT+   H +ST+A  HQ PIKG ++I AGC  W
Sbjct  140  AKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSATDHQDPIKGTLLIGAGCFCW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F  LQAITL+SYPA LSL + ICLMG +Q  V+ L  E  N A W+++WD KLLA VY
Sbjct  200  AGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHWDSKLLAAVY  259

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSGV YY+ G++MKE+GP FV+AF+PLS++IVA+M SF+LAE + LG V+GA +I 
Sbjct  260  SGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLGRVIGAMVIV  319

Query  451  VGLYLVIWSKSDNQ  410
            +GLY+V+W KS ++
Sbjct  320  IGLYMVLWGKSKDR  333



>ref|XP_009347451.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=350

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP +  PWT+   H +ST +  HQ PIKGAIMI AGC  W
Sbjct  140  AKILGTIVTVGGAMLMTLINGPLLNFPWTRRNIHQESTVSTVHQDPIKGAIMIAAGCFCW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F ILQAITL SYPA LSL + ICL G +Q   + LA E +N   W++++D KLLA VY
Sbjct  200  AGFMILQAITLNSYPAELSLATWICLAGTVQGTAVALAFEWNNPIAWSIHFDFKLLAAVY  259

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSG+ YY+ GV+MKE+GP FV+AF+PLS++IVA+M SF+LAE + LG V+GA +I 
Sbjct  260  SGIICSGIAYYVQGVVMKERGPVFVTAFSPLSMIIVAVMSSFILAEIMYLGRVIGAMVIV  319

Query  451  VGLYLVIWSKSDNQDSPVLSNAEEGsss*SAT  356
            +GLY+V+W KS +Q   + S +E+  +   AT
Sbjct  320  IGLYMVLWGKSKDQ---LPSKSEKDDNMELAT  348



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 160/210 (76%), Gaps = 12/210 (6%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER--GHIQSTTAATHQHPIKGAIMITAGC  821
            QAK++GTLVTVGGAM+MTL+KGP I LPWT+ R   H   TT   HQ PIKG++MI AGC
Sbjct  143  QAKVVGTLVTVGGAMLMTLIKGPVINLPWTKGRVNNHGNQTTP-IHQDPIKGSLMIAAGC  201

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              W+CF ILQAITLR YPA L+LT+LICLMGA +  V+ LA++   +++W+++WD K LA
Sbjct  202  FCWSCFIILQAITLREYPAELTLTALICLMGAAEGAVVALALQWGKSSIWSIHWDAKFLA  261

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             +Y GI+CSGV YY+  VI+K++GP FV+AF+PL ++IVAI+GSF+LAEQ+ +GSV+GA 
Sbjct  262  ALYGGIVCSGVSYYIQAVIIKKRGPVFVTAFSPLCMIIVAILGSFILAEQMFVGSVIGAI  321

Query  460  IIAVGLYLVIWSK---------SDNQDSPV  398
            +I VGLYLV+W K         +DN+  PV
Sbjct  322  VIVVGLYLVVWGKIKDHVPSSPADNELIPV  351



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP +  PWT+   H +ST +  HQ PIKGAIMI AGC  W
Sbjct  127  AKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVSTVHQDPIKGAIMIAAGCFCW  186

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            +CF ILQAITL+SYPA LSLT+ ICL+G +Q     LA E +N   W++++D KLLA  Y
Sbjct  187  SCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSIHFDYKLLAAFY  246

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+ YY+ G++MKE+GP FV+AF+PL+++I A+M SF+LAE + LG V+GA +I 
Sbjct  247  SGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAEIMYLGRVIGAMVIV  306

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
            +GLY+V+W KS +Q    L   ++
Sbjct  307  IGLYMVLWGKSKDQLPSELEKDDK  330



>ref|XP_008371417.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKILGT+VTVGGAM+MTL+ GP +  PWT+   H +ST +  HQ PIKGAIMI AGC  W
Sbjct  140  AKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVSTVHQDPIKGAIMIAAGCFCW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A F ILQAITL SYPA L+L + ICL G +Q   + LA E +N  VW++++D KLLA VY
Sbjct  200  AGFMILQAITLNSYPAELTLATWICLAGTVQGTAVALAFEWNNPIVWSIHFDFKLLAAVY  259

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GIICSG+ YY+ GV+MKE+GP FV+AF+PLS++IVAIM S +LAE + LG V+GA +I 
Sbjct  260  SGIICSGIAYYIQGVVMKERGPVFVTAFSPLSMIIVAIMSSLILAEIMYLGRVIGAMVIV  319

Query  451  VGLYLVIWSKSDNQDSPVLSNAEEGsss*SAT  356
            +GLY+V+W KS +Q   + S +E+  +   AT
Sbjct  320  IGLYMVLWGKSKDQ---LPSESEKDDNMELAT  348



>ref|XP_010096638.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65306.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=361

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+VTVGGAM MTL  GP + LPW ++  HI ST  A +Q  IKGA+MI AGC  
Sbjct  118  QAKILGTIVTVGGAMFMTLFNGPVLNLPWAKQDNHIDSTKGAHNQVSIKGALMIGAGCVS  177

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F ILQAITL++YPA LSLT+LICLMG +Q   + LA+E  N A W++++D KLLA +
Sbjct  178  WSSFIILQAITLKAYPAELSLTALICLMGMVQGSAVALALEWGNPAAWSIHFDSKLLAAL  237

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ICSG+ YY+ G++M++KGP FV+AFNPL++VIVAIM SF+L+E + LG V+GA +I
Sbjct  238  YSGVICSGLTYYIQGIVMQDKGPVFVTAFNPLNMVIVAIMSSFILSETMYLGRVIGAAVI  297

Query  454  AVGLYLVIWSKSDNQDSP  401
              GLY+V+W KS  +D P
Sbjct  298  VAGLYMVLWGKS--KDEP  313



>ref|XP_004494994.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=330

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 153/205 (75%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GT+ TV GAM+MTL+KGP +   +  +  +  ++  +T QH I GA+MIT GC  
Sbjct  122  QAKVVGTIATVSGAMVMTLIKGPVLFGTFGSDSQNHHNSGIST-QHTIIGAVMITLGCFS  180

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL +YPA LSL+S ICL+G L+   + L VER N +VW++ WD++LL+ +
Sbjct  181  WACFIILQAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYSVWSIKWDVRLLSAI  240

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI CSG+GYYL GV+MK +GP FV+ FNPL +VIVAIMG F+LAEQ+ LG V+GA II
Sbjct  241  YTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILAEQMFLGRVVGAFII  300

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLYLV+W KS + +SP  SN EE
Sbjct  301  CLGLYLVVWGKSKDYNSPSKSNIEE  325



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT++T+GGAM+MTLV GP I LPWT+      S  + T  +P+KGA+ I  GC  
Sbjct  142  QAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSTTTTSVASPTELNPVKGALFILVGCFC  201

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNW-DIKLLAI  638
            WACF+ LQ ITL++YPAGLSLTSLIC+ GALQ   LTL VER N+AVW++ W   KL A 
Sbjct  202  WACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERGNSAVWSIQWGSSKLFAY  261

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GI+ SG+GYY+SG+IM  KGP FV+AFNPL++VIVAI+GSF+L+EQL LG V+GA +
Sbjct  262  VYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGSFILSEQLNLGRVVGAAV  321

Query  457  IAVGLYLVIWSKSDNQD-SPVLSNAEE  380
            I +GLYLVIW  +  Q  S +LS   E
Sbjct  322  IVIGLYLVIWGTTKEQKSSKILSTTTE  348



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQ-STTAATHQHPIKGAIMITAGCC  818
            QAK+LGT+VTVGGAMIMTLVKG K+ LPWT+    IQ S++A T Q  IKGA +I  GC 
Sbjct  139  QAKLLGTIVTVGGAMIMTLVKGAKLNLPWTEGYNDIQGSSSAPTMQDTIKGASLIGVGCI  198

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ F ILQAITL++YPA LSLT+ ICLMG ++  +  + +ER N + W++++D KLLA 
Sbjct  199  CWSAFIILQAITLKTYPAELSLTAFICLMGTIEGTIFAVIMERGNPSAWSIHFDTKLLAC  258

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ICSGV YY+ GVIMK KGP FV+AFNPL ++IV I+GSF+L+E +  G VLGA +
Sbjct  259  VYSGVICSGVAYYVQGVIMKSKGPVFVTAFNPLCMIIVTILGSFVLSEIVYFGRVLGALV  318

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W KS +Q SP  SN ++
Sbjct  319  IVIGLYLVLWGKSKDQ-SPSTSNNDD  343



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE--RGHIQSTTAATHQHPIKGAIMITAGC  821
            QAKILGT+VTVGGAM+MTLVKGP + LPWT      H +S+  +  Q P+KGA++I  GC
Sbjct  138  QAKILGTIVTVGGAMLMTLVKGPLVPLPWTDNPNNAHQESSNPSIKQDPVKGALLIAVGC  197

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WA F  LQAITL++YP  LSLT+ ICLMGA++  V+ L +ER N + W++  D KLLA
Sbjct  198  ICWAGFINLQAITLKTYPVELSLTAYICLMGAIEGTVVALVIERGNPSAWSIQLDSKLLA  257

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
            IVY+G+ICSG+ YY+ GV+MK +GP FV+AFNPLS+VIVAI+GSF+LAE + LG++LGA 
Sbjct  258  IVYSGVICSGIAYYVQGVVMKTRGPVFVTAFNPLSMVIVAILGSFVLAEVMFLGTILGAI  317

Query  460  IIAVGLYLVIWSKSDNQDS  404
            +I +GLY V+W KS + ++
Sbjct  318  VIVLGLYSVLWGKSKDDNA  336



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TVGGAMIMTL+KGP + L W +ERG + Q +   + QH IKG+IMIT GC 
Sbjct  138  QAKIVGTVATVGGAMIMTLMKGPILELFWVKERGTNPQQSGEISLQHTIKGSIMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  +  V+ L +ER N AVW++ W  KLLA 
Sbjct  198  SWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAVWSITWGTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ G++MK+KGP FV+AF+PLS+VIVAIM SF+L E+L  G VLGA +
Sbjct  258  VYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGERLYFGRVLGAVV  317

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I VGLYLV+W K  N+D    SN +
Sbjct  318  IIVGLYLVVWGK--NKDENCSSNED  340



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 159/208 (76%), Gaps = 3/208 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA-THQHPIKGAIMITAGCC  818
            QAKI+GT++T+GGAM+MTLV GP I LPWT+      ++ A+ T  +P+KGA+ I  GC 
Sbjct  142  QAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSSTATTSVASPTELNPVKGALFILVGCF  201

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNW-DIKLLA  641
             WACF+ LQ ITL++YPAGLSLTSLIC+ GALQ   LTL VER N+AVW++ W   KL+A
Sbjct  202  CWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERGNSAVWSIQWGSSKLIA  261

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY GI+ SG+GYY+SG+IM  KGP FV+AFNPL++VIVAI+GSF+L+EQL LG V+GA 
Sbjct  262  SVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGSFILSEQLNLGRVVGAA  321

Query  460  IIAVGLYLVIWSKSDNQD-SPVLSNAEE  380
            +I +GLYLVIW  +  Q  S +LS  EE
Sbjct  322  VIVIGLYLVIWGTTKEQKSSKILSTNEE  349



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAAT--HQHPIKGAIMITAGC  821
            QAKI+GT VT GGAMIMTL+ GP I LPWT+      + T+A+     PIKGA+ I AGC
Sbjct  140  QAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTATSASLTELQPIKGALFIAAGC  199

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF+ LQAITL++YPA LSLT LIC  GA+Q   LTL  ER NT++W+++ D KLL+
Sbjct  200  ICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAERGNTSIWSIHLDTKLLS  259

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY+G++ SGVGYY+SG+IMK+KGP FV+AFNPL++VIVAI+GSF+L+EQL LG VLG  
Sbjct  260  YVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILGSFILSEQLNLGRVLGGA  319

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            II +GLYLVIW KS +Q     S+ ++
Sbjct  320  IIVIGLYLVIWGKSKDQKLSKYSSTDD  346



>ref|XP_011080962.1| PREDICTED: WAT1-related protein At2g39510-like [Sesamum indicum]
Length=379

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA-THQHPIKGAIMITAGCC  818
             AKI+GT+VTVGGAMIMTL+ GP I LPWT +     S++ +  H++P+KGA+MI AGC 
Sbjct  137  HAKIVGTMVTVGGAMIMTLLSGPVIPLPWTHKSHQSHSSSNSNDHENPVKGALMIGAGCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             ++ F+ILQA+TL++YPAGLSLT+LIC  GAL+  VLT  VER NTA+WAL W+ KLLA 
Sbjct  197  GYSLFYILQAVTLKTYPAGLSLTALICTFGALEGTVLTFIVERGNTAIWALGWNAKLLAY  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GI+ SGV YYLSGVIMK KGP F++AFNP ++VIVAI+ SF+  EQ+ +G V GA +
Sbjct  257  VYGGIVASGVTYYLSGVIMKHKGPVFLTAFNPCTMVIVAILSSFIFHEQMTVGKVTGALV  316

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I  GLY VIW KS +Q   V
Sbjct  317  IVTGLYFVIWGKSKDQKEEV  336



>ref|XP_009778858.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAMIMTLV+GP I L WT+     +S +   +  H IKG++MIT GC 
Sbjct  116  QAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLMITIGCF  175

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+ WD K LA 
Sbjct  176  SWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAA  235

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVAI+ SF+L EQ+ LG VLGA +
Sbjct  236  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVV  295

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQ  341
            I +GLY+V+W KS +Q SP   +A+E +     T +  +
Sbjct  296  IVLGLYIVLWGKSKDQKSP---SADEQAIPTQETTHENK  331



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAMIMTLV+GP I L WT+     +S +   +  H IKG++MIT GC 
Sbjct  137  QAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLMITIGCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+ WD K LA 
Sbjct  197  SWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAA  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVAI+ SF+L EQ+ LG VLGA +
Sbjct  257  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVV  316

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQ  341
            I +GLY+V+W KS +Q SP   +A+E +     T +  +
Sbjct  317  IVLGLYIVLWGKSKDQKSP---SADEQAIPTQETTHENK  352



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            A ILGT+VTVGGAM+MTL+ GP +  PWT+   H +ST +  HQ PIKG IM+ AGC  W
Sbjct  135  AMILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVSTVHQDPIKGGIMLAAGCFCW  194

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            +CF ILQAITL+SYPA LSLT+ ICL+G +Q     LA E +N   W++++D KLLA VY
Sbjct  195  SCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSIHFDYKLLAAVY  254

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+ YY+ G++MKE+GP FV+AF+PLS++I A+M SF+LAE + LG V+GA +I 
Sbjct  255  SGIMCSGIAYYIQGMVMKERGPVFVTAFSPLSMIITAVMSSFILAEIMYLGRVIGAMVIV  314

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
            +GLY+V+W KS +Q    L   ++
Sbjct  315  IGLYMVLWGKSKDQLPSELEKDDK  338



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 165/240 (69%), Gaps = 15/240 (6%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQS------TTAATHQHPIKGAIMI  833
            QAK+ GTLVTV GAMIMTLV+G  I LPWT+   HI S        A +HQ+P++GA+MI
Sbjct  135  QAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRH-SHINSQLTAADADANSHQNPVRGALMI  193

Query  832  TAGCCFWACFFILQ-------AITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAV  674
            TAGC  W+ F+ILQ       AITL+SYPAGLSLT+LIC+ GALQ   LTL  E+SNTA+
Sbjct  194  TAGCFCWSIFYILQKKLTYLQAITLKSYPAGLSLTALICMGGALQGTALTLVAEKSNTAI  253

Query  673  WALNWDIKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAE  494
            W +  D KLLA VY+G++ SG+ YY++GV+ KEKGP F ++FNPLS+V VA+M SF+LAE
Sbjct  254  WTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVMSSFILAE  313

Query  493  QLLLGSVLGACIIAVGLYLVIWSKS-DNQDSPVLSNAEEGsss*SATVYNYQSNSC*RRQ  317
            QL +G V GA +I VGLYL IW K+ D ++S  L+   E       +  N  +N+    Q
Sbjct  314  QLDVGKVSGAIVIVVGLYLFIWGKAKDKKESLTLNAQSEMVVEKQGSATNSSTNASKDNQ  373



>emb|CDP00045.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWA  809
            KI GT VTVGGAMIMTLVKGP I LPWT+    + S+T A  Q PIKGA+M+ AGC  WA
Sbjct  141  KIAGTAVTVGGAMIMTLVKGPTIGLPWTKADTGVHSSTVANPQDPIKGALMLAAGCFCWA  200

Query  808  CFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYN  629
             F+ LQAITL+SYPAGLSLTS+IC+ GALQ  V+TL  ER N+++W++++D  LL  VY 
Sbjct  201  NFYNLQAITLKSYPAGLSLTSMICMAGALQAIVVTLVAERGNSSIWSIHFDTILLCYVYC  260

Query  628  GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAV  449
            G+I SGV YY++G+I++ KGP FV+AFNPLS+VIVAIM SF+L+E+L  G V GA II +
Sbjct  261  GLINSGVTYYVTGLILRSKGPVFVAAFNPLSMVIVAIMSSFILSERLNFGRVFGAVIIML  320

Query  448  GLYLVIWSKSDNQ  410
            GLYLVIW KS ++
Sbjct  321  GLYLVIWGKSKDK  333



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 154/213 (72%), Gaps = 2/213 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT+VTVGGAM+MTLVKG ++ LPWT+      ST   T Q PIKGA+MIT GC  
Sbjct  139  QAKIIGTIVTVGGAMLMTLVKGTQLDLPWTKGYDQHASTGGLTKQDPIKGALMITTGCAC  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQAITL+SYP  LSLT+ IC MG ++  VL + +ER N + W++  D KLLA V
Sbjct  199  WASFIILQAITLKSYPVELSLTAWICFMGTIEGTVLAVVMERGNPSAWSIALDYKLLAAV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ CSG+ YY+ G+IMK +GP FV+AFNPLS+VIVAI+GSF L E L LG V GA +I
Sbjct  259  YSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLKEILYLGRVFGAVVI  318

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEEGsss*SAT  356
              GLYLV+W KS  +D P  +++ +   + SAT
Sbjct  319  VTGLYLVLWGKS--KDEPPSNSSNDHKVAASAT  349



>ref|XP_009614497.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAMIMTLV+GP I L WT+     +S +   +  H IKG+++IT GC 
Sbjct  116  QAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLLITIGCF  175

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+ WD K LA 
Sbjct  176  SWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAA  235

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVAI+ SF+L EQ+ LG VLGA +
Sbjct  236  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVV  295

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYN  347
            I +GLY+V+W KS +Q SP  S  E+   +   T  N
Sbjct  296  IVLGLYIVLWGKSKDQKSP--STDEQAIPTQETTHEN  330



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            Q+K++GT+ TV GAMIMTLVKGP + L WT+  GH Q T+AAT  Q  IKG++MIT GC 
Sbjct  136  QSKLVGTVATVAGAMIMTLVKGPLLHLFWTRP-GHEQHTSAATSLQDSIKGSLMITVGCF  194

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSL++ IC +G L+     L +ER N AVW++ WD KLLA 
Sbjct  195  CWACFMILQAITLKTYPAELSLSAWICALGTLEGTAAALVMERGNAAVWSIKWDTKLLAA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI CSG+ YY+ GV+MK +GP FV+AF+PLS+VIVA+M SF+L EQ+ LG +LGA +
Sbjct  255  SYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQMFLGRLLGAVV  314

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I  GLYLV+W K+ + +SP  +  +E
Sbjct  315  IIAGLYLVVWGKAKDHESPEKTIGDE  340



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAMIMTLV+GP I L WT+     +S +   +  H IKG+++IT GC 
Sbjct  137  QAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNSSHESQSGGLNLSHAIKGSLLITIGCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+ WD K LA 
Sbjct  197  SWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIKWDTKFLAA  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVAI+ SF+L EQ+ LG VLGA +
Sbjct  257  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNLGRVLGAVV  316

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYN  347
            I +GLY+V+W KS +Q SP  S  E+   +   T  N
Sbjct  317  IVLGLYIVLWGKSKDQKSP--STDEQAIPTQETTHEN  351



>ref|XP_002312071.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE89438.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=380

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 158/221 (71%), Gaps = 1/221 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI GT+VTVGGAM+MTLVKG ++ LPWT+      ST+A T Q PIKGA+MI  GC  
Sbjct  137  QAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGYDQQASTSALTKQDPIKGALMIATGCVC  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQ+ITL+SYP  LSLT+ IC MG ++  ++ + +ER N + W++  + KLLA V
Sbjct  197  WASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAWSVGLNYKLLAAV  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ICSG+GYY+ G+IMK KGP FV+AF+PLS+VIVAI+GSF L E L +G V+GA +I
Sbjct  257  YSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVAILGSFFLKEILCVGRVIGAVVI  316

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
              GLYLV+W KS +Q  P  S+ ++  +  + T    Q  +
Sbjct  317  VTGLYLVLWGKSKDQ-PPSDSSDDKAEAIVTQTATEMQERT  356



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER-GHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TVGGAMIMTL+KGP + L W +ER  + Q     + QH IKG+IMIT GC 
Sbjct  131  QAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISLQHTIKGSIMITIGCF  190

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  +  V+ L +ER N AVW++ W  KLLA 
Sbjct  191  SWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAVWSITWGTKLLAA  250

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ G++MK+KGP FV+AF+PLS+VIVAIM SF+L E+L  G VLGA +
Sbjct  251  VYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGERLYFGRVLGAVV  310

Query  457  IAVGLYLVIWSKSDNQD  407
            I VGLYLV+W K+ +++
Sbjct  311  IIVGLYLVVWGKNKDEN  327



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 156/222 (70%), Gaps = 7/222 (3%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQE----RGHIQSTTAATHQHPIKGAIMITAG  824
            AK++GTL TV GAMIMTLVKGP I LPW +E      H       +  H + GAIMI  G
Sbjct  145  AKMVGTLTTVTGAMIMTLVKGPHIHLPWNKEGLSNNNHSTQKGEISFHHSVTGAIMIAIG  204

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  WACF ILQ ITLR+YPA LSLT+ IC++GA++ GV+ L +E    A W+L WDIKLL
Sbjct  205  CLCWACFMILQVITLRAYPAELSLTAWICVLGAVEGGVVALIMENDKLA-WSLKWDIKLL  263

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A+ Y+GIICSG+ YY+ GV++KE+GP FV+AF+PLS+V+VA++ SF+L+EQ+ LG V+GA
Sbjct  264  AVAYSGIICSGIAYYVQGVVLKERGPVFVTAFSPLSMVLVAVLSSFILSEQMYLGRVIGA  323

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQS  338
             II +GLYLVIW K  + +SP   N E+      +   N QS
Sbjct  324  IIIIMGLYLVIWGKKKDYNSP--CNKEQEMQVNQSVDMNAQS  363



>ref|XP_008370940.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+V VGGAM+MTL+ GP +  PWT+   H +ST +  HQ  IKGAIM+ AGC  
Sbjct  139  QAKILGTIVMVGGAMLMTLINGPMLNFPWTRRNPHHESTVSTDHQDHIKGAIMVAAGCFC  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F  LQAITL+SYPA LSLT  ICL G +Q   + LA E +N   W++++D KLLA+V
Sbjct  199  WAGFVTLQAITLKSYPAELSLTVWICLAGTVQGFAVALAFEWNNLTAWSIHFDSKLLAVV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+CSG+ +Y+ G++MKE+GP FV+AFNPLSL+IVA+M SF+LAE + LG V+GA +I
Sbjct  259  YCGIMCSGIAFYIQGIVMKERGPVFVTAFNPLSLIIVAVMSSFILAEIMYLGRVIGAIVI  318

Query  454  AVGLYLVIWSKSDNQ  410
             +GLY+V+W KS +Q
Sbjct  319  VIGLYMVLWGKSKDQ  333



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MTL+ GP + LPW      H+ S+ AA   H IKGA+MI  GC 
Sbjct  134  QAKILGTMVTVGGAMLMTLINGPMLNLPWANPNNQHVFSSAAAKQDH-IKGAVMIAVGCF  192

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA LSLT+LICL+G ++  ++ LA E  N A W+++ D+K LA 
Sbjct  193  CWAGFIILQAITLKSYPAELSLTALICLVGTIEGSIVALAREAGNAAAWSVHLDVKFLAA  252

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G++CSGVGYYL  VIMK +GP FV+AFNPL++VIVAI+GSF+L+E L  G V+GA +
Sbjct  253  VYGGVVCSGVGYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEVLYSGRVIGAIV  312

Query  457  IAVGLYLVIWSKSDNQDSPVLS  392
            I +GLYLV+W KS +Q S  L 
Sbjct  313  IVIGLYLVLWGKSKDQPSSNLD  334



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER-GHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TVGGAMIMTL+KGP + L W +ER  + Q     + QH IKG+IMIT GC 
Sbjct  138  QAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISLQHTIKGSIMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  +  V+ L +ER N AVW++ W  KLLA 
Sbjct  198  SWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAVWSITWGTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ G++MK+KGP FV+AF+PLS+VIVAIM SF+L E+L  G VLGA +
Sbjct  258  VYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGERLYFGRVLGAVV  317

Query  457  IAVGLYLVIWSKSDNQD  407
            I VGLYLV+W K+ +++
Sbjct  318  IIVGLYLVVWGKNKDEN  334



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            Q+K++GT+ TV GAMIMTLVKGP + L WT+   H Q T+AAT  Q  IKG++MIT GC 
Sbjct  136  QSKLVGTVATVAGAMIMTLVKGPLLHLFWTRA-SHEQHTSAATSLQDSIKGSLMITVGCF  194

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSL++ IC +G L+   + L +ER N AVW++ WD KLLA 
Sbjct  195  CWACFMILQAITLKTYPAELSLSAWICALGTLEGTAVALVMERGNAAVWSIKWDTKLLAA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI CSG+ YY+ GV+MK +GP FV+AF+PLS+VIVA+M SF+L EQ+ LG +LGA +
Sbjct  255  SYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQMFLGRLLGAVV  314

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I  GLYLV+W K+ + +SP  +  +E
Sbjct  315  IIAGLYLVVWGKAKDYESPEKTIEDE  340



>ref|XP_011077436.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 153/222 (69%), Gaps = 3/222 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GTL TV GAMIMTLV+GP I LPWT+E   H         QH IKGA+MI  GC 
Sbjct  143  QAKIVGTLATVAGAMIMTLVRGPDIPLPWTKEGSKHGNHQGEIDLQHSIKGAVMIIIGCF  202

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQ ITL++YPA LSLT+ ICLMG ++  ++ L +E+ N   W+L WDI+  A 
Sbjct  203  SWACFMILQVITLQTYPAELSLTAWICLMGTVEGAIVALIMEKGNATAWSLKWDIRFFAA  262

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI CSG+ YY+ GV+MKE+GP FV+AF+PLS+++VAI+ SF+LAE+L LG V+GA +
Sbjct  263  AYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMILVAILSSFILAEKLYLGRVIGAMV  322

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I VGLY V+W K  +   P  S  E+      +   + QSN+
Sbjct  323  IIVGLYFVVWGKRKDYKPP--SAGEQEPPVNQSGNIDDQSNA  362



>emb|CBI32681.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAK++GT+ TV GAM+MTLVKGP I L WT+ R +       T+ H  IKG++MITAGC 
Sbjct  149  QAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQGVKGGGTNIHDSIKGSLMITAGCF  208

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  Q  ++ L +ER  T+VW+++WD K LA 
Sbjct  209  SWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMERGKTSVWSIHWDTKFLAA  268

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            +Y+GI+CSG+ YY+ GV+MK++GP FV+AFNPLS++IVA+M SF+LAEQ+ LG V+GA +
Sbjct  269  LYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSSFILAEQMYLGRVIGAIV  328

Query  457  IAVGLYLVIWSKSDNQDS  404
            I  GLY V+W KS    S
Sbjct  329  IVAGLYFVVWGKSKEYKS  346



>ref|XP_002274909.2| PREDICTED: WAT1-related protein At2g37460-like [Vitis vinifera]
Length=396

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAK++GT+ TV GAM+MTLVKGP I L WT+ R +       T+ H  IKG++MITAGC 
Sbjct  143  QAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQGVKGGGTNIHDSIKGSLMITAGCF  202

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G  Q  ++ L +ER  T+VW+++WD K LA 
Sbjct  203  SWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMERGKTSVWSIHWDTKFLAA  262

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            +Y+GI+CSG+ YY+ GV+MK++GP FV+AFNPLS++IVA+M SF+LAEQ+ LG V+GA +
Sbjct  263  LYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSSFILAEQMYLGRVIGAIV  322

Query  457  IAVGLYLVIWSKSDNQDS  404
            I  GLY V+W KS    S
Sbjct  323  IVAGLYFVVWGKSKEYKS  340



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAMIMTLV+GP + L WT    GH   +      H IKG+IMIT GC 
Sbjct  137  QAKIVGTVATVAGAMIMTLVRGPIVELFWTTGNAGHNSQSGGLNLSHAIKGSIMITIGCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+NWD K LA 
Sbjct  197  SWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGKPAVWAINWDSKFLAA  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVA++ + +L EQL LG VLGA +
Sbjct  257  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAVLSTIILREQLNLGRVLGAVV  316

Query  457  IAVGLYLVIWSKSDNQDSPVLSN  389
            I VGLY+V+W KS +  SP +  
Sbjct  317  IVVGLYIVLWGKSKDHKSPSIDE  339



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GT+ TV GAMIMTLV+GP + L WT    GH   +      H IKG+IMIT GC 
Sbjct  137  QAKLVGTVATVAGAMIMTLVRGPIVELFWTAGNAGHDSQSGGLNLSHAIKGSIMITIGCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITLR+YPA LSLT+ ICL+G  +  ++ + +ER   AVWA+NWD K LA 
Sbjct  197  SWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGKPAVWAINWDSKFLAA  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GVIMK++GP FV+AFNPLS+VIVAI+ + +L EQL LG VLGA +
Sbjct  257  VYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSTIILREQLNLGRVLGAVV  316

Query  457  IAVGLYLVIWSKSDNQDSPVLSN  389
            I VGLY+V+W KS +  SP +  
Sbjct  317  IVVGLYIVLWGKSKDHKSPSIDE  339



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 157/214 (73%), Gaps = 8/214 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL TV GAMIMTL+KGP + L WT+  G    +IQ+ +AA   + Q+ IKG++M
Sbjct  136  QAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIKGSLM  195

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITL++YPA LSLT+ IC +G ++   + L +ER N  VW + WD
Sbjct  196  ITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFMERGNATVWFIQWD  255

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+ AEQL LG 
Sbjct  256  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILSTFIFAEQLFLGR  315

Query  475  VLGACIIAVGLYLVIWSK-SDNQDSPVLSNAEEG  377
            ++GA +I  GLYLV+W K  D + SP  ++  + 
Sbjct  316  LVGAVVIVAGLYLVVWGKGKDYKSSPAPTDEHKA  349



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 158/213 (74%), Gaps = 10/213 (5%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL  V GAMIMTLVKGP + L WT+  G    +IQ+ +AA   + Q+ I+G++M
Sbjct  136  QAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIEGSLM  195

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITLR+YPA LSLT+ IC +G ++  V+ L +ER N   W + WD
Sbjct  196  ITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIMERGNATAWFIQWD  255

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+LAEQL LG 
Sbjct  256  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQLFLGR  315

Query  475  VLGACIIAVGLYLVIWSK-SDNQDSPVLSNAEE  380
            ++GA +I  GLYLV+W K  D + SP  S+ +E
Sbjct  316  LVGAVVIVAGLYLVVWGKGKDYKSSP--SSTDE  346



>ref|XP_011023754.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g39510-like 
[Populus euphratica]
Length=351

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI GT+VTVGGAM+MTLVKG ++ LPWT+      ST+A T Q PIKGA+MI  GC  
Sbjct  137  QAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGYDQQASTSALTKQDPIKGALMIATGCVC  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQ+ITL+SYP  LSLT+ IC MG ++  ++ + +ER N + W++  + KLLA V
Sbjct  197  WASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAWSVGLNYKLLAAV  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ICSG+GYY+ G+IMK KGP FV+AF+PLS+VIV I+GSF L E L +G V+GA +I
Sbjct  257  YSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVTILGSFFLKEILYVGRVIGAVVI  316

Query  454  AVGLYLVIWSKSDNQ  410
              GLYLV+W KS +Q
Sbjct  317  VTGLYLVLWGKSKDQ  331



>ref|XP_010554433.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=355

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQ-STTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MTLVKGP + LPWT    + Q ++   T Q  +KGAI+I  GC 
Sbjct  120  QAKILGTIVTVGGAMLMTLVKGPLVPLPWTNNHSNSQGASNPETKQDLVKGAILIGVGCI  179

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYPA LSLT+ +CL GA+   ++ L +ER+N A W++ +D KLLA+
Sbjct  180  CWAGFINLQAITLKSYPAELSLTAYMCLSGAIGGTIVALVIERANPAAWSIQFDSKLLAV  239

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ICSG+ YY+ G +MK +GP FV+AFNPLS+VIVAI+GSFLLAE + LG +LGA +
Sbjct  240  VYSGVICSGISYYIQGAVMKTRGPVFVTAFNPLSMVIVAILGSFLLAEVMFLGRILGAVV  299

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLY V+W KS ++ +
Sbjct  300  IVLGLYSVLWGKSKDEPA  317



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK+LGT+ TV GAM+MTL+KGP +   +        S+  + H H I G+++IT GC  
Sbjct  140  QAKVLGTIATVSGAMVMTLMKGPILFETFGDHSQSYHSSGTSAH-HTILGSVLITIGCFS  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL +YPA LSL+S ICL GA++   L L +ER+N +VW++ WD++LL+ +
Sbjct  199  WACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERNNPSVWSIKWDMRLLSAI  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI CSG+GYYL GV+MK +GP FV+ FNP  +VIVAIMG FLLAEQ+ LG V+GA II
Sbjct  259  YTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYFLLAEQMFLGRVIGAFII  318

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLYLV+W KS + ++P  + +EE
Sbjct  319  CLGLYLVVWGKSKDYNNPSNAISEE  343



>ref|XP_004302750.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            Q K+LGT  TV GAMIMTLVKGP + L WT+     Q  T     H  IKGA+MITAGC 
Sbjct  139  QCKLLGTAATVAGAMIMTLVKGPLLKLFWTRATTSNQQQTNGVDIHSSIKGALMITAGCF  198

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQ++TLR+YPA LSL++ ICLMG L+   + L +ER N AVWA++WD KLLA 
Sbjct  199  CWACFMILQSMTLRTYPAELSLSAWICLMGTLEGTAVALVMERGNAAVWAIHWDGKLLAA  258

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ GV+MK +GP FV+AF+PLS+VIVA+M SF+L EQL LG +LGA +
Sbjct  259  VYSGIFCSGLAYYIQGVVMKHRGPVFVTAFSPLSMVIVAVMSSFILREQLFLGRLLGAFV  318

Query  457  IAVGLYLVIWSKSDNQDSP  401
            I +GLYLV+W KS  + SP
Sbjct  319  IIIGLYLVVWGKS-KEKSP  336



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 156/222 (70%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  S+     Q   KGA++I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLIATGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+LICLMG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAIMGS +L+E + LG +LGA +
Sbjct  252  VYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++ +   S+ ++     +  V ++ S +
Sbjct  312  IVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQVVSFSSKA  353



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT+VTVGGAM+MTLVKG ++ LPWT+      ST     Q PIKGA+MIT GC  
Sbjct  139  QAKIIGTIVTVGGAMLMTLVKGTQLDLPWTKGYDQHPSTGGLIKQDPIKGALMITIGCVC  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQAITL++YP  LSLT+ IC MG ++  VL + +ER N + W++  D KLLA V
Sbjct  199  WASFIILQAITLKTYPVELSLTAWICFMGTIEGTVLAVVMERGNPSAWSIALDYKLLAAV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ CSG+ YY+ G+IMK +GP FV+AFNPLS+VIVAI+GSF L E L LG V GA +I
Sbjct  259  YSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLKEILYLGRVFGAVVI  318

Query  454  AVGLYLVIWSKSDNQDSPVLSNAE  383
              GLYLV+W KS ++     SN +
Sbjct  319  VTGLYLVLWGKSKDEPPSNSSNDK  342



>gb|AFK43964.1| unknown [Medicago truncatula]
Length=291

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK+LG + TV GAM+MTL+KGP +   +        S+  + H H I G+++IT GC  
Sbjct  67   QAKVLGIIATVSGAMVMTLMKGPILFETFGDHSQSYHSSGTSAH-HTILGSVLITIGCFS  125

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL +YPA LSL+S ICL GA++   L L +ER+N +VW++ WD++LL+ +
Sbjct  126  WACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERNNPSVWSIKWDMRLLSAI  185

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI CSG+GYYL GV+MK +GP FV+ FNP  +VIVAIMG FLLAEQ+ LG V+GA II
Sbjct  186  YTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYFLLAEQMFLGRVIGAFII  245

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLYLV+W KS + ++P  + +EE
Sbjct  246  CLGLYLVVWGKSKDYNNPSNAISEE  270



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAAT--HQHPIKGAIMITAGC  821
            QAKI+GT VT GGAMIM L+ GP I LPWT+      + T+A+     PIKGA+ I AGC
Sbjct  140  QAKIVGTTVTFGGAMIMALIGGPTIGLPWTRHLLSTTTATSASLTELQPIKGALFIAAGC  199

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF+ LQAITL++YPA LSLT LIC  GA++   LTL  ER NT++WA++ D KLL+
Sbjct  200  ICWACFYNLQAITLKTYPAALSLTCLICSAGAVEGTALTLVAERGNTSIWAIHLDTKLLS  259

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY+G++ SG+GYY+SG+IMK+KGP FV+AFNPL++V+VAI+GSF+L+EQL LG VLG  
Sbjct  260  YVYSGMVTSGLGYYVSGLIMKDKGPVFVTAFNPLNMVLVAILGSFILSEQLNLGRVLGGA  319

Query  460  IIAVGLYLVIWSKSDNQ  410
            II +GLYLVIW KS +Q
Sbjct  320  IIVIGLYLVIWGKSKDQ  336



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA--THQHPIKGAIMITAGCC  818
            AKILGT  T+GGAMIMTLV+G  I LPWT+   + +S      T Q P+KGA+MIT GC 
Sbjct  136  AKILGTFATLGGAMIMTLVQGSIIGLPWTKIEPNSESADGVVITTQDPVKGALMITVGCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              + F+ILQAIT++SY A LSLT LIC+ G LQ  VLTLAVER N ++W++ WD KLLA 
Sbjct  196  CCSIFYILQAITMKSYAAPLSLTCLICMAGMLQGIVLTLAVERGNFSIWSIGWDTKLLAY  255

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+G+ICSGV YY+SG++M EKGP FV++FNPL++VIVA++ SF+ AEQL +G V+GA +
Sbjct  256  TYSGVICSGVSYYVSGIVMNEKGPVFVTSFNPLNMVIVAVLSSFIFAEQLNIGKVIGATV  315

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I  GLYLVIW K+ +Q    + + E
Sbjct  316  IVFGLYLVIWGKTQDQRETAIIDQE  340



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 157/214 (73%), Gaps = 8/214 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL TV GAMIMTL+KGP + L WT+  G    +IQ+ +AA   + Q+ IKG++M
Sbjct  196  QAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIKGSLM  255

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITL++YPA LSLT+ IC +G ++   + L +ER N  VW + WD
Sbjct  256  ITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFMERGNATVWFIQWD  315

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+ AEQL LG 
Sbjct  316  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILSTFIFAEQLFLGR  375

Query  475  VLGACIIAVGLYLVIWSK-SDNQDSPVLSNAEEG  377
            ++GA +I  GLYLV+W K  D + SP  ++  + 
Sbjct  376  LVGAVVIVAGLYLVVWGKGKDYKSSPAPTDEHKA  409



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 149/206 (72%), Gaps = 1/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQ-STTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MTLVKGP I LPW     H Q S+     Q   KGA++I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTLVKGPLIPLPWANPNDHHQDSSNTGVKQDLTKGAMLIATGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ ICLMG+++  ++ L +ER N + W++  D KLLA 
Sbjct  192  CWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWSIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYAGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLY V+W KS ++ S  L   +E
Sbjct  312  IVLGLYSVLWGKSKDEPSSFLDMDKE  337



>gb|KDP29854.1| hypothetical protein JCGZ_18429 [Jatropha curcas]
Length=348

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK+LGT+VTVGGAM+MTL+KG  + LPW++   +  ST A T    IKGA MI  GC  W
Sbjct  112  AKVLGTIVTVGGAMLMTLIKGAILELPWSKGYDNQASTAAVTPHDTIKGAFMIGIGCLCW  171

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            +CF ILQAITL++YPA LSLT+LIC MG ++  +  + +E+ N + W++++D KLLA VY
Sbjct  172  SCFIILQAITLKTYPAELSLTALICFMGTIEGSIFAVIMEKGNPSAWSIHFDSKLLAAVY  231

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY+ GVIMK KGP FV+AFNPLS+VIV I+GSF+L+E + LG ++GA +I 
Sbjct  232  SGVMCSGIAYYVQGVIMKAKGPVFVTAFNPLSMVIVTILGSFVLSEIMYLGRIIGALVIV  291

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
             GLYLV+W KS ++     SN +E
Sbjct  292  TGLYLVLWGKSKDKSPLASSNDKE  315



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 158/213 (74%), Gaps = 10/213 (5%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL  V GAMIMTLVKGP + L WT+  G    +IQ+ +AA   + Q+ I+G++M
Sbjct  196  QAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIEGSLM  255

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITLR+YPA LSLT+ IC +G ++  V+ L +ER N   W + WD
Sbjct  256  ITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIMERGNATAWFIQWD  315

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+LAEQL LG 
Sbjct  316  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQLFLGR  375

Query  475  VLGACIIAVGLYLVIWSK-SDNQDSPVLSNAEE  380
            ++GA +I  GLYLV+W K  D + SP  S+ +E
Sbjct  376  LVGAVVIVAGLYLVVWGKGKDYKSSP--SSTDE  406



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 156/222 (70%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  S+     Q   KGA++I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLIATGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+LICLMG+++  ++ L +ER N + WA+  D KL+A 
Sbjct  192  CWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDSKLVAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAIMGS +L+E + LG +LGA +
Sbjct  252  VYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++ +   S+ ++     +  V ++ S +
Sbjct  312  IVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQVVSFSSKA  353



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 156/222 (70%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  S+     Q   KGA++I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLIATGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+LICLMG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GIICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +L+E + LG +LGA +
Sbjct  252  VYGGIICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++ +   S+ ++     +  V ++ S +
Sbjct  312  IVLGLYSVLWGKSKDEPANSFSDTDKELPLSNIQVVSFSSKA  353



>ref|XP_004493899.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=361

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKI-LLPWTQERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + +         IQ    A  QHPIKG+IMIT GC 
Sbjct  117  QAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANLQHPIKGSIMITIGCF  176

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAITL +YPA LSLT+ ICL+G ++ G++ L +ER   +VW+LNWD KLLA 
Sbjct  177  SCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLNWDTKLLAA  236

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +M+ +GP FV+ FNPL +VIVAIMGSF LAE++ LG V+GA +
Sbjct  237  VYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAEKIYLGRVIGAVV  296

Query  457  IAVGLYLVIWSKSDNQDSP  401
            I  GLYLV+W KS + DSP
Sbjct  297  IIFGLYLVVWGKSKDYDSP  315



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 154/211 (73%), Gaps = 7/211 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL  V GAMIMTL+KGP + L WT+  G    +IQ+ +AA   + Q+ I+G++M
Sbjct  136  QAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIEGSLM  195

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITL++YPA LSLT  IC +G ++  V+ L +ER N   W + WD
Sbjct  196  ITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIMERGNATAWFIQWD  255

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+LAEQL LG 
Sbjct  256  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQLFLGR  315

Query  475  VLGACIIAVGLYLVIWSKSDNQDSPVLSNAE  383
            ++GA +I  GLYLV+W K  + +S   S  E
Sbjct  316  LVGAVVIVAGLYLVVWGKGKDYNSSPSSTDE  346



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKI-LLPWTQERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + +         IQ    A  QHPIKG+IMIT GC 
Sbjct  138  QAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANLQHPIKGSIMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAITL +YPA LSLT+ ICL+G ++ G++ L +ER   +VW+LNWD KLLA 
Sbjct  198  SCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLNWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +M+ +GP FV+ FNPL +VIVAIMGSF LAE++ LG V+GA +
Sbjct  258  VYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAEKIYLGRVIGAVV  317

Query  457  IAVGLYLVIWSKSDNQDSP  401
            I  GLYLV+W KS + DSP
Sbjct  318  IIFGLYLVVWGKSKDYDSP  336



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAA-THQHPIKGAIMITAGC  821
            Q+K+ GT  TV GAMIMTLVKGP + L WT+    H Q T  A + Q  IKGA+MIT GC
Sbjct  141  QSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAISLQSSIKGAVMITIGC  200

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF ILQ+ITL++YPA LSL++ ICLMG L+   L L +ER N+AVWA+ WD KLLA
Sbjct  201  FCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSAVWAIKWDAKLLA  260

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y+ + CSG+ YY+ GV+MK +GP FV+AF+PLS+VIVA+M SF+L EQL LG +LGA 
Sbjct  261  ACYSAVFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQLYLGRLLGAA  320

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            +I  GLY+V+W KS +  S   +  EE
Sbjct  321  VIVAGLYMVVWGKSKDYKSETPTIEEE  347



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATH-QHPIKGAIMITAGC  821
            Q+K+ GT  TV GAMIMTLVKGP + L WT+    H Q T  A   Q  IKGAIMIT GC
Sbjct  141  QSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAVSLQSSIKGAIMITIGC  200

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF ILQ+ITL++YPA LSL++ ICLMG L+   L L +ER N+AVWA+ WD KLLA
Sbjct  201  FCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSAVWAIKWDAKLLA  260

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y+ + CSG+ YY+ G++MK +GP FV+AF+PLS+VIVA+M SF+L EQL LG +LGA 
Sbjct  261  ACYSAVFCSGLAYYIQGIVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQLYLGRLLGAA  320

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            +I  GLY+V+W KS +  S   +  EE
Sbjct  321  VIITGLYMVVWGKSKDYKSETPTIEEE  347



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 151/222 (68%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  ++     Q   KGA++I  GC 
Sbjct  132  QAKILGTIVTVGGAMLMTVVKGPMIPLPWANPNDIHQDASNPGVKQDLTKGALLIAVGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LS+T+ IC MG+L+  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GIICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++ S    + +      S  +  + S +
Sbjct  312  IVLGLYSVLWGKSKDEPSSPFPDMDRELPLSSPQIVTFSSKA  353



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 154/211 (73%), Gaps = 7/211 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAA---THQHPIKGAIM  836
            QAK+ GTL  V GAMIMTL+KGP + L WT+  G    +IQ+ +AA   + Q+ I+G++M
Sbjct  222  QAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSIEGSLM  281

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            ITAGC  WACF ILQAITL++YPA LSLT  IC +G ++  V+ L +ER N   W + WD
Sbjct  282  ITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIMERGNATAWFIQWD  341

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             KLLA VY+GI+CSGV YY+ GV+MK++GP FV+AFNPLS+VIVAI+ +F+LAEQL LG 
Sbjct  342  TKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQLFLGR  401

Query  475  VLGACIIAVGLYLVIWSKSDNQDSPVLSNAE  383
            ++GA +I  GLYLV+W K  + +S   S  E
Sbjct  402  LVGAVVIVAGLYLVVWGKGKDYNSSPSSTDE  432



>gb|KHG29314.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=296

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 170/239 (71%), Gaps = 3/239 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VT GGAM+MTL+ GP + LPWT+    H+ S+ +A  Q PIKGA+MI  GC 
Sbjct  49   QAKILGTIVTFGGAMLMTLINGPMLPLPWTKSNNNHVFSSASAVKQDPIKGALMIIFGCF  108

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA LSLT+ ICL G +   ++ LA+E  N AVW++++D+KLLA 
Sbjct  109  CWAGFIILQAITLKSYPAELSLTAFICLAGTIGGSIVALAMEAGNAAVWSIHFDVKLLAA  168

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ICSG+ YY+ GVIM+ +GP FV+AFNPLS+VIVAI+ SF+L+E L LG ++GA +
Sbjct  169  VYSGVICSGITYYVQGVIMRSRGPVFVTAFNPLSMVIVAILSSFILSEILYLGRIIGAIV  228

Query  457  IAVGLYLVIWSKSDNQ--DSPVLSNAEEGsss*SATVYNYQSNSC*RRQFSMVEERTPN  287
            I +GLY+V+W KS +Q   +  +   E  +      + ++Q++    + F +V + T N
Sbjct  229  IVIGLYMVLWGKSKDQCSSNQNIKVEEASNDQKMIVIDDHQTSIISDQDFVVVLDLTSN  287



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 145/198 (73%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+VTVGGAM+MT+VKGP I LPWT     H  S+         KGA++I  GC 
Sbjct  132  QAKIIGTIVTVGGAMLMTVVKGPLIPLPWTNPNENHQDSSNPGVKPDLTKGALLIATGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ ICLMG+++  ++ L +ER N A WA+  D KLLA 
Sbjct  192  CWAAFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPAAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            +Y G+ICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +L+E + LG +LGA +
Sbjct  252  IYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLY V+W KS ++ S
Sbjct  312  IVIGLYSVLWGKSKDEPS  329



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 151/222 (68%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  ++     Q   KGA++I  GC 
Sbjct  132  QAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDLTKGALLIAVGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ IC MG+L+  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFINLQAITLKSYPVELSLTACICFMGSLESTIVALYIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GIICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++ S    + ++     +  +  + S  
Sbjct  312  IVLGLYSVLWGKSKDEPSSPFPDMDKELPLSTPQIVTFSSKE  353



>ref|XP_010097389.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB67895.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=357

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GT  TV GAM+MT++KGP + L WT+  R     +   +  H IKG++MIT GC 
Sbjct  118  QAKVVGTTATVAGAMVMTVMKGPILDLFWTRGTRVDEARSGGISLSHSIKGSLMITVGCF  177

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL++YPA LSLT+ ICL+G L+   + L +ER N +VW+L WD KL+A 
Sbjct  178  SWACFMILQAITLKTYPAELSLTAWICLLGTLEGTAVALVMERGNASVWSLKWDTKLMAA  237

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            +Y+G++CSG+ YY+ GVIM+++GP FV+AF PL +VIVAIMGS  LAEQL LG V+GA I
Sbjct  238  LYSGVVCSGLAYYIQGVIMRDRGPVFVTAFCPLCMVIVAIMGSLFLAEQLYLGRVIGATI  297

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I VGLYLV+W KS +  S   S  E
Sbjct  298  IIVGLYLVVWGKSKDYKSSTTSLDE  322



>gb|KHG12592.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=230

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = -3

Query  952  MIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWACFFILQAITLRS  773
            M+MTL+KGP + LPW +       ++AATHQ+PIKGAIMIT GC  WA F ILQAITL+S
Sbjct  1    MLMTLIKGPMLQLPWIKSDDDHAFSSAATHQYPIKGAIMITIGCFSWAAFIILQAITLKS  60

Query  772  YPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYNGIICSGVGYYLS  593
            YPA LSLT+LICL+G ++  ++ +A+E  N AVW+++ D KLLA VY+G+ICSG+ YY+ 
Sbjct  61   YPAELSLTALICLVGTIEGCIVAVAMEAGNAAVWSIHLDAKLLAAVYSGVICSGIAYYVQ  120

Query  592  GVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAVGLYLVIWSKSDN  413
            G++MK +GP FV+AF+PLS+V++AI  SF+L+E L LG V+GA +I VGLYLV+W KS +
Sbjct  121  GMVMKTRGPVFVTAFSPLSMVVIAIFSSFILSEILYLGRVIGAIVIVVGLYLVLWGKSKD  180

Query  412  QDSPVLSNAEEG  377
            Q S       EG
Sbjct  181  QRSSNQDIQMEG  192



>ref|XP_009337582.1| PREDICTED: WAT1-related protein At2g39510 [Pyrus x bretschneideri]
Length=350

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGTLVTVGGAM++TL+ GP +  PWT+   H +ST +  HQ  IKGAIM+ AGC  
Sbjct  139  QAKILGTLVTVGGAMLLTLINGPMLNFPWTRRNPHHESTVSTDHQDHIKGAIMVAAGCFC  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F  L AITL+SYPA LSLT+ ICL+G +Q   + +A E +N   W++++D KLLA V
Sbjct  199  WAGFVNLLAITLKSYPAELSLTAWICLVGTVQGSAVAVAFEWNNPTSWSIHFDSKLLAAV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSG+ YY+ G++MKE+GP FV++F+PL ++IVA+M SF+LAE + LG  +GA +I
Sbjct  259  YSGIMCSGIAYYIQGMVMKERGPVFVTSFSPLIMIIVAVMSSFILAEIMYLGRAIGAIVI  318

Query  454  AVGLYLVIWSKSDNQ  410
             +GLY+V+W KS +Q
Sbjct  319  VIGLYMVLWGKSKDQ  333



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ--ERGHIQSTTAATHQHPIKGAIMITAGC  821
            QAKILGT+VTVGGAM+MT+VKGP I LPW    +  H  ++     Q   KGA++I  GC
Sbjct  132  QAKILGTIVTVGGAMLMTVVKGPLIPLPWANPSDMHHQDASNPGVKQDLTKGALLIAIGC  191

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WA F  LQAITL+SYP  LS+T+ IC MG+L+  ++ L +ER N + WA+  D KLLA
Sbjct  192  ICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWAIQLDSKLLA  251

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY G+ICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA 
Sbjct  252  AVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYLGRILGAV  311

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            +I +GLY V+W KS +Q S    + ++
Sbjct  312  VIVLGLYSVLWGKSKDQPSSSFPDMDK  338



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 148/206 (72%), Gaps = 1/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  S+     Q   KGA +I  GC 
Sbjct  132  QAKILGTIVTVGGAMLMTVVKGPLIPLPWANPHDIHQDSSNTGVKQDLTKGASLIAIGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ IC +G+++  ++ L +ER N + WA++ D KLLA 
Sbjct  192  CWAGFINLQAITLKSYPVELSLTAYICFLGSIESTIVALFIERGNPSAWAIHLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLY V+W KS ++ S   S+ ++
Sbjct  312  IVLGLYSVLWGKSKDEPSSSFSDMDK  337



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 146/206 (71%), Gaps = 1/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H   +     Q   KGA +I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTVVKGPLIPLPWANPHDIHQDPSNTGVQQDLTKGASLIAIGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ IC MG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFINLQAITLKSYPVELSLTAYICFMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLY V+W KS ++ S   S+ ++
Sbjct  312  IVLGLYSVLWGKSKDEPSSSFSDTDK  337



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 150/222 (68%), Gaps = 1/222 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP I LPW      H  ++     Q   KGA++I  GC 
Sbjct  132  QAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDLTKGALLIAVGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ IC MG+L+  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFINLQAITLKSYPVELSLTAYICFMGSLESTIVALYIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GIICSG+GYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNS  332
            I +GLY V+W KS ++      + +      +  +  + S +
Sbjct  312  IVLGLYSVLWGKSKDEPPSSFPDMDTELPLSTPQIVTFSSKA  353



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + L  T     H Q       QH IKG++MIT GC 
Sbjct  138  QAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHAIKGSVMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAIT+ +YPA LSLT+ ICL+G ++ GV+ L +ER N + W+L WD KLLA 
Sbjct  198  SCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAWSLQWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +MK++GP FV+ FNPL +VIVAIMGSF LAE + LG V+GA +
Sbjct  258  VYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEIMYLGRVVGAIV  317

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLYLV+W KS++ +S
Sbjct  318  IILGLYLVVWGKSNDYES  335



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 147/205 (72%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP + LPW      H  S+         KGA++I  GC 
Sbjct  132  QAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDSHQDSSNPGVTPDLTKGALLIAIGCI  191

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ ICLMG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  192  CWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  251

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  252  VYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYLGRILGAIV  311

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I +GLY V+W KS ++ S   S+ +
Sbjct  312  IVLGLYSVLWGKSKDEPSNSFSDMD  336



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 147/205 (72%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP + LPW      H  S+         KGA++I  GC 
Sbjct  133  QAKILGTVVTVGGAMLMTVVKGPLVPLPWVNPNDSHQDSSNPGVTPDLTKGALLIAIGCI  192

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAITL+SYP  LSLT+ ICLMG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  193  CWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  252

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  253  VYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYLGRILGAIV  312

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I +GLY V+W KS ++ S   S+ +
Sbjct  313  IVLGLYSVLWGKSKDEPSNSFSDMD  337



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 144/198 (73%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + L  T     H Q       QH IKG++MIT GC 
Sbjct  138  QAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGVNLQHAIKGSVMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAIT+ +YPA LSLT+ ICL+G ++ GV+ L +ER N + W+L WD KLLA 
Sbjct  198  SCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAWSLQWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +MK++GP FV+ FNPL +VIVAIMGSF LAE + LG  +GA +
Sbjct  258  VYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEIMYLGRAVGAIV  317

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLYLV+W KS + +S
Sbjct  318  IILGLYLVVWGKSQDYES  335



>gb|AFK37263.1| unknown [Lotus japonicus]
Length=386

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 148/201 (74%), Gaps = 3/201 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ--ERGHIQSTTAATHQHPIKGAIMITAGC  821
            QAK+ GTL TV GAM+MTL+KGP++ L  T      HIQ       QH IKG++MIT GC
Sbjct  138  QAKVFGTLATVAGAMVMTLIKGPELELFGTHGGSSTHIQHNGGVNLQHAIKGSVMITIGC  197

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTA-VWALNWDIKLL  644
              +A F ILQAITL +YPA LSLT+ ICL+G ++ G++ L +ER N A VW+LNW+  LL
Sbjct  198  FSFAGFMILQAITLEAYPADLSLTAWICLLGTVEGGIVALVMERGNPAPVWSLNWNTSLL  257

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY GI+CSG+ YY+ G +MK KGP FV+ F+PL ++IVAI+GSF+LAEQ+ LG V+GA
Sbjct  258  AAVYGGIVCSGMTYYIQGAVMKYKGPVFVTTFSPLCMIIVAILGSFILAEQMYLGRVIGA  317

Query  463  CIIAVGLYLVIWSKSDNQDSP  401
             +I +GLYLV+W K+ + DSP
Sbjct  318  IVILLGLYLVVWGKNKDYDSP  338



>emb|CDP06652.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 148/205 (72%), Gaps = 13/205 (6%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-------HPIKGAIM  836
            QAKI+GT+ TVGGAM+MTL++GP I LPWT+       TT+  HQ       + IKGA+ 
Sbjct  99   QAKIVGTVATVGGAMLMTLLRGPVIKLPWTK------GTTSPEHQSGGINLQNSIKGALF  152

Query  835  ITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWD  656
            IT G   W+CF +LQAITLR+YPA LSLT+ ICL+G  +  +L L +ER   AVW++NWD
Sbjct  153  ITIGYFGWSCFMVLQAITLRAYPAELSLTAWICLLGTAEGAILALIMERGKAAVWSINWD  212

Query  655  IKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
             K LA +Y+G+ CSG+ YY+ GV+MK++GP FV+AF+PL++VIVA++ SF+L E + LG 
Sbjct  213  TKFLAALYSGVFCSGLAYYIQGVVMKQRGPVFVTAFSPLNMVIVAVLSSFILHELMDLGR  272

Query  475  VLGACIIAVGLYLVIWSKSDNQDSP  401
            VLGA  I VGLYLV+W K  + D P
Sbjct  273  VLGAITIVVGLYLVVWGKRKDYDCP  297



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 144/198 (73%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + L  T     H Q       QH IKG++MIT GC 
Sbjct  138  QAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGVNLQHAIKGSVMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAIT+ +YPA LSLT+ ICL+G ++ GV+ L +ER N + W+L WD KLLA 
Sbjct  198  SCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAWSLQWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +MK++GP FV+ FNPL +VIVAIMGSF LAE + LG  +GA +
Sbjct  258  VYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEIMYLGRAVGAIV  317

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLYLV+W KS + +S
Sbjct  318  IILGLYLVVWGKSQDYES  335



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 147/205 (72%), Gaps = 1/205 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGT+VTVGGAM+MT+VKGP + LPW      H  S+         KGA++I  GC 
Sbjct  133  QAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDNHQDSSNPGVTPDLTKGALLIAIGCI  192

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F  LQAIT++SYP  LSLT+ ICLMG+++  ++ L +ER N + WA+  D KLLA 
Sbjct  193  CWAGFVNLQAITIKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAIQLDSKLLAA  252

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSGVGYY+ GVIMK +GP FV+AFNPLS+VIVAI+GS +LAE + LG +LGA +
Sbjct  253  VYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYLGRILGAIV  312

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I +GLY V+W KS ++ S   S+ +
Sbjct  313  IVLGLYSVLWGKSKDEPSNSFSDMD  337



>ref|XP_007009429.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18239.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=436

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 150/197 (76%), Gaps = 0/197 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGTL TVGGAMIMTLV GP + LPWT+ +   QST +AT   P+KGA+MI AGC  
Sbjct  137  QAKILGTLGTVGGAMIMTLVNGPILPLPWTKVKNEHQSTVSATKDDPLKGALMILAGCVC  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL+SYPA LSLT+L+C MGA++  ++ L +E  N A W+++WD KL A  
Sbjct  197  WACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAAWSIHWDSKLFAAA  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G+ICSGV YY+  ++++ KGP F +AFNPL++VIVAIM SF+ +E + LG V+G  +I
Sbjct  257  YSGVICSGVAYYVGAMVIQAKGPVFFAAFNPLTMVIVAIMSSFIFSEIMYLGRVIGVIVI  316

Query  454  AVGLYLVIWSKSDNQDS  404
             VGLYLV+W KS +Q S
Sbjct  317  VVGLYLVLWGKSKDQHS  333


 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = -3

Query  688  SNTAVWALNWDIKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGS  509
            + TA    N D  LL    +G++CSGV YYL  VIMK +GP FV+AFNPL++VIVAI+GS
Sbjct  356  NETAAVTSNQDFVLL----DGVVCSGVAYYLQAVIMKARGPVFVTAFNPLTMVIVAILGS  411

Query  508  FLLAEQLLLGSVLGACIIAVGLYLV  434
            F+L+E L LG V+GA +I  GLYLV
Sbjct  412  FVLSEVLYLGRVIGAILIVTGLYLV  436



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKI-LLPWTQERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAM+MTL+KGP + L    +    IQ       QH +KG+IMIT GC 
Sbjct  138  QAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNLQHAVKGSIMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQA+TL +YPA LSLT+ ICL+G ++ G++ L +ER   +VW+L+WD KLLA 
Sbjct  198  SCACFTILQAVTLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLSWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ GV+M+ +GP FV+ FNPL +VIVAIM  F+LAE++ LG V+GA +
Sbjct  258  VYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAEKIYLGRVIGAVV  317

Query  457  IAVGLYLVIWSKSDNQDSP  401
            I +GLYLV+W KS + D P
Sbjct  318  IILGLYLVVWGKSKDYDRP  336



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKI-LLPWTQERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GT+ TV GAM+MTL+KGP + L    +    IQ       QH +KG+IMIT GC 
Sbjct  138  QAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNLQHAVKGSIMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQA+TL +YPA LSLT+ ICL+G ++ G++ L +ER   +VW+L+WD KLLA 
Sbjct  198  SCACFTILQAVTLEAYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLSWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ GV+M+ +GP FV+ FNPL +VIVAIM  F+LAE++ LG V+GA +
Sbjct  258  VYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAEKIYLGRVIGAVV  317

Query  457  IAVGLYLVIWSKSDNQDSP  401
            I +GLYLV+W KS + D P
Sbjct  318  IILGLYLVVWGKSKDYDRP  336



>emb|CDX79734.1| BnaC03g20700D [Brassica napus]
Length=362

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGASAPNTAGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N   WA+ WD KL+   Y
Sbjct  199  ACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWAIGWDTKLITATY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
             GI+CSG+GYY+ G++MK KGP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  TGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW KS +   P
Sbjct  319  AGLYLVIWGKSKDYKYP  335



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GTL TV GAM+MTL+KGP + L  T     H Q       QH IKG++MIT GC 
Sbjct  138  QAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHAIKGSVMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAIT+ +YPA LSLT+ ICL+G ++ GV+ L +ER N + W+L WD KLLA 
Sbjct  198  SCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAWSLQWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ G +MK++GP FV+ FNPL +VIVAIMGSF  AE + LG V+GA +
Sbjct  258  VYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFPAEIMYLGRVVGAIV  317

Query  457  IAVGLYLVIWSKSDNQDS  404
            I +GLYLV+W KS++ +S
Sbjct  318  IILGLYLVVWGKSNDYES  335



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 147/206 (71%), Gaps = 1/206 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-QHPIKGAIMITAGCC  818
            QAK++GTL TV GAMIMTL+KGP + L  T             + QH IKG++MIT GC 
Sbjct  138  QAKVVGTLATVAGAMIMTLLKGPILDLFGTHGNNTNNLQNGGVNLQHAIKGSVMITIGCF  197

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
              ACF ILQAIT+ +YPA LSLT+ ICL+G ++ G++ L +ER+N + W+L WD KLLA 
Sbjct  198  SCACFMILQAITIEAYPAELSLTAWICLLGTVEGGIVALVMERNNFSAWSLQWDTKLLAA  257

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSG+ YY+ GV+MK++GP FV+ FNPL +VIVAIMGSF LAEQ+ LG  +GA +
Sbjct  258  VYSGIVCSGMAYYIQGVVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEQMYLGRAVGAIV  317

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLYLV+W KS +  S      E+
Sbjct  318  IILGLYLVVWGKSKDYGSSSAITEED  343



>emb|CDY07788.1| BnaA03g17230D [Brassica napus]
Length=362

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGASAPNTVGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N   WA+ WD KL+   Y
Sbjct  199  ACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWAIGWDTKLITATY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+GYY+ G++MK KGP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW KS +   P
Sbjct  319  AGLYLVIWGKSKDYKYP  335



>ref|XP_009133180.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
Length=362

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGASAPNTVGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N   WA+ WD KL+   Y
Sbjct  199  ACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWAIGWDTKLITATY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+GYY+ G++MK KGP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW KS +   P
Sbjct  319  AGLYLVIWGKSKDYKYP  335



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 156/235 (66%), Gaps = 11/235 (5%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-----HIQSTTAATHQH-PIKGAIMI  833
            QAK++GT+ TV GAM+MT+VKGP + L +   +G     H Q T+   + H  IKGA+MI
Sbjct  138  QAKVVGTIATVAGAMVMTVVKGPPVDL-FNSTKGMRIYHHNQQTSDDVNLHNSIKGALMI  196

Query  832  TAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDI  653
            T GC  WACF ILQAITL++YPA LSLT+ ICL G ++  ++ L +ER N +VW+LN DI
Sbjct  197  TIGCFGWACFVILQAITLKTYPAELSLTAWICLFGTIEGSIVALVMERGNPSVWSLNLDI  256

Query  652  KLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSV  473
            KL   VY+G++CSG  YY+ GV+MK++GP FV+AF+PL +VIVA+M S +LAEQ+ LG V
Sbjct  257  KLATAVYSGVVCSGFAYYIQGVVMKDRGPVFVTAFSPLCMVIVAVMSSIILAEQMFLGRV  316

Query  472  LGACIIAVGLYLVIWSK----SDNQDSPVLSNAEEGsss*SATVYNYQSNSC*RR  320
            +GA II  GLYLV+W K     D   SP+ +  E    +     ++ Q      R
Sbjct  317  IGAIIIVGGLYLVVWGKGKDYKDESSSPIPTKQEMEKETHEKENFDQQVTQSVHR  371



>ref|XP_011019904.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Populus 
euphratica]
Length=348

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 1/215 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAK+ GT+ TV GAM+MTL+KGP I     + R + ++ T+    H  IKGA+MIT GC 
Sbjct  133  QAKVAGTIATVAGAMLMTLMKGPLIEFFRIKGRAYHENGTSGIDLHSSIKGALMITVGCF  192

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL+SYP  LSLT+ ICL+G ++  V+ L  E+   +VWA+NWD+KLLA 
Sbjct  193  SWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSVWAINWDMKLLAA  252

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+G+ CSG+ YY+ G++MK++GP FV+AF+PL +VIVA+M S + AEQ+ LG +LGA I
Sbjct  253  VYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIIWAEQMYLGRILGALI  312

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATV  353
            I  GLYLV+W KS +  +      E+       TV
Sbjct  313  IVAGLYLVVWGKSKDYKTASPPADEQTIPVKQTTV  347



>ref|XP_010554592.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=378

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHI--QSTTAATHQHPIKGAIMITAGC  821
            QAKI GT+VTVGGAM+MTLV+GP + LPW      I  ++        P+KGAI+I  G 
Sbjct  138  QAKIFGTIVTVGGAMLMTLVRGPLVPLPWNTNPDIIDREAPNPEIENQPLKGAILIVVGS  197

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WA F  LQAITL+SYP  LSLT+ ICLMGA++  +    +ER N A W++ +D KLLA
Sbjct  198  ICWAGFINLQAITLKSYPFELSLTAYICLMGAIEGTLAAFLIERGNPAAWSVQFDSKLLA  257

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY+G+ICSG+ YY+ G+IMK +GP FV+AF+PL +VIVAI+GSF+LAE   LG+VLGA 
Sbjct  258  AVYSGVICSGIAYYVQGLIMKTRGPVFVTAFSPLKMVIVAILGSFVLAEVFFLGTVLGAI  317

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            +I +GLY V+W KS ++ +P      E
Sbjct  318  VIVLGLYSVLWGKSKDEPAPFSDMDNE  344



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 158/240 (66%), Gaps = 17/240 (7%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ----ERGHIQSTTAATHQHPIKGAIMITA  827
            QAKI+GT+ TVGGAM+MTL+KGP  L  W++    +   ++    + H   IKG+IMI  
Sbjct  137  QAKIVGTVATVGGAMMMTLIKGPA-LTSWSKNTATDHNGVKPLDISVHD-AIKGSIMIII  194

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
            GC  WA F ILQAITL++YP  LSLT+ ICL+G L+   L L +E+  ++VWA+NWD  L
Sbjct  195  GCFSWAAFVILQAITLKTYPVELSLTAWICLLGTLEGTALALVMEKGRSSVWAINWDANL  254

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
            LA VY+GI CSG+ Y++ GV+MKE+GP FV+AF+PL +VIVAI+ +F +AE++ LG VLG
Sbjct  255  LAAVYSGIFCSGLLYFIQGVVMKERGPVFVTAFSPLCMVIVAILSTFFMAEKMYLGRVLG  314

Query  466  ACIIAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNYQSNSC*RRQFSMVEERTPN  287
            A +I VGLY+VIW K  + D+P L   ++     +  V           QF   E+  PN
Sbjct  315  AVVIVVGLYMVIWGKGKDYDAPPLDEEDKTGEKVTTQV-----------QFQGPEQDNPN  363



>ref|XP_003542469.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=379

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTL TV GAM+MTL+KGP +LL   +   H Q     + QH I G IMIT GC  
Sbjct  136  QAKVVGTLATVSGAMVMTLLKGP-VLLGSHRSNDHGQHN-GTSMQHTITGFIMITIGCFS  193

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL++YPA LSL++ ICLMG ++   + L +ER N +VW+L  D+KLL  V
Sbjct  194  WACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSVWSLKLDMKLLCAV  253

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+CSG+GYYL GV+MK +GP FV+AF+PL +VIVA+M  F+LAEQ+ LG ++GA II
Sbjct  254  YTGIVCSGMGYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFLGRMIGAVII  313

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLY+V+W KS +  SP   N +E
Sbjct  314  CLGLYVVVWGKSKDY-SPPNPNTQE  337



>ref|XP_006410931.1| hypothetical protein EUTSA_v10017814mg [Eutrema salsugineum]
 gb|ESQ52384.1| hypothetical protein EUTSA_v10017814mg [Eutrema salsugineum]
Length=281

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 142/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWA  809
            K++GT VTVGGAM+MTLVKGP + L WT+E    Q+T      + IKGAI +T GC  +A
Sbjct  42   KVVGTAVTVGGAMVMTLVKGPVLNLFWTKEPSA-QNTAGTDIHNSIKGAIFVTIGCFSYA  100

Query  808  CFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYN  629
            CF ILQAITL+ YPA LSLT+LICLMG ++  ++ L +ER N + W + WD+KLL + Y+
Sbjct  101  CFHILQAITLKIYPAELSLTALICLMGTIEGAIVALVMERGNLSAWTIGWDMKLLTVSYS  160

Query  628  GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAV  449
            GI+CS +GYY+ GV+M+  GP FV+AF  L ++ VAIM S + +EQ+ LG VL A +I  
Sbjct  161  GIVCSALGYYIGGVVMRTNGPMFVTAFKTLCMIAVAIMSSIIFSEQMYLGRVLDAAVICA  220

Query  448  GLYLVIWSKSDNQDSPVLSNAEE  380
            GLYL IW K+ + ++P     EE
Sbjct  221  GLYLEIWVKTKDYENPFTPQTEE  243



>gb|KHN48995.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTL TV GAM+MTL+KGP +LL   +   H Q     + QH I G IMIT GC  
Sbjct  136  QAKVVGTLATVSGAMVMTLLKGP-VLLGSHRSNDHGQHN-GTSMQHTITGFIMITIGCFS  193

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL++YPA LSL++ ICLMG ++   + L +ER N +VW+L  D+KLL  V
Sbjct  194  WACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSVWSLKLDMKLLCAV  253

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+CSG+GYYL GV++K +GP FV+AF+PL +VIVA+M  F+LAEQ+ LG ++GA II
Sbjct  254  YTGIVCSGMGYYLQGVVIKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFLGRMIGAVII  313

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLY+V+W KS +  SP   N +E
Sbjct  314  CLGLYVVVWGKSKDY-SPPNPNTQE  337



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 150/217 (69%), Gaps = 3/217 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GT+ TV GAMIMTL+KGP +L        H Q+   +T QH + G +MIT GC  
Sbjct  139  QAKVVGTVATVSGAMIMTLIKGP-VLFGSHVSNAHSQNNGTST-QHSMTGFVMITIGCFC  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA F ILQAITL++YPA LSL++ ICLMG ++   + L +ER + +VW+L +D++LL  V
Sbjct  197  WASFMILQAITLKTYPAALSLSAWICLMGTIEGAAVALVMERGHPSVWSLKFDMRLLCAV  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI CSGVGYYL GV+MK +GP FV+AF+PL ++IVAIMG F+LAEQ+ LG ++GA II
Sbjct  257  YAGITCSGVGYYLQGVVMKSRGPVFVTAFSPLCMIIVAIMGFFILAEQVFLGRMIGAIII  316

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATVYNY  344
             +GLY V+W KS +  SP   N EE          NY
Sbjct  317  CLGLYSVVWGKSKDY-SPSDPNTEEPIVDMDNAKENY  352



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 152/209 (73%), Gaps = 7/209 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA-----THQHPIKGAIMIT  830
            QAKILGT+VTVGGAMIMT ++GP + LPWT+    + ++++       HQ+ I G +MIT
Sbjct  137  QAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAASPDHQNQIVGFLMIT  196

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  WA F  LQAITL+ YPA LSLT+LICL+G +    + L +ER N + WAL++D +
Sbjct  197  TGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVIERGNVSAWALHFDSQ  256

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            LLA+VY+G+ICSGV YY+ GV+M+ KGP F ++FNPL++++VAIM  F+L+E + LG ++
Sbjct  257  LLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIMSFFILSEIMFLGRMI  316

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAE  383
            G  II  GLY+V+W KS  QD P + N+E
Sbjct  317  GVVIIICGLYMVLWGKS--QDEPPVLNSE  343



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 152/209 (73%), Gaps = 7/209 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA-----THQHPIKGAIMIT  830
            QAKILGT+VTVGGAMIMT ++GP + LPWT+    + ++++       HQ+ I G +MIT
Sbjct  137  QAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAASPDHQNQIVGFLMIT  196

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  WA F  LQAITL+ YPA LSLT+LICL+G +    + L +ER N + WAL++D +
Sbjct  197  TGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVIERGNVSAWALHFDSQ  256

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            LLA+VY+G+ICSGV YY+ GV+M+ KGP F ++FNPL++++VAIM  F+L+E + LG ++
Sbjct  257  LLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIMSFFILSEIMFLGRMI  316

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAE  383
            G  II  GLY+V+W KS  QD P + N+E
Sbjct  317  GVVIIICGLYMVLWGKS--QDEPPVLNSE  343



>ref|XP_010419331.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g37450-like 
[Camelina sativa]
Length=382

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GTL TVGG M+MTLVKGP + L WT+     Q+TT       IKGAI++T GC  +
Sbjct  141  AKVVGTLTTVGGTMMMTLVKGPALDLFWTKGPSA-QNTTGTDIHSSIKGAILVTIGCFSY  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQAITL++YPA LSL + ICLMG ++  V+ L +E+ N A WA+ WD KLL + Y
Sbjct  200  ACFMILQAITLKTYPAELSLATWICLMGTVEGAVVALVIEKGNPAAWAIGWDNKLLTVTY  259

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ GV+MK +GP FV+AF PL + +VAI  S + AEQ+ LG  LGA II 
Sbjct  260  SGIMCSALGYYIGGVVMKTRGPVFVTAFKPLCMXVVAIKSSIIFAEQMYLGRALGAAIIC  319

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
             GLYLVIW K+ +   P     ++
Sbjct  320  AGLYLVIWGKAKDYKHPFTPQVDD  343



>ref|XP_006294412.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
 gb|EOA27310.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
Length=380

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 148/206 (72%), Gaps = 7/206 (3%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGISSKNTAGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG L+  V+ L +E+ N + WA+ WD KLL   Y
Sbjct  199  ACFMILQAVTLRTYPAELSLTAWICLMGTLEGTVVALVMEKGNPSAWAIGWDTKLLTSTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDN---QDSPVLSNAE  383
             GLYLVIW K  +   Q +P L+N E
Sbjct  319  GGLYLVIWGKGKDYKYQTTP-LTNDE  343



>ref|XP_008461651.1| PREDICTED: WAT1-related protein At2g39510-like isoform X3 [Cucumis 
melo]
Length=357

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 149/208 (72%), Gaps = 7/208 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH------IQSTTAATHQHPIKGAIMI  833
            QAKILGT+VTVGGAMIMT +KGP + LPW++   H        S  +  HQ+ I G +M+
Sbjct  116  QAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAASTDHQNQIIGFLML  175

Query  832  TAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDI  653
            T GC  WA F  LQAITL+ YPA LSLT+LICL+G +    + L +ER N + WAL++D 
Sbjct  176  TTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIERGNPSAWALHFDR  235

Query  652  KLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSV  473
            +LLA+VY+G+ICSGV YY+ GV+M+ KGP F SAFNPL++V+VAIM  F+L+E + LG +
Sbjct  236  QLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSFFILSEIMFLGRM  295

Query  472  LGACIIAVGLYLVIWSKSDNQDSPVLSN  389
            +G  II  GLY+V+W K+ +Q  PVL +
Sbjct  296  IGVVIIICGLYMVLWGKTRDQ-PPVLKS  322



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 149/208 (72%), Gaps = 7/208 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH------IQSTTAATHQHPIKGAIMI  833
            QAKILGT+VTVGGAMIMT +KGP + LPW++   H        S  +  HQ+ I G +M+
Sbjct  137  QAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAASTDHQNQIIGFLML  196

Query  832  TAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDI  653
            T GC  WA F  LQAITL+ YPA LSLT+LICL+G +    + L +ER N + WAL++D 
Sbjct  197  TTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIERGNPSAWALHFDR  256

Query  652  KLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSV  473
            +LLA+VY+G+ICSGV YY+ GV+M+ KGP F SAFNPL++V+VAIM  F+L+E + LG +
Sbjct  257  QLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSFFILSEIMFLGRM  316

Query  472  LGACIIAVGLYLVIWSKSDNQDSPVLSN  389
            +G  II  GLY+V+W K+ +Q  PVL +
Sbjct  317  IGVVIIICGLYMVLWGKTRDQ-PPVLKS  343



>ref|XP_006410932.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52385.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=308

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  69   KVVGTLATVGGAMIMTLVKGPVLDLFWT--KGSSAQNTNGTDIHSAIKGAVLVTIGCFSY  126

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y
Sbjct  127  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTATY  186

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  187  SGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAVVIC  246

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW K  + + P
Sbjct  247  AGLYLVIWGKGKDYEYP  263



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 149/208 (72%), Gaps = 7/208 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH------IQSTTAATHQHPIKGAIMI  833
            QAKILGT+VTVGGAMIMT +KGP + LPW++   H        S  +  HQ+ I G +M+
Sbjct  147  QAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSAASTDHQNQIIGFLML  206

Query  832  TAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDI  653
            T GC  WA F  LQAITL+ YPA LSLT+LICL+G +    + L +ER N + WAL++D 
Sbjct  207  TTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALVIERGNPSAWALHFDR  266

Query  652  KLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSV  473
            +LLA+VY+G+ICSGV YY+ GV+M+ KGP F SAFNPL++V+VAIM  F+L+E + LG +
Sbjct  267  QLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAIMSFFILSEIMFLGRM  326

Query  472  LGACIIAVGLYLVIWSKSDNQDSPVLSN  389
            +G  II  GLY+V+W K+ +Q  PVL +
Sbjct  327  IGVVIIICGLYMVLWGKTRDQ-PPVLKS  353



>gb|KDO67718.1| hypothetical protein CISIN_1g043160mg, partial [Citrus sinensis]
Length=333

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER-GHIQSTTAATH---QHPIKGAIMITA  827
            QAKILGT+VT GGAM MTL+KGP +  PW Q R  H QS T  TH   +H  KGA+MI A
Sbjct  134  QAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQSETG-THNKEEHITKGALMIAA  192

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
            GC  W+CF IL+A  L+SYPA LSLT+L+C + +++  +L LA+ER NT +W L++D KL
Sbjct  193  GCFSWSCFIILEAFLLKSYPAELSLTALMCFVSSVEGTILALAIERGNTGIWLLHFDAKL  252

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
            L+++Y G + S   Y++ G +MK KGP FVS+FNPLS+VI+AI+GSF +AE+L LG ++G
Sbjct  253  LSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEELFLGRIVG  311

Query  466  ACIIAVGLYLVIWSKSDNQD  407
            A +I +GLY+V+W +S +Q 
Sbjct  312  AIVIVIGLYMVLWGRSKDQS  331



>gb|KFK36632.1| hypothetical protein AALP_AA4G149800 [Arabis alpina]
Length=370

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            KI+GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  132  KIIGTLATVGGAMIMTLVKGPVLELFWT--KGVSAPNTAGTDIHSAIKGAVLVTIGCFSY  189

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y
Sbjct  190  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTATY  249

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  250  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAGVIC  309

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW K  + + P
Sbjct  310  AGLYLVIWGKGKDYEYP  326



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCF  815
            AKI+GT  TV GAM+MTLVKGP + L WT+        T  T  H  IKGA++IT GC  
Sbjct  142  AKIIGTAATVAGAMMMTLVKGPVLDLFWTKGPSPQHDGTEGTDIHSAIKGAVLITIGCFS  201

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            +ACF +LQAITLR+YPA LSLT+ ICLMG ++   L L +E+ +   WA+ WD KLL   
Sbjct  202  YACFMVLQAITLRTYPAELSLTAWICLMGTIEGTALALVMEKGHPGAWAIGWDTKLLTAT  261

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSG+ YY+ GV+MK++GP FV+AFNPL +VIVA + S + AEQ+ LG VLGA +I
Sbjct  262  YSGIVCSGLAYYIGGVVMKDRGPVFVTAFNPLCMVIVAFISSIIFAEQMYLGRVLGAVVI  321

Query  454  AVGLYLVIWSKSDNQDSPVLSNAE  383
              GLY VIW K  + + P   +A+
Sbjct  322  CAGLYFVIWGKGKDYEYPNEESAQ  345



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVVGTLATVGGAMIMTLVKGPVLDLFWT--KGSSAQNTNGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y
Sbjct  199  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTATY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW K  + + P
Sbjct  319  AGLYLVIWGKGKDYEYP  335



>ref|XP_006294396.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
 gb|EOA27294.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
Length=385

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 139/193 (72%), Gaps = 1/193 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK+ GT+ TVGG M+MTLVKGP + L WT+     Q+TT       IKGAI++T GC  +
Sbjct  134  AKVFGTITTVGGTMMMTLVKGPALDLFWTKGPSG-QNTTGTDIHSSIKGAILVTIGCFSY  192

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQAITL++YPA LSL +LICLMG ++  V+ L +E+ N   WA+ WD KLL + Y
Sbjct  193  ACFMILQAITLKTYPAELSLATLICLMGTIEGAVVALVIEKGNPTAWAIGWDNKLLTVTY  252

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ G++MK +GP FV+AF PL +++VAIM S + +EQ+ LG  LGA +I 
Sbjct  253  SGIMCSALGYYIGGMVMKTRGPVFVTAFKPLCMIVVAIMSSIIFSEQMYLGRALGAAVIC  312

Query  451  VGLYLVIWSKSDN  413
             GLYLVIW K+ +
Sbjct  313  AGLYLVIWGKAKD  325



>ref|XP_002881508.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57767.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=339

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  102  KVVGTLATVGGAMIMTLVKGPVVDLFWT--KGVSAHNTAGTDIHSAIKGAVLVTIGCFSY  159

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQAITLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y
Sbjct  160  ACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTATY  219

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  220  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  279

Query  451  VGLYLVIWSKSDN  413
             GLYLVIW K  +
Sbjct  280  AGLYLVIWGKGKD  292



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 153/201 (76%), Gaps = 4/201 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTT---AATHQHPIKGAIMITAG  824
            QAKI+GT++T+GGA IMTLV GP I LPWT+   ++ +TT   +    +P+KGAI I AG
Sbjct  142  QAKIIGTIITLGGATIMTLVGGPTIGLPWTKHHNNVPTTTNVVSPNELNPLKGAIFIAAG  201

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  WACF+ LQAITL+ Y AG+SLTSLIC+ GALQ   LTL V+R N  +W+++W   L 
Sbjct  202  CFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQRGNFGIWSIHWGSSLF  261

Query  643  -AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
             A +Y GI+ SG+GYY+SG+IM EKGP FV+AFNPL++VIVAI+GSF+L+EQL +G V+G
Sbjct  262  YASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILGSFILSEQLNMGRVVG  321

Query  466  ACIIAVGLYLVIWSKSDNQDS  404
            A +I VGLYLVIW  S ++ S
Sbjct  322  AAVIVVGLYLVIWGSSKDKIS  342



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT+VT  GAM MTL KGP + L  ++   H +++++A  QH + G +M+ A C  
Sbjct  144  QAKIIGTIVTFAGAMAMTLYKGPILNLGLSRGGAHHEASSSAAGQHWVAGTLMLLASCTG  203

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CFFILQ+ TL+ YPA LSLTSLIC MG +Q   + L +ER   A W+L WD +LLA V
Sbjct  204  WSCFFILQSFTLKQYPAELSLTSLICFMGMVQGAAVALVMERKPGA-WSLGWDSRLLAAV  262

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G++CSG+ YY+ G+++KE+GP FV+AFNPL +VIVA +GS +LAEQ+ LGSV+GA +I
Sbjct  263  YSGVVCSGITYYVQGIVIKERGPVFVTAFNPLCMVIVAALGSLILAEQIHLGSVIGAIVI  322

Query  454  AVGLYLVIWSKS-DNQDSPVLSNAEEG  377
             +GLY V+W KS D   S  L+N E+G
Sbjct  323  VIGLYSVVWGKSKDIVASSQLTN-EKG  348



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 156/210 (74%), Gaps = 4/210 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTT---AATHQHPIKGAIMITAG  824
            QAKI+GT++T+GGA IM+LV GP I LPWT+   ++ +T    +    +P+KGAI I AG
Sbjct  142  QAKIIGTIITLGGATIMSLVGGPIIGLPWTKHHSNVPTTKNVVSPNELNPVKGAIFIAAG  201

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  WACF+ LQAITL+ Y AG+SLTSLIC+ GALQ   LTL V+R N  +W++ W   L 
Sbjct  202  CFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQRGNFGIWSIKWGSSLF  261

Query  643  -AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
             A +Y GI+ SG+GYY+SG+IM EKGP FV+AFNPL++VIVAI+GSF+L+EQL +G V+G
Sbjct  262  YASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILGSFILSEQLNMGRVVG  321

Query  466  ACIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            A +I VGLYLVIW  S +++S  + + +E 
Sbjct  322  AAVIVVGLYLVIWGTSKDKNSTKIVSTKEN  351



>ref|XP_010939364.1| PREDICTED: WAT1-related protein At2g37450 isoform X2 [Elaeis 
guineensis]
Length=311

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 147/208 (71%), Gaps = 5/208 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP---IKGAIMITAG  824
            QAK++GT+VTV GA++M L KGP +   W++ R H    TA  HQ+    +KG +M+ +G
Sbjct  76   QAKLVGTIVTVAGAVLMILYKGPVLDFVWSKGRSH--QNTAVGHQNSSNWLKGTLMLLSG  133

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CFFILQ+ T+ SYPA L+LT+LICLMGAL   ++ L  ER +   W + WD +LL
Sbjct  134  CFCWSCFFILQSNTIDSYPAELTLTTLICLMGALMGSLVALVAERGSAKPWIIGWDTRLL  193

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY+G+ICSGV YY+ G +MKE+GP FV+AFNPL ++I A++GS +LAE + LGSV+GA
Sbjct  194  AAVYSGVICSGVAYYMQGKVMKERGPVFVTAFNPLCMIITAVLGSIVLAEDITLGSVIGA  253

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
              I +GLY +IW KS +  +    ++E+
Sbjct  254  VFIVIGLYSLIWGKSKDHLNQRSQSSEK  281



>ref|XP_009141665.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Brassica 
rapa]
Length=302

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            +K++GT+ +VGG MIMTLVKGP + L WT+     Q+TT       IKGAI++T GC  +
Sbjct  68   SKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSA-QNTTGTDIHSSIKGAILVTIGCFSY  126

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACFFIL AITL++YP  LSLT+ ICLMG L+   + L +ER N   WA+ WD KLL + Y
Sbjct  127  ACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGAWAIGWDNKLLTVTY  186

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ G++MK +GP FV+AF+PL +++VA M S + AEQ+ LG  LGA +I 
Sbjct  187  SGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAEQMYLGRALGAAVIC  246

Query  451  VGLYLVIWSK-SDNQDS  404
             GLYLVIW K +D +D+
Sbjct  247  AGLYLVIWGKGNDYKDA  263



>emb|CDX75163.1| BnaC09g25190D [Brassica napus]
Length=384

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 151/211 (72%), Gaps = 8/211 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            QAKI+GTLV +GGA++MTL KGP I LPW+     Q  GH  S ++  H H + G ++I 
Sbjct  137  QAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNTNQHNGH--SNSSQDHNHWVGGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+CF++LQ+IT+++YPA LSL++LICL GA+Q  V+ L VER +   WA+ WD +
Sbjct  195  LGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHSRG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            LLA +Y GI+ SG+ YY+ G++M+ +GP FV+AFNPL +++VA++ SF+L EQ+  G V+
Sbjct  254  LLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIHYGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            G  +IA+GLYLV+W K  + D  VL+  E+ 
Sbjct  314  GGTVIAMGLYLVVWGKGKDYDVSVLAMLEKN  344



>gb|AAM62850.1| nodulin-like protein [Arabidopsis thaliana]
Length=362

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  123  KVVGTLATVGGAMIMTLVKGPVLDLFWT--KGVSAHNTAGTDIHSAIKGAVLVTIGCFSY  180

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQAITLR+YPA LSLT+ ICLMG ++   + L +E+ N + WA+ WD KLL   Y
Sbjct  181  ACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTATY  240

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  241  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  300

Query  451  VGLYLVIWSKSDN  413
             GLYLVIW K  +
Sbjct  301  AGLYLVIWGKGKD  313



>ref|NP_181282.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q9ZUS1.1|WTR13_ARATH RecName: Full=WAT1-related protein At2g37460 [Arabidopsis thaliana]
 gb|AAC98072.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAK59607.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAK73261.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL34209.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AEC09403.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=380

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     TA T  H  IKGA+++T GC  +
Sbjct  141  KVVGTLATVGGAMIMTLVKGPVLDLFWT--KGVSAHNTAGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQAITLR+YPA LSLT+ ICLMG ++   + L +E+ N + WA+ WD KLL   Y
Sbjct  199  ACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTATY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDN  413
             GLYLVIW K  +
Sbjct  319  AGLYLVIWGKGKD  331



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 146/215 (68%), Gaps = 1/215 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAK+ GT+ TV GAM+MTL+KGP I     +   + ++ T     H  IKGA+MIT GC 
Sbjct  199  QAKLAGTIATVAGAMLMTLMKGPLIEFFRIKGNAYHENGTGGIDLHSSIKGALMITVGCF  258

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WACF ILQAITL+SYPA LSLT+ ICL+G ++  V+ L  E    +VWA+NWD+KLLA 
Sbjct  259  SWACFMILQAITLKSYPAELSLTAWICLLGTIEGAVVALVAENGKPSVWAINWDMKLLAA  318

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI CSG+ YY+ G++MK++GP FV+AF+PL +VIVA+M   + AEQ+ LG +LGA I
Sbjct  319  VYSGIFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSCIIWAEQMYLGRILGAII  378

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEGsss*SATV  353
            I  GLYLV+W KS +  +      E+       TV
Sbjct  379  IVAGLYLVVWGKSKDYKTSSPPADEQTIPVKQTTV  413



>ref|XP_010553301.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=388

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCF  815
            AKILGT  TV GAM+MTLVKGP + L WT+        TA T  H  IKGA++IT GC  
Sbjct  140  AKILGTAATVSGAMMMTLVKGPVLHLFWTKGASTNDGGTAGTDIHSAIKGAVLITIGCFS  199

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            +ACF ILQAITL++YPA LSLT+ ICLMG ++   + L +E+ N  VW + WD KLL   
Sbjct  200  YACFMILQAITLKTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGVWVIGWDTKLLTAT  259

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CS + YY+ GV+MK +GP FV+AFNPL +VIVA M S + AEQ+ LG VLGA +I
Sbjct  260  YSGIVCSALAYYIGGVVMKSRGPVFVTAFNPLCMVIVAFMSSVIFAEQMYLGRVLGALVI  319

Query  454  AVGLYLVIWSKSDNQDSP  401
             VGLY V+W K  +   P
Sbjct  320  CVGLYFVLWGKGKDYGYP  337



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 147/208 (71%), Gaps = 5/208 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP---IKGAIMITAG  824
            QAK++GT+VTV GA++M L KGP +   W++ R H    TA  HQ+    +KG +M+ +G
Sbjct  136  QAKLVGTIVTVAGAVLMILYKGPVLDFVWSKGRSH--QNTAVGHQNSSNWLKGTLMLLSG  193

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CFFILQ+ T+ SYPA L+LT+LICLMGAL   ++ L  ER +   W + WD +LL
Sbjct  194  CFCWSCFFILQSNTIDSYPAELTLTTLICLMGALMGSLVALVAERGSAKPWIIGWDTRLL  253

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY+G+ICSGV YY+ G +MKE+GP FV+AFNPL ++I A++GS +LAE + LGSV+GA
Sbjct  254  AAVYSGVICSGVAYYMQGKVMKERGPVFVTAFNPLCMIITAVLGSIVLAEDITLGSVIGA  313

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
              I +GLY +IW KS +  +    ++E+
Sbjct  314  VFIVIGLYSLIWGKSKDHLNQRSQSSEK  341



>ref|XP_011023643.1| PREDICTED: WAT1-related protein At5g13670-like [Populus euphratica]
Length=375

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE---RGHIQSTTAATHQHPIKGAIMITAG  824
            QAK+ GTLVT+GGAM++    GP + LPWT+    RG  QS  +A  Q  IKGA+M+  G
Sbjct  139  QAKVAGTLVTIGGAMLLPFAHGPLLHLPWTKRNFCRG--QSAQSAHIQDLIKGAVMVVFG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+ F ILQA+ L+SYPA LSL + +C+MG ++  +LT AVER+NTAVW++ +D++LL
Sbjct  197  CLSWSSFIILQAMILKSYPAKLSLAAFMCIMGTVESTILTFAVERANTAVWSVYFDVRLL  256

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY GI+ SG+ YY+ G+++KE+GP F+SA NPLSLV+VAI+GSF+  E+  LG  +GA
Sbjct  257  AAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFKEKFYLGRAIGA  315

Query  463  CIIAVGLYLVIWSKSDNQDS  404
             +I +GLYLV+W KS +Q +
Sbjct  316  IVIILGLYLVLWGKSKDQTT  335



>ref|XP_002312070.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
 gb|EEE89437.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
Length=368

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE---RGHIQSTTAATHQHPIKGAIMITAG  824
            QAK++GTLVT+GGAM++ L  GP I LPWT+    RG  QS  +   Q  IKGA+M+  G
Sbjct  137  QAKVVGTLVTIGGAMLLPLAHGPLINLPWTKRNFCRG--QSAHSVHIQDLIKGAVMVIFG  194

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+ F ILQA+ L SYPA LSL +L+C+MG ++  +L  AVER+NTAVW++ +DI+LL
Sbjct  195  CLSWSSFIILQAMILESYPAKLSLAALMCIMGTVESTILAFAVERANTAVWSVYFDIRLL  254

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY GI+ SG+ YY+ G+++KE+GP F+SA NPLSLV+VAI+GSF+  E+  LG  +GA
Sbjct  255  AAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFKEKFYLGRAIGA  313

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLYLV+W KS +Q
Sbjct  314  IVIVLGLYLVLWGKSKDQ  331



>ref|XP_009141664.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Brassica 
rapa]
Length=374

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            +K++GT+ +VGG MIMTLVKGP + L WT+     Q+TT       IKGAI++T GC  +
Sbjct  140  SKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSA-QNTTGTDIHSSIKGAILVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACFFIL AITL++YP  LSLT+ ICLMG L+   + L +ER N   WA+ WD KLL + Y
Sbjct  199  ACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGAWAIGWDNKLLTVTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ G++MK +GP FV+AF+PL +++VA M S + AEQ+ LG  LGA +I 
Sbjct  259  SGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAEQMYLGRALGAAVIC  318

Query  451  VGLYLVIWSK-SDNQDS  404
             GLYLVIW K +D +D+
Sbjct  319  AGLYLVIWGKGNDYKDA  335



>ref|XP_010509331.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGISSKNTDGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N + WA+ WD KLL   Y
Sbjct  199  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAWAIGWDTKLLTSTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDN---QDSPV  398
             GLYLVIW K  +   Q +P+
Sbjct  319  GGLYLVIWGKGKDYKYQSTPL  339



>ref|XP_010517017.1| PREDICTED: WAT1-related protein At2g37460 [Camelina sativa]
Length=380

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 141/198 (71%), Gaps = 3/198 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGISSKNTDGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N + WA+ WD KLL   Y
Sbjct  199  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAWAIGWDTKLLTSTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSPV  398
             GLYLVIW K  +    V
Sbjct  319  GGLYLVIWGKGKDYKYQV  336



>emb|CDY18443.1| BnaA04g21440D [Brassica napus]
Length=374

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            +K++GT+ +VGG MIMTLVKGP + L WT+     Q+TT       IKGA+++T GC  +
Sbjct  140  SKVIGTMTSVGGTMIMTLVKGPALDLFWTKGPSA-QNTTGTDIHSSIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACFFIL AITL++YP  LSLT+ ICLMG L+   + L +ER N   WA+ WD KLL + Y
Sbjct  199  ACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGAWAIGWDNKLLTVTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ G++MK +GP FV+AF+PL +++VA M S + AEQ+ LG  LGA +I 
Sbjct  259  SGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAEQMYLGRALGAAVIC  318

Query  451  VGLYLVIWSK-SDNQDS  404
             GLYLVIW K +D +D+
Sbjct  319  AGLYLVIWGKGNDYKDA  335



>ref|XP_002534331.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28049.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -3

Query  940  LVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFWACFFILQAITLRSYPA  764
            +VKG  + L  T+   H +  T+A + H  IKGA+MIT GC  WACF ILQAITL++YPA
Sbjct  1    MVKGAPVNLFGTKGNSHHEQGTSAINLHDSIKGALMITVGCFSWACFMILQAITLKTYPA  60

Query  763  GLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYNGIICSGVGYYLSGVI  584
             LSLT+ ICL+G ++  ++ + +ER N +VWAL+WD KL+A VY+G++CSG  YY+ GVI
Sbjct  61   ELSLTAWICLLGTIEGSIVAMVMERGNNSVWALHWDTKLIAAVYSGVVCSGFAYYIQGVI  120

Query  583  MKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAVGLYLVIWSKSDNQDS  404
            MK++GP FV+AF PL +VIVA+M S +LAEQ+ LG V+GA II  GLYLVIW KS +  S
Sbjct  121  MKDRGPVFVTAFGPLCMVIVAVMSSIILAEQMFLGRVIGAAIIVGGLYLVIWGKSKDHKS  180

Query  403  P  401
            P
Sbjct  181  P  181



>gb|KGN51272.1| hypothetical protein Csa_5G505820 [Cucumis sativus]
Length=376

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 143/210 (68%), Gaps = 5/210 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+V VGGAMIMT V+GP + LPWT    H  STTAA  Q  +KG++MI  GC F
Sbjct  137  QAKILGTVVAVGGAMIMTAVRGPILNLPWTNHNLHDHSTTAANQQDLLKGSLMILIGCIF  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F +LQAIT++ YPA LSLT+ IC  GA+Q  V+  A+E    A W+L+ D  LLA +
Sbjct  197  WSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAAWSLHLDSTLLAPL  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+ SGV Y +   +MK KGP F S F+PLS+VIVAI+ SF L+E L  G V+GA +I
Sbjct  257  YSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSEILYFGRVIGAAVI  316

Query  454  AVGLYLVIWSKSDNQ-----DSPVLSNAEE  380
              GLYLV+W K  +Q     DS  ++ +++
Sbjct  317  ITGLYLVLWGKIKDQALYKLDSEKMAPSDQ  346



>ref|XP_007027104.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY07606.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=391

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 145/202 (72%), Gaps = 6/202 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH----QHPIKGAIMITA  827
              K++GTL TV GAM+MTL+KGP + L WT  +G      AA +     H IKG +MIT 
Sbjct  139  HGKVVGTLATVAGAMVMTLMKGPVLELFWT--KGSTNHQAAAQNGTDIHHTIKGGLMITV  196

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
            GC  +ACF ILQA+TL +YPA LSLT  ICLMG L+  +  L +ER N A+WA+ WD KL
Sbjct  197  GCFSYACFVILQAVTLETYPAELSLTVWICLMGTLEGTIAALIMERGNAAIWAIKWDTKL  256

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
            L   Y+GI+CSG+ YY+ GVIMK++GP FV+AF+PL +VIVAIM +F+LAEQ+ LG V+G
Sbjct  257  LTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMSTFILAEQMYLGRVIG  316

Query  466  ACIIAVGLYLVIWSKSDNQDSP  401
            A II VGLYLV+W KS+   SP
Sbjct  317  AIIIIVGLYLVLWGKSNEYKSP  338



>emb|CDY18444.1| BnaA04g21430D [Brassica napus]
Length=373

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWA  809
            K++GTL TVGGAMIMTLVKGP + L WT+     Q+T        IKGA+++T GC  +A
Sbjct  137  KVIGTLATVGGAMIMTLVKGPVLDLFWTKV-ASAQNTDGTDIHSAIKGAVLVTIGCFSYA  195

Query  808  CFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYN  629
            CF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y+
Sbjct  196  CFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTSTYS  255

Query  628  GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAV  449
            GI+CS + YY+ G++MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I  
Sbjct  256  GIVCSAIAYYVGGLVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAAVICA  315

Query  448  GLYLVIWSKSDNQD  407
            GLYLVIW K  + +
Sbjct  316  GLYLVIWGKGKDYE  329



>ref|XP_004149823.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
 ref|XP_004166635.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=384

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 143/210 (68%), Gaps = 5/210 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+V VGGAMIMT V+GP + LPWT    H  STTAA  Q  +KG++MI  GC F
Sbjct  145  QAKILGTVVAVGGAMIMTAVRGPILNLPWTNHNLHDHSTTAANQQDLLKGSLMILIGCIF  204

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F +LQAIT++ YPA LSLT+ IC  GA+Q  V+  A+E    A W+L+ D  LLA +
Sbjct  205  WSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAAWSLHLDSTLLAPL  264

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+ SGV Y +   +MK KGP F S F+PLS+VIVAI+ SF L+E L  G V+GA +I
Sbjct  265  YSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSEILYFGRVIGAAVI  324

Query  454  AVGLYLVIWSKSDNQ-----DSPVLSNAEE  380
              GLYLV+W K  +Q     DS  ++ +++
Sbjct  325  ITGLYLVLWGKIKDQALYKLDSEKMAPSDQ  354



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT+VT+ GAM MTL KGP + L  ++   H + +++++ QH + G +M+   C  
Sbjct  143  QAKIIGTVVTLAGAMAMTLYKGPILNLGLSRGGSHHEDSSSSSGQHWVVGTLMLLGSCTG  202

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WA FFILQ+ TL+ YPA LSLTSLIC MG +Q   + L +ER N A WA+ WD +LLA V
Sbjct  203  WASFFILQSFTLKQYPAELSLTSLICFMGTMQGAAVALVMER-NPAAWAVGWDSRLLAAV  261

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y G+ICSGV YY+ GV++KE+GP FV+AFNPL ++IVA +GS +L EQL LGSV+GA +I
Sbjct  262  YTGVICSGVAYYVQGVVIKERGPVFVTAFNPLCMIIVAALGSLILGEQLHLGSVIGALVI  321

Query  454  AVGLYLVIWSKS-DNQDSPVLSNAEEG  377
             +GLY V+W KS D+  S  L+N E+G
Sbjct  322  VIGLYSVVWGKSKDHLVSSELTN-EKG  347



>ref|XP_010505334.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 140/198 (71%), Gaps = 3/198 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            K++GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWT--KGISSKNTDGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+YPA LSLT+ ICLMG ++  V+ L +E+ N   WA+ WD KLL   Y
Sbjct  199  ACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPRAWAIGWDTKLLTSTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ GV+MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSPV  398
             GLYLVIW K  +    V
Sbjct  319  GGLYLVIWGKGKDYKYQV  336



>ref|XP_003537193.1| PREDICTED: WAT1-related protein At2g37460-like isoform 1 [Glycine 
max]
Length=379

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTL TV GAM+MTL+KGP +L        H Q     + +H I G I+IT GC  
Sbjct  136  QAKVVGTLTTVSGAMVMTLLKGP-VLFGSHGSNDHSQHN-GTSMRHTITGFILITIGCFC  193

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQA TL++YPA LSL++ ICLMG L+   + + +ER N +VW+L  D+KLL  V
Sbjct  194  WACFVILQATTLKTYPAELSLSAWICLMGTLEGAAVAMIMERGNPSVWSLKLDMKLLCAV  253

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSG+ YYL GV+MK +GP FV+AF+PL +VIVA+M  F+LAEQ+ LG V+GA II
Sbjct  254  YSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFLGRVIGAVII  313

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLY V+W KS +  SP   N +E
Sbjct  314  CLGLYAVVWGKSKDC-SPRSPNTQE  337



>gb|KDO40046.1| hypothetical protein CISIN_1g019311mg [Citrus sinensis]
Length=299

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTL TV GAM+MTL+KGP + L WT+    H   ++  T  + IKGA+MITAGC  
Sbjct  68   AKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNSIKGALMITAGCFS  127

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F ILQAITL++YPA LSLT+ IC  G ++  +  L +ER   ++WA++WD KL+A V
Sbjct  128  WSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAIHWDTKLVASV  187

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GIICSG+ YY+ G++MK++GP FV+AF+PL +VIVAIM + +LAEQ+ LG ++GA II
Sbjct  188  YSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMYLGRIIGAIII  247

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
              GLYLV+W KS +  SP  S  E 
Sbjct  248  IGGLYLVVWGKSKDHKSPSPSTDEH  272



>ref|XP_008463491.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=337

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 141/210 (67%), Gaps = 5/210 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+V VGGAMIMT V+GP + LPWT    H  STTA   Q  +KG++MI  GC  
Sbjct  98   QAKILGTVVAVGGAMIMTTVRGPILNLPWTNHNIHDHSTTAVNQQDLLKGSLMILVGCIL  157

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F +LQAIT++ YPA LSLT+LIC  GA+Q  V+  A+E    A W+L+ D  LLA +
Sbjct  158  WSVFNVLQAITIKVYPAQLSLTTLICFTGAVQASVIAFAMEGHKPAAWSLHLDSTLLAPL  217

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+ SGV Y +   +MK KGP F S F PLSLVIVAI+ SF L+E L +G V+GA +I
Sbjct  218  YSGIMSSGVSYTIQSAVMKTKGPVFSSTFGPLSLVIVAIISSFALSEILYIGRVIGAAVI  277

Query  454  AVGLYLVIWSKSDNQ-----DSPVLSNAEE  380
              GLYLV+W K   Q     DS  ++ +++
Sbjct  278  ITGLYLVLWGKIKGQALYKLDSEKMTPSDQ  307



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT++TVGGAMIMTL KGP + +       H  STT ++ QH I G +M+   C  W
Sbjct  140  AKVIGTVITVGGAMIMTLYKGPIVDIIRGHSHSHNSSTTESSEQHWIAGPLMLLGSCGGW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A FFILQ+ TL+ YPA LSLT+ ICLMG L+ GV+T AVER   +VW + WD +LLA VY
Sbjct  200  ASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSVWVIGWDSRLLASVY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY+ GV+++E+GP FV+AF+PL ++I A +G+ +LAEQ+ LGSV+GA  I 
Sbjct  259  SGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIITAALGAIVLAEQVHLGSVIGAICIV  318

Query  451  VGLYLVIWSKSDNQDSPVLSNA  386
             GLY V+W KS +   P+ S+A
Sbjct  319  FGLYTVVWGKSKD---PLASSA  337



>ref|XP_009151422.1| PREDICTED: WAT1-related protein At4g08290 [Brassica rapa]
Length=383

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 149/209 (71%), Gaps = 4/209 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ---ERGHIQSTTAATHQHPIKGAIMITAG  824
            QAKI+GTLV +GGA++MTL KGP I L W+     + +  S ++  H H + G ++I  G
Sbjct  137  QAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSSQDHNHWVGGTLLILLG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF++LQ+IT+R+YPA LSL++LICL GA+Q  V+ L VER +   WA+ WD +LL
Sbjct  197  CVAWSCFYVLQSITIRTYPADLSLSALICLSGAVQSTVVALVVERHSRG-WAVGWDARLL  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GI+ SG+ YY+ G++M+ +GP FV+AFNPL +++VA++ SF+L EQ+  G V+G 
Sbjct  256  APLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIHYGCVIGG  315

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
             +IA+GLYLV+W K  + D  VL+  E+ 
Sbjct  316  TVIAMGLYLVVWGKGKDYDVSVLAMPEKN  344



>gb|KHG03072.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=391

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHI---QSTTAATHQHPIKGAIMITAG  824
            QAK+ GT V VGGAMIMTL+KGP + LPWT+ R H       + A  Q  + GA+++ AG
Sbjct  137  QAKVAGTAVAVGGAMIMTLIKGPVLELPWTKGRNHYLGQHGASGAHKQDMVMGALLLLAG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            CC WACF I QA  L+SYPA LSLT+LIC+MG  +  +L  AVE  N +VW + +D KL+
Sbjct  197  CCCWACFVISQARILKSYPAKLSLTALICIMGTFEGTILAFAVEWRNPSVWLIGFDSKLI  256

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y G++ +    Y  G +MK +GP FVSAFNPLS+VIVAI+GSF LAE + LG VLG+
Sbjct  257  ASLYGGLV-TAFALYAMGSVMKRRGPVFVSAFNPLSMVIVAILGSFFLAEDMYLGRVLGS  315

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLYLV+W KS +Q
Sbjct  316  IVIVIGLYLVLWGKSKDQ  333



>emb|CDX93378.1| BnaC04g45180D [Brassica napus]
Length=373

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWA  809
            K++GTL TVGGAMIMTLVKGP + L WT+     Q+T        IKGA+++T GC  +A
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWTKGV-STQNTDGTDINSAIKGAVLVTIGCFSYA  199

Query  808  CFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYN  629
            CF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y+
Sbjct  200  CFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTSTYS  259

Query  628  GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAV  449
            GI+CS + YY+ G++MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I  
Sbjct  260  GIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAVVICA  319

Query  448  GLYLVIWSKSDNQD  407
            GLYLVIW K  + +
Sbjct  320  GLYLVIWGKGKDYE  333



>gb|KHN05928.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTL TV GAM+MTL+KGP +L        H Q     + +H I G I+IT GC  
Sbjct  136  QAKVVGTLTTVSGAMVMTLLKGP-VLFGSHGSNDHSQHN-GTSMRHTITGFILITIGCFC  193

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQA TL++YPA LSL++ ICLMG ++   + + +ER N +VW+L  D+KLL  V
Sbjct  194  WACFVILQATTLKTYPAELSLSAWICLMGTIEGAAVAMIMERGNPSVWSLKLDMKLLCAV  253

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSG+ YYL GV+MK +GP FV+AF+PL +VIVA+M  F+LAEQ+ LG V+GA II
Sbjct  254  YSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFLGRVIGAVII  313

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
             +GLY V+W KS +  SP   N +E
Sbjct  314  CLGLYAVVWGKSKDC-SPRSPNTQE  337



>gb|KDO40045.1| hypothetical protein CISIN_1g019311mg [Citrus sinensis]
Length=343

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTL TV GAM+MTL+KGP + L WT+    H   ++  T  + IKGA+MITAGC  
Sbjct  112  AKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNSIKGALMITAGCFS  171

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F ILQAITL++YPA LSLT+ IC  G ++  +  L +ER   ++WA++WD KL+A V
Sbjct  172  WSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAIHWDTKLVASV  231

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GIICSG+ YY+ G++MK++GP FV+AF+PL +VIVAIM + +LAEQ+ LG ++GA II
Sbjct  232  YSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMYLGRIIGAIII  291

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
              GLYLV+W KS +  SP  S  E 
Sbjct  292  IGGLYLVVWGKSKDHKSPSPSTDEH  316



>ref|XP_008466700.1| PREDICTED: WAT1-related protein At4g08290 [Cucumis melo]
Length=389

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTLVT  GA+IMTL KGP +   WTQ+  H + S  AAT+QH + G + I  GC  
Sbjct  160  AKVIGTLVTFAGALIMTLYKGPILDFFWTQKTNHHVNSGAAATNQHWVAGTLFILLGCVA  219

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CF+ILQ++T++ YPA LSL++LICL GALQ  V+ +A+ER  +A WA+ WD +LLA +
Sbjct  220  WSCFYILQSVTVKKYPAELSLSALICLAGALQSTVIAVAIERHASA-WAVGWDSRLLAPL  278

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SG+ YY   ++MK +GP FV+AFNPL +++V ++ S +LAE++ LGSV+G  II
Sbjct  279  YTGIVGSGIAYYFQALVMKTRGPVFVTAFNPLCMIVVTVISSIVLAEKIHLGSVIGGLII  338

Query  454  AVGLYLVIWSKSDNQDS  404
            A+GLY V+W KS +  +
Sbjct  339  AIGLYAVVWGKSKDYST  355



>emb|CDX93377.1| BnaC04g45190D [Brassica napus]
Length=374

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 140/197 (71%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            +K++GT+ +VGG MIMTLVKGP + L WT+     Q+TT       IKGA+++T GC  +
Sbjct  140  SKVIGTMASVGGTMIMTLVKGPALDLFWTKGPSA-QNTTGTDIHSSIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACFFIL AITL+ YP  LSLT+ ICLMG L+   + L +ER N   WA+ WD KLL + Y
Sbjct  199  ACFFILYAITLKIYPTELSLTAWICLMGTLEGAAVALVMERGNPGAWAIGWDNKLLTVTY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS +GYY+ G++MK +GP FV+AF+PL +++VA M S + AEQ+ LG  LGA +I 
Sbjct  259  SGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAEQMYLGRALGAAVIC  318

Query  451  VGLYLVIWSK-SDNQDS  404
             GLYLVIW K +D +D+
Sbjct  319  AGLYLVIWGKGNDYKDA  335



>ref|XP_008463490.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=376

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 141/210 (67%), Gaps = 5/210 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKILGT+V VGGAMIMT V+GP + LPWT    H  STTA   Q  +KG++MI  GC  
Sbjct  137  QAKILGTVVAVGGAMIMTTVRGPILNLPWTNHNIHDHSTTAVNQQDLLKGSLMILVGCIL  196

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F +LQAIT++ YPA LSLT+LIC  GA+Q  V+  A+E    A W+L+ D  LLA +
Sbjct  197  WSVFNVLQAITIKVYPAQLSLTTLICFTGAVQASVIAFAMEGHKPAAWSLHLDSTLLAPL  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+ SGV Y +   +MK KGP F S F PLSLVIVAI+ SF L+E L +G V+GA +I
Sbjct  257  YSGIMSSGVSYTIQSAVMKTKGPVFSSTFGPLSLVIVAIISSFALSEILYIGRVIGAAVI  316

Query  454  AVGLYLVIWSKSDNQ-----DSPVLSNAEE  380
              GLYLV+W K   Q     DS  ++ +++
Sbjct  317  ITGLYLVLWGKIKGQALYKLDSEKMTPSDQ  346



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT++TVGGAMIMTL KGP + +     + H  STT ++ QH I G +M+   C  W
Sbjct  140  AKVIGTVITVGGAMIMTLYKGPIVDIIRGHSQSHNSSTTESSEQHWIAGPLMLLGSCGGW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A FFILQ+ TL+ YPA LSLT+ ICLMG L+ GV+T AVER   +VW + WD +LLA VY
Sbjct  200  ASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSVWVIGWDSRLLASVY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY+ GV+++E+GP FV+AF+PL ++I A +G+ +LAEQ+ LGS++GA  I 
Sbjct  259  SGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIIPAALGAIVLAEQVHLGSIIGAICIV  318

Query  451  VGLYLVIWSKSDNQDSPVLSNA  386
             GLY V+W KS +   P+ S+A
Sbjct  319  FGLYTVVWGKSKD---PLASSA  337



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAAT--HQHPIKGAIMITAGC  821
            QAKI+GT VT GGAMIMTL+ GP I LPWT+      + T+A+     PIKGA+ I AGC
Sbjct  140  QAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTATSASLTELQPIKGALFIAAGC  199

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACF+ LQAITL++YPA LSLT LIC  GA+Q   LTL  ER NT++W+++ D KLL+
Sbjct  200  ICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAERGNTSIWSIHLDTKLLS  259

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL---  470
             VY+G++ SGVGYY+SG+IMK+KGP FV+AFNPL++VIVAI+GSF+L+EQL LGS +   
Sbjct  260  YVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILGSFILSEQLNLGSNVACK  319

Query  469  GACII  455
            G C+I
Sbjct  320  GGCLI  324



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 153/226 (68%), Gaps = 7/226 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG--HIQSTTAATHQHPIKGAIMITAGC  821
            QAKI+GT+VTVGGAMIMT ++GP + LPWT+        S+++  HQ  IKG++MI  GC
Sbjct  137  QAKIVGTIVTVGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSKNHQDQIKGSLMIAIGC  196

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
               + F ILQAITL+ YPA LSLT+LICL+  +   ++ L +ER N + WAL++D +LL+
Sbjct  197  ICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWALHFDSQLLS  256

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
            +VY G+ICSGV YY+ G++M+ KGP FV+AFNPLS++ VAIM SF+L+E +LLG ++GA 
Sbjct  257  VVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSEIMLLGRIVGAV  316

Query  460  IIAVGLYLVIWSKSDNQ-----DSPVLSNAEEGsss*SATVYNYQS  338
             I  GLYLV+W K  ++     DS       E   +   TV   Q 
Sbjct  317  TIITGLYLVLWGKRKDRLLVKSDSDSKQQMTETDETSKKTVQPSQE  362



>ref|XP_006429015.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
 ref|XP_006480748.1| PREDICTED: WAT1-related protein At2g37460-like [Citrus sinensis]
 gb|ESR42255.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
Length=370

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQ-ERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTL TV GAM+MTL+KGP + L WT+    H   ++  T  + IKGA+MITAGC  
Sbjct  139  AKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNSIKGALMITAGCFS  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F ILQAITL++YPA LSLT+ IC  G ++  +  L +ER   ++WA++WD KL+A V
Sbjct  199  WSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAIHWDTKLVASV  258

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GIICSG+ YY+ G++MK++GP FV+AF+PL +VIVAIM + +LAEQ+ LG ++GA II
Sbjct  259  YSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMYLGRIIGAIII  318

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
              GLYLV+W KS +  SP  S  E 
Sbjct  319  IGGLYLVVWGKSKDHKSPSPSTDEH  343



>emb|CDY29141.1| BnaA09g53940D [Brassica napus]
Length=383

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 149/209 (71%), Gaps = 4/209 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ---ERGHIQSTTAATHQHPIKGAIMITAG  824
            QAKI+GTLV +GGA++MTL KGP I L W+     + +  S ++  H H + G ++I  G
Sbjct  137  QAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSSQDHNHWVGGTLLILLG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF++LQ+IT+++YPA LSL++LICL GA+Q  V+ L VER +   WA+ WD +LL
Sbjct  197  CVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHSRG-WAVGWDARLL  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GI+ SG+ YY+ G++M+ +GP FV+AFNPL +++VA++ SF+L EQ+  G V+G 
Sbjct  256  APLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIHYGCVIGG  315

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
             +IA+GLYLV+W K  + D  VL+  E+ 
Sbjct  316  TVIAMGLYLVVWGKGKDYDVSVLAMPEKN  344



>ref|XP_009340894.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=363

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 145/202 (72%), Gaps = 4/202 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT++TVGGAMIMTL KGP + +       H  STT +  QH I G +M+   C  W
Sbjct  140  AKVIGTVITVGGAMIMTLYKGPIVDIIRGHSHSHNSSTTGSGEQHWIAGPLMLIGSCGGW  199

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A FFILQ+ TL+ YPA LSLT+ ICLMG L+ GV+T AVER   +VW + WD +LLA VY
Sbjct  200  ASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSVWVIGWDSRLLASVY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY+ GV+++E+GP FV+AF+PL ++I A +G+ +LAEQ+ LGS++GA  I 
Sbjct  259  SGVVCSGIAYYVQGVVIRERGPVFVTAFSPLCMIITAGLGAIVLAEQVHLGSIIGAICIV  318

Query  451  VGLYLVIWSKSDNQDSPVLSNA  386
             GLY V+W KS +   P+ S+A
Sbjct  319  FGLYTVVWGKSKD---PLASSA  337



>ref|XP_010534299.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=386

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 143/216 (66%), Gaps = 13/216 (6%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQS------------TTAATHQHPI  851
            QA I+GT+VTVGGAM M LVKGP + +PW      I              T + T   P 
Sbjct  131  QAMIMGTIVTVGGAMAMALVKGPSMDIPWVHNHHKIHDMYLNLLQQQSHQTKSTTSHDPT  190

Query  850  KGAIMITAGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVW  671
            KGA+ + +GC  WA F  LQA+TL++YPA LSL + IC +GA +  +  L +ER N + W
Sbjct  191  KGALFVASGCLCWAAFTTLQALTLKAYPAVLSLAAWICFIGATEGSIAALVMERHNISAW  250

Query  670  ALNWDIKLLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQ  491
            +L+ DIKL A VY+G+ICSGVGYY+ G+IM++KGP FV+AFNPLS+VIV I+ S +  E 
Sbjct  251  SLHIDIKLFAAVYSGVICSGVGYYVQGMIMRKKGPVFVTAFNPLSMVIVTIISSLVFHEG  310

Query  490  LLLGSVLGACIIAVGLYLVIWSKSDNQDSPVLSNAE  383
            + LG V G+ +I VGLYLV+W KS +Q +  L N++
Sbjct  311  IHLGRVTGSILIVVGLYLVLWGKSKDQ-TEALPNSD  345



>ref|XP_009390255.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-HPIKGAIMITAGCC  818
            QAKI+GTLVTV GA+IM L KGP +   W + R H+Q+  AA +  H + G +M+   CC
Sbjct  136  QAKIIGTLVTVIGALIMILYKGPIVEFIWNKGR-HLQAEAAAQNDTHWLLGTLMLLFSCC  194

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FF+LQ+ TL+SYPA LSLT+LICL G  Q G + L +ER     W++ +D++L   
Sbjct  195  CWSAFFVLQSHTLKSYPAELSLTTLICLTGTGQAGAVALFMERGAKP-WSIGFDMRLFTA  253

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+C+GV YYL GV+MKE+GP FV+AFNPL ++IVA+MGS +LAE++ LG V+GA +
Sbjct  254  VYSGIMCTGVAYYLQGVVMKERGPVFVTAFNPLCMIIVAVMGSIILAEEISLGRVIGAVV  313

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEE  380
            I +GLY +IW KS ++ +    N+E+
Sbjct  314  IVIGLYCLIWGKSSDRMNTSTENSEK  339



>ref|XP_007223359.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
 gb|EMJ24558.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
Length=367

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT++TVGGAM+MTL KGP + +       H  STT +T+QH + G +M+ A C  W
Sbjct  145  AKVVGTVITVGGAMVMTLYKGPIVDIIRGHAHSHGTSTTDSTNQHWVAGPLMLLASCGGW  204

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A FFI+Q+ TL+ YPA LSLT+ IC+MG L+ GV+T AVER   +VW + WD +LLA VY
Sbjct  205  ASFFIVQSFTLKKYPAELSLTAWICIMGVLEGGVITFAVER-KMSVWVIGWDSRLLASVY  263

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CSG+ YY+ GV+ +E+GP FV+AF+PL ++I A +G+ +LAE++ LGS++GA  I 
Sbjct  264  SGIVCSGLAYYVQGVVSRERGPVFVTAFSPLCMIITAALGAIVLAEKVHLGSIIGAIFIV  323

Query  451  VGLYLVIWSKSDNQDSPVLSNA  386
             GLY V+W KS +   P+ S+A
Sbjct  324  FGLYTVVWGKSKD---PLASSA  342



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA--THQHPIKGAIMITAGC  821
            QAKI+GT+VT+GGAMIMT ++GP + LPWT+      S++++   H + IKG++MIT GC
Sbjct  137  QAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSINHHNQIKGSLMITIGC  196

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
               + F ILQAITL+ YPA LSLT+LICL+  +   ++ L +ER N + WAL++D +LL+
Sbjct  197  ICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWALHFDSQLLS  256

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
            +VY G+ICSGV YY+ G++M+ KGP FV+AFNPLS++ VAIM SF+L+E +LLG ++GA 
Sbjct  257  VVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSEIMLLGRIVGAV  316

Query  460  IIAVGLYLVIWSKSDNQ  410
             I  GLYLV+W K  ++
Sbjct  317  TIITGLYLVLWGKRKDK  333



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFW  812
            KI+GTL TVGGAMIMTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +
Sbjct  141  KIIGTLATVGGAMIMTLVKGPVLDLFWT--KGVSAPNTTGTDIHSAIKGAVLVTIGCFSY  198

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            ACF ILQA+TLR+Y A LSLT+ ICLMG ++   + L +E+ N   WA+ WD +LL   Y
Sbjct  199  ACFMILQAVTLRTYQAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTELLTAAY  258

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +GI+CS + YY+ G++MK +GP FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I 
Sbjct  259  SGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAVVIC  318

Query  451  VGLYLVIWSKSDNQDSP  401
             GLYLVIW K  + + P
Sbjct  319  AGLYLVIWGKGKDIEYP  335



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAA---THQHPIKGAIMITAG  824
            QAKI+GT+VT+GGAMIMT ++GP + LPWT+      S++++    H + IKG++MIT G
Sbjct  137  QAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSSINHHNQIKGSLMITIG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C   + F ILQAITL+ YPA LSLT+LICL+  +   ++ L +ER N + WAL++D +LL
Sbjct  197  CICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWALHFDSQLL  256

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            ++VY G+ICSGV YY+ G++M+ KGP FV+AFNPLS++ VAIM SF+L+E +LLG ++GA
Sbjct  257  SVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSEIMLLGRIVGA  316

Query  463  CIIAVGLYLVIWSKSDNQ  410
              I  GLYLV+W K  ++
Sbjct  317  VTIITGLYLVLWGKRKDK  334



>ref|XP_010999362.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Populus 
euphratica]
Length=363

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVT+GGA++MT+ KGP I LPW+Q+     ST A++ +H + G +++  GC  
Sbjct  143  QAKVVGTLVTLGGALLMTVYKGPVIGLPWSQKTSQHGSTAASSDKHWVTGTLLLLVGCVS  202

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F++LQ  TL+ YPA LSL SLICL G++Q   + L V    ++ WA+ WD +L   +
Sbjct  203  WSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAHHPSS-WAVGWDTRLFTPL  261

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SGV YY+ G++MK +GP FV+AFNPL ++IVA +GS +LAE+L LGSVLG  II
Sbjct  262  YTGIVASGVTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAEKLHLGSVLGGIII  321

Query  454  AVGLYLVIWSKSDNQDSP  401
            A+GLY V+W K  +  SP
Sbjct  322  AIGLYSVVWGKRKDYASP  339



>gb|EMT13376.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=525

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQST---TAATHQHPIKGAIMITAG  824
            QAKI GT++TV GA++M L  GP +  PWT  +GH  +T     A  +  + G IM+ A 
Sbjct  269  QAKIAGTVLTVAGAVLMVLYHGPALRFPWT--KGHHHATIGGQGAAARDWLVGTIMLIAS  326

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W  FFILQA TLRSYPA LSLT+LIC MG+L  G + L  ER+NT VWA+ +D +L 
Sbjct  327  CMIWPGFFILQANTLRSYPAELSLTALICGMGSLMSGAVALVAERANTQVWAIGFDNRLF  386

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
             +VY GI+CSGV YYL GV+ +++GP FV+AF+PLS+VI A+MGS +L E++ LGSV+GA
Sbjct  387  TVVYGGIVCSGVAYYLQGVVSRQRGPVFVTAFSPLSMVITAVMGSIILKEEITLGSVIGA  446

Query  463  CIIAVGLYLVIWSKSDNQDSP  401
             II  GLY +IW KS +  SP
Sbjct  447  VIIVSGLYFLIWGKSKDAISP  467



>ref|XP_009388785.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVTV GA++M L  GP I   WT+ R H    +     H + G  M+   C  
Sbjct  136  QAKVVGTLVTVIGALLMILYTGPIIEFVWTKGRSHHAGDSGQNESHWLIGTFMLLFSCFC  195

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ FFILQ+ TL+SYPA LSL++LICLMGA Q G L L +ERS T  W + +D +L   V
Sbjct  196  WSAFFILQSHTLKSYPAELSLSTLICLMGAGQGGALALVMERS-TKPWLIGFDTRLFTAV  254

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSGV YY+ G++MKE+GP FV+AFNPL ++I AIMGS +LAE++ LG VLGA II
Sbjct  255  YSGIMCSGVAYYVQGIVMKERGPVFVTAFNPLCMIITAIMGSIILAEEITLGRVLGAVII  314

Query  454  AVGLYLVIWSKS-DNQDSPVLSNAEEG  377
             +GLY +IW KS D+   P     +E 
Sbjct  315  VIGLYSLIWGKSKDHLTEPSQPREKEA  341



>ref|XP_007009431.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18241.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHI-QSTTAATHQHPI-KGAIMITAGC  821
            QAK++GT+VTVGGAM+MTL+KGP + LPWT+ R H+ QS  +  H+H + KG +M+ AGC
Sbjct  138  QAKVVGTMVTVGGAMVMTLIKGPVLELPWTKGRNHLDQSGASGGHEHDLMKGTLMLMAGC  197

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
            C W+CF I QA+ L+SYPA LSL +LIC MG ++  +L  AVE  NT+VW  + D K +A
Sbjct  198  CCWSCFIISQAVILKSYPAKLSLAALICTMGTVEGTILAFAVEWRNTSVWLFHLDSKFIA  257

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             +Y G+I S       G +MK++GP FVSAFNPLSLVIVAI+GSFLLAE++ LG V+G+ 
Sbjct  258  AIYGGMI-SAFAVTTLGSVMKKRGPVFVSAFNPLSLVIVAILGSFLLAEEICLGRVIGSI  316

Query  460  IIAVGLYLVIWSKSDNQ  410
            II +GLYLV+W KS ++
Sbjct  317  IIVIGLYLVLWGKSKDE  333



>ref|XP_009141663.1| PREDICTED: WAT1-related protein At2g37460 [Brassica rapa]
Length=370

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = -3

Query  988  KILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFWA  809
            K++GTL TVGGAMIMTLVKGP + L WT+     Q+T        IKGA+++T GC  +A
Sbjct  141  KVIGTLATVGGAMIMTLVKGPVLDLFWTKV-ASAQNTDGTDIHSAIKGAVLVTIGCFSYA  199

Query  808  CFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYN  629
            CF ILQA+TLR+YPA LSLT+ ICLMG ++   + L +E+ N   WA+ WD KLL   Y+
Sbjct  200  CFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDTKLLTSTYS  259

Query  628  GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAV  449
            GI+CS + YY+ G +MK + P FV+AF+PL ++IVAIM + + AEQ+ LG VLGA +I  
Sbjct  260  GIVCSAIAYYVGGPVMKTRCPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRVLGAAVICA  319

Query  448  GLYLVIWSKSDNQD  407
            GLYLVIW K  + +
Sbjct  320  GLYLVIWGKGKDYE  333



>gb|EMS57240.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=343

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 139/202 (69%), Gaps = 5/202 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQST-----TAATHQHPIKGAIMIT  830
            QAKI GT++TV GA++M L  GP +  PWT+ + H  ++     +AA  +  + G IM+ 
Sbjct  99   QAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGVGSAADARDWLNGTIMVI  158

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
              C  WACFFILQ+ TL+SYPA LSLT LIC MG+L  G + L  ER+NT  W + +D++
Sbjct  159  IACVAWACFFILQSNTLKSYPAELSLTVLICGMGSLMSGAIALVAERANTQAWVIGFDMR  218

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   VY GI+CSGV YY+ G++  ++GP FV+AFNPL ++I A+MGS +L E++ LGSV+
Sbjct  219  LFTAVYAGIVCSGVAYYVQGIVSSQRGPVFVTAFNPLCMIITAVMGSIILKEEINLGSVI  278

Query  469  GACIIAVGLYLVIWSKSDNQDS  404
            GA II  GLY +IW KS ++ S
Sbjct  279  GAAIIVGGLYFLIWGKSKDEIS  300



>ref|XP_004167845.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=347

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG---HIQSTTAATHQHPIKGAIMITAG  824
            QAKILGTLVTVGGAM+MTL+KGP + LPWT +     H  ST     Q P+K AI+IT  
Sbjct  111  QAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLP-NKQQPVKAAIVITIS  169

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
                + F IL A T+R+YPA L+LT+ ICL GA++  +L LA E  N + W L+ D  LL
Sbjct  170  SICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSAWVLHADSILL  229

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GII SG+ YYL GV++K KGP FV+AFNPLS+VIVAI+ SF+ AE L LG V+GA
Sbjct  230  AALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFAETLRLGRVIGA  289

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLYLV+W KS ++
Sbjct  290  AVIIIGLYLVLWGKSKDK  307



>gb|ABG65997.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=270

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCC  818
            QAKI GTL+TVGGAM+M L KGP I  PWT+   H I  ++   + H + G  MI   C 
Sbjct  42   QAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDHNNGHWLMGIFMILLSCF  101

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR YPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  102  CWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIKA-WLIGFDMRLFTA  160

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L E + LG V+GA I
Sbjct  161  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCEVVTLGRVIGAII  220

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  221  IVVGLYALIWGKNKDHGNQV  240



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 148/210 (70%), Gaps = 7/210 (3%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH---QHPIKGAIMITAGC  821
            AKI+GT VTV GAM+MTL KGP +    +   G    +T +T    QH + G +M+ A C
Sbjct  144  AKIMGTCVTVAGAMVMTLYKGPILNFLTSHGAGSHHGSTTSTEPNDQHWVTGTLMLLASC  203

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
            C WA FFILQ+ TL+ YPA LSLT+LICLMGA+Q   ++L +ER  +A W + +D + LA
Sbjct  204  CGWASFFILQSFTLKKYPAELSLTALICLMGAVQGAAVSLVMERDMSA-WKIGFDSRFLA  262

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y+GI+CSGV YY+ G+++KE+GP FV++F+PL ++I A +G+ +LAEQL LGS++GA 
Sbjct  263  AAYSGIVCSGVAYYVQGMVIKERGPVFVTSFSPLCMIITAALGTIILAEQLRLGSIIGAI  322

Query  460  IIAVGLYLVIWSKSDNQD---SPVLSNAEE  380
            +I +GLY V+W K+ ++    +P L+N +E
Sbjct  323  LIVIGLYTVVWGKTKDKRISATPALTNEKE  352



>ref|XP_009409675.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+G+LVTV GA++M L KGP +   W++ R H  + T+ +  + + G  ++   C  
Sbjct  136  QAKIVGSLVTVVGALLMILYKGPVVEFVWSKGRSHRDTATSQSSGNWLTGIFLLLGSCLC  195

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ FFILQ+ TL +Y A LSLT+LICLMGA    V+TLAVE  +   W + WD++L+  +
Sbjct  196  WSSFFILQSNTLETYSAELSLTTLICLMGAAMSAVVTLAVEGFSAKPWTIGWDMRLVTAI  255

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G++CSGV YY+ G++MKE+GP +V+AFNPL ++I A++GS +LAE++ LGSV+GA II
Sbjct  256  YSGVVCSGVAYYVQGIVMKERGPVYVTAFNPLCMIITAVLGSIILAEEITLGSVIGAVII  315

Query  454  AVGLYLVIWSKSDNQ  410
             VGLY +IW KS +Q
Sbjct  316  VVGLYSLIWGKSKDQ  330



>ref|XP_004145365.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004153183.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=367

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTLVT  GA++MTL KGP +   WTQ+  H +    AAT+QH + G + I  GC  
Sbjct  138  AKVIGTLVTFAGALVMTLYKGPILDFFWTQKTNHHVNIGAAATNQHWVAGTLFILLGCVA  197

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CF+ILQ+IT++ YPA LSL++LICL GALQ  V+ +A+E   +A WA+ WD +LLA +
Sbjct  198  WSCFYILQSITVKRYPAELSLSALICLAGALQSTVIAVAIEHHASA-WAVGWDSRLLAPL  256

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SG+ YY   ++MK +GP FV+AFNPL +++V I+ S +LAE++ LGSV+G  II
Sbjct  257  YTGIVGSGIAYYFQALVMKTRGPVFVTAFNPLCMIVVTIISSIVLAEKIHLGSVIGGLII  316

Query  454  AVGLYLVIWSKSDNQDS  404
            A+GLY V+W KS +  +
Sbjct  317  AIGLYAVVWGKSKDYST  333



>gb|KGN61714.1| hypothetical protein Csa_2G231960 [Cucumis sativus]
Length=386

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTLVT  GA++MTL KGP +   WTQ+  H +    AAT+QH + G + I  GC  
Sbjct  157  AKVIGTLVTFAGALVMTLYKGPILDFFWTQKTNHHVNIGAAATNQHWVAGTLFILLGCVA  216

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CF+ILQ+IT++ YPA LSL++LICL GALQ  V+ +A+E   +A WA+ WD +LLA +
Sbjct  217  WSCFYILQSITVKRYPAELSLSALICLAGALQSTVIAVAIEHHASA-WAVGWDSRLLAPL  275

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SG+ YY   ++MK +GP FV+AFNPL +++V I+ S +LAE++ LGSV+G  II
Sbjct  276  YTGIVGSGIAYYFQALVMKTRGPVFVTAFNPLCMIVVTIISSIVLAEKIHLGSVIGGLII  335

Query  454  AVGLYLVIWSKSDNQDS  404
            A+GLY V+W KS +  +
Sbjct  336  AIGLYAVVWGKSKDYST  352



>ref|XP_004142736.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN51278.1| hypothetical protein Csa_5G512850 [Cucumis sativus]
Length=374

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG---HIQSTTAATHQHPIKGAIMITAG  824
            QAKILGTLVTVGGAM+MTL+KGP + LPWT +     H  ST     Q P+K AI+IT  
Sbjct  137  QAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLP-NKQQPVKAAIVITIS  195

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
                + F IL A T+R+YPA L+LT+ ICL GA++  +L LA E  N + W L+ D  LL
Sbjct  196  SICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSAWVLHADSILL  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GII SG+ YYL GV++K KGP FV+AFNPLS+VIVAI+ SF+ AE L LG V+GA
Sbjct  256  AALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFAETLRLGRVVGA  315

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLYLV+W KS ++
Sbjct  316  AVIIIGLYLVLWGKSKDK  333



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 154/241 (64%), Gaps = 8/241 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER--GHIQSTTAATHQHP-IKGAIMITAG  824
             AK+ GTL TV GAM+MTL+KGP + L WT  R   H  +    T  H  IKG ++I  G
Sbjct  133  HAKVFGTLATVAGAMVMTLMKGPVLELFWTTGRINNHEAAAKNRTDFHDTIKGGLLIAVG  192

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  +ACF ILQA+TL++YPA LSLT  ICLMG L+  V  L +E    ++WA+ WD KLL
Sbjct  193  CFSYACFVILQAVTLKTYPAELSLTVWICLMGTLEATVAALVMETGKASIWAIKWDTKLL  252

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
               Y+GI+CSG+ YY+ GVIMK++GP FV+AF+PL +VIVAIM SF+LAEQ+ LG V+GA
Sbjct  253  TAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMASFILAEQMFLGRVIGA  312

Query  463  CIIAVGLYLVIWSKSDNQDS--PVLSNAEEGsss*SATVYNYQSNSC*RRQFSMVEERTP  290
             II VGLYLV+W KS    S  P++    E +     T      N     Q  +++E++ 
Sbjct  313  IIIIVGLYLVLWGKSKEYKSQQPLMEQQIEAAKLDIGT---NNENGSFDHQAIIIDEKSQ  369

Query  289  N  287
             
Sbjct  370  E  370



>ref|XP_008463583.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=432

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG---HIQSTTAATHQHPIKGAIMITAG  824
            QAKILGTLVTVGGAM+MTL+KGP + LPWT +     H  ST     Q P+K AI+IT  
Sbjct  198  QAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNFNPHSYSTLP-NKQQPVKAAIVITIS  256

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
                + F IL A T+R+YPA L+LT+ ICL GA++  +L LA E  N + WAL+ D  LL
Sbjct  257  SICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSAWALHADSILL  316

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GII SG+ YYL GV++K KGP FV+AFNPLS+VIVA++ SF+ AE L LG V+GA
Sbjct  317  AALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAVISSFIFAETLRLGRVVGA  376

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLYLV+W KS ++
Sbjct  377  AVIIIGLYLVLWGKSKDK  394



>gb|EMS60728.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 138/201 (69%), Gaps = 5/201 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQST---TAATHQHPIKGAIMITAG  824
            QAKI GT++ V GA++M L  GP +  PWT   GH  +T     A  +  + G +M+ A 
Sbjct  137  QAKIAGTVLAVAGAVLMVLYHGPVVRFPWTS--GHHDATIGGQVAAARDWLIGTVMLIAS  194

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W  FFILQA TL SYPA LSLT+LIC MG+L  G + L  ER++T VW + +D +LL
Sbjct  195  CMIWPGFFILQANTLGSYPAELSLTALICGMGSLMSGAIALVAERADTQVWVVGFDSRLL  254

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
             +VY GI+CSGV YYL GV+ +++GP FV+AF+PLS++I A+MGS +L E++ LGSV+GA
Sbjct  255  TVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFSPLSMIITAVMGSIILKEEITLGSVIGA  314

Query  463  CIIAVGLYLVIWSKSDNQDSP  401
             II  GLY +IW KS +  SP
Sbjct  315  VIIVTGLYFIIWGKSKDDISP  335



>gb|ABG65998.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=304

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCC  818
            QAKI GTL+TVGGAM+M L KGP I  PWT+   H I  ++   + H + G  MI   C 
Sbjct  76   QAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDHNNGHWLMGIFMILLSCF  135

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR YPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  136  CWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIKA-WLIGFDMRLFTA  194

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L E + LG V+GA I
Sbjct  195  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCEVVTLGRVIGAII  254

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  255  IVVGLYALIWGKNKDHGNQV  274



>gb|AAM01041.1|AC091735_14 Putative nodulin-like protein [Oryza sativa Japonica Group]
Length=330

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCC  818
            QAKI GTL+TVGGAM+M L KGP I  PWT+   H I  ++   + H + G  MI   C 
Sbjct  102  QAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDHNNGHWLMGIFMILLSCF  161

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR YPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  162  CWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIKA-WLIGFDMRLFTA  220

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L E + LG V+GA I
Sbjct  221  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCEVVTLGRVIGAII  280

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  281  IVVGLYALIWGKNKDHGNQV  300



>ref|XP_002284452.2| PREDICTED: WAT1-related protein At4g08290 [Vitis vinifera]
 emb|CBI19039.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 150/205 (73%), Gaps = 2/205 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAKI+GT++T  GA++MTL KGP I L W+ +  H  +  ++T  H I G ++I  GCC 
Sbjct  143  QAKIVGTVLTFSGALLMTLYKGPIIDLIWSHKTSH-NANHSSTDTHWITGTLLILVGCCA  201

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F+ILQ+IT+++YPA LSL++LICLMGA+Q G + L  ER  +A WA+ WD +LLA V
Sbjct  202  WSAFYILQSITIKTYPAELSLSTLICLMGAIQSGAVGLVAERHPSA-WAIGWDSRLLAPV  260

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SG+ YY+ G++MK +GP FV+AFNPL ++IVA +G+ +LAEQL LGS++GA II
Sbjct  261  YTGIVSSGLTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGTLILAEQLHLGSIIGAIII  320

Query  454  AVGLYLVIWSKSDNQDSPVLSNAEE  380
            A+GLY V W KS +Q  P  +  EE
Sbjct  321  AIGLYSVAWGKSKDQFGPTPTTTEE  345



>ref|XP_004494995.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=314

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GT+ TV GAM+MTL+KGP +   +  +  +  ++  +T QH I GA+MIT GC  
Sbjct  143  QAKVVGTIATVSGAMVMTLIKGPVLFGTFGSDSQNHHNSGIST-QHTIIGAVMITLGCFS  201

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            WACF ILQAITL +YPA LSL+S ICL+G L+   + L VER N +VW++ WD++LL+ +
Sbjct  202  WACFIILQAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYSVWSIKWDVRLLSAI  261

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGS  476
            Y GI CSG+GYYL GV+MK +GP FV+ FNPL +VIVAIMG F+LAEQ+ LG 
Sbjct  262  YTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILAEQMFLGR  314



>ref|XP_002306625.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
 gb|EEE93621.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
Length=363

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 140/198 (71%), Gaps = 1/198 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVT+ GA++MT+ KGP I LPW+Q+     ST A++ +H + G +++  GC  
Sbjct  143  QAKVVGTLVTLAGALLMTVYKGPVIGLPWSQKTSQHGSTAASSDKHWVTGTLLLLVGCVS  202

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ F++LQ  TL+ YPA LSL SLICL G++Q   + L V    ++ WA+ WD +L   +
Sbjct  203  WSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAHHPSS-WAVGWDARLFTPL  261

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y GI+ SG+ YY+ G++MK +GP FV+AFNPL ++IVA +GS +LAE+L LGSVLG  II
Sbjct  262  YTGIVASGITYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAEKLHLGSVLGGIII  321

Query  454  AVGLYLVIWSKSDNQDSP  401
            A+GLY V+W K  +  SP
Sbjct  322  AIGLYSVVWGKRKDYTSP  339



>ref|XP_008219662.1| PREDICTED: WAT1-related protein At1g21890-like [Prunus mume]
Length=381

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 144/204 (71%), Gaps = 1/204 (0%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT++TV GAM+MT  KGP + +   Q +GH  +T  +  QH I G  M+ A CC W
Sbjct  144  AKVIGTVITVMGAMVMTWYKGPIVEIIKGQTQGHHNTTALSAEQHWITGTFMLLARCCGW  203

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            + FFILQ+ TL+ YPA LSLT+LICLMGAL+  V T  +E  N +VW + WD +L+A  Y
Sbjct  204  SGFFILQSFTLKLYPAELSLTALICLMGALEGAVATFILEH-NMSVWVIGWDSRLIAAGY  262

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY+ G++MKE+GP FV+AF+PL+++I A + + +LAEQ+ LGS+LG  +I 
Sbjct  263  SGVVCSGIAYYVQGIVMKEQGPVFVTAFSPLAMIITAALAAVILAEQIHLGSILGTILIV  322

Query  451  VGLYLVIWSKSDNQDSPVLSNAEE  380
            +GLY V+W KS +  +  L   +E
Sbjct  323  IGLYAVVWGKSKDPTASSLLIEDE  346



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 139/200 (70%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GTLVTVGGAM+M L KGP I  PWT+   + +   +     H + G  MI   C 
Sbjct  136  QAKIVGTLVTVGGAMLMILFKGPVINFPWTKNANYNVADNSGQNSGHWLMGIFMILLSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR+YPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  196  CWSAFFILQSYTLRNYPAELSLTTLICAMGVAQSGAIALVMERDMKA-WLIGFDMRLFTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L+E + LG V+GA I
Sbjct  255  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILSEVVTLGRVIGAII  314

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  315  IVVGLYALIWGKNKDHANQV  334



>gb|EMT18534.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=319

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-----QHPIKGAIMIT  830
            QAKI GT++TV GA++M L  GP +  PWT+ + H  ++          +  + G IM+ 
Sbjct  67   QAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGAGGAADARDWLNGTIMVI  126

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
              C  WACFFILQ+ TLRSYPA LSLT LIC MG+L  G + L  ER+NT  W + +D++
Sbjct  127  IACVAWACFFILQSNTLRSYPAELSLTVLICGMGSLMSGAIALVAERANTQAWVIGFDMR  186

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   VY GI+CSGV YY+ G++ +++GP FV+AFNPL ++I A+MGS +L E++ LGSV+
Sbjct  187  LFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILKEEINLGSVI  246

Query  469  GACIIAVGLYLVIWSKSDNQDS  404
            GA II  GLY +IW KS ++ S
Sbjct  247  GAAIIVGGLYFLIWGKSKDEIS  268



>ref|NP_001064323.1| Os10g0210500 [Oryza sativa Japonica Group]
 gb|ABB47053.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47054.2| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26237.1| Os10g0210500 [Oryza sativa Japonica Group]
 dbj|BAG90481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50726.1| hypothetical protein OsJ_31032 [Oryza sativa Japonica Group]
Length=364

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH-IQSTTAATHQHPIKGAIMITAGCC  818
            QAKI GTL+TVGGAM+M L KGP I  PWT+   H I  ++   + H + G  MI   C 
Sbjct  136  QAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDHNNGHWLMGIFMILLSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR YPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  196  CWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIKA-WLIGFDMRLFTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L E + LG V+GA I
Sbjct  255  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCEVVTLGRVIGAII  314

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  315  IVVGLYALIWGKNKDHGNQV  334



>gb|KHG24903.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=373

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHP-IKGAIMITAGC  821
              KI+GTL TV GAM+MTL+KGP + L WT+ R  H  ++   T  H  IKG ++IT GC
Sbjct  139  HGKIIGTLATVAGAMVMTLMKGPVLELFWTKGRNNHEAASKNGTDLHDCIKGGVLITIGC  198

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              +ACF ILQAITL +YPA LSLT  ICL+G L+  +  L +E+ N A+WA+ WD KLL 
Sbjct  199  FSYACFVILQAITLETYPADLSLTVWICLLGTLEGTIAALIMEKGNAAIWAIKWDTKLLT  258

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y GI+CSG+ YY+ G+IM+ +GP FV+AF+PL +VIVAIM SF+LAEQ+ LG V+GA 
Sbjct  259  AAYTGIVCSGLAYYIQGMIMRHRGPVFVTAFSPLCMVIVAIMSSFILAEQMFLGRVIGAI  318

Query  460  IIAVGLYLVIWSKSDN  413
            II VGLYLV+W K+ +
Sbjct  319  IIIVGLYLVLWGKNKD  334



>gb|EMS60727.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=377

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-----QHPIKGAIMIT  830
            QAKI GT++TV GA++M L  GP +  PWT+ + H  +           +  +KG +M+ 
Sbjct  121  QAKIAGTVLTVAGAVLMILYHGPAMQFPWTKGQHHAAAGGQGAVGAAAARDWLKGTMMLI  180

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
              C  W+CFFILQ+ TLRSYPA LS+T+LIC MG+L  G + L  ER+NT  W + +D +
Sbjct  181  GSCMVWSCFFILQSSTLRSYPAELSVTALICGMGSLMSGAVALVAERANTHAWVIGFDTR  240

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            LL +VY GI+CSGV YYL GV+ +++GP FV+AFNPL ++I A+MGS +L E++ LGSV+
Sbjct  241  LLTVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFNPLCMIITAVMGSIILKEEITLGSVI  300

Query  469  GACIIAVGLYLVIWSKSDNQ  410
            GA II  GLY +IW KS ++
Sbjct  301  GAVIIVAGLYFLIWGKSKDK  320



>ref|NP_565861.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 gb|AAK73266.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAC98071.2| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09401.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=297

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 139/208 (67%), Gaps = 3/208 (1%)
 Frame = -3

Query  952  MIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFWACFFILQAITLR  776
            M+MTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +ACF ILQAITL+
Sbjct  87   MVMTLVKGPALDLFWT--KGPSAQNTVGTDIHSSIKGAVLVTIGCFSYACFMILQAITLK  144

Query  775  SYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYNGIICSGVGYYL  596
            +YPA LSL + ICL+G ++  V+ L +E+ N +VWA+ WD KLL I Y+GI+CS +GYY+
Sbjct  145  TYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALGYYI  204

Query  595  SGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAVGLYLVIWSKSD  416
             GV+MK +GP FV+AF PL +++VAIM S +  EQ+ LG  LGA +I VGLYLVIW K+ 
Sbjct  205  GGVVMKTRGPVFVTAFKPLCMIVVAIMSSIIFDEQMYLGRALGATVICVGLYLVIWGKAK  264

Query  415  NQDSPVLSNAEEGsss*SATVYNYQSNS  332
            + + P     ++  +  + +    Q  +
Sbjct  265  DYEYPSTPQIDDDLAQATTSKQKEQRRT  292



>ref|XP_006436052.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
 ref|XP_006486061.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49292.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
Length=383

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER---GHIQSTTAATHQHPIKGAIMITAG  824
            QAKILGT+VT GGAM MTL KGP +  PW Q R     ++++     +   KGA++I AG
Sbjct  140  QAKILGTIVTAGGAMCMTLFKGPILKFPWKQVRLLHNQLETSIQNNEEDLTKGALLIAAG  199

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF ILQA  L+SYPA LSLT+LIC M +++  +LTLA+ER NT +W L++D KLL
Sbjct  200  CFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNTGIWLLHFDAKLL  259

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A++Y G + S   Y++ G +MK +GP FVS+FNPL +VI+A++GSF LAE+L LG ++GA
Sbjct  260  AVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFLAEKLYLGRIIGA  318

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
             II +GLY+V+W ++ ++ SP  S+  E
Sbjct  319  VIIVIGLYMVLWGRNKDR-SPSKSDNNE  345



>ref|XP_002489200.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
 gb|EES20205.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
Length=368

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 142/207 (69%), Gaps = 3/207 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQE--RGHIQSTTAATHQHPIKGAIMITAGCC  818
            AKI GT +TVGGA++M L KGP +  PW++      +  + A    H + G  MI   C 
Sbjct  137  AKIAGTAITVGGALLMILFKGPNVNCPWSKHVINDSVSDSGAHNSGHWLMGTFMILLSCF  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLRSYP GLSLT+LIC  GA++ G + L +ER +T  W++ +DI+L   
Sbjct  197  CWSAFFILQSYTLRSYPCGLSLTTLICATGAMESGAVALVMER-DTKAWSIGFDIRLFTA  255

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV ++GSF+L+E + LG ++GA +
Sbjct  256  VYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTVLGSFILSEVVTLGRLIGATV  315

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            I VGLY +IW K+ +    + +N EE 
Sbjct  316  IVVGLYALIWGKNMDHLKSIDNNKEEN  342



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GT+VTV GA++M L KGP +   W++ R H  +       + +KG +M+  GC  
Sbjct  411  QAKLVGTIVTVAGALLMILYKGPVLDFVWSKGRSHHNTAVGQNGSNSLKGTLMLLGGCFC  470

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
             + F+ILQ+ TL SYPA L+LTSLICLMGAL   ++ L  ER +   W + WD +LLA+V
Sbjct  471  CSSFYILQSNTLESYPAELTLTSLICLMGALMSSLVALVAERGSAKPWIIGWDTRLLAVV  530

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+G++CSGV YY+ G +MKE+GP FV+AFNPL +++ A++GS +LAE++ LGSV+GA +I
Sbjct  531  YSGVLCSGVAYYVQGKVMKERGPVFVTAFNPLCMIVTAVLGSIVLAEEITLGSVIGAAVI  590

Query  454  AVGLYLVIWSKSDNQ  410
             +GLY +IW KS + 
Sbjct  591  VIGLYSLIWGKSKDH  605


 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GT+VTV GA++M L KGP +   W++ R H  +  +    + +KG +M+  GC  
Sbjct  136  QAKLVGTIVTVAGALLMILYKGPSLDFVWSKGRSHHNTAVSQNGSNSLKGTLMLLGGCFC  195

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ FFILQ+ TL SYPA L+LT+LICLMG L   ++ L  ER +   W + WD +LLA+V
Sbjct  196  WSSFFILQSNTLESYPAALTLTTLICLMGTLMSSLVALVAERGSAKPWIIGWDTRLLAVV  255

Query  634  YN  629
            Y+
Sbjct  256  YS  257



>dbj|BAJ98418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 140/211 (66%), Gaps = 5/211 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATH-----QHPIKGAIMIT  830
            QAKI GT++TV GA++M L  GP +  PWT+ + H  ++          +  + G IM+ 
Sbjct  137  QAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGAGGAAAARDWLNGTIMVI  196

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
              C  WACFFILQ+ TLRSYPA LSLT LIC MG+L  G + L  ER+NT  W + +D +
Sbjct  197  IACVAWACFFILQSNTLRSYPAELSLTVLICGMGSLMSGAIALVAERANTQAWVIGFDTR  256

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   VY GI+CSGV YY+ G++ +++GP FV+AFNPL ++I A+MGS +L E++ LGSV+
Sbjct  257  LFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILKEEINLGSVI  316

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            GA II  GLY +IW KS ++ + V   + +G
Sbjct  317  GAAIIVGGLYFLIWGKSKDEINKVSDVSVKG  347



>ref|XP_009398157.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 133/195 (68%), Gaps = 1/195 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVTV GA++M L KGP I   WT+ R H     +    H + G  M+   C  
Sbjct  136  QAKVVGTLVTVIGALLMILYKGPAIEFIWTKGRSHHADDGSQNQSHWLVGTFMLLFSCFC  195

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+ FFILQ+ TL+SYPA LSL++LICL GA Q G L L +ERS    W + +D +L   V
Sbjct  196  WSAFFILQSHTLKSYPAELSLSTLICLTGAGQSGALALVMERSAQP-WLIGFDTRLFTAV  254

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GI+CSG+ YY+ G++MKE+GP FV+AFNPL ++I AIMGS +LAE + LG +LGA II
Sbjct  255  YSGIMCSGIAYYVQGMVMKERGPVFVTAFNPLCMIITAIMGSIILAEDITLGRLLGAVII  314

Query  454  AVGLYLVIWSKSDNQ  410
             +GLY +IW K  + 
Sbjct  315  VIGLYFLIWGKGKDH  329



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 144/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQS----TTAATHQHPIKGAIMITAG  824
            +K++GT VTVGGAM+MTL KGP +    +   GH  +       +T+QH + G +M+ A 
Sbjct  141  SKVIGTAVTVGGAMVMTLYKGPIVDFMRSGGTGHPHAGGDGPHQSTNQHWVTGTLMLLAS  200

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            CC W+ FFILQ+ TL+ YPA LSLT+LICLMG+++   +TL +ER N  VW + WD +LL
Sbjct  201  CCGWSGFFILQSFTLKKYPAELSLTALICLMGSVEGAAVTLVMER-NMNVWRIGWDSRLL  259

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A VY+G++CSG+ YY+ GV++KE+GP F+++F+PL ++I A +G+ +LAE + LGS++GA
Sbjct  260  AAVYSGVVCSGIAYYVQGVVIKERGPVFITSFSPLCMIITAALGAIVLAETIHLGSIIGA  319

Query  463  CIIAVGLYLVIWSKSDNQDS  404
              I  GLY+V+W KS ++ +
Sbjct  320  IFIVCGLYIVVWGKSKDRQA  339



>ref|XP_003570554.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=398

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 133/203 (66%), Gaps = 4/203 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG----HIQSTTAATHQHPIKGAIMITA  827
            QAKI GT++TV GA++M L  GP +  PWT+ R     H            + G IM  A
Sbjct  136  QAKIAGTVLTVAGAVLMILYHGPAVQFPWTKGRAGAANHGAGQGQGQGAGWLSGTIMTIA  195

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
             C  WACFF+LQ+ TL+SYPA LSLT LIC +G+L  G + L  ER NT  W + +D +L
Sbjct  196  ACVAWACFFVLQSSTLQSYPAELSLTVLICAVGSLMSGSVALVAERGNTQAWVIGFDTRL  255

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
               VY GI+CSGV YY+ G++ +++GP FV+AFNPL ++I ++MGS +L E++ LGSV+G
Sbjct  256  FTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITSVMGSIILKEEITLGSVIG  315

Query  466  ACIIAVGLYLVIWSKSDNQDSPV  398
            A II  GLY +IW KS ++ S V
Sbjct  316  AAIIVAGLYFLIWGKSKDEVSQV  338



>ref|XP_010421738.1| PREDICTED: WAT1-related protein At4g08290 [Camelina sativa]
Length=386

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 144/210 (69%), Gaps = 8/210 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTL+ VGGA++MTL KGP I LPW+     Q+ GH  S+    H H + G +++ 
Sbjct  137  KAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMDQQNGHTNSSQ--DHSHWVVGTLLLL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL+SLICL GA+Q   + L VER  +  WA+ WD +
Sbjct  195  IGCVAWSGFYVLQSITIKTYPANLSLSSLICLAGAVQSFAVALVVERHPSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   +Y GI+ SG+ YY+ G++M  +GP FV+AFNPL +V+VA++ SF+L EQ+  G V+
Sbjct  254  LYGPLYTGIVSSGITYYVQGMVMNTRGPVFVTAFNPLCMVLVALLASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            G  +IA GLY+V+W K  + +   L N E+
Sbjct  314  GGVVIAAGLYMVVWGKGKDYEVSGLDNLEK  343



>ref|XP_006649078.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=357

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 141/212 (67%), Gaps = 7/212 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH---IQSTTAATHQHPIKGAIMITAG  824
            QAKI GTL TV GA++M L  GP +  PWT+ + H         A     ++G I I   
Sbjct  136  QAKIAGTLFTVAGAVLMVLYHGPVVQFPWTKGQHHDGASGGAGGAAGGGFLQGTIFIVVA  195

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+ FF+LQ+ TL+SYPA LSLT+LICLMG++  G + L  ER NT  W + +D +L 
Sbjct  196  CVCWSGFFVLQSNTLQSYPAELSLTTLICLMGSVMSGAVALVAERHNTRAWLIGFDTRLF  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
              VY GI+CSGV YY+ G++ +++GP FV+AFNPL ++I AIMGS +L E++ LGSV+GA
Sbjct  256  TCVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKEEIRLGSVIGA  315

Query  463  CIIAVGLYLVIWSKS-DNQD--SPV-LSNAEE  380
             II VGLY +IW KS DN+   SPV L  A+E
Sbjct  316  VIIVVGLYALIWGKSADNEQNTSPVRLRVADE  347



>gb|KDO67719.1| hypothetical protein CISIN_1g042257mg [Citrus sinensis]
Length=383

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER---GHIQSTTAATHQHPIKGAIMITAG  824
            QAKILGT+VT GGAM MTL+KGP +  PW Q R     +++      +   KGA++I AG
Sbjct  140  QAKILGTIVTAGGAMCMTLLKGPILKFPWKQVRLLHNQLETGIQNNEEDLTKGALLIAAG  199

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF ILQA  L+SYPA LSLT+LIC M +++  +LTLA+ER NT +W L++D KLL
Sbjct  200  CFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNTGIWLLHFDAKLL  259

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A++Y G + S   Y++ G +MK +GP FVS+FNPL +VI+A++GSF LAE+L LG ++GA
Sbjct  260  AVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFLAEKLYLGRIIGA  318

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
             II +GLY+V+W ++ ++ SP  S+  E
Sbjct  319  VIIVIGLYMVLWGRNKDR-SPSKSDNNE  345



>ref|XP_006397315.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
 gb|ESQ38768.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
Length=382

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 149/220 (68%), Gaps = 16/220 (7%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQ---ERGHIQSTTAATHQHPIKGAIMITAG  824
            QAKI+GTLV +GGA++MTL KGP I LPW+    ++ +  S ++  + H + G ++I   
Sbjct  137  QAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNMDQHNEHSNSSQDNNHWVAGTLLILLA  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF++LQ+IT+++YPA LSL +LICL GA+Q   + L VER ++  WA+ WD +L 
Sbjct  197  CVAWSCFYVLQSITIKTYPADLSLAALICLSGAIQSTAVALVVERHSSG-WAVGWDARLF  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GI+ SG+ YY+ G++M+ +GP FV+AFNPL +++VA++ SF+L EQ+  G V+G 
Sbjct  256  APLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIHYGCVIGG  315

Query  463  CIIAVGLYLVIWSKSDN------------QDSPVLSNAEE  380
             +IA+GLYLV+W K  +            Q+ P+ +  EE
Sbjct  316  TVIAMGLYLVVWGKGKDYEVSGVAEKNSLQELPIRTKFEE  355



>gb|EMT07558.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=354

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 137/208 (66%), Gaps = 2/208 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH--IQSTTAATHQHPIKGAIMITAGC  821
            QAK  GT++TV GA++M L  GP +  PWT+ + H       A   +  + G IM+   C
Sbjct  99   QAKNAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHSTAGGQGAGGARDWLNGTIMVIIAC  158

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              WACFFILQ+ TLRSYPA LSLT LIC MG+L  G + L  ER NT  W + +D +L  
Sbjct  159  VAWACFFILQSNTLRSYPAELSLTVLICSMGSLMSGAIALVAERGNTQAWVIGFDTRLFT  218

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY GI+CSGV YY+ G++ +++GP FV+AFNPL ++I A+MGS +L E++ LGSV+GA 
Sbjct  219  AVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILKEEINLGSVIGAA  278

Query  460  IIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            II  GLY +IW KS ++ + V   + +G
Sbjct  279  IIVGGLYFLIWGKSKDEINKVSDVSVKG  306



>dbj|BAF00152.1| nodulin-like protein [Arabidopsis thaliana]
Length=336

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 139/208 (67%), Gaps = 3/208 (1%)
 Frame = -3

Query  952  MIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFWACFFILQAITLR  776
            M+MTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +ACF ILQAITL+
Sbjct  126  MVMTLVKGPALDLFWT--KGPSAQNTVGTDIHSSIKGAVLVTIGCFSYACFMILQAITLK  183

Query  775  SYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYNGIICSGVGYYL  596
            +YPA LSL + ICL+G ++  V+ L +E+ N +VWA+ WD KLL I Y+GI+CS +GYY+
Sbjct  184  TYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALGYYI  243

Query  595  SGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAVGLYLVIWSKSD  416
             GV+MK +GP FV+AF PL +++VAIM S +  EQ+ LG  LGA +I VGLYLVIW K+ 
Sbjct  244  GGVVMKTRGPVFVTAFKPLCMIVVAIMSSIIFDEQMYLGRALGATVICVGLYLVIWGKAK  303

Query  415  NQDSPVLSNAEEGsss*SATVYNYQSNS  332
            + + P     ++  +  + +    Q  +
Sbjct  304  DYEYPSTPQIDDDLAQATTSKQKEQRRT  331



>ref|NP_001078016.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|F4IQX1.1|WTR12_ARATH RecName: Full=WAT1-related protein At2g37450 [Arabidopsis thaliana]
 gb|AEC09402.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=336

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 139/208 (67%), Gaps = 3/208 (1%)
 Frame = -3

Query  952  MIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCCFWACFFILQAITLR  776
            M+MTLVKGP + L WT  +G     T  T  H  IKGA+++T GC  +ACF ILQAITL+
Sbjct  126  MVMTLVKGPALDLFWT--KGPSAQNTVGTDIHSSIKGAVLVTIGCFSYACFMILQAITLK  183

Query  775  SYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVYNGIICSGVGYYL  596
            +YPA LSL + ICL+G ++  V+ L +E+ N +VWA+ WD KLL I Y+GI+CS +GYY+
Sbjct  184  TYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALGYYI  243

Query  595  SGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIAVGLYLVIWSKSD  416
             GV+MK +GP FV+AF PL +++VAIM S +  EQ+ LG  LGA +I VGLYLVIW K+ 
Sbjct  244  GGVVMKTRGPVFVTAFKPLCMIVVAIMSSIIFDEQMYLGRALGATVICVGLYLVIWGKAK  303

Query  415  NQDSPVLSNAEEGsss*SATVYNYQSNS  332
            + + P     ++  +  + +    Q  +
Sbjct  304  DYEYPSTPQIDDDLAQATTSKQKEQRRT  331



>ref|XP_006436051.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
 gb|ESR49291.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
Length=339

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER---GHIQSTTAATHQHPIKGAIMITAG  824
            QAKILGT+VT GGAM MTL+KGP +  PW Q R     +++ T    +H  KGA+MI A 
Sbjct  140  QAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLETGTHNKEEHMTKGALMIAAA  199

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF ILQA  L+SYPA LSLT+L+C + +++  +L LA+E+ NT +W L++D KLL
Sbjct  200  CFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGNTGIWLLHFDAKLL  259

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            +++Y G + S   Y++ G +MK KGP FVS+FNPLS+VI+AI+GSF +AE+L LG ++G 
Sbjct  260  SVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEELFLGRIVGG  318

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLY+V+W +S +Q
Sbjct  319  IVIVIGLYMVLWGRSKDQ  336



>ref|XP_006486497.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
Length=341

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER---GHIQSTTAATHQHPIKGAIMITAG  824
            QAKILGT+VT GGAM MTL+KGP +  PW Q R     +++ T    +H  KGA+MI A 
Sbjct  141  QAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLETGTHNKEEHMTKGALMIAAA  200

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF ILQA  L+SYPA LSLT+L+C + +++  +L LA+E+ NT +W L++D KLL
Sbjct  201  CFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGNTGIWLLHFDAKLL  260

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            +++Y G + S   Y++ G +MK KGP FVS+FNPLS+VI+AI+GSF +AE+L LG ++G 
Sbjct  261  SVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEELFLGRIVGG  319

Query  463  CIIAVGLYLVIWSKSDNQ  410
             +I +GLY+V+W +S +Q
Sbjct  320  IVIVIGLYMVLWGRSKDQ  337



>dbj|BAK04730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 3/201 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP--IKGAIMITAGC  821
            QAKI GTL+TVGGA++M L  GP I  PWT+  G    T  A+H     + G  MI   C
Sbjct  136  QAKIAGTLITVGGALLMVLFSGPVINFPWTKHAGSHAVTNTASHSSGCWLLGIFMILLSC  195

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              W+ FFILQ+ TLRSYP+ LSLT+LIC  G +Q GV+ L +ER +T  WA+ +D++L  
Sbjct  196  FCWSAFFILQSHTLRSYPSELSLTTLICTTGVVQSGVVALVMER-DTKAWAIGFDMRLFT  254

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
             VY+GI+CSGV YY+ G++++E+GP F++AF PL ++IV ++GSF+L+E + LG + GA 
Sbjct  255  AVYSGIMCSGVAYYVQGIVIQERGPVFITAFCPLCMIIVTVLGSFILSEVITLGRITGAM  314

Query  460  IIAVGLYLVIWSKSDNQDSPV  398
            II VGLY +IW KS++  + V
Sbjct  315  IIVVGLYALIWGKSNDHVNQV  335



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 1/207 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAKI GT++TV GA++M L  GP +  PWT+ + H      A      +KG IM  A C 
Sbjct  137  QAKIAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHAGGAATAADGAAWLKGTIMTVAACV  196

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+CFFILQ+ TLR YPA LSLT LIC +G++    + +  ER+NT  W + +D +L  +
Sbjct  197  AWSCFFILQSSTLRDYPAELSLTVLICGVGSVMSTAVAVVAERANTHAWVIGFDTRLFTV  256

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GI+CSGV YY+ GV+ +++GP FV+AFNPL +++ A+MGS +L E + LGSV+GA I
Sbjct  257  VYGGIVCSGVAYYVQGVVSRQRGPVFVTAFNPLCMIVTAVMGSIILKEAITLGSVIGAVI  316

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            I VGLY +IW KS +  S V   + +G
Sbjct  317  IVVGLYFLIWGKSKDGISQVSDVSVKG  343



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 141/208 (68%), Gaps = 3/208 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-HPIKGAIMITAGCC  818
            QAKI+GTLVTV GA++M L KGP +   WT+ R H  +T  +    H + G  M+   C 
Sbjct  136  QAKIIGTLVTVVGALLMILYKGPVVEFIWTKGRSHHNNTAGSQDDSHWLAGVFMLLGSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TL+SYPA LSLT  IC MGA Q G + L +ERS    W + +D++LL  
Sbjct  196  SWSAFFILQSNTLKSYPAELSLTVWICFMGAAQSGAVALVMERS-VKPWLIGFDMRLLTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+G++CSG+ YY+ G +MKE+GP FV+AFNPL ++IVA++GS +LAE++ LG ++GA I
Sbjct  255  AYSGVMCSGIAYYVQGKVMKERGPVFVTAFNPLCMIIVAVLGSIILAEEITLGRLIGAII  314

Query  457  IAVGLYLVIWSKS-DNQDSPVLSNAEEG  377
            I +GLY +IW KS D+   P  +  E G
Sbjct  315  IVIGLYSLIWGKSKDHLTQPSETGEEMG  342



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 143/207 (69%), Gaps = 4/207 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG--HIQSTTAATHQHPIKGAIMITAGC  821
            QAK+LGT++TVGGA+I+TL KGP + LPWT+ +   H Q  + + H+   K A++  A C
Sbjct  137  QAKVLGTIITVGGAIILTLAKGPALNLPWTKGKNQHHHQMQSDSNHKDITKSALLSAAAC  196

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVE-RSNTAVWALNWDIKLL  644
              W+ F ILQA TLRSYP  LSL +L C  G ++  +L L VE R++ A W+++ DI+LL
Sbjct  197  FCWSSFIILQAFTLRSYPCKLSLAALTCFWGLVEGAILALVVEWRNSNADWSIHLDIRLL  256

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A  Y GI+ SGV YY+ G++ KEKGP F SAFNPL  VI+AI+GS +L E + LGS++GA
Sbjct  257  AAFYGGIL-SGVAYYIMGMVNKEKGPVFFSAFNPLGTVIIAILGSLVLDEHMYLGSLIGA  315

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAE  383
             +I VGLYLV+W K+ ++    LS  +
Sbjct  316  IVIVVGLYLVLWGKTKDEPPSQLSKTQ  342



>ref|XP_004290852.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=368

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 148/208 (71%), Gaps = 6/208 (3%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AK++GT+VT+ GAMIMTL KGP I +          S+T ++ QH I G +M+ A C  W
Sbjct  145  AKVIGTVVTLSGAMIMTLYKGPIIDIVRGHSNSAQSSSTESSDQHWIAGPLMLIASCGGW  204

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            A FFILQ+ TL+ YPA LSLT+ IC+MG L+ GV+TL +ER N +VW + WD +LLA VY
Sbjct  205  ASFFILQSFTLKKYPAQLSLTAWICVMGVLEGGVVTLVMER-NMSVWVIGWDSRLLASVY  263

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G+ICSG+ YY+ GV+ +E+GP FV++F+PL ++I A++G+ +LAEQ+ LGS+LGA +I 
Sbjct  264  SGVICSGLAYYVQGVVNRERGPVFVTSFSPLCMIITAVLGAIVLAEQVHLGSILGAILIV  323

Query  451  VGLYLVIWSKSDNQ---DSPVLSNAEEG  377
             GLY V+W KS +    D P+    E+G
Sbjct  324  FGLYTVVWGKSKDPLPLDEPL--KDEKG  349



>ref|XP_010544709.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544717.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQER--GHIQSTT-AATHQHPIKGAIMITAG  824
            QAK++GTLVT+GGA+ MTL KGP + LPW+ +   GH  +T     H H I G ++I  G
Sbjct  137  QAKVIGTLVTLGGALAMTLYKGPVVPLPWSDQNLDGHNGNTNDTQDHAHWIAGTMLILLG  196

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+ F++LQ+IT++ YPA LSL++LIC  GA Q   + L +ER ++  WA+ WD +L 
Sbjct  197  CVAWSGFYVLQSITIKKYPAELSLSALICFAGAAQSLAVALVMERRSSG-WAVGWDARLF  255

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y GII SG+ YY+ G++MK +GP FV+AFNPL +V+VA++ SF+L EQ+ LGSV+G 
Sbjct  256  APLYTGIISSGLTYYVQGMVMKTRGPVFVTAFNPLCMVLVAVLASFILHEQIHLGSVIGG  315

Query  463  CIIAVGLYLVIWSKSDN  413
             +IAVGLY V+W K  +
Sbjct  316  VVIAVGLYSVVWGKGKD  332



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI GTL+TVGGAM+M L KGP I  PWT+    +I  ++   +   + G  MI   C 
Sbjct  136  QAKIAGTLITVGGAMLMILFKGPVINFPWTKNANQNISDSSDHNNGRWLMGIFMILLSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLRSYPA LSLT+LIC MG  Q G + L +ER   A W + +D++L   
Sbjct  196  CWSAFFILQSYTLRSYPAELSLTTLICAMGVAQSGAVALVMERDIKA-WLIGFDMRLFTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV I+GSF+L E + LG V+GA I
Sbjct  255  VYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILCEVVTLGRVIGAII  314

Query  457  IAVGLYLVIWSKSDNQDSPV  398
            I VGLY +IW K+ +  + V
Sbjct  315  IVVGLYALIWGKNKDHGNQV  334



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 139/196 (71%), Gaps = 3/196 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGP--KILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCC  818
            AK+ GTLVT+GGAM+MTL KGP   I     +   H  S++ +  QH + G +M+     
Sbjct  144  AKVAGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHNSSSSESADQHWVLGTLMLLGSIV  203

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLR YPA LSLT+LIC+ GA++  ++TL +ER  T VW + WD +LLA 
Sbjct  204  GWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIVTLIMERDFT-VWVIGWDSRLLAA  262

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY G+ICSG+ YY+ GV+++E+GP FV++F PL ++I AI+GS +LAEQ+ LGS++GA  
Sbjct  263  VYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMIITAILGSIVLAEQIHLGSIIGAIF  322

Query  457  IAVGLYLVIWSKSDNQ  410
            I +GLYLV+W K+ + 
Sbjct  323  IVMGLYLVVWGKAKDH  338



>gb|KFK32145.1| hypothetical protein AALP_AA6G204100 [Arabis alpina]
Length=383

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT---QERGHIQSTTAATHQHPIKGAIMITAG  824
            QAKI GTLV + GA++MTL KGP I LPW+   Q  G+ +S+    H H + G ++I   
Sbjct  137  QAKIAGTLVALAGALVMTLYKGPLIPLPWSNPDQLNGNTKSSQ--DHNHWVAGTLLILLA  194

Query  823  CCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLL  644
            C  W+CF++LQ+IT++ YPA LSL +LICL GA+Q   + L +ER ++  WA+ WD +L 
Sbjct  195  CVAWSCFYVLQSITIKKYPADLSLAALICLSGAVQSTAVALVMERHSSG-WAVGWDARLF  253

Query  643  AIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGA  464
            A +Y G++ SG+ YY+ G++MK +GP FV+AFNPL +++VA++ SF+L EQ+  G V+G 
Sbjct  254  APLYTGVVSSGLTYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIHFGCVIGG  313

Query  463  CIIAVGLYLVIWSKSDNQDSPVLSNAEEG  377
             +IA GLY+V+W K  + +   L N E+ 
Sbjct  314  AVIAAGLYMVVWGKGKDYEVSGLPNLEKN  342



>ref|XP_010438422.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=386

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 145/210 (69%), Gaps = 8/210 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTL+ VGGA++MTL KGP I LPW+     Q+ GH  S+    H + + G ++I 
Sbjct  137  KAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMDQQNGHTNSSQ--DHSNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL+SLICL G +Q   + L VER  +  WA+ WD +
Sbjct  195  IGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGVVQSFAVALVVERHPSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +V+VA++ SF+L E++ +G V+
Sbjct  254  LYGPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHEKIHVGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            G  IIA GLYLV+W K  + +   L N E+
Sbjct  314  GGVIIAAGLYLVVWGKGKDYEVSGLDNLEK  343



>ref|XP_010455250.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=387

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 144/210 (69%), Gaps = 8/210 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTL+ VGGA++MTL KGP I LPW+     Q+ GH  S+    H + + G ++I 
Sbjct  137  KAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSTDQQNGHTNSSQ--DHSNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
              C  W+CF++LQ+IT+++YPA LSL+SLICL GA+Q   + L +ER  +  WA+ WD +
Sbjct  195  ICCVAWSCFYVLQSITIKTYPADLSLSSLICLAGAVQSFAVALVMERHPSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L   +Y GI+ SG+ YY+ G +MK +GP FV+AFNPL +V+VA++ SF+L EQ+  G V+
Sbjct  254  LYGPLYTGIVSSGITYYVQGKVMKTRGPVFVTAFNPLCMVLVALLASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQDSPVLSNAEE  380
            G  +IA GLY+V+W K  + +   L N E+
Sbjct  314  GGIVIAAGLYMVVWGKGKDYEVSGLDNLEK  343



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 138/207 (67%), Gaps = 1/207 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTT-AATHQHPIKGAIMITAGCC  818
            QAKI+GT++TV GA++M L  GP +  PW++   H      AA+    + G I I   C 
Sbjct  136  QAKIVGTVLTVAGAVLMILYHGPVVQFPWSKGHHHDAGAQGAASSGSFLTGIITIIVACV  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FF+LQA TL+SYPA LSLT+LICLMG+L  G + L  ER+NT  W + +D +L   
Sbjct  196  CWSAFFVLQANTLKSYPAELSLTTLICLMGSLMSGSVALVAERNNTQAWVIGFDTRLFTC  255

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y GI+CSGV YY+ G++ +++GP FV+AFNPL ++I AIMGS +L E++  GSV+GA I
Sbjct  256  AYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKEEITRGSVIGAAI  315

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            I +GLY +IW KS ++ + V   +  G
Sbjct  316  IVLGLYALIWGKSKDEVNQVADVSASG  342



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 137/207 (66%), Gaps = 1/207 (0%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP-IKGAIMITAGCC  818
            QAKI GT++TV GA++M L  GP +  PWT+ + H     A       +KG IM+ A C 
Sbjct  135  QAKIAGTVLTVAGAVLMILYHGPTVQFPWTKGQHHAGGAAAGADAAAWLKGTIMVIAACV  194

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+CFF+LQ+ TLR YP+ LSLT LIC +G++    + L  ER+NT  W + +D +    
Sbjct  195  AWSCFFVLQSSTLRDYPSELSLTVLICGVGSVMSTGVALVAERANTQAWVIGFDARFFTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            VY GI+CSGV YY+ G++ K++GP FV+AFNPL ++I A+MGS +L E++ LGSV+GA I
Sbjct  255  VYAGIVCSGVAYYVQGIVSKQRGPVFVTAFNPLCMIITAVMGSIILKEEITLGSVIGAVI  314

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            I VGLY +IW KS ++ + V  +   G
Sbjct  315  IVVGLYFLIWGKSKDKVNQVSDDFVAG  341



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 141/205 (69%), Gaps = 4/205 (2%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCFW  812
            AKI+GT++ V GA+IMTL KGP I     Q  GH  +T AA  +H + G +M+ A C  W
Sbjct  144  AKIIGTVIMVPGAVIMTLYKGPAINFIKLQGGGHHGATNAAEAKHWVAGTLMLLARCWGW  203

Query  811  ACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIVY  632
            + F+ILQ+ TLR YPA LSLT+LIC +G +    ++ AVER   A W + WD  LLA VY
Sbjct  204  SGFYILQSFTLRMYPAELSLTALICFIGTIGGAAVSFAVERDMNA-WKIGWDASLLAAVY  262

Query  631  NGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACIIA  452
            +G++CSG+ YY  GV+++E+GP FV+AF+PL ++I A +GSFLLAE++ LGS++G  II 
Sbjct  263  SGVVCSGIAYYAQGVVLREQGPVFVTAFSPLCMIITAALGSFLLAEKVHLGSIIGTVIII  322

Query  451  VGLYLVIWSKSDNQDSPVLSNAEEG  377
             GLY V+W KS +Q +   S  +EG
Sbjct  323  CGLYTVLWGKSKDQQN---STTDEG  344



>ref|XP_002872388.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48647.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 143/201 (71%), Gaps = 8/201 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTLV +GGA++MTL KGP I LPW+     Q+ GH  S+    H + + G ++I 
Sbjct  137  KAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPTMDQQNGHTNSS--EDHNNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL++LICL GA+Q   + L VER ++  WA+ WD +
Sbjct  195  LGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHSSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L A +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +++VA++ SF+L EQ+  G V+
Sbjct  254  LFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQD  407
            G  +IA GLY+V+W K  + +
Sbjct  314  GGAVIAAGLYMVVWGKGKDYE  334



>gb|EYU28757.1| hypothetical protein MIMGU_mgv1a023410mg, partial [Erythranthe 
guttata]
Length=302

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 127/173 (73%), Gaps = 3/173 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCC  818
            QAKI+GTLV++GGAMIMTLV+GP + LPWT  RG H          + IKGA+MI     
Sbjct  132  QAKIIGTLVSIGGAMIMTLVRGPNLDLPWT--RGNHQDHKNGEDFNNSIKGALMIAIASF  189

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F I  AITL++YPA LSLT+ IC++G ++   L L +ER N+AVW++ WD KLL  
Sbjct  190  AWAGFMISHAITLQTYPAALSLTAWICMLGTVEGAALALIMERGNSAVWSIKWDTKLLGA  249

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLG  479
            VY+GI CSG+ YY+ G+++KE+GP FV+AF+PLS+V+VA+M SF+L EQ+ LG
Sbjct  250  VYSGIFCSGITYYVQGIVLKERGPVFVTAFSPLSMVLVAVMSSFILREQMYLG  302



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 140/207 (68%), Gaps = 5/207 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGH----IQSTTAATHQHPIKGAIMITA  827
            QAKI+GTL++VGGAM+MTL KGP + + W+    H    ++S +A   +  IKG++++ A
Sbjct  142  QAKIVGTLLSVGGAMLMTLYKGPAVHMFWSPHHHHHDKYVKSASAVPDKDWIKGSLLVIA  201

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
             C  WA FF+LQA   + Y A LSLT+LIC +G LQ   LTL +E    +VWA+ WD+ L
Sbjct  202  SCLAWAGFFVLQAFVAKKYSAQLSLTTLICFLGTLQSAALTLVIEH-KPSVWAIGWDMNL  260

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
            L  VY+G+I SG+ YY+  + M+ KGP F +AF+PL ++IVA+MGS +LAE + LGSVLG
Sbjct  261  LTAVYSGVIASGIAYYVQSLCMELKGPVFATAFSPLMMIIVAVMGSIILAETIYLGSVLG  320

Query  466  ACIIAVGLYLVIWSKSDNQDSPVLSNA  386
            A +I VGLY V+W K  +   P   N+
Sbjct  321  AILIVVGLYAVLWGKVKDHKIPSGKNS  347



>ref|XP_010096633.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65301.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=378

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 158/246 (64%), Gaps = 14/246 (6%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-QERGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAK++GT+VTVGGAM MTL  GP + LPWT Q   H +S  A  +Q   KGA+MITAGC 
Sbjct  118  QAKLIGTVVTVGGAMSMTLYNGPILNLPWTNQSTHHPESMIAKNNQVSAKGALMITAGCL  177

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ F ILQAITL+SYPA LSLT+ +CLMGA+Q  V+ LA+E  N A W++     +LA 
Sbjct  178  CWSSFIILQAITLKSYPAELSLTAWMCLMGAVQGSVVALALEWGNPAAWSICSGSMILAA  237

Query  637  VYN------------GIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAE  494
            +Y+            GI  SG  YY+ G++MKEKGP FV+AFNP+ LVIV I+GSFLL+E
Sbjct  238  LYSFLSFNVVDGIWQGIFRSGFAYYIQGLVMKEKGPVFVAAFNPVGLVIVVILGSFLLSE  297

Query  493  QLLLGSVLGACIIAVGLYLVIWSKS-DNQDSPVLSNAEEGsss*SATVYNYQSNSC*RRQ  317
             + LG ++GA II VGLYLV+W KS D + S       E S+  + T  N  + +  R  
Sbjct  298  IMYLGRIIGAIIIIVGLYLVLWGKSKDERQSESSEKVSEPSTDENMTEKNETTKNPNREL  357

Query  316  FSMVEE  299
               ++E
Sbjct  358  VVTIKE  363



>gb|EMS45454.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=370

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 141/204 (69%), Gaps = 3/204 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHP--IKGAIMITAGC  821
            QAKI GT++TVGGA++M L +GP +  PWT+  G       A H     + G +MI    
Sbjct  123  QAKIAGTVITVGGALLMVLFRGPVLNFPWTKHAGSHVVADTANHSSGCWLLGIVMILLSS  182

Query  820  CFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              W+ FFILQ+ TLRSYP+ LSLT++IC+MG +Q GV+ L +ER +T  WA+ +D++L+ 
Sbjct  183  FCWSAFFILQSHTLRSYPSELSLTTMICVMGVVQSGVVALVMER-DTKAWAIGFDMRLVT  241

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y+GI+CSGV YYL G++++E+GP FV+AF PL ++IV ++GSF+L+E + LG + GA 
Sbjct  242  AAYSGIMCSGVAYYLQGIVIQERGPVFVTAFCPLCMIIVTVLGSFILSEVITLGRITGAM  301

Query  460  IIAVGLYLVIWSKSDNQDSPVLSN  389
            II VGLY +IW KS +  + V  N
Sbjct  302  IIVVGLYALIWGKSKDHVNQVERN  325



>gb|EYU22954.1| hypothetical protein MIMGU_mgv1a0088041mg [Erythranthe guttata]
Length=362

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 141/197 (72%), Gaps = 6/197 (3%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERG-HIQSTTAATHQHPIKGAIMITAGCCF  815
            AK++GTL+TV GAM+MTL KGP + + W    G H ++ +AAT QH + G IM+   CC 
Sbjct  122  AKVIGTLITVTGAMLMTLYKGPVVDILWYSHGGSHHKAASAATDQHWVTGTIMLL--CCI  179

Query  814  --WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLA  641
              W+ FFILQ  TL  YPA LSLTSLIC+MG ++ G+  + +ER  +A W + +D +LLA
Sbjct  180  VGWSAFFILQNKTLEEYPAELSLTSLICIMGMVEGGIAAVIMERRKSA-WVIGFDSRLLA  238

Query  640  IVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGAC  461
              Y+GI+CSG+ YY+  V+ K +GP FV+AF+PLS++I A++G+ +L+EQ+ LGS++GA 
Sbjct  239  AAYSGIVCSGIAYYMQSVVNKSRGPVFVTAFSPLSMIITAVLGAIILSEQVHLGSLIGAA  298

Query  460  IIAVGLYLVIWSKSDNQ  410
            II VGLY V+W KS  +
Sbjct  299  IIVVGLYSVVWGKSKER  315



>gb|AAM65570.1| nodulin-like protein [Arabidopsis thaliana]
Length=377

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 142/201 (71%), Gaps = 8/201 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTLV +GGA++MTL KGP I LPW+     Q+ GH  S+    H + + G ++I 
Sbjct  130  KAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQQNGHTNSSQ--DHNNWVVGTLLIL  187

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL++LICL GA+Q   + L VER  +  WA+ WD +
Sbjct  188  LGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVGWDAR  246

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L A +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +++VA++ SF+L EQ+  G V+
Sbjct  247  LFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIHFGCVI  306

Query  469  GACIIAVGLYLVIWSKSDNQD  407
            G  +IA GLY+V+W K  + +
Sbjct  307  GGAVIAAGLYMVVWGKGKDYE  327



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 144/207 (70%), Gaps = 4/207 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-HPIKGAIMITAGCC  818
            QAKI GT +TVGGA++M L KGP +  PWT++  H  S + A +  H + G  MI   C 
Sbjct  136  QAKIAGTAITVGGALLMILFKGPIVNFPWTKDVSHAVSDSGAHNGGHWLMGTFMILLSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ+ TLRSYP+ LSLT+LIC +GA + G + L +ER +T  W++ +D++L   
Sbjct  196  CWSAFFILQSYTLRSYPSELSLTTLICALGATESGAVALVMER-DTKTWSIGFDMRLFTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
            +Y+GI+CSGV YY+ G+++KE+GP FV+AF+PL ++IV ++GS +L+E + LG ++GA +
Sbjct  255  IYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTLLGSIILSEVVTLGRLIGATV  314

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAEEG  377
            I  GLY +IW K  N+D    ++AE  
Sbjct  315  IVFGLYALIWGK--NKDHVNGNDAENN  339



>ref|XP_006289117.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
 gb|EOA22015.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
Length=388

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 142/201 (71%), Gaps = 8/201 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTL+ +GGA++MTL KGP I LPW+     Q+ GH  S+    H + + G ++I 
Sbjct  137  KAKIIGTLIGLGGALVMTLYKGPLIPLPWSNPSMNQQNGHTNSSQ--DHNNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL+SLICL GA+Q   + L VER  +  WA+ WD +
Sbjct  195  VGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGAVQSFGVALVVERHASG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L A +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +V+VA++ SF+L EQ+  G V+
Sbjct  254  LYAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQD  407
            G  +IA GLY+V+W K  + +
Sbjct  314  GGVVIAAGLYMVVWGKGKDYE  334



>gb|AES71306.2| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=291

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 141/202 (70%), Gaps = 9/202 (4%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIK-----GAIMITA  827
            AK++GT+VTV GAM+MTL KGP   +   +  G I    +AT   P +     G +M+ +
Sbjct  43   AKVIGTVVTVSGAMVMTLYKGPAYQI--IKGGGAINHHASATTDQPSEQNWLMGTVMLIS  100

Query  826  GCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKL  647
             CC WA FFILQ+ TL+ YPA LSLT+ ICLMG ++  + +L  ER + +VW + WD +L
Sbjct  101  SCCSWAGFFILQSFTLKKYPAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRL  159

Query  646  LAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLG  467
            LA VY+G+ICSG+ YY+ GV+ +E+GP FV++F+PL ++I A +GS +LAEQ+ LGS+ G
Sbjct  160  LACVYSGVICSGMAYYVQGVVTRERGPVFVTSFSPLCMIITAALGSLVLAEQVHLGSIFG  219

Query  466  ACIIAVGLYLVIWSKS-DNQDS  404
            A II +GLY V+W KS D ++S
Sbjct  220  AIIIVIGLYTVVWGKSKDRRES  241



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQE-RGHIQSTTAATHQHPIKGAIMITAGCC  818
            QAKILGTLVT+GGAMIMTL KGP + LPWT+    H+     A  Q PI+GA+MITAGC 
Sbjct  141  QAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTSAHVDLDGVA--QKPIEGALMITAGCF  198

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             WA F ILQAITL+SYPA L+LT+LIC+ G  Q  V   A+ERSN A W++ +D++LLA+
Sbjct  199  CWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERSNFAAWSIQFDVRLLAV  258

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQ  491
            VY+GIICSGVGYY+ GV+M+ KGP F++AFNPL +V   +  + L  E+
Sbjct  259  VYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMVSSQLPRNLLTFEE  307



>ref|XP_007223097.1| hypothetical protein PRUPE_ppa007061mg [Prunus persica]
 gb|EMJ24296.1| hypothetical protein PRUPE_ppa007061mg [Prunus persica]
Length=384

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVT  GA++MT+ KGP + L W+ +     STT ++ QH + G + I  GC  
Sbjct  139  QAKVIGTLVTFAGALLMTVYKGPVVDLLWSHKTSSHSSTTTSSDQHWVTGTLFILIGCVA  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CF++LQ+IT++ YPA +SL+ LICL+GALQ   + + VER  +A WA+ WD +LLA +
Sbjct  199  WSCFYVLQSITVKKYPANISLSCLICLVGALQGAAVAVTVERRASA-WAVGWDSRLLAPL  257

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GII SG+ YY+ G++MK +GP FV+AFNPL ++IV+I+GS +LAE+L LGS++G  II
Sbjct  258  YSGIIGSGITYYVQGLVMKTRGPVFVTAFNPLCMIIVSILGSIILAEKLHLGSIIGGVII  317

Query  454  AVGLYLVIWSKSDN  413
              GLY V+W KS +
Sbjct  318  VFGLYSVVWGKSKD  331



>ref|XP_008219762.1| PREDICTED: WAT1-related protein At4g08290 [Prunus mume]
Length=385

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQHPIKGAIMITAGCCF  815
            QAK++GTLVT  GA++MT+ KGP + L W+ +     STT ++ QH + G + I  GC  
Sbjct  139  QAKVIGTLVTFAGALLMTVYKGPVVGLLWSHKTSSHSSTTTSSDQHWVTGTLFILIGCVA  198

Query  814  WACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAIV  635
            W+CF++LQ+IT++ YPA +SL+ LICL+GALQ   + + VER  +A WA+ WD +LLA +
Sbjct  199  WSCFYVLQSITVKKYPANISLSCLICLVGALQGAAVAVTVERRASA-WAVGWDSRLLAPL  257

Query  634  YNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACII  455
            Y+GII SG+ YY+ G++MK +GP FV+AFNPL ++IV+I+GS +LAE+L LGS++G  II
Sbjct  258  YSGIIGSGITYYVQGLVMKTRGPVFVTAFNPLCMIIVSILGSIILAEKLHLGSIIGGVII  317

Query  454  AVGLYLVIWSKSDN  413
             +GLY V+W KS +
Sbjct  318  VLGLYSVVWGKSKD  331



>ref|XP_010916579.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=376

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 141/208 (68%), Gaps = 3/208 (1%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWTQERGHIQSTTAATHQ-HPIKGAIMITAGCC  818
            QAKI+G LVTV GA++M L KGP +   WT+ R H  +T  +    H + G  M+   C 
Sbjct  136  QAKIIGALVTVVGALLMILYKGPVVEFIWTKGRNHHNNTAGSQDDGHWLAGVFMLLLSCF  195

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FF+LQ+ TL+SYPA LSLT+ IC MGA+Q G + L +ERS    W + +D++ L  
Sbjct  196  CWSAFFVLQSHTLKSYPAELSLTTWICSMGAVQSGAVALVMERSAKP-WLIGFDMRFLTA  254

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI+CSG+ YY+  ++MKE+GP FV+AFNPL ++IVA++GS +L E++ +G V+GA I
Sbjct  255  AYSGIMCSGIAYYVQAIVMKERGPVFVTAFNPLCMIIVAVLGSIVLGEEITVGRVIGASI  314

Query  457  IAVGLYLVIWSKS-DNQDSPVLSNAEEG  377
            I +GLY +IW KS D+   P  +  +EG
Sbjct  315  IVIGLYSLIWGKSKDHLTQPSETGEKEG  342



>ref|NP_192569.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9SUF1.1|WTR31_ARATH RecName: Full=WAT1-related protein At4g08290 [Arabidopsis thaliana]
 emb|CAB45799.1| nodulin-like protein [Arabidopsis thaliana]
 emb|CAB77954.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE82622.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=384

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 142/201 (71%), Gaps = 8/201 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTLV +GGA++MTL KGP I LPW+     Q+ GH  +  +  H + + G ++I 
Sbjct  137  KAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQQNGH--TNNSQDHNNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL++LICL GA+Q   + L VER  +  WA+ WD +
Sbjct  195  LGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L A +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +++VA++ SF+L EQ+  G V+
Sbjct  254  LFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQD  407
            G  +IA GLY+V+W K  + +
Sbjct  314  GGAVIAAGLYMVVWGKGKDYE  334



>dbj|BAC43205.1| putative nodulin [Arabidopsis thaliana]
 gb|AAO63397.1| At4g08290 [Arabidopsis thaliana]
Length=384

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 142/201 (71%), Gaps = 8/201 (4%)
 Frame = -3

Query  994  QAKILGTLVTVGGAMIMTLVKGPKILLPWT-----QERGHIQSTTAATHQHPIKGAIMIT  830
            +AKI+GTLV +GGA++MTL KGP I LPW+     Q+ GH  +  +  H + + G ++I 
Sbjct  137  KAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQQNGH--TNNSQDHNNWVVGTLLIL  194

Query  829  AGCCFWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIK  650
             GC  W+ F++LQ+IT+++YPA LSL++LICL GA+Q   + L VER  +  WA+ WD +
Sbjct  195  LGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVGWDAR  253

Query  649  LLAIVYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVL  470
            L A +Y GI+ SG+ YY+ G++MK +GP FV+AFNPL +++VA++ SF+L EQ+  G V+
Sbjct  254  LFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQIHFGCVI  313

Query  469  GACIIAVGLYLVIWSKSDNQD  407
            G  +IA GLY+V+W K  + +
Sbjct  314  GGAVIAAGLYMVVWGKGKDYE  334



>ref|XP_011069552.1| PREDICTED: WAT1-related protein At1g21890-like [Sesamum indicum]
Length=384

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 143/205 (70%), Gaps = 3/205 (1%)
 Frame = -3

Query  991  AKILGTLVTVGGAMIMTLVKGPKILLPWTQERG--HIQSTTAATHQHPIKGAIMITAGCC  818
            AK++GTL+TV GAM+MTL KGP + + W    G  H  +  AAT QH + G IM+ +   
Sbjct  144  AKVVGTLITVTGAMLMTLYKGPVVNILWYSHAGSHHKAAAAAATDQHLVTGTIMLISCIV  203

Query  817  FWACFFILQAITLRSYPAGLSLTSLICLMGALQCGVLTLAVERSNTAVWALNWDIKLLAI  638
             W+ FFILQ  TL+ YPA LSLTSLICLMG ++ G++ + +ER  +A WA+ +D +LLA 
Sbjct  204  GWSAFFILQNKTLKEYPAELSLTSLICLMGFVEGGIVGVIMERRKSA-WAIGFDSRLLAA  262

Query  637  VYNGIICSGVGYYLSGVIMKEKGPFFVSAFNPLSLVIVAIMGSFLLAEQLLLGSVLGACI  458
             Y+GI+CSG+ YY+  ++ K +GP FV+AF+PLS++I A++G+ +LAEQ+ LGS++GA I
Sbjct  263  AYSGIVCSGIAYYMQSIVNKSRGPVFVTAFSPLSMIITAVLGAIVLAEQVHLGSLIGAVI  322

Query  457  IAVGLYLVIWSKSDNQDSPVLSNAE  383
            I  GLY V+W KS    S  L + E
Sbjct  323  IVSGLYSVVWGKSKESASNKLVDGE  347



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2217996789222