BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22095_g2_i2 len=690 path=[1:0-178 1454:179-227 227:228-324
1758:325-330 344:331-689]

Length=690
                                                                      Score     E

ref|XP_009783356.1|  PREDICTED: uncharacterized protein LOC104231966    129   5e-34   
ref|XP_006356630.1|  PREDICTED: uncharacterized protein LOC102586080    128   6e-34   
ref|XP_004245413.1|  PREDICTED: uncharacterized protein LOC101258579    128   8e-34   
ref|XP_009590703.1|  PREDICTED: uncharacterized protein LOC104087847    124   3e-32   
emb|CDP18438.1|  unnamed protein product                                118   9e-30   
ref|XP_011081846.1|  PREDICTED: uncharacterized protein LOC105164783    116   3e-29   
ref|XP_010254157.1|  PREDICTED: uncharacterized protein LOC104595231    112   8e-28   
ref|XP_006476166.1|  PREDICTED: uncharacterized protein LOC102622661    108   3e-26   
ref|XP_007012018.1|  Polyamine-modulated factor 1-binding protein 1     108   3e-26   
gb|KDP34235.1|  hypothetical protein JCGZ_07806                         106   1e-25   
ref|XP_007226944.1|  hypothetical protein PRUPE_ppa014696mg             106   2e-25   
gb|EYU39136.1|  hypothetical protein MIMGU_mgv1a017112mg                105   3e-25   
ref|XP_008219831.1|  PREDICTED: uncharacterized protein LOC103320006    105   5e-25   
ref|XP_010049064.1|  PREDICTED: uncharacterized protein LOC104437743    103   2e-24   
gb|EPS62876.1|  hypothetical protein M569_11913                         100   3e-23   
ref|XP_004307098.1|  PREDICTED: uncharacterized protein LOC101302...    100   3e-23   
ref|XP_010454899.1|  PREDICTED: uncharacterized protein LOC104736585  99.4    1e-22   
ref|XP_008378280.1|  PREDICTED: uncharacterized protein LOC103441383  99.0    1e-22   
ref|XP_004307097.1|  PREDICTED: uncharacterized protein LOC101302...  99.4    2e-22   
ref|XP_004501263.1|  PREDICTED: uncharacterized protein LOC101503210  98.2    2e-22   
ref|XP_009377369.1|  PREDICTED: uncharacterized protein LOC103965983  98.2    2e-22   
ref|XP_010421417.1|  PREDICTED: uncharacterized protein LOC104706881  98.2    2e-22   
ref|XP_004136463.1|  PREDICTED: uncharacterized protein LOC101215419  97.8    3e-22   
ref|XP_006288960.1|  hypothetical protein CARUB_v10002328mg           97.8    3e-22   
ref|XP_008466349.1|  PREDICTED: uncharacterized protein LOC103503784  97.8    4e-22   
ref|NP_568475.1|  uncharacterized protein                             97.4    4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KGN60141.1|  hypothetical protein Csa_3G881050                     97.8    5e-22   
ref|XP_006578183.1|  PREDICTED: uncharacterized protein LOC102665...  95.9    2e-21   
gb|KCW81517.1|  hypothetical protein EUGRSUZ_C02878                   95.9    2e-21   
ref|XP_006394811.1|  hypothetical protein EUTSA_v10005188mg           95.5    3e-21   
emb|CDX80526.1|  BnaC07g29180D                                        95.1    3e-21   
ref|XP_009348439.1|  PREDICTED: uncharacterized protein LOC103940086  94.4    6e-21   
ref|XP_002309578.1|  hypothetical protein POPTR_0006s26150g           94.4    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003603499.1|  hypothetical protein MTR_3g108310                94.4    9e-21   
ref|XP_009151091.1|  PREDICTED: uncharacterized protein LOC103874417  93.6    1e-20   
ref|XP_010670780.1|  PREDICTED: uncharacterized protein LOC104887751  94.0    1e-20   
gb|AEV42262.1|  hypothetical protein                                  93.2    2e-20   
ref|XP_002872174.1|  hypothetical protein ARALYDRAFT_489417           92.8    2e-20   
ref|XP_002282007.1|  PREDICTED: uncharacterized protein LOC100268084  92.8    2e-20   Vitis vinifera
ref|XP_006450591.1|  hypothetical protein CICLE_v10010030mg           92.0    4e-20   
ref|XP_002318293.1|  hypothetical protein POPTR_0012s14810g           90.5    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010519920.1|  PREDICTED: uncharacterized protein LOC104799213  89.4    5e-19   
ref|XP_003527805.1|  PREDICTED: uncharacterized protein LOC100798...  89.0    5e-19   
ref|XP_002516597.1|  conserved hypothetical protein                   88.6    8e-19   Ricinus communis
ref|XP_008793456.1|  PREDICTED: uncharacterized protein LOC103709741  88.2    1e-18   
emb|CDY54899.1|  BnaC02g48580D                                        87.0    3e-18   
ref|XP_007137096.1|  hypothetical protein PHAVU_009G099200g           86.7    4e-18   
ref|NP_001190398.1|  uncharacterized protein                          87.4    4e-18   
ref|XP_010915051.1|  PREDICTED: uncharacterized protein LOC105040285  84.7    2e-17   
ref|XP_008393997.1|  PREDICTED: uncharacterized protein LOC103456...  84.7    4e-17   
ref|XP_008393998.1|  PREDICTED: uncharacterized protein LOC103456...  84.0    4e-17   
ref|XP_009388668.1|  PREDICTED: uncharacterized protein LOC103975428  76.6    2e-14   
ref|XP_006844361.1|  hypothetical protein AMTR_s00142p00047070        75.9    3e-14   
ref|XP_003568805.1|  PREDICTED: uncharacterized protein LOC100839090  66.6    8e-11   
gb|EMS58168.1|  hypothetical protein TRIUR3_29520                     64.3    5e-10   
ref|XP_007220023.1|  hypothetical protein PRUPE_ppb025125mg           61.6    3e-09   
ref|XP_002439384.1|  hypothetical protein SORBIDRAFT_09g005560        61.6    5e-09   Sorghum bicolor [broomcorn]
ref|XP_002454073.1|  hypothetical protein SORBIDRAFT_04g024200        59.3    3e-08   Sorghum bicolor [broomcorn]
gb|AFW77404.1|  hypothetical protein ZEAMMB73_660545                  54.7    1e-06   
ref|NP_001145017.1|  uncharacterized protein LOC100278188             53.9    3e-06   Zea mays [maize]
ref|NP_001159064.1|  uncharacterized protein LOC100304105             49.7    1e-04   Zea mays [maize]



>ref|XP_009783356.1| PREDICTED: uncharacterized protein LOC104231966 [Nicotiana sylvestris]
Length=98

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -3

Query  637  MEASKVLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVE  458
            ME S+    +  D Q+A T +I+SQL+S+V DLSQ VQ  MENM+KMI EIDQ+ST++ E
Sbjct  1    MEPSR--DAAAGDDQLARTCEIESQLSSVVYDLSQQVQAAMENMLKMISEIDQSSTEVTE  58

Query  457  DIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNNEE  344
            D+EKCKD+ALER+++LEEQ++HFQ+AAYA+LNMLNN+E
Sbjct  59   DMEKCKDSALERRKTLEEQKDHFQRAAYAILNMLNNQE  96



>ref|XP_006356630.1| PREDICTED: uncharacterized protein LOC102586080 [Solanum tuberosum]
Length=98

 Score =   128 bits (322),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -3

Query  637  MEASKVLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVE  458
            ME S+  T    D Q+A TS+I+SQL+S+V +LSQ VQ  MENM+KMI EIDQ+ST++ E
Sbjct  1    MELSR--TACAADDQLARTSEIESQLSSVVYELSQQVQGAMENMLKMINEIDQSSTEVTE  58

Query  457  DIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNNEE  344
            D+EKCK++ALER ++LEEQ+EHFQ+AAYA+L+MLNN+E
Sbjct  59   DMEKCKESALERSKTLEEQKEHFQRAAYAILDMLNNQE  96



>ref|XP_004245413.1| PREDICTED: uncharacterized protein LOC101258579 [Solanum lycopersicum]
Length=97

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -3

Query  616  TVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKD  437
            T    D Q+A TS+I+SQL+++V +LSQ VQ  MENM+KMI E+DQ+ST++ ED+EKCK+
Sbjct  6    TAGAADDQLARTSEIESQLSTVVYELSQQVQGAMENMLKMINEVDQSSTEVTEDMEKCKE  65

Query  436  TALERKRSLEEQREHFQKAAYAVLNMLNN  350
            +ALER ++LEEQ+EHFQ+AAYA+LNMLNN
Sbjct  66   SALERSKTLEEQKEHFQRAAYAILNMLNN  94



>ref|XP_009590703.1| PREDICTED: uncharacterized protein LOC104087847 [Nicotiana tomentosiformis]
Length=98

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  595  QMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKR  416
            Q+A TS+I+SQL+S++ DLSQ VQV ME+M+KMI EIDQ+ST++ ED+EKCKD+ALER++
Sbjct  13   QLARTSEIESQLSSVLYDLSQQVQVAMEHMLKMINEIDQSSTEVTEDMEKCKDSALERRK  72

Query  415  SLEEQREHFQKAAYAVLNMLNNEE  344
            +LEEQ+++FQ+AAYA+LNMLNN+E
Sbjct  73   TLEEQKDNFQRAAYAILNMLNNQE  96



>emb|CDP18438.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   118 bits (295),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -3

Query  610  SPPDVQMA-PTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDT  434
            SP + ++A P SD++SQL+S++ DLS  VQ  ME+M+KMI EIDQNS+D+++DI+ CKD 
Sbjct  12   SPANAELALPRSDVESQLSSLLYDLSHRVQAAMEHMLKMINEIDQNSSDVMDDIKNCKDF  71

Query  433  ALERKRSLEEQREHFQKAAYAVLNMLNNEEIS  338
            AL+RKR+L+E++EH+QKAAY V++MLNN+ IS
Sbjct  72   ALDRKRTLDEEKEHYQKAAYTVISMLNNQVIS  103



>ref|XP_011081846.1| PREDICTED: uncharacterized protein LOC105164783 [Sesamum indicum]
 ref|XP_011081847.1| PREDICTED: uncharacterized protein LOC105164783 [Sesamum indicum]
 ref|XP_011081848.1| PREDICTED: uncharacterized protein LOC105164783 [Sesamum indicum]
 ref|XP_011081849.1| PREDICTED: uncharacterized protein LOC105164783 [Sesamum indicum]
Length=96

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -3

Query  619  LTVSPPDVQ--MAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            +T SPP     + P S I+SQL+S+V DLSQ+VQV M+NM+KMI EIDQNS  I+E+IEK
Sbjct  1    MTSSPPPTGGDLGPPSSIESQLSSLVYDLSQNVQVAMDNMLKMISEIDQNSAGIMEEIEK  60

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLNNEEIS  338
             KD+ L+RK +LEE+++HFQKAA+AVL+ML+  +IS
Sbjct  61   SKDSVLKRKINLEEEKDHFQKAAFAVLDMLDGRDIS  96



>ref|XP_010254157.1| PREDICTED: uncharacterized protein LOC104595231 [Nelumbo nucifera]
Length=103

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = -3

Query  637  MEASKVL--TVSPPDVQMA-PTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTD  467
            ME SK L  TVSPP   +A P  + + QL++++ D+SQ VQ  M NM+KMI EIDQNS  
Sbjct  1    MEPSKSLAITVSPPSESLALPPPESEFQLSNLIYDVSQQVQEAMSNMLKMINEIDQNSAG  60

Query  466  IVEDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNNEEIS  338
            IVE+IEKCK++A E+K+ L+E++EHFQ+AAY VL+MLNN ++S
Sbjct  61   IVEEIEKCKESANEKKKLLDEEKEHFQRAAYTVLDMLNNRDVS  103



>ref|XP_006476166.1| PREDICTED: uncharacterized protein LOC102622661 [Citrus sinensis]
 ref|XP_006476167.1| PREDICTED: uncharacterized protein LOC102622958 [Citrus sinensis]
 gb|KDO79679.1| hypothetical protein CISIN_1g034379mg [Citrus sinensis]
 gb|KDO79680.1| hypothetical protein CISIN_1g034379mg [Citrus sinensis]
Length=96

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 73/84 (87%), Gaps = 3/84 (4%)
 Frame = -3

Query  601  DVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALER  422
            DVQ   +S+++SQL+S+V D+SQ V +VM+NM+KMI EIDQNS+ I+E++EKCK+ A ER
Sbjct  14   DVQ---SSEVESQLSSLVYDMSQQVHMVMQNMLKMIAEIDQNSSGIMEEVEKCKNLAFER  70

Query  421  KRSLEEQREHFQKAAYAVLNMLNN  350
            K+SLEE++E FQKAA+AVL+MLN+
Sbjct  71   KKSLEEEKERFQKAAFAVLDMLND  94



>ref|XP_007012018.1| Polyamine-modulated factor 1-binding protein 1 [Theobroma cacao]
 gb|EOY29637.1| Polyamine-modulated factor 1-binding protein 1 [Theobroma cacao]
Length=88

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  580  SDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQ  401
            ++ +SQL+S+V ++SQHVQ  MENM+KMI EIDQNS+ + E+IEKCKD+ALERK+ LEE+
Sbjct  10   AEAESQLSSLVYEMSQHVQTAMENMLKMISEIDQNSSGVREEIEKCKDSALERKKGLEEE  69

Query  400  REHFQKAAYAVLNMLNN  350
            +E  QKAAY +L+ML+N
Sbjct  70   KERLQKAAYTILDMLSN  86



>gb|KDP34235.1| hypothetical protein JCGZ_07806 [Jatropha curcas]
Length=96

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = -3

Query  604  PDVQ-MAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTAL  428
            PD Q +A + +++SQL+S++ D+SQ VQ  M NM+KMI EIDQNS  I+E+IEKCK++ L
Sbjct  9    PDAQAIASSPEVESQLSSLLYDMSQQVQTTMGNMLKMIVEIDQNSAGIMEEIEKCKESTL  68

Query  427  ERKRSLEEQREHFQKAAYAVLNMLNN  350
            ERK+ LEE++E FQKAA+  L+MLNN
Sbjct  69   ERKKVLEEEKERFQKAAFTALDMLNN  94



>ref|XP_007226944.1| hypothetical protein PRUPE_ppa014696mg [Prunus persica]
 gb|EMJ28143.1| hypothetical protein PRUPE_ppa014696mg [Prunus persica]
Length=95

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  610  SPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTA  431
            S PD+Q+    + +SQ++SIV ++SQ VQ  MENM+KM+ EID+NS  I E+IEKCK+ +
Sbjct  7    SQPDLQLQLQPETESQMSSIVYEISQEVQGAMENMLKMMSEIDENSAGITEEIEKCKEQS  66

Query  430  LERKRSLEEQREHFQKAAYAVLNMLNN  350
            LE+KR LEE +E  +KAAYAVL MLNN
Sbjct  67   LEKKRGLEEAKEQVEKAAYAVLEMLNN  93



>gb|EYU39136.1| hypothetical protein MIMGU_mgv1a017112mg [Erythranthe guttata]
Length=93

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 74/92 (80%), Gaps = 3/92 (3%)
 Frame = -3

Query  619  LTVSPP--DVQMAPT-SDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIE  449
            +T SPP    ++AP  S ++SQL+S++ DL+Q+VQV M+NM+KMI EID NS  I+E+I+
Sbjct  1    MTSSPPLTGAELAPPPSAVESQLSSLIYDLTQNVQVAMDNMLKMINEIDHNSAGIMEEIQ  60

Query  448  KCKDTALERKRSLEEQREHFQKAAYAVLNMLN  353
            K KD ALERK  LE++++HFQKAA+++L+MLN
Sbjct  61   KSKDFALERKNHLEQEKDHFQKAAFSILDMLN  92



>ref|XP_008219831.1| PREDICTED: uncharacterized protein LOC103320006 [Prunus mume]
 ref|XP_008219832.1| PREDICTED: uncharacterized protein LOC103320006 [Prunus mume]
Length=95

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -3

Query  610  SPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTA  431
            S PD+Q+    + +SQ++SIV ++SQ VQ  MENM+KM+ EID NS  I E+IEKCK+ +
Sbjct  7    SQPDLQLQLQPETESQMSSIVYEISQQVQGAMENMLKMMSEIDDNSAGITEEIEKCKEQS  66

Query  430  LERKRSLEEQREHFQKAAYAVLNMLNN  350
            LE+KR LEE +E  +KAAYAVL MLNN
Sbjct  67   LEKKRGLEEAKEQVEKAAYAVLEMLNN  93



>ref|XP_010049064.1| PREDICTED: uncharacterized protein LOC104437743 [Eucalyptus grandis]
 ref|XP_010049065.1| PREDICTED: uncharacterized protein LOC104437743 [Eucalyptus grandis]
 ref|XP_010049066.1| PREDICTED: uncharacterized protein LOC104437743 [Eucalyptus grandis]
Length=103

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +SQL S+V D+SQ VQ  MENM+KMI E DQ+S  I+EDIEKC+++ALERK+ LEE+++ 
Sbjct  28   ESQLASLVYDMSQQVQAAMENMLKMINEADQSSAGIIEDIEKCRNSALERKKGLEEEKKQ  87

Query  391  FQKAAYAVLNMLN  353
            FQ+AAYAV++MLN
Sbjct  88   FQRAAYAVIDMLN  100



>gb|EPS62876.1| hypothetical protein M569_11913, partial [Genlisea aurea]
Length=91

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = -3

Query  619  LTVSPPDV--QMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            +  SPP    ++ P+S ++SQL+ +V D+SQ+VQ+ M+NM+KMI EIDQNS+ I E++E+
Sbjct  1    MEASPPSTGGELVPSSAVESQLSGLVYDMSQNVQIAMDNMLKMIIEIDQNSSRITEEMER  60

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLN  353
             KD+ L+RK +L+E++++FQKAA+AVL++LN
Sbjct  61   SKDSILQRKINLQEEKKNFQKAAFAVLDLLN  91



>ref|XP_004307098.1| PREDICTED: uncharacterized protein LOC101302979 isoform 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307099.1| PREDICTED: uncharacterized protein LOC101302979 isoform 3 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307100.1| PREDICTED: uncharacterized protein LOC101302979 isoform 4 [Fragaria 
vesca subsp. vesca]
Length=98

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -3

Query  592  MAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRS  413
            +AP  + +SQ++S++ ++SQ VQ  ME+M+K I+EID+NS  I E+I+KCK++ALE+KR 
Sbjct  15   LAPPPESESQISSLLYEISQQVQAEMEDMLKSIREIDENSGQITEEIDKCKESALEKKRG  74

Query  412  LEEQREHFQKAAYAVLNMLNN  350
            LEE +E  +KAAYAVL MLNN
Sbjct  75   LEESKEQVEKAAYAVLQMLNN  95



>ref|XP_010454899.1| PREDICTED: uncharacterized protein LOC104736585 [Camelina sativa]
 ref|XP_010454900.1| PREDICTED: uncharacterized protein LOC104736585 [Camelina sativa]
 ref|XP_010454901.1| PREDICTED: uncharacterized protein LOC104736585 [Camelina sativa]
Length=100

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            +P    +S L S+V D+SQ VQ+ MENM+KM+ EIDQNS  I E+IEK KD A+E+KR L
Sbjct  17   SPGHQAESDLTSLVFDMSQQVQMAMENMLKMVNEIDQNSVGIKEEIEKSKDFAMEKKRIL  76

Query  409  EEQREHFQKAAYAVLNMLNN  350
            EE++E FQKAAY +L+ML+N
Sbjct  77   EEEKEQFQKAAYTILDMLSN  96



>ref|XP_008378280.1| PREDICTED: uncharacterized protein LOC103441383 [Malus domestica]
 ref|XP_008378281.1| PREDICTED: uncharacterized protein LOC103441383 [Malus domestica]
Length=94

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = -3

Query  619  LTVSPP--DVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            +  SP   D+Q+   S+ +S ++SIV  +SQ VQ  MENM KM+ E D+NS  I E+IEK
Sbjct  1    MAASPSQSDLQLQLQSESESPMSSIVYVISQQVQGAMENMFKMMSETDENSAGISEEIEK  60

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLNN  350
            CK++ALE+K+ LEE RE  +KAAYAVL MLNN
Sbjct  61   CKESALEKKKGLEEAREQVEKAAYAVLEMLNN  92



>ref|XP_004307097.1| PREDICTED: uncharacterized protein LOC101302979 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=123

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -3

Query  592  MAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRS  413
            +AP  + +SQ++S++ ++SQ VQ  ME+M+K I+EID+NS  I E+I+KCK++ALE+KR 
Sbjct  40   LAPPPESESQISSLLYEISQQVQAEMEDMLKSIREIDENSGQITEEIDKCKESALEKKRG  99

Query  412  LEEQREHFQKAAYAVLNMLNN  350
            LEE +E  +KAAYAVL MLNN
Sbjct  100  LEESKEQVEKAAYAVLQMLNN  120



>ref|XP_004501263.1| PREDICTED: uncharacterized protein LOC101503210 [Cicer arietinum]
Length=88

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  589  APT-SDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRS  413
            AP  ++ ++ L+S++ D+S   Q +MENM+KMI EI+QNS  I E+IEKCK +A+ERK +
Sbjct  7    APAEAETENHLSSLIYDISNEAQAIMENMLKMIAEINQNSAVIEEEIEKCKGSAIERKTA  66

Query  412  LEEQREHFQKAAYAVLNMLN  353
            L+E+R+HFQKAAYAVL+MLN
Sbjct  67   LDEERDHFQKAAYAVLDMLN  86



>ref|XP_009377369.1| PREDICTED: uncharacterized protein LOC103965983 [Pyrus x bretschneideri]
 ref|XP_009377370.1| PREDICTED: uncharacterized protein LOC103965983 [Pyrus x bretschneideri]
Length=93

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -3

Query  610  SPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTA  431
            S  D+Q+   S+ +S ++SIV  +SQ VQ  ME+M KM+ EID+NS  I E+IEKCK++A
Sbjct  5    SQSDLQLQLQSESESPMSSIVYVISQQVQGAMEDMFKMMSEIDENSAGISEEIEKCKESA  64

Query  430  LERKRSLEEQREHFQKAAYAVLNMLNN  350
            LE+K+ LEE RE  +KAAYAVL MLNN
Sbjct  65   LEKKKGLEEAREQVEKAAYAVLEMLNN  91



>ref|XP_010421417.1| PREDICTED: uncharacterized protein LOC104706881 [Camelina sativa]
 ref|XP_010421418.1| PREDICTED: uncharacterized protein LOC104706881 [Camelina sativa]
 ref|XP_010493818.1| PREDICTED: uncharacterized protein LOC104771042 [Camelina sativa]
 ref|XP_010493819.1| PREDICTED: uncharacterized protein LOC104771042 [Camelina sativa]
Length=100

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            +P    +S L S+V D+SQ VQ+ MENM+KM+ EIDQNS  I E+IEK KD A+E+KR L
Sbjct  17   SPGHQAESDLTSLVFDMSQQVQMGMENMLKMVNEIDQNSVGIKEEIEKSKDFAMEKKRIL  76

Query  409  EEQREHFQKAAYAVLNMLNN  350
            EE++E FQKAAY +L+ML+N
Sbjct  77   EEEKEQFQKAAYTILDMLSN  96



>ref|XP_004136463.1| PREDICTED: uncharacterized protein LOC101215419 [Cucumis sativus]
 ref|XP_004162066.1| PREDICTED: uncharacterized protein LOC101229077 [Cucumis sativus]
Length=104

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  565  QLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQ  386
            QL++++ D+SQ  Q  MENM++MI EIDQN+  IVEDIEKC+ +AL+RK  LEE+++ FQ
Sbjct  27   QLSALIFDISQQAQGAMENMLRMISEIDQNAVGIVEDIEKCRGSALDRKGVLEEEKQQFQ  86

Query  385  KAAYAVLNMLNN  350
            +AAY VL+MLNN
Sbjct  87   QAAYTVLDMLNN  98



>ref|XP_006288960.1| hypothetical protein CARUB_v10002328mg [Capsella rubella]
 ref|XP_006288961.1| hypothetical protein CARUB_v10002328mg [Capsella rubella]
 gb|EOA21858.1| hypothetical protein CARUB_v10002328mg [Capsella rubella]
 gb|EOA21859.1| hypothetical protein CARUB_v10002328mg [Capsella rubella]
Length=99

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            AP    +S L S+V +LSQ VQ+ ME+M+KM+ EIDQNS  I E+IEK KD A+ERKR L
Sbjct  17   APAQQAESDLTSLVFELSQQVQMGMESMLKMVNEIDQNSVGIKEEIEKSKDFAMERKRVL  76

Query  409  EEQREHFQKAAYAVLNMLNN  350
            EE++E FQKAAY +L+ML++
Sbjct  77   EEEKEQFQKAAYTILDMLSH  96



>ref|XP_008466349.1| PREDICTED: uncharacterized protein LOC103503784 [Cucumis melo]
Length=107

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  565  QLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQ  386
            QL++++ D+SQ  Q  MENM++MI EIDQN+  IVEDIEKC+ +AL+RK  LEE+++ FQ
Sbjct  27   QLSALIFDISQQAQGAMENMLRMISEIDQNAVGIVEDIEKCRGSALDRKGVLEEEKQQFQ  86

Query  385  KAAYAVLNMLNN  350
            +AAY VL+MLNN
Sbjct  87   QAAYTVLDMLNN  98



>ref|NP_568475.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974834.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM64259.1| unknown [Arabidopsis thaliana]
 gb|ABF47125.1| At5g25570 [Arabidopsis thaliana]
 gb|AED93466.1| uncharacterized protein AT5G25570 [Arabidopsis thaliana]
 gb|AED93467.1| uncharacterized protein AT5G25570 [Arabidopsis thaliana]
Length=99

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            +P    DS L S+V ++SQ VQ+ MENM+KM+ EIDQNS  I E+IEK KD A+E+KR L
Sbjct  17   SPGQQADSDLTSLVFEMSQQVQMGMENMLKMVYEIDQNSVGIKEEIEKSKDFAMEKKRIL  76

Query  409  EEQREHFQKAAYAVLNMLNN  350
            EE+++ FQKAAY +L+ML+N
Sbjct  77   EEEKDQFQKAAYTILDMLSN  96



>gb|KGN60141.1| hypothetical protein Csa_3G881050 [Cucumis sativus]
Length=110

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  565  QLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQ  386
            QL++++ D+SQ  Q  MENM++MI EIDQN+  IVEDIEKC+ +AL+RK  LEE+++ FQ
Sbjct  27   QLSALIFDISQQAQGAMENMLRMISEIDQNAVGIVEDIEKCRGSALDRKGVLEEEKQQFQ  86

Query  385  KAAYAVLNMLNNEEIS*CH  329
            +AAY VL+MLNN      H
Sbjct  87   QAAYTVLDMLNNGGGGMLH  105



>ref|XP_006578183.1| PREDICTED: uncharacterized protein LOC102665109 isoform X1 [Glycine 
max]
 ref|XP_006578184.1| PREDICTED: uncharacterized protein LOC102665109 isoform X2 [Glycine 
max]
 gb|KHN10287.1| hypothetical protein glysoja_017891 [Glycine soja]
Length=88

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -3

Query  592  MAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRS  413
            +AP ++ +S+L+S++ + S  VQ  MENM + I EI+QNS  + E+IEKCK + LERKR+
Sbjct  7    IAPEAEPESRLSSLIYEKSNEVQGFMENMFRTITEINQNSAVVEEEIEKCKGSGLERKRA  66

Query  412  LEEQREHFQKAAYAVLNMLNNE  347
            L+E++++FQKAAYAVL+MLN E
Sbjct  67   LDEEKDNFQKAAYAVLDMLNRE  88



>gb|KCW81517.1| hypothetical protein EUGRSUZ_C02878 [Eucalyptus grandis]
Length=100

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = -3

Query  643  CSMEASKVLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDI  464
            C + AS VL    P        D D     + +D+SQ VQ  MENM+KMI E DQ+S  I
Sbjct  6    CIVTASGVLWFCRP----VNVIDFDD-CCIMAADMSQQVQAAMENMLKMINEADQSSAGI  60

Query  463  VEDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLN  353
            +EDIEKC+++ALERK+ LEE+++ FQ+AAYAV++MLN
Sbjct  61   IEDIEKCRNSALERKKGLEEEKKQFQRAAYAVIDMLN  97



>ref|XP_006394811.1| hypothetical protein EUTSA_v10005188mg [Eutrema salsugineum]
 gb|ESQ32097.1| hypothetical protein EUTSA_v10005188mg [Eutrema salsugineum]
Length=98

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -3

Query  586  PTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLE  407
            P    +S L S++ ++SQ VQ+ MENM+K++ EIDQNS  I E+IEK KD A+E+KR LE
Sbjct  18   PGQQAESDLASLIFEMSQQVQMGMENMLKLVNEIDQNSVGIKEEIEKSKDFAMEKKRVLE  77

Query  406  EQREHFQKAAYAVLNMLNN  350
            E++E FQKAAY +L+ML+N
Sbjct  78   EEKEQFQKAAYTILDMLSN  96



>emb|CDX80526.1| BnaC07g29180D [Brassica napus]
Length=93

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S L S+V ++SQ VQV MENM+K++ EIDQNS  I E+IEK KD A+E+KR LEE++E 
Sbjct  18   ESDLASLVFEMSQQVQVGMENMLKLVNEIDQNSVGIKEEIEKSKDYAMEKKRVLEEEKEQ  77

Query  391  FQKAAYAVLNMLNN  350
            FQKAAY +L+ML+N
Sbjct  78   FQKAAYTILDMLSN  91



>ref|XP_009348439.1| PREDICTED: uncharacterized protein LOC103940086 [Pyrus x bretschneideri]
Length=94

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = -3

Query  619  LTVSPP--DVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            +  SP   D+Q+   S+ +S ++SIV  +SQ VQ  MENM +M+ EID+NS  I E+IEK
Sbjct  1    MAASPSQSDLQLQFQSETESPMSSIVYVISQQVQGEMENMFEMMSEIDENSAGISEEIEK  60

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLNN  350
            CK++A E+K+ LEE RE  +KAAYAVL +LNN
Sbjct  61   CKESATEKKKGLEEVREQVEKAAYAVLELLNN  92



>ref|XP_002309578.1| hypothetical protein POPTR_0006s26150g [Populus trichocarpa]
 ref|XP_011019693.1| PREDICTED: uncharacterized protein LOC105122335 [Populus euphratica]
 gb|EEE93101.1| hypothetical protein POPTR_0006s26150g [Populus trichocarpa]
Length=99

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  550  VSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQKAAYA  371
            V D SQ  Q+ M NM+KMI EIDQ +  I+E+I KCKDTA ERK+ LEE++E FQKAAYA
Sbjct  32   VYDTSQQFQMAMGNMLKMITEIDQTTGGIMEEIGKCKDTAFERKKDLEEEKERFQKAAYA  91

Query  370  VLNMLNN  350
            VL MLN+
Sbjct  92   VLGMLND  98



>ref|XP_003603499.1| hypothetical protein MTR_3g108310 [Medicago truncatula]
 gb|AES73750.1| hypothetical protein MTR_3g108310 [Medicago truncatula]
Length=109

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  580  SDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQ  401
            ++ ++QL S++ ++S   Q +MENM+KMI EI+QNS  I E+IEKCK +A+ERK +L+E+
Sbjct  32   AETENQLTSLIYEMSNEAQSIMENMLKMIAEINQNSAVIEEEIEKCKGSAMERKTALDEE  91

Query  400  REHFQKAAYAVLNMLN  353
            +EH QKAAYAVL+MLN
Sbjct  92   KEHCQKAAYAVLDMLN  107



>ref|XP_009151091.1| PREDICTED: uncharacterized protein LOC103874417 [Brassica rapa]
 emb|CDX88191.1| BnaA06g27820D [Brassica napus]
Length=93

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S L S+V ++SQ VQ+ MENM+K++ EIDQNS  I E+IEK KD A+E+KR LEE++E 
Sbjct  18   ESDLASLVFEMSQQVQMGMENMLKLVNEIDQNSVGIKEEIEKSKDYAMEKKRVLEEEKEQ  77

Query  391  FQKAAYAVLNMLNN  350
            FQKAAY +L+ML+N
Sbjct  78   FQKAAYTILDMLSN  91



>ref|XP_010670780.1| PREDICTED: uncharacterized protein LOC104887751 [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = -3

Query  625  KVLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            + +  S P ++    S +DS  +S++ DLSQ VQ  ME+M+KMI EID  S ++ E++E+
Sbjct  6    QAIVASSPQME---QSIVDSHFSSVLYDLSQQVQGAMEDMLKMISEIDVQSAEVTEEMER  62

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLN  353
            CK+ ALER++++EE++E FQKAAYAVL++LN
Sbjct  63   CKEYALERRKAIEEEKECFQKAAYAVLDVLN  93



>gb|AEV42262.1| hypothetical protein [Beta vulgaris]
Length=102

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = -3

Query  625  KVLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEK  446
            + +  S P ++    S +DS  +S++ DLSQ VQ  ME+M+KMI EID  S ++ E++E+
Sbjct  6    QAIVASSPQME---QSIVDSHFSSVLYDLSQQVQGAMEDMLKMINEIDVQSAEVTEEMER  62

Query  445  CKDTALERKRSLEEQREHFQKAAYAVLNMLN  353
            CK+ ALER++++EE++E FQKAAYAVL++LN
Sbjct  63   CKEYALERRKAIEEEKECFQKAAYAVLDVLN  93



>ref|XP_002872174.1| hypothetical protein ARALYDRAFT_489417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48433.1| hypothetical protein ARALYDRAFT_489417 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIK-EIDQNSTDIVEDIEKCKDTALERKRS  413
            +P    +S L S+V ++SQ VQ+ MENM+KM+K EIDQNS  I E+IEK KD A+E+KR 
Sbjct  17   SPGQQAESDLASLVFEMSQQVQMGMENMLKMVKYEIDQNSVGIKEEIEKSKDFAMEKKRI  76

Query  412  LEEQREHFQKAAYAVLNMLNN  350
            LEE+++ FQKAAY +L+ML+N
Sbjct  77   LEEEKDQFQKAAYTILDMLSN  97



>ref|XP_002282007.1| PREDICTED: uncharacterized protein LOC100268084 [Vitis vinifera]
 emb|CBI20952.3| unnamed protein product [Vitis vinifera]
Length=105

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 5/101 (5%)
 Frame = -3

Query  637  MEASKVLTV--SPPDV---QMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNS  473
            MEASK  T   SP       + P  ++DSQL+S++  LSQ VQ  MENM+KMI E+DQNS
Sbjct  1    MEASKSTTAATSPSSTDLQLLLPPPELDSQLSSLIYGLSQQVQAAMENMLKMINEVDQNS  60

Query  472  TDIVEDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNN  350
             +++E+IEKCKD+ALE+K+ LEE++EHF+KAAY VL+MLNN
Sbjct  61   AEVMEEIEKCKDSALEKKKLLEEEKEHFEKAAYTVLDMLNN  101



>ref|XP_006450591.1| hypothetical protein CICLE_v10010030mg [Citrus clementina]
 ref|XP_006450592.1| hypothetical protein CICLE_v10010030mg [Citrus clementina]
 gb|ESR63831.1| hypothetical protein CICLE_v10010030mg [Citrus clementina]
 gb|ESR63832.1| hypothetical protein CICLE_v10010030mg [Citrus clementina]
Length=94

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = -3

Query  601  DVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALER  422
            DVQ   +S+++SQL+S+V D+SQ V +VM+NM+KMI EIDQNS+ I+E++EKCK+ A ER
Sbjct  14   DVQ---SSEVESQLSSLVYDMSQQVHMVMQNMLKMIAEIDQNSSGIMEEVEKCKNLAFER  70

Query  421  KRSLEEQREHFQKAAYAVLNMLNN  350
            K+SLEE+++  Q  A+AVL+MLN+
Sbjct  71   KKSLEEEKD--QIDAFAVLDMLND  92



>ref|XP_002318293.1| hypothetical protein POPTR_0012s14810g [Populus trichocarpa]
 gb|EEE96513.1| hypothetical protein POPTR_0012s14810g [Populus trichocarpa]
Length=99

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -3

Query  550  VSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQKAAYA  371
            V D SQ  Q+ M NM+KMI EIDQ +  I+E+I K KDTA ERK+ LEE++E FQKAAYA
Sbjct  32   VYDTSQQFQMAMGNMLKMITEIDQTTGGIMEEIGKYKDTAFERKKDLEEEKERFQKAAYA  91

Query  370  VLNMLNN  350
            VL MLN+
Sbjct  92   VLGMLND  98



>ref|XP_010519920.1| PREDICTED: uncharacterized protein LOC104799213 [Tarenaya hassleriana]
Length=98

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S L+S+V ++SQ VQ+ MENM+KM+ EIDQNS  I E+IEK K+ A+E+KR LE+++E 
Sbjct  23   ESDLSSLVYEMSQQVQMAMENMLKMVNEIDQNSIGIKEEIEKSKEYAVEKKRVLEDEKEQ  82

Query  391  FQKAAYAVLNMLNN  350
            FQKAAY +L+ML++
Sbjct  83   FQKAAYTILDMLSS  96



>ref|XP_003527805.1| PREDICTED: uncharacterized protein LOC100798551 isoform X1 [Glycine 
max]
 ref|XP_006581392.1| PREDICTED: uncharacterized protein LOC100798551 isoform X2 [Glycine 
max]
 ref|XP_006581393.1| PREDICTED: uncharacterized protein LOC100798551 isoform X3 [Glycine 
max]
 ref|XP_006581394.1| PREDICTED: uncharacterized protein LOC100798551 isoform X4 [Glycine 
max]
 gb|KHN16477.1| hypothetical protein glysoja_036579 [Glycine soja]
Length=88

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  568  SQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHF  389
            S L+S++ ++S  VQ +MENM K + EI+Q+S  + E+IEKCK +ALERKR+L+E++++F
Sbjct  15   SHLSSLIYEISNEVQGIMENMFKTVTEINQSSAVVEEEIEKCKGSALERKRALDEEKDNF  74

Query  388  QKAAYAVLNMLNNE  347
            QKAAYAVL+ML+ E
Sbjct  75   QKAAYAVLDMLSRE  88



>ref|XP_002516597.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45938.1| conserved hypothetical protein [Ricinus communis]
Length=95

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -3

Query  610  SPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTA  431
            S P    +P ++ +SQL+S++ DLSQ VQ+ M NM+KMI EIDQNS  I+E+I KCKD+A
Sbjct  8    SGPQPHGSP-AETESQLSSLLYDLSQQVQMSMGNMLKMIAEIDQNSAGIMEEIAKCKDSA  66

Query  430  LERKRSLEEQREHFQKAAYAVLNMLNN  350
            +E+K++LEE++E FQK+AYAVL+MLNN
Sbjct  67   VEKKKALEEEKEKFQKSAYAVLDMLNN  93



>ref|XP_008793456.1| PREDICTED: uncharacterized protein LOC103709741 [Phoenix dactylifera]
Length=99

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -3

Query  637  MEASK-VLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIV  461
            ME +K +L +S P   +AP  + +SQ++S++ D+SQ +Q+ ++NM+KM  EID+ S +I+
Sbjct  1    MENTKAILALSSPSESLAP--EAESQISSLLCDVSQQLQIAIQNMLKMTSEIDETSAEIM  58

Query  460  EDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNN  350
            E+IEK K++A  + + LEE++E FQKAA AVL MLN 
Sbjct  59   EEIEKSKESAGVKNKILEEEKERFQKAAIAVLEMLNG  95



>emb|CDY54899.1| BnaC02g48580D [Brassica napus]
Length=93

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S L S+V ++SQ VQV MENM+K + EID NS  I E+I++ K+ A+E+KR LEE++E 
Sbjct  18   ESDLASLVFEMSQQVQVGMENMLKFVNEIDGNSVGIKEEIDRSKEFAMEKKRVLEEEKEQ  77

Query  391  FQKAAYAVLNMLNN  350
            FQKAAY +L+ML+N
Sbjct  78   FQKAAYTILDMLSN  91



>ref|XP_007137096.1| hypothetical protein PHAVU_009G099200g [Phaseolus vulgaris]
 gb|ESW09090.1| hypothetical protein PHAVU_009G099200g [Phaseolus vulgaris]
Length=88

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -3

Query  586  PT-SDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            PT ++ ++ L+S++ ++S  VQ +MEN+ K I EI+ NS  I E+IEKCK +ALERK +L
Sbjct  8    PTEAESENHLSSLIYEISNEVQEIMENLFKTITEINHNSAVIDEEIEKCKGSALERKTAL  67

Query  409  EEQREHFQKAAYAVLNMLNNE  347
             E R++FQKAAYAVL MLN E
Sbjct  68   NEDRDNFQKAAYAVLEMLNRE  88



>ref|NP_001190398.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93468.1| uncharacterized protein AT5G25570 [Arabidopsis thaliana]
Length=131

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  550  VSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQKAAYA  371
            ++++SQ VQ+ MENM+KM+ EIDQNS  I E+IEK KD A+E+KR LEE+++ FQKAAY 
Sbjct  62   IAEMSQQVQMGMENMLKMVYEIDQNSVGIKEEIEKSKDFAMEKKRILEEEKDQFQKAAYT  121

Query  370  VLNMLNN  350
            +L+ML+N
Sbjct  122  ILDMLSN  128



>ref|XP_010915051.1| PREDICTED: uncharacterized protein LOC105040285 [Elaeis guineensis]
Length=99

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -3

Query  637  MEASK-VLTVSPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIV  461
            ME +K +L +S P   + P  D +S +++++ D+SQ +Q+ ++NM+KM  EIDQ S +I+
Sbjct  1    MENTKAILPLSSPSESLVP--DGESLISALLCDVSQQLQIAIQNMLKMTSEIDQTSAEIM  58

Query  460  EDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNNEEI  341
            E+IEK K++A  + + LEE++E FQKAA AVL MLN  +I
Sbjct  59   EEIEKSKESAGVKNKILEEEKERFQKAAIAVLEMLNGSDI  98



>ref|XP_008393997.1| PREDICTED: uncharacterized protein LOC103456134 isoform X1 [Malus 
domestica]
Length=117

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  547  SDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQKAAYAV  368
            + +SQ VQ  MENM KM  EID+NS  I E+IEKCK++A+E+K+ LEE RE  +KAAYAV
Sbjct  50   AXISQQVQGAMENMFKMTSEIDENSAGISEEIEKCKESAIEKKKDLEEVREQVEKAAYAV  109

Query  367  LNMLNN  350
            L +LNN
Sbjct  110  LELLNN  115



>ref|XP_008393998.1| PREDICTED: uncharacterized protein LOC103456134 isoform X2 [Malus 
domestica]
Length=90

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -3

Query  580  SDIDSQLNSIVS----DLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRS  413
            SD+  QLN  +S      S  VQ  MENM KM  EID+NS  I E+IEKCK++A+E+K+ 
Sbjct  8    SDLQLQLNRRLSLRCHPSSTQVQGAMENMFKMTSEIDENSAGISEEIEKCKESAIEKKKD  67

Query  412  LEEQREHFQKAAYAVLNMLNN  350
            LEE RE  +KAAYAVL +LNN
Sbjct  68   LEEVREQVEKAAYAVLELLNN  88



>ref|XP_009388668.1| PREDICTED: uncharacterized protein LOC103975428 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  577  DIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQR  398
            + +SQ+++I+ D  Q VQ  M++M+KM  EI+Q+S +I E+IEKCK++   R ++LEE +
Sbjct  25   EAESQISAILFDTWQQVQEAMQSMLKMTSEIEQSSAEIKEEIEKCKESVEVRSKALEEAK  84

Query  397  EHFQKAAYAVLNMLNNEEI  341
            EH QK A AVL + N  E+
Sbjct  85   EHLQKTAIAVLQIFNGPEV  103



>ref|XP_006844361.1| hypothetical protein AMTR_s00142p00047070 [Amborella trichopoda]
 gb|ERN06036.1| hypothetical protein AMTR_s00142p00047070 [Amborella trichopoda]
Length=98

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = -3

Query  610  SPPDVQMAPTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTA  431
            SP + Q+   S+  +QL+S+V D+ Q  Q   ENM++MI EID++S  I E++ + K++ 
Sbjct  11   SPSNPQL--LSETAAQLSSLVDDVIQQAQGATENMLRMISEIDESSNGITEEMAQSKEST  68

Query  430  LERKRSLEEQREHFQKAAYAVLNMLNNE  347
            + RK++LEE+RE FQ AA  VL ML  E
Sbjct  69   INRKKTLEEERERFQNAAMNVLAMLTGE  96



>ref|XP_003568805.1| PREDICTED: uncharacterized protein LOC100839090 [Brachypodium 
distachyon]
Length=105

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S+L++++ D+SQHVQ  +++M+KM  EI+Q   +I  +IE+ K+   ++ R LEE++E 
Sbjct  30   ESKLSALLFDVSQHVQDGLQSMLKMTGEIEQCGGEIEAEIEQAKEGVADKCRMLEEEKER  89

Query  391  FQKAAYAVLNMLNN  350
            FQK A A LN+L+ 
Sbjct  90   FQKVALAALNILSG  103



>gb|EMS58168.1| hypothetical protein TRIUR3_29520 [Triticum urartu]
Length=105

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            +S+L++++ DLSQ VQ  +++M+KM  EI+Q S +I  +IE+ K+   ++ R LEE++E 
Sbjct  30   ESKLSALLYDLSQQVQDSLQSMLKMTGEIEQCSDEIEVEIEQAKEGVADKYRVLEEEKER  89

Query  391  FQKAAYAVLNMLNN  350
            FQK A A LN+L+ 
Sbjct  90   FQKVALAALNILSG  103



>ref|XP_007220023.1| hypothetical protein PRUPE_ppb025125mg, partial [Prunus persica]
 gb|EMJ21222.1| hypothetical protein PRUPE_ppb025125mg, partial [Prunus persica]
Length=79

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  496  IKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREHFQKAAYAVLNMLNN  350
            + EID+NS  I E+IEKCK+ +LE+K  LEE +E  +KAAYAVL  LNN
Sbjct  29   LSEIDENSGRITEEIEKCKEQSLEKKSGLEEVKEQVKKAAYAVLEKLNN  77



>ref|XP_002439384.1| hypothetical protein SORBIDRAFT_09g005560 [Sorghum bicolor]
 gb|EES17814.1| hypothetical protein SORBIDRAFT_09g005560 [Sorghum bicolor]
Length=108

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            DS+L++++ D+SQ VQ  +++M+KM  EI +   +I  ++E+ +D   E+ R+L ++RE 
Sbjct  30   DSKLSALLFDVSQQVQAGLQSMLKMSSEIARCDGEIDAEVERARDAVAEKSRALHDERER  89

Query  391  FQKAAYAVLNMLNN  350
             QKAA A L++L+ 
Sbjct  90   VQKAALAALDILSG  103



>ref|XP_002454073.1| hypothetical protein SORBIDRAFT_04g024200 [Sorghum bicolor]
 gb|EES07049.1| hypothetical protein SORBIDRAFT_04g024200 [Sorghum bicolor]
Length=108

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  589  APTSDIDSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSL  410
            A     DS L++++ D+SQ VQ  +++M+KM  EI +   +I  ++E+ +D   E+ R+L
Sbjct  24   AADGGCDSNLSALLFDVSQQVQGGLQSMLKMSSEIVRCDGEIDAEVERARDAMAEKGRAL  83

Query  409  EEQREHFQKAAYAVLNMLNN  350
             ++RE  QKAA A L++L+ 
Sbjct  84   HDERERVQKAALAALDILSG  103



>gb|AFW77404.1| hypothetical protein ZEAMMB73_660545 [Zea mays]
Length=108

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            DS+L++++ D+SQ VQ  +++M+K   EI +   +I  ++E+ +D   E  R+L ++RE 
Sbjct  30   DSKLSALLFDVSQQVQDGLQSMLKTSSEIARCDGEIDAELERARDAVAENARALHDERER  89

Query  391  FQKAAYAVLNMLNN  350
             QKAA A L++L+ 
Sbjct  90   VQKAALAALDILSG  103



>ref|NP_001145017.1| uncharacterized protein LOC100278188 [Zea mays]
 gb|ACG44463.1| hypothetical protein [Zea mays]
Length=108

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            DS+L++++ D+SQ VQ  +++M+K   EI +   +I  ++E+ +D   E  R+L ++RE 
Sbjct  30   DSKLSALLFDVSQQVQDGLQSMLKTSSEIARCDREIDAELERARDAVAENARALHDERER  89

Query  391  FQKAAYAVLNMLNN  350
             QKAA A L++L+ 
Sbjct  90   VQKAALAALDILSG  103



>ref|NP_001159064.1| uncharacterized protein LOC100304105 [Zea mays]
 gb|ACG44404.1| hypothetical protein [Zea mays]
Length=107

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  571  DSQLNSIVSDLSQHVQVVMENMVKMIKEIDQNSTDIVEDIEKCKDTALERKRSLEEQREH  392
            DS+L++++ D+SQ V   +++M+K   EI +   +I  ++E+ +D   E  R+L ++RE 
Sbjct  30   DSKLSALLFDVSQQVHG-LQSMLKTSSEIARFDGEIDAELERARDAVAENARALHDERER  88

Query  391  FQKAAYAVLNMLNN  350
             QKAA A L++L+ 
Sbjct  89   VQKAALAALDILSG  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067213240424