BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22094_g2_i1 len=1269 path=[4932:0-1268]

Length=1269
                                                                      Score     E

ref|XP_009772297.1|  PREDICTED: probable aquaporin TIP3-2               343   1e-112   
ref|XP_009625471.1|  PREDICTED: probable aquaporin TIP3-2               342   2e-112   
gb|EYU22320.1|  hypothetical protein MIMGU_mgv1a012158mg                340   2e-111   
ref|XP_011072095.1|  PREDICTED: probable aquaporin TIP3-2               339   3e-111   
ref|XP_004241485.1|  PREDICTED: probable aquaporin TIP3-2               338   1e-110   
ref|NP_001274301.1|  probable aquaporin TIP3-2-like                     335   2e-109   
ref|XP_006347387.1|  PREDICTED: probable aquaporin TIP3-2-like          335   2e-109   
ref|XP_006351524.1|  PREDICTED: probable aquaporin TIP3-2-like          334   3e-109   
ref|XP_009597545.1|  PREDICTED: probable aquaporin TIP3-2               333   7e-109   
ref|XP_009767160.1|  PREDICTED: probable aquaporin TIP3-2               333   1e-108   
emb|CDP17376.1|  unnamed protein product                                333   1e-108   
ref|XP_010687268.1|  PREDICTED: aquaporin TIP3-1-like                   325   9e-106   
gb|EPS57548.1|  hypothetical protein M569_17268                         323   1e-104   
ref|XP_002525663.1|  tonoplast intrinsic protein, putative              322   2e-104   Ricinus communis
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2               322   2e-104   
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg             320   2e-103   
gb|KDP46476.1|  hypothetical protein JCGZ_08448                         318   8e-103   
ref|XP_009355907.1|  PREDICTED: probable aquaporin TIP3-2               317   1e-102   
ref|XP_006372647.1|  aquaporin TIP-type alpha family protein            317   1e-102   
gb|KHG24233.1|  putative aquaporin TIP3-2 -like protein                 317   2e-102   
ref|XP_006441499.1|  hypothetical protein CICLE_v10021799mg             315   6e-102   
ref|XP_010102791.1|  putative aquaporin TIP3-2                          315   1e-101   
ref|XP_006478158.1|  PREDICTED: probable aquaporin TIP3-2-like          314   2e-101   
ref|XP_011046111.1|  PREDICTED: probable aquaporin TIP3-2               313   5e-101   
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2-like          313   6e-101   
ref|XP_008375083.1|  PREDICTED: probable aquaporin TIP3-2               313   8e-101   
ref|XP_008351935.1|  PREDICTED: probable aquaporin TIP-type alpha       310   8e-100   
ref|XP_003619795.1|  Tonoplast intrinsic protein                        307   1e-98    
ref|XP_010918027.1|  PREDICTED: aquaporin TIP3-1-like                   307   1e-98    
ref|XP_009389231.1|  PREDICTED: aquaporin TIP3-1-like                   306   2e-98    
ref|XP_011017549.1|  PREDICTED: probable aquaporin TIP3-2               306   4e-98    
ref|XP_010540050.1|  PREDICTED: probable aquaporin TIP3-2               305   8e-98    
ref|XP_007099759.1|  Beta-tonoplast intrinsic protein                   305   1e-97    
gb|KEH42879.1|  major intrinsic protein (MIP) family transporter        305   1e-97    
ref|XP_008797218.1|  PREDICTED: aquaporin TIP3-1-like                   304   2e-97    
ref|XP_008800430.1|  PREDICTED: aquaporin TIP3-1-like                   303   5e-97    
ref|XP_009397951.1|  PREDICTED: aquaporin TIP3-1-like                   302   7e-97    
ref|XP_010549592.1|  PREDICTED: probable aquaporin TIP3-2               303   8e-97    
ref|XP_006372278.1|  aquaporin TIP-type alpha family protein            302   9e-97    
ref|XP_003536182.1|  PREDICTED: probable aquaporin TIP-type alpha       301   2e-96    
ref|NP_177462.1|  aquaporin TIP3-1                                      301   3e-96    Arabidopsis thaliana [mouse-ear cress]
gb|ACU18941.1|  unknown                                                 301   3e-96    Glycine max [soybeans]
ref|XP_002887476.1|  alpha-tonoplast intrinsic protein                  301   4e-96    
ref|XP_006599671.1|  PREDICTED: probable aquaporin TIP-type alpha       300   4e-96    
ref|XP_006390582.1|  hypothetical protein EUTSA_v10019492mg             301   4e-96    
emb|CDY66321.1|  BnaCnng50290D                                          301   5e-96    
ref|XP_003534069.1|  PREDICTED: probable aquaporin TIP-type alpha       300   6e-96    
emb|CDX72962.1|  BnaC06g34100D                                          300   7e-96    
ref|XP_006301877.1|  hypothetical protein CARUB_v10022350mg             300   7e-96    
ref|XP_010037056.1|  PREDICTED: probable aquaporin TIP3-2               300   8e-96    
emb|CDX96453.1|  BnaA07g30640D                                          299   2e-95    
emb|CDY11123.1|  BnaC06g23750D                                          299   3e-95    
dbj|BAO18638.1|  tonoplast intrinsic protein 3;1                        298   3e-95    
ref|XP_010471374.1|  PREDICTED: aquaporin TIP3-1                        298   3e-95    
ref|XP_010476946.1|  PREDICTED: probable aquaporin TIP3-2               298   3e-95    
ref|XP_010459395.1|  PREDICTED: probable aquaporin TIP3-2               298   4e-95    
gb|ACU23484.1|  unknown                                                 298   5e-95    Glycine max [soybeans]
ref|XP_004512692.1|  PREDICTED: probable aquaporin TIP-type alpha...    298   5e-95    
ref|XP_010498157.1|  PREDICTED: probable aquaporin TIP3-2               297   1e-94    
ref|XP_002890250.1|  beta-tonoplast intrinsic protein                   297   1e-94    
gb|KFK41757.1|  hypothetical protein AALP_AA2G168300                    297   1e-94    
ref|NP_173223.1|  beta-tonoplast intrinsic protein                      297   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416107.1|  PREDICTED: aquaporin TIP3-1-like                   296   2e-94    
ref|XP_006303840.1|  hypothetical protein CARUB_v10012552mg             295   6e-94    
ref|XP_010428229.1|  PREDICTED: aquaporin TIP3-1-like                   294   2e-93    
ref|XP_009127978.1|  PREDICTED: aquaporin TIP3-1                        293   6e-93    
ref|XP_003555545.1|  PREDICTED: probable aquaporin TIP-type alpha...    292   6e-93    
ref|XP_008437248.1|  PREDICTED: probable aquaporin TIP3-2               292   2e-92    
ref|XP_010248450.1|  PREDICTED: aquaporin TIP3-1-like                   291   2e-92    
ref|XP_009104826.1|  PREDICTED: aquaporin TIP3-1-like                   291   4e-92    
ref|XP_004137540.1|  PREDICTED: probable aquaporin TIP3-2-like          291   6e-92    
emb|CDX81850.1|  BnaC08g37510D                                          290   8e-92    
ref|XP_006416665.1|  hypothetical protein EUTSA_v10008480mg             290   9e-92    
pir||T10251  membrane protein MP23 precursor - cucurbit                 290   1e-91 
ref|XP_009149235.1|  PREDICTED: probable aquaporin TIP3-2               289   2e-91    
emb|CDY19176.1|  BnaC05g13770D                                          289   2e-91    
ref|XP_009117640.1|  PREDICTED: probable aquaporin TIP3-2               289   2e-91    
ref|XP_004164504.1|  PREDICTED: probable aquaporin TIP3-2-like          290   6e-91    
emb|CDY26214.1|  BnaA06g12030D                                          287   1e-90    
ref|XP_004495487.1|  PREDICTED: probable aquaporin TIP-type alpha...    286   1e-90    
ref|XP_010248431.1|  PREDICTED: aquaporin TIP3-1-like                   284   8e-90    
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680          284   9e-90    
pir||T10253  membrane protein MP28 - cucurbit                           285   9e-90 
ref|XP_002467022.1|  hypothetical protein SORBIDRAFT_01g018430          283   4e-89    Sorghum bicolor [broomcorn]
ref|NP_001105032.1|  aquaporin TIP3-1                                   282   8e-89    Zea mays [maize]
ref|XP_007152506.1|  hypothetical protein PHAVU_004G136000g             281   9e-89    
ref|XP_010933299.1|  PREDICTED: aquaporin TIP3-1-like                   281   1e-88    
ref|NP_001241721.1|  aquaporin TIP3.1                                   281   2e-88    
ref|XP_004982756.1|  PREDICTED: aquaporin TIP3-1-like                   281   2e-88    
ref|NP_001064933.1|  Os10g0492600                                       281   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010069542.1|  PREDICTED: probable aquaporin TIP3-2               280   4e-88    
tpg|DAA49507.1|  TPA: aquaporin TIP3-2                                  280   4e-88    
ref|XP_002262978.1|  PREDICTED: probable aquaporin TIP3-2               280   5e-88    Vitis vinifera
dbj|BAI66441.1|  tonoplast intrinsic protein                            279   1e-87    Hordeum vulgare subsp. vulgare [barley]
ref|NP_001105045.1|  aquaporin TIP3-2                                   279   1e-87    Zea mays [maize]
sp|P23958.1|TIPA_PHAVU  RecName: Full=Probable aquaporin TIP-type...    278   3e-87    Phaseolus vulgaris [French bean]
gb|AGV54386.1|  aquaporin TIP-type alpha-like protein                   278   4e-87    
emb|CBI26397.3|  unnamed protein product                                278   4e-87    
dbj|BAL14718.1|  tonoplast intrinsic protein 3;1                        278   4e-87    
gb|EMT18736.1|  Putative aquaporin TIP3-1                               276   9e-87    
ref|XP_003574110.1|  PREDICTED: aquaporin TIP3-1                        275   4e-86    
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                        272   4e-85    
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                   272   4e-85    
emb|CAB39758.1|  major intrinsic protein                                270   2e-84    Picea abies
ref|XP_010042457.1|  PREDICTED: probable aquaporin TIP3-2               270   3e-84    
ref|XP_009105968.1|  PREDICTED: aquaporin TIP3-1-like                   270   4e-84    
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                        269   6e-84    
gb|ABK22410.1|  unknown                                                 269   8e-84    Picea sitchensis
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg             266   6e-83    
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                        266   7e-83    
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                   265   1e-82    
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                  265   1e-82    Brassica oleracea var. botrytis [cauliflower]
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    265   3e-82    
gb|ACP28878.1|  tonoplast intrinsic protein                             265   3e-82    Gossypium hirsutum [American cotton]
gb|KDP29188.1|  hypothetical protein JCGZ_16577                         264   4e-82    
gb|AFH36344.1|  aquaporin TIP2;2                                        264   6e-82    
gb|ABK22242.1|  unknown                                                 264   7e-82    Picea sitchensis
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                  264   7e-82    Brassica oleracea var. botrytis [cauliflower]
ref|NP_001284655.1|  aquaporin TIP1-1                                   263   8e-82    
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1               263   1e-81    
gb|ADB93067.1|  aquaporin                                               263   1e-81    
gb|AGD98716.1|  aquaporin protein 13                                    263   1e-81    
emb|CDY53270.1|  BnaCnng24720D                                          263   1e-81    
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                        262   2e-81    
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                    262   3e-81    
ref|XP_008350342.1|  PREDICTED: aquaporin TIP1-1-like                   262   3e-81    
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                   262   4e-81    
gb|AEQ29861.1|  aquaporin TIP1                                          262   4e-81    
ref|XP_002519456.1|  tonoplast intrinsic protein, putative              261   4e-81    Ricinus communis
gb|ACI95283.1|  tonoplast intrinsic protein                             261   5e-81    Sinapis arvensis [charlock mustard]
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                   261   5e-81    
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                        261   6e-81    
ref|XP_009349744.1|  PREDICTED: aquaporin TIP1-1-like                   261   7e-81    
ref|XP_008387528.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    261   1e-80    
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                      261   1e-80    Pyrus communis
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                        260   1e-80    
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                  260   2e-80    
gb|ACX37451.1|  tonoplast intrinsic protein                             260   2e-80    Hevea brasiliensis [Para rubber tree]
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                  258   7e-80    
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                    258   8e-80    
emb|CAE53881.1|  aquaporin                                              258   9e-80    Ricinus communis
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg             258   2e-79    
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                        258   2e-79    
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg             258   2e-79    
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                        257   2e-79    
ref|NP_181221.1|  aquaporin TIP1-1                                      257   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg             257   2e-79    
emb|CAN69323.1|  hypothetical protein VITISV_032929                     257   3e-79    Vitis vinifera
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...    257   3e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                  257   3e-79    
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000          257   3e-79    
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                  257   3e-79    
emb|CAA38633.1|  possible membrane channel protein                      257   3e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                        256   5e-79    
ref|XP_007027468.1|  Aquaporin TIP1,6                                   256   7e-79    
dbj|BAD04010.1|  tonoplast intrinsic protein                            256   7e-79    Prunus persica
gb|AFN53695.1|  putative tonoplast intrinsic protein                    261   9e-79    
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                  256   1e-78    
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                        255   1e-78    
ref|NP_001267926.1|  aquaporin-like                                     255   2e-78    
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                   255   2e-78    
gb|AHA84270.1|  nodulin-26                                              255   2e-78    
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                   255   2e-78    Brassica napus [oilseed rape]
ref|XP_010098813.1|  Aquaporin TIP1-1                                   255   2e-78    
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...    255   2e-78    Lotus japonicus
dbj|BAA12711.1|  VM23                                                   255   2e-78    Raphanus sativus
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3                254   4e-78    Populus trichocarpa [western balsam poplar]
emb|CDX83623.1|  BnaC07g23630D                                          254   5e-78    
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                        254   6e-78    
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                   253   9e-78    
gb|AFQ23566.1|  aquaporin TIP1                                          253   9e-78    
gb|ADE76384.1|  unknown                                                 253   1e-77    
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g             253   1e-77    
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1               253   1e-77    
ref|XP_002531118.1|  tonoplast intrinsic protein, putative              253   2e-77    Ricinus communis
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                   252   2e-77    
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1               252   2e-77    
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3                252   3e-77    Populus trichocarpa [western balsam poplar]
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2                251   3e-77    
ref|XP_009152050.1|  PREDICTED: aquaporin TIP1-2                        251   4e-77    
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1               251   4e-77    
gb|KDP43963.1|  hypothetical protein JCGZ_05430                         251   5e-77    
gb|AFQ98316.1|  MIP6                                                    251   5e-77    
gb|ABK96489.1|  unknown                                                 251   5e-77    Populus trichocarpa x Populus deltoides
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg             251   6e-77    
gb|AAT65835.2|  tonoplast intrinsic protein gamma                       250   1e-76    Salicornia herbacea
ref|NP_001237062.1|  uncharacterized protein LOC100527509               250   1e-76    
emb|CAC85291.1|  putative tonoplast intrinsic protein                   249   2e-76    Posidonia oceanica
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                        249   2e-76    
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1               249   3e-76    
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                        249   4e-76    
gb|ABK23010.1|  unknown                                                 249   4e-76    Picea sitchensis
gb|AHW81522.1|  ECFP-tagged gamma TIP                                   256   4e-76    
gb|AFU51578.1|  aquaporin                                               249   4e-76    
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2               249   5e-76    
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg             248   9e-76    
ref|XP_002465859.1|  hypothetical protein SORBIDRAFT_01g047140          248   9e-76    Sorghum bicolor [broomcorn]
gb|KDP29873.1|  hypothetical protein JCGZ_18448                         248   1e-75    
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                        248   1e-75    
emb|CDP00041.1|  unnamed protein product                                247   2e-75    
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1               247   2e-75    
ref|XP_010669827.1|  PREDICTED: aquaporin TIP1-3-like                   247   2e-75    
gb|AAB17284.1|  tonoplast intrinsic protein                             247   2e-75    Mesembryanthemum crystallinum
gb|AHJ09607.1|  aquaporin protein 26                                    247   2e-75    
gb|AJA04408.1|  tonoplast intrinsic protein                             247   3e-75    
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                   246   3e-75    
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                   246   3e-75    
gb|AHI54565.1|  tonoplastic intrinsic protein                           247   3e-75    
gb|ABK25915.1|  unknown                                                 246   3e-75    Picea sitchensis
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg             246   4e-75    
gb|ACB71282.1|  tonoplast intrinsic protein                             246   5e-75    Tamarix hispida
ref|XP_008241379.1|  PREDICTED: aquaporin TIP1-1                        246   5e-75    
ref|XP_009421351.1|  PREDICTED: probable aquaporin TIP1-2               246   6e-75    
dbj|BAM44345.1|  vacuolar aluminum transporter                          245   8e-75    
ref|NP_001238026.1|  nodulin-26                                         246   8e-75    
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1               251   1e-74    
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2                245   1e-74    Populus trichocarpa [western balsam poplar]
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg             245   1e-74    
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                        245   2e-74    
ref|XP_003518658.1|  PREDICTED: aquaporin TIP1-3-like                   245   2e-74    
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417             245   2e-74    
gb|KHN30200.1|  Aquaporin TIP1-3                                        244   2e-74    
emb|CAB61841.1|  putative gamma tonoplast intrinsic protein (TIP)       244   2e-74    Sporobolus stapfianus [resurrection grass]
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                        244   2e-74    
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                        244   2e-74    
gb|KFK30698.1|  hypothetical protein AALP_AA6G016000                    244   2e-74    
emb|CDP08994.1|  unnamed protein product                                244   3e-74    
ref|NP_189283.1|  aquaporin TIP1-2                                      244   3e-74    Arabidopsis thaliana [mouse-ear cress]
sp|P50156.1|TIP11_ORYSJ  RecName: Full=Probable aquaporin TIP1-1;...    244   3e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                   244   5e-74    
ref|XP_008463493.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        243   5e-74    
ref|XP_006649396.1|  PREDICTED: probable aquaporin TIP1-1-like          243   7e-74    
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                   243   9e-74    
ref|NP_192056.1|  aquaporin TIP1-3                                      243   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872891.1|  GAMMA-TIP3/TIP1_3                                  243   1e-73    
ref|XP_010922400.1|  PREDICTED: aquaporin TIP1-3-like                   243   1e-73    
ref|XP_008788076.1|  PREDICTED: aquaporin TIP1-3-like                   243   1e-73    
gb|ABK28617.1|  unknown                                                 243   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396348.1|  hypothetical protein EUTSA_v10028907mg             243   1e-73    
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                        242   1e-73    
gb|ADU25490.1|  tonoplastic intrinsic protein                           242   2e-73    
gb|AFS50011.1|  hypothetical protein                                    242   2e-73    
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                        242   2e-73    
gb|KDP44188.1|  hypothetical protein JCGZ_05655                         242   2e-73    
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg                242   2e-73    
emb|CDQ12452.1|  tonoplast intrinsic protein 3;1                        239   2e-73    
ref|NP_001104896.1|  aquaporin TIP1-1                                   241   3e-73    Zea mays [maize]
ref|XP_007139266.1|  hypothetical protein PHAVU_008G014900g             241   3e-73    
gb|ADO17795.1|  tonoplast intrinsic protein                             241   3e-73    
gb|AGD98709.1|  aquaporin protein 6                                     241   3e-73    
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1               241   4e-73    
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                    241   4e-73    
ref|XP_006291577.1|  hypothetical protein CARUB_v10017730mg             243   4e-73    
ref|XP_004494087.1|  PREDICTED: probable aquaporin TIP-type-like        241   5e-73    
ref|XP_004307558.1|  PREDICTED: aquaporin TIP1-3-like                   241   6e-73    
ref|XP_010096653.1|  Aquaporin TIP1-3                                   241   6e-73    
ref|XP_010920700.1|  PREDICTED: probable aquaporin TIP1-2               241   6e-73    
ref|XP_003542571.1|  PREDICTED: aquaporin TIP1-1-like                   241   6e-73    
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                        240   7e-73    Mimosa pudica [sensitive-plant]
ref|XP_008795635.1|  PREDICTED: probable aquaporin TIP1-1               240   7e-73    
ref|NP_001105029.1|  aquaporin TIP1-2                                   240   8e-73    Zea mays [maize]
gb|KHN21988.1|  Aquaporin TIP1-3                                        240   1e-72    
ref|NP_001242707.1|  uncharacterized protein LOC100777419               240   1e-72    
ref|XP_009358317.1|  PREDICTED: aquaporin TIP1-3-like                   240   1e-72    
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                  240   1e-72    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                   240   1e-72    
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                        240   1e-72    
ref|XP_009111380.1|  PREDICTED: aquaporin TIP1-3                        240   1e-72    
ref|XP_008366336.1|  PREDICTED: probable aquaporin TIP1-2               239   2e-72    
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                   239   2e-72    
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                   239   2e-72    
dbj|BAP33938.1|  aquaporin                                              239   2e-72    
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1               239   2e-72    
ref|XP_008357781.1|  PREDICTED: aquaporin TIP1-3-like                   239   2e-72    
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                     239   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985722.1|  PREDICTED: aquaporin TIP1-1-like                   238   4e-72    
gb|ACF78734.1|  unknown                                                 238   4e-72    Zea mays [maize]
ref|NP_001241727.1|  aquaporin TIP1.1                                   238   6e-72    
gb|AGV54343.1|  tonoplast intrinsic protein                             237   6e-72    
emb|CAA06335.1|  aquaporin-like protein                                 238   6e-72    
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                        238   7e-72    
gb|ABI96817.1|  tonoplast intrinsic protein                             238   8e-72    
ref|XP_009404620.1|  PREDICTED: aquaporin TIP1-1-like                   238   8e-72    
dbj|BAI66439.1|  tonoplast intrinsic protein                            237   1e-71    
gb|KHN32099.1|  Aquaporin TIP1-1                                        237   1e-71    
emb|CAA56553.1|  gamma-TIP-like protein                                 237   1e-71    
dbj|BAJ98454.1|  predicted protein                                      237   1e-71    
gb|KDP37268.1|  hypothetical protein JCGZ_06324                         237   1e-71    
ref|XP_004971442.1|  PREDICTED: probable aquaporin TIP1-2-like          237   1e-71    
ref|XP_003565186.1|  PREDICTED: probable aquaporin TIP1-2               237   1e-71    
gb|AGG39699.1|  aquaporin protein AQU21                                 237   1e-71    
ref|XP_009338345.1|  PREDICTED: aquaporin TIP1-3-like                   237   2e-71    
gb|AGD98711.1|  aquaporin protein 8                                     237   2e-71    
ref|XP_004492091.1|  PREDICTED: aquaporin TIP1-3-like                   236   2e-71    
ref|NP_001045562.1|  Os01g0975900                                       236   2e-71    
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                        236   3e-71    
gb|KEH44484.1|  tonoplast intrinsic protein                             236   3e-71    
ref|XP_003606614.1|  Aquaporin TIP1-1                                   236   3e-71    
gb|ABB76813.1|  tonoplast intrinsic protein                             236   3e-71    
ref|NP_001274695.1|  aquaporin TIP1-3-like                              236   4e-71    
gb|KHG16987.1|  Aquaporin TIP1-3 -like protein                          236   4e-71    
ref|XP_006350747.1|  PREDICTED: aquaporin TIP1-3-like                   235   6e-71    
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                   235   8e-71    
gb|EAZ15017.1|  hypothetical protein OsJ_04959                          235   1e-70    
ref|XP_007142715.1|  hypothetical protein PHAVU_007G010800g             235   1e-70    
ref|NP_001236728.1|  nodulin-26                                         234   2e-70    
ref|XP_002523724.1|  tonoplast intrinsic protein, putative              234   2e-70    
ref|XP_006384960.1|  nodulin-26 family protein                          234   2e-70    
emb|CBI31728.3|  unnamed protein product                                234   2e-70    
gb|AIK66517.1|  putative aquaporin                                      234   2e-70    
gb|ACG35910.1|  aquaporin TIP1.2                                        234   2e-70    
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                        234   2e-70    
ref|XP_003597702.1|  Aquaporin                                          234   2e-70    
dbj|BAF95576.1|  tonoplast intrinsic protein                            234   3e-70    
gb|ACN40807.1|  unknown                                                 234   3e-70    
ref|XP_006426918.1|  hypothetical protein CICLE_v10026351mg             234   3e-70    
ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1               234   3e-70    
gb|EMT32480.1|  Putative aquaporin TIP1-2                               234   3e-70    
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    233   3e-70    
gb|AEZ52401.1|  aquaporin                                               233   3e-70    
ref|XP_006465649.1|  PREDICTED: aquaporin TIP2-1-like                   233   3e-70    
dbj|BAO18637.1|  tonoplast intrinsic protein 2;5                        233   3e-70    
gb|AEI83501.1|  Major intrinsic protein                                 233   3e-70    
gb|ACU16456.1|  unknown                                                 233   3e-70    
gb|ACJ53708.1|  tonoplast intrinsic protein 1-1                         233   4e-70    
ref|XP_008794805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    233   4e-70    
gb|ACV52008.1|  tonoplast aquaporin 1;1                                 233   4e-70    
ref|XP_010685836.1|  PREDICTED: aquaporin TIP1-3-like                   233   5e-70    
ref|XP_008669132.1|  PREDICTED: probable aquaporin TIP3-2               233   6e-70    
ref|XP_002515999.1|  tonoplast intrinsic protein, putative              233   6e-70    
dbj|BAL41683.1|  tonoplast intrinsic protein                            233   6e-70    
ref|XP_004497305.1|  PREDICTED: aquaporin TIP1-3-like                   233   6e-70    
ref|XP_010062508.1|  PREDICTED: aquaporin TIP2-1                        233   7e-70    
ref|NP_001267923.1|  aquaporin-like                                     233   8e-70    
gb|AAF78757.1|AF271660_1  putative aquaporin TIP3                       233   9e-70    
ref|XP_009614306.1|  PREDICTED: aquaporin TIP2-1-like                   232   9e-70    
gb|EPS62187.1|  nodulin-26                                              232   1e-69    
ref|XP_007024239.1|  Delta tonoplast integral protein                   232   1e-69    
ref|XP_011004925.1|  PREDICTED: aquaporin TIP2-1                        232   1e-69    
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                   232   2e-69    
gb|AAB62692.1|  salt-stress induced tonoplast intrinsic protein         233   2e-69    
ref|NP_001234103.1|  aquaporin-like                                     231   2e-69    
gb|AAL49753.1|AF452015_1  aquaporin-like protein                        231   2e-69    
ref|XP_011028266.1|  PREDICTED: aquaporin TIP1-1-like                   232   2e-69    
gb|ACY74345.1|  aquaporin-like protein                                  231   2e-69    
ref|XP_010322694.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    231   2e-69    
emb|CAB45653.1|  putative tonoplast intrinsic protein                   231   2e-69    
ref|XP_002459183.1|  hypothetical protein SORBIDRAFT_03g047470          231   2e-69    
gb|AFK41698.1|  unknown                                                 231   3e-69    
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                   231   3e-69    
gb|ACI95284.1|  tonoplast intrinsic protein                             231   3e-69    
ref|XP_003536771.1|  PREDICTED: aquaporin TIP1-3-like                   231   3e-69    
emb|CCI55669.1|  EaTIP1,1                                               231   3e-69    
dbj|BAL41684.1|  tonoplast intrinsic protein                            231   3e-69    
gb|AGD98715.1|  aquaporin protein 12                                    231   4e-69    
emb|CAB55837.1|  delta tonoplast intrinsic protein                      230   5e-69    
ref|XP_002298233.1|  delta-tonoplast intrinsic family protein           230   5e-69    
ref|XP_002303300.1|  delta-tonoplast intrinsic family protein           230   5e-69    
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                          231   5e-69    
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                   231   5e-69    
ref|XP_009617337.1|  PREDICTED: aquaporin TIP2-1                        230   6e-69    
emb|CAN74049.1|  hypothetical protein VITISV_007330                     230   6e-69    
ref|XP_002299893.1|  nodulin-26 family protein                          230   7e-69    
ref|NP_001289845.1|  aquaporin TIP2-1                                   230   7e-69    
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                          230   8e-69    
sp|Q9FY14.1|TIP1_MEDTR  RecName: Full=Probable aquaporin TIP-type...    229   1e-68    
gb|AFK36325.1|  unknown                                                 229   1e-68    
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                   229   1e-68    
ref|XP_003552678.1|  PREDICTED: aquaporin TIP1-3-like                   229   1e-68    
ref|XP_007161564.1|  hypothetical protein PHAVU_001G0803001g            228   1e-68    
ref|XP_010456993.1|  PREDICTED: aquaporin TIP1-3-like                   229   1e-68    
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                   229   1e-68    
gb|ABK22530.1|  unknown                                                 229   2e-68    
gb|ABK21457.1|  unknown                                                 229   2e-68    
ref|XP_006356145.1|  PREDICTED: aquaporin TIP2-1-like                   229   2e-68    
ref|XP_003626979.1|  Aquaporin TIP2-1                                   229   2e-68    
ref|XP_006645407.1|  PREDICTED: probable aquaporin TIP1-2-like          229   2e-68    
ref|XP_009786545.1|  PREDICTED: aquaporin TIP2-1-like                   229   2e-68    
gb|AAD31848.1|AF133532_1  water channel protein MipK                    229   2e-68    
gb|AFH36343.1|  aquaporin TIP2;1                                        229   2e-68    
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                    229   2e-68    
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...    228   3e-68    
gb|AAG44946.1|AF290619_1  putative gamma TIP                            229   3e-68    
ref|XP_007150651.1|  hypothetical protein PHAVU_005G170300g             228   3e-68    
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1               229   3e-68    
gb|AAG44945.1|AF290618_1  putative delta TIP                            228   3e-68    
gb|KHN13870.1|  Aquaporin TIP1-3                                        229   3e-68    
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                   228   3e-68    
ref|XP_003543633.1|  PREDICTED: aquaporin TIP2-1                        228   3e-68    
gb|ADD59910.1|  aquaporin                                               229   3e-68    
gb|KHG06645.1|  putative aquaporin TIP1-2                               228   3e-68    
ref|XP_004149825.1|  PREDICTED: aquaporin TIP1-3-like                   228   3e-68    
ref|XP_002531978.1|  tonoplast intrinsic protein, putative              228   3e-68    
ref|XP_008437066.1|  PREDICTED: probable aquaporin TIP2-2               228   4e-68    
gb|AAD31847.1|AF133531_1  water channel protein MipI                    228   4e-68    
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                   228   4e-68    
emb|CDX75873.1|  BnaC03g39560D                                          229   4e-68    
ref|NP_001240119.1|  uncharacterized protein LOC100817754               228   5e-68    
gb|ADE34283.1|  aquaporin TIP1;7                                        228   5e-68    
gb|ABK94373.1|  unknown                                                 228   5e-68    
gb|KHM98732.1|  Aquaporin TIP2-1                                        228   6e-68    
gb|AAN40746.1|  tonoplast intrinsic protein                             228   6e-68    
gb|AEV54105.1|  putative tonoplast intrinsic protein 1.5                226   6e-68    
ref|XP_011080630.1|  PREDICTED: aquaporin TIP2-1                        227   7e-68    
ref|XP_002314305.2|  nodulin-26 family protein                          228   7e-68    
ref|XP_010098111.1|  Aquaporin TIP2-1                                   227   8e-68    
gb|AAB67881.1|  membrane channel protein                                227   8e-68    
ref|XP_010254028.1|  PREDICTED: aquaporin TIP2-1                        227   1e-67    
gb|ABK26146.1|  unknown                                                 227   1e-67    
emb|CDY67380.1|  BnaAnng24130D                                          226   1e-67    
gb|KFK35805.1|  hypothetical protein AALP_AA4G039000                    227   1e-67    
ref|XP_007144382.1|  hypothetical protein PHAVU_007G151600g             227   1e-67    
emb|CDX82410.1|  BnaA03g34110D                                          227   1e-67    
ref|XP_002314201.1|  nodulin-26 family protein                          227   1e-67    
ref|NP_188245.1|  aquaporin TIP2-1                                      227   1e-67    
gb|ADE34289.1|  aquaporin TIP2;3                                        226   1e-67    
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                         226   1e-67    
gb|AGQ46837.1|  aquaporin-like protein                                  226   1e-67    
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2               227   1e-67    
ref|XP_006359462.1|  PREDICTED: aquaporin TIP2-1-like                   226   2e-67    
gb|AEV54106.1|  putative tonoplast intrinsic protein 1.8                226   2e-67    
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...    226   2e-67    
gb|AFK48554.1|  unknown                                                 226   2e-67    
gb|AEV54104.1|  putative tonoplast intrinsic protein 1.6                225   2e-67    
ref|XP_008228469.1|  PREDICTED: aquaporin TIP2-1                        226   2e-67    
ref|XP_008342659.1|  PREDICTED: aquaporin TIP2-1                        226   2e-67    
ref|XP_009377878.1|  PREDICTED: aquaporin TIP2-1                        226   2e-67    
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                        226   2e-67    
gb|ADF32096.1|  aquaporin                                               226   2e-67    
ref|XP_008222876.1|  PREDICTED: probable aquaporin TIP1-2               226   3e-67    
gb|EYU24713.1|  hypothetical protein MIMGU_mgv1a012474mg                226   3e-67    
emb|CDP07030.1|  unnamed protein product                                226   3e-67    
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                        226   3e-67    
gb|KHG26174.1|  Aquaporin TIP2-1 -like protein                          226   3e-67    
gb|ABR68795.1|  aquaporin gamma-TIP                                     226   4e-67    
emb|CDY63821.1|  BnaC01g44580D                                          226   4e-67    
emb|CDY20190.1|  BnaA01g28120D                                          225   4e-67    
ref|XP_007215863.1|  hypothetical protein PRUPE_ppa010472mg             225   4e-67    
emb|CAA64952.1|  tonoplast intrinsic protein                            226   4e-67    
gb|ABB29477.1|  tonoplast intrinsic protein                             225   4e-67    
ref|NP_001237401.1|  uncharacterized protein LOC100306092               225   5e-67    
ref|XP_009135480.1|  PREDICTED: aquaporin TIP2-1-like                   225   5e-67    
gb|EPS72940.1|  hypothetical protein M569_01821                         225   5e-67    
gb|AAB53329.1|  Rb7                                                     225   6e-67    
ref|XP_010545684.1|  PREDICTED: aquaporin TIP2-1                        225   7e-67    
ref|XP_006298401.1|  hypothetical protein CARUB_v10014472mg             225   7e-67    
gb|AGV54720.1|  water-selective transport intrinsic membrane prot...    224   7e-67    
ref|XP_008380900.1|  PREDICTED: aquaporin TIP2-1-like                   225   7e-67    
gb|AEV54107.1|  putative tonoplast intrinsic protein 1.7                224   7e-67    
gb|AFK47280.1|  unknown                                                 225   7e-67    
ref|XP_006406857.1|  hypothetical protein EUTSA_v10021303mg             226   7e-67    
ref|XP_003554937.1|  PREDICTED: aquaporin TIP2-1-like                   224   8e-67    
gb|AAB04557.1|  delta-tonoplast intrinsic protein                       224   8e-67    
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                        225   8e-67    
ref|XP_009793775.1|  PREDICTED: aquaporin TIP2-1-like                   224   8e-67    
gb|KFK42314.1|  hypothetical protein AALP_AA2G239800                    224   1e-66    
ref|XP_010915908.1|  PREDICTED: probable aquaporin TIP2-2               224   1e-66    
emb|CDX97733.1|  BnaA05g23460D                                          224   1e-66    
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2               224   1e-66    
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                   224   1e-66    
ref|NP_001274703.1|  TIP protein                                        224   1e-66    
emb|CDY30146.1|  BnaC05g37160D                                          224   1e-66    
gb|AAL38357.1|  delta tonoplast intrinsic protein                       224   1e-66    
ref|XP_002446824.1|  hypothetical protein SORBIDRAFT_06g023240          224   2e-66    
gb|KHG09483.1|  putative aquaporin TIP-type                             224   2e-66    
ref|XP_010500811.1|  PREDICTED: aquaporin TIP2-1-like                   224   2e-66    
ref|XP_006392950.1|  hypothetical protein EUTSA_v10011730mg             224   2e-66    
ref|XP_010479718.1|  PREDICTED: aquaporin TIP2-1-like                   224   2e-66    
ref|XP_009146158.1|  PREDICTED: aquaporin TIP2-1                        224   2e-66    
gb|ACU19274.1|  unknown                                                 223   2e-66    
ref|XP_010462056.1|  PREDICTED: aquaporin TIP2-1-like                   224   3e-66    
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg             223   3e-66    
gb|AAC39480.1|  aquaporin                                               223   3e-66    
gb|ABP35520.1|  tonoplast intrinsic protein                             223   3e-66    
ref|XP_004294610.1|  PREDICTED: aquaporin TIP1-1-like                   223   3e-66    
gb|AFN53680.1|  hypothetical protein                                    236   4e-66    
ref|XP_004511697.1|  PREDICTED: probable aquaporin TIP2-2-like          223   4e-66    
emb|CDO98003.1|  unnamed protein product                                223   5e-66    
sp|P42067.2|TIP1_MEDSA  RecName: Full=Probable aquaporin TIP-type...    222   6e-66    
ref|XP_006304972.1|  hypothetical protein CARUB_v10011466mg             223   7e-66    
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     222   8e-66    
ref|XP_011089424.1|  PREDICTED: aquaporin TIP1-3-like                   222   9e-66    
ref|XP_004152399.1|  PREDICTED: aquaporin TIP2-3-like                   222   9e-66    
ref|XP_009611581.1|  PREDICTED: aquaporin TIP2-1-like                   222   1e-65    
dbj|BAA31452.1|  delta-VM23                                             222   1e-65    
gb|KFK38977.1|  hypothetical protein AALP_AA3G184100                    222   1e-65    
gb|AFK35772.1|  unknown                                                 221   1e-65    
ref|XP_007132109.1|  hypothetical protein PHAVU_011G067200g             221   1e-65    
ref|XP_010465638.1|  PREDICTED: aquaporin TIP2-1                        221   1e-65    
gb|ABI84252.1|  tonoplast intrinsic protein alpha TIP                   219   1e-65    
gb|KEH21895.1|  tonoplast intrinsic protein                             221   2e-65    
tpg|DAA33871.1|  TPA: aquaporin TIP2;2                                  221   2e-65    
gb|EYU21481.1|  hypothetical protein MIMGU_mgv1a010922mg                223   2e-65    
ref|XP_007205767.1|  hypothetical protein PRUPE_ppa010367mg             221   3e-65    
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     221   3e-65    
ref|XP_002882988.1|  delta tonoplast intrinsic protein                  221   3e-65    
ref|XP_010487476.1|  PREDICTED: aquaporin TIP2-1-like                   221   3e-65    
ref|XP_004302879.1|  PREDICTED: aquaporin TIP2-1-like                   221   3e-65    
ref|XP_007135655.1|  hypothetical protein PHAVU_010G147100g             220   3e-65    
ref|XP_011031897.1|  PREDICTED: probable aquaporin TIP2-2               220   5e-65    



>ref|XP_009772297.1| PREDICTED: probable aquaporin TIP3-2 [Nicotiana sylvestris]
Length=259

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +2

Query  239  MAPPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGlt  418
            M PPRRYAFGR DEATHPDSMRATLSEFLST +FVF GEG+ LA+DKLY D+ALGAS LT
Sbjct  1    MQPPRRYAFGRVDEATHPDSMRATLSEFLSTFIFVFAGEGSALALDKLYPDTALGASRLT  60

Query  419  vlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACL  598
             +ALAHAL+LFAAVASS+NVSGGH+NPAVTFGALVGGRIS L A+YYW+AQLLG++VA  
Sbjct  61   AIALAHALSLFAAVASSMNVSGGHINPAVTFGALVGGRISVLRAVYYWVAQLLGAVVASA  120

Query  599  LLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAI  778
            LLR++ DG+RP GF +AAG G  + L++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAI
Sbjct  121  LLRLATDGLRPLGFGVAAGVGNLNALVMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAI  180

Query  779  AFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            AFIVGAN+FVG PF GASMNPARAFGPALVGWRWR HWIYW+GPFIGA +AGLIYEFG+
Sbjct  181  AFIVGANIFVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFIGAAIAGLIYEFGL  239



>ref|XP_009625471.1| PREDICTED: probable aquaporin TIP3-2 [Nicotiana tomentosiformis]
Length=259

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +2

Query  239  MAPPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGlt  418
            M PPRRYAFGR DEATHPDSMRATLSEFLST +FVF GEG+ LA+DKLY D+ALGAS LT
Sbjct  1    MQPPRRYAFGRVDEATHPDSMRATLSEFLSTFIFVFAGEGSALALDKLYPDTALGASRLT  60

Query  419  vlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACL  598
             +ALAHAL+LFAAVASS+NVSGGH+NPAVTFGALVGGR+S L A+YYW+AQLLG++VA  
Sbjct  61   AIALAHALSLFAAVASSMNVSGGHINPAVTFGALVGGRVSVLRAVYYWVAQLLGAVVASA  120

Query  599  LLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAI  778
            LLR++ DG+RP GF +AAG G  + L++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAI
Sbjct  121  LLRLATDGLRPLGFGVAAGVGNLNALVMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAI  180

Query  779  AFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            AFIVGAN+FVG PF GASMNPARAFGPALVGWRWR HWIYW+GPFIGA +AGLIYEFG+
Sbjct  181  AFIVGANIFVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFIGAAIAGLIYEFGL  239



>gb|EYU22320.1| hypothetical protein MIMGU_mgv1a012158mg [Erythranthe guttata]
Length=259

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFGRA+EATHPDS++ATLSEFLST +FVF GEG+VLA+DK+Y D AL AS L V+A
Sbjct  2    PRRYAFGRAEEATHPDSVKATLSEFLSTFIFVFAGEGSVLALDKMYSDRALSASSLVVIA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHA +LFAAVASS+NVSGGH+NPAVTFGALVGGR+S L A+YYWIAQLLG++VA LLLR
Sbjct  62   LAHAFSLFAAVASSMNVSGGHINPAVTFGALVGGRVSVLRAIYYWIAQLLGAVVASLLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +S DGMRP GFS+AAG G  + LL+E++MTF L+YTVYATAIDPKRGSLGTIAPLAIAFI
Sbjct  122  LSTDGMRPVGFSVAAGVGGLNALLMEVVMTFALVYTVYATAIDPKRGSLGTIAPLAIAFI  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            VGANV VG PF GA+MNPARAFGPALVGWRW+ HWIYW+GPFIGA LAG+IYEFG+
Sbjct  182  VGANVLVGGPFEGAAMNPARAFGPALVGWRWKNHWIYWLGPFIGAALAGIIYEFGV  237



>ref|XP_011072095.1| PREDICTED: probable aquaporin TIP3-2 [Sesamum indicum]
Length=257

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFG A+EATHPDS++ATLSEFLST +FVF GEG++LA+DK+YRD+ALGAS L V+A
Sbjct  2    PRRYAFGMAEEATHPDSVKATLSEFLSTFIFVFAGEGSILALDKMYRDTALGASRLVVIA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHAL+LFAAVASS+NVSGGH+NPAVTFGALVGGR+S L A+YYWIAQLLG++VA LLLR
Sbjct  62   LAHALSLFAAVASSMNVSGGHINPAVTFGALVGGRVSLLRAVYYWIAQLLGAVVASLLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            ++  GMRP GFS+A+G G  + L+LEI+MTFGL+YTVYATAIDP+RGSLGT+APLAIAFI
Sbjct  122  LATHGMRPYGFSVASGVGEINALVLEIVMTFGLVYTVYATAIDPRRGSLGTVAPLAIAFI  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            VGANV VG PF GASMNPARAFGPALVGWRWR HWIYWVGPF+GA LAGLIYE+G+
Sbjct  182  VGANVLVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFVGAALAGLIYEYGV  237



>ref|XP_004241485.1| PREDICTED: probable aquaporin TIP3-2 [Solanum lycopersicum]
Length=259

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRY FGRADEATHPDS+RATLSEFLST +FVF GEG+VLA+DKLY D ALGAS LT +A
Sbjct  3    PRRYEFGRADEATHPDSVRATLSEFLSTFIFVFAGEGSVLALDKLYPDRALGASRLTAIA  62

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHA +LFAAVASS+NVSGGH+NPAVTFGALVGGR+S L A+YYWI QLLG++VA  LLR
Sbjct  63   LAHAFSLFAAVASSMNVSGGHINPAVTFGALVGGRVSVLRAMYYWIGQLLGAVVASALLR  122

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            ++ DG+RP GF++A+G G G+ L++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAIAFI
Sbjct  123  LATDGLRPVGFAVASGVGNGNALVMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAIAFI  182

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            VGANV VG PF GASMNPARAFGPALVGWRWR HWIYWVGPFIGA +AG+IYEFG+
Sbjct  183  VGANVLVGGPFEGASMNPARAFGPALVGWRWRNHWIYWVGPFIGAAIAGIIYEFGL  238



>ref|NP_001274301.1| probable aquaporin TIP3-2-like [Solanum lycopersicum]
 dbj|BAO18639.1| tonoplast intrinsic protein 3;2 [Solanum lycopersicum]
Length=260

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 211/237 (89%), Gaps = 0/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RRYAFGRADEATHPDSMRATLSE LST +FVF GEG+VLAIDKLY D+ LG+S L V+
Sbjct  4    PARRYAFGRADEATHPDSMRATLSELLSTFIFVFAGEGSVLAIDKLYPDTGLGSSRLIVI  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA + FAAVASSLNVSGGH+NPAVTFG+LVGGRIS + A+YYW+AQL GS++A LLL
Sbjct  64   ALAHAFSFFAAVASSLNVSGGHINPAVTFGSLVGGRISVVRAIYYWVAQLFGSVLASLLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++ DG+RP+GFS+AAG G  + L++EI+MTFGLMYTVYATA+DP+RGSL TIAPLAIAF
Sbjct  124  RLATDGLRPRGFSVAAGVGNLNALVMEIVMTFGLMYTVYATAVDPRRGSLSTIAPLAIAF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I+GAN  VG PF GASMNPARAFGPALVGWRWR HWIYW+GPFIGA LAGLIYE+GI
Sbjct  184  ILGANTLVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFIGAALAGLIYEYGI  240



>ref|XP_006347387.1| PREDICTED: probable aquaporin TIP3-2-like [Solanum tuberosum]
Length=259

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRY FGRADEATHPDSMRATLSEFLST +FVF GEG+VLA+DKLY D  LGAS LT +A
Sbjct  3    PRRYEFGRADEATHPDSMRATLSEFLSTFIFVFAGEGSVLALDKLYPDRGLGASRLTAIA  62

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHA +LFAAVASS+NVSGGH+NPAVTFGALVGGR+S L A+YYWI QLLG++VA  LLR
Sbjct  63   LAHAFSLFAAVASSMNVSGGHINPAVTFGALVGGRVSVLRAIYYWIGQLLGAVVASALLR  122

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            ++ DG+RP GF++A G G G+ L++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAIAFI
Sbjct  123  LATDGLRPVGFAVAPGVGNGNALVMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAIAFI  182

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            VGANV VG PF GASMNPARAFGPALVGWRWR HWIYW+GPFIGA +AG+IYEFG+
Sbjct  183  VGANVLVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFIGAAIAGIIYEFGL  238



>ref|XP_006351524.1| PREDICTED: probable aquaporin TIP3-2-like [Solanum tuberosum]
Length=260

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 211/237 (89%), Gaps = 0/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RRYAFGRADEATHPDSMRATLSE LST +FVF GEG+VLAIDKLY D+ LG+S L V+
Sbjct  4    PARRYAFGRADEATHPDSMRATLSELLSTFIFVFAGEGSVLAIDKLYPDTGLGSSRLIVI  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA + FAAVASSLNVSGGH+NPAVTFG+LVGGRIS + A+YYW+AQL GS++A LLL
Sbjct  64   ALAHAFSFFAAVASSLNVSGGHINPAVTFGSLVGGRISVVRAIYYWVAQLFGSVLASLLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++ DG+RP+GFS+AAG G  + L++EI+MTFGLMYTVYATA+DP+RGSL TIAPLAIAF
Sbjct  124  RLATDGLRPRGFSVAAGVGNLNALVMEIVMTFGLMYTVYATAVDPRRGSLSTIAPLAIAF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I+GAN  VG PF GASMNPARAFGPALVGWRWR HWIYW+GPF+GA LAGLIYE+GI
Sbjct  184  ILGANTLVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFVGAALAGLIYEYGI  240



>ref|XP_009597545.1| PREDICTED: probable aquaporin TIP3-2 [Nicotiana tomentosiformis]
Length=260

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RRYAFGRADEATHPDSMRATLSE LST +FVF GEG VLA+DKLY ++ALGAS LT +
Sbjct  4    PERRYAFGRADEATHPDSMRATLSELLSTFIFVFAGEGTVLALDKLYPETALGASRLTAI  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL+ FAAVASSLNVSGGH+NPAVTFGALVGGRIS + A+YYW+AQL+G++VA LLL
Sbjct  64   ALAHALSFFAAVASSLNVSGGHINPAVTFGALVGGRISVVRAVYYWLAQLVGAVVASLLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++ DG+RP GFS+AAG G  + L++EI+MTFGL+YTVYATAIDP+RGSL TIAPLAIAF
Sbjct  124  RLATDGLRPLGFSVAAGVGNLNALVMEIVMTFGLVYTVYATAIDPRRGSLHTIAPLAIAF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            IVGANV VG PF G SMNPARAFGPALVGWRWR HWIYW+GPF+GA LAGLIYE+GI
Sbjct  184  IVGANVLVGGPFEGGSMNPARAFGPALVGWRWRNHWIYWLGPFVGAALAGLIYEYGI  240



>ref|XP_009767160.1| PREDICTED: probable aquaporin TIP3-2 [Nicotiana sylvestris]
Length=260

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RRYAFGRADEATHPDSMRATLSE LST +FVF GEG VLA+DKLY ++ALGAS LT +
Sbjct  4    PARRYAFGRADEATHPDSMRATLSELLSTFIFVFAGEGTVLALDKLYPETALGASRLTAI  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL+ FAAVASSLNVSGGH+NPAVTFGALVGGRIS + A+YYW+AQL+G+++A LLL
Sbjct  64   ALAHALSFFAAVASSLNVSGGHINPAVTFGALVGGRISVVRAVYYWLAQLVGAVIASLLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++ DG+RP GFS+AAG G  + L++EI+MTFGL+YTVYATAIDP+RGSL TIAPLAIAF
Sbjct  124  RLATDGLRPLGFSVAAGVGNLNALVMEIVMTFGLVYTVYATAIDPRRGSLHTIAPLAIAF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            IVGANV VG PF G SMNPARAFGPALVGWRWR HWIYW+GPF+GA LAGLIYE+GI
Sbjct  184  IVGANVLVGGPFEGGSMNPARAFGPALVGWRWRNHWIYWLGPFVGAALAGLIYEYGI  240



>emb|CDP17376.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFG  +EATHPDSMRATL EFLST +FVF GEG++LA+DK+YR++AL ASGL V+A
Sbjct  5    PRRYAFGGTEEATHPDSMRATLGEFLSTFIFVFAGEGSLLALDKMYRETALEASGLAVVA  64

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHAL LFAAVA+S+NVSGGHVNPAVTFGALVGGR+SF+ ALYYW+AQLLG++VA LLLR
Sbjct  65   LAHALGLFAAVAASMNVSGGHVNPAVTFGALVGGRVSFVRALYYWVAQLLGAVVASLLLR  124

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            ++ DG RP GFS+AAGEG  + LL+EII+TFGL+Y VYATA DPK+GSLGTIAPLAIAF+
Sbjct  125  IATDGRRPMGFSVAAGEGNLNALLMEIILTFGLVYVVYATAFDPKKGSLGTIAPLAIAFV  184

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            +GAN+ VG PF GASMNPARAFGPALVGWRWR HWIYW+GPF+GA L+ LIYE+GI
Sbjct  185  LGANILVGGPFEGASMNPARAFGPALVGWRWRNHWIYWLGPFVGAALSALIYEYGI  240



>ref|XP_010687268.1| PREDICTED: aquaporin TIP3-1-like [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   325 bits (834),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 208/238 (87%), Gaps = 1/238 (0%)
 Frame = +2

Query  239  MAPPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLY-RDSALGASGl  415
            MAPPRRYAFGR +EATHPDSMRATL+EF+ST +FVF GEG+ LA+ KLY  ++  GAS L
Sbjct  1    MAPPRRYAFGRPEEATHPDSMRATLAEFISTFIFVFAGEGSQLALRKLYGVEAPAGASSL  60

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA  LFAAVA+SLNVSGGHVNPAVTFGALVGGR+SFL A+ YWIAQLLG+IVA 
Sbjct  61   IMIALAHAFGLFAAVAASLNVSGGHVNPAVTFGALVGGRVSFLRAILYWIAQLLGAIVAA  120

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ DGMRP G  +A GEG  + L+LEI+MTFGL+YTVYATAIDPKRGSLGTIAPLA
Sbjct  121  LLLRLTTDGMRPMGLGVAYGEGNINALVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPLA  180

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IA +VGAN+ VG PF GASMNPARAFGPAL+GWRWR+HWIYWVGP IG GLAGLIYEF
Sbjct  181  IALVVGANILVGGPFDGASMNPARAFGPALIGWRWRHHWIYWVGPLIGGGLAGLIYEF  238



>gb|EPS57548.1| hypothetical protein M569_17268 [Genlisea aurea]
Length=257

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/237 (76%), Positives = 210/237 (89%), Gaps = 1/237 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLY-RDSALGASGltvl  424
            PRRYAFGRA+EATHPDS+RAT++EF ST +FVF GEG++LA+DK+Y  D+ L +S L V+
Sbjct  2    PRRYAFGRAEEATHPDSVRATMAEFFSTFIFVFAGEGSILALDKIYGADTGLHSSSLAVI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALALFAAVASS+NVSGGHVNPAVT GALVGGR+S L A+YYWIAQLLG++VA LLL
Sbjct  62   ALAHALALFAAVASSMNVSGGHVNPAVTLGALVGGRVSVLRAIYYWIAQLLGAVVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP G  +  GEG  + LL+EI+MTFGL+YTVYATAIDPKRGSLGTI+PLAIAF
Sbjct  122  RLTTGGMRPVGLGVTVGEGSLNALLMEIVMTFGLVYTVYATAIDPKRGSLGTISPLAIAF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I GAN+ VGAPF GASMNPARAFGPALVGWRWRYHWIYW+GPF+GA +AGLIYEFGI
Sbjct  182  IFGANILVGAPFEGASMNPARAFGPALVGWRWRYHWIYWLGPFVGAAIAGLIYEFGI  238



>ref|XP_002525663.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF36781.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=255

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 206/234 (88%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFGRA+EATHPDS+RATL+EF+ST +FVF GEG+VLA+DKLYR++   ASGL ++A
Sbjct  2    PRRYAFGRAEEATHPDSIRATLAEFVSTLIFVFAGEGSVLALDKLYRETGPPASGLVMVA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAH LALF+AV++S+N+SGGH+NPAVTFGALVGGRIS +LA YYWIAQLLG+IVA LLLR
Sbjct  62   LAHGLALFSAVSASINISGGHLNPAVTFGALVGGRISVVLAFYYWIAQLLGAIVASLLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GMRP GF + +G G   GL++E++MTFGL+YTVYATAIDPKRGSLG IAPLAI FI
Sbjct  122  LVTNGMRPVGFHVTSGVGEVHGLIMEMVMTFGLVYTVYATAIDPKRGSLGIIAPLAIGFI  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYW+GPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGASMNPARAFGPALVGWRWNNHWIYWLGPFVGGGLAALIYEY  235



>ref|XP_008240429.1| PREDICTED: probable aquaporin TIP3-2 [Prunus mume]
Length=256

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 206/235 (88%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYAFGRADEATHPDSMRATL+EF++T +FVF GEG+VLA+ K+Y+DS   A+ L  +
Sbjct  2    PPRRYAFGRADEATHPDSMRATLAEFVATFIFVFAGEGSVLALGKIYKDSGTSAAELIAI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA +LF+AV++S+NVSGGHVNPAVTFGAL+GGR+S + ALYYW+AQLLG+IVA LLL
Sbjct  62   ALAHAFSLFSAVSTSINVSGGHVNPAVTFGALIGGRLSVVRALYYWVAQLLGAIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMR  GFS+A+G G   GL+LEI+MTFGL+YTVYATAIDPKRGSLGT+APLAI  
Sbjct  122  RLVTNGMRTVGFSMASGVGEWHGLILEIVMTFGLVYTVYATAIDPKRGSLGTMAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GASMNPARAFGPALVGWRWR HWIYWVGPFIG GLA LIYE+
Sbjct  182  IVGANILVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFIGGGLAALIYEY  236



>ref|XP_007210530.1| hypothetical protein PRUPE_ppa010285mg [Prunus persica]
 gb|EMJ11729.1| hypothetical protein PRUPE_ppa010285mg [Prunus persica]
Length=256

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 205/235 (87%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYAFGRADEATHPDSMRATL+EF++T +FVF GEG+VLA+ K+Y+DS   A+ L  +
Sbjct  2    PPRRYAFGRADEATHPDSMRATLAEFVATFIFVFAGEGSVLALGKIYKDSGTSAAELIAI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA +LF+AV++S+NVSGGHVNPAVTFGAL+GGR+S + ALYYW+AQLLG+IVA LLL
Sbjct  62   ALAHAFSLFSAVSTSINVSGGHVNPAVTFGALIGGRLSVVRALYYWVAQLLGAIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMR   FS+A+G G   GL+LEI+MTFGL+YTVYATAIDPKRGSLGT+APLAI  
Sbjct  122  RLVTNGMRTVAFSMASGVGEWHGLILEIVMTFGLVYTVYATAIDPKRGSLGTMAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GASMNPARAFGPALVGWRWR HWIYWVGPFIG GLA LIYE+
Sbjct  182  IVGANILVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFIGGGLAALIYEY  236



>gb|KDP46476.1| hypothetical protein JCGZ_08448 [Jatropha curcas]
Length=257

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRY FGR +EATHPDS+RATL+EF+ST +FVF GEG+VLA++KLYR++   ASGL ++
Sbjct  2    PPRRYIFGRTEEATHPDSIRATLAEFVSTLIFVFAGEGSVLALEKLYRETGPPASGLVMI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALALFAAVA+S+N+SGGHVNPAVT GALVGGRIS + A YYWIAQLLGSIVA LLL
Sbjct  62   ALAHALALFAAVAASINISGGHVNPAVTLGALVGGRISVVRAFYYWIAQLLGSIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMRP+GF + AG G   GL++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAI  
Sbjct  122  RLVTNGMRPEGFHVTAGVGEVHGLIMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GA+MNPARAFGPALVGWRW  HWIYWVGPFIG  LAGLIYE+
Sbjct  182  IVGANILVGGPFDGAAMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAGLIYEY  236



>ref|XP_009355907.1| PREDICTED: probable aquaporin TIP3-2 [Pyrus x bretschneideri]
 ref|XP_009338888.1| PREDICTED: probable aquaporin TIP3-2 [Pyrus x bretschneideri]
Length=256

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYAFGRADEATHPDS+RATL+EF++T +FVF GEG+VLA+ K+Y+DS   AS L  +
Sbjct  2    PPRRYAFGRADEATHPDSIRATLAEFVATFVFVFAGEGSVLALGKIYKDSGTSASELIAI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA +LF+A+++S+NVSGGHVNPAVTFGAL+GGR+S + ALYYW+AQLLG+IVA LLL
Sbjct  62   ALAHAFSLFSAISASINVSGGHVNPAVTFGALLGGRLSVVRALYYWVAQLLGAIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMR  GF++A+G     GL+LEI++TFGL+YTVYATAIDPKRGSLGTIAPLAI F
Sbjct  122  RLVTNGMRTVGFNVASGVAEVHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GA MNPARAFGPALVGWRWR HWIYWVGP +G GLA LIYE+
Sbjct  182  IVGANILVGGPFDGACMNPARAFGPALVGWRWRNHWIYWVGPLLGGGLAALIYEY  236



>ref|XP_006372647.1| aquaporin TIP-type alpha family protein [Populus trichocarpa]
 gb|ERP50444.1| aquaporin TIP-type alpha family protein [Populus trichocarpa]
Length=258

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 206/234 (88%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRR+AFGRADEATHPDSMRA L+EF+ST +FVF GEG+VLA+DKLY+++   ASGL V+A
Sbjct  2    PRRHAFGRADEATHPDSMRAALAEFVSTFVFVFAGEGSVLALDKLYKETGPLASGLVVVA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHALALF+AVASS+N+SGGHVNPAVTFG+LVGGRIS + A+YYW+AQLLGSIVA LLLR
Sbjct  62   LAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVIRAVYYWVAQLLGSIVAALLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GMRP GF + +G G   GLL+E+ +TFG++YTVYATA+DPKRGSLG IAPLAI FI
Sbjct  122  LVTNGMRPVGFHVQSGVGEVHGLLMEMALTFGVVYTVYATALDPKRGSLGIIAPLAIGFI  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GASMNPARAFGPAL+GWRWR HWIYWVGPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGASMNPARAFGPALIGWRWRNHWIYWVGPFLGGGLAALIYEY  235



>gb|KHG24233.1| putative aquaporin TIP3-2 -like protein [Gossypium arboreum]
Length=256

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 205/235 (87%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRY FGRADEATHPDSMRATL+EFLST +FVF GEG++LA+DK+Y+D++   + L ++
Sbjct  2    PPRRYQFGRADEATHPDSMRATLAEFLSTIIFVFAGEGSILALDKMYKDTSATPARLVMI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH L+LFAAVASS+NVSGGHVNPAVTFGAL+GGRIS + ALYYWIAQLLGSIVACL L
Sbjct  62   ALAHGLSLFAAVASSVNVSGGHVNPAVTFGALLGGRISLVRALYYWIAQLLGSIVACLFL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GF+LA+G G   GL+LEI++T+GL+YTVYAT IDPKRGS+GTIAPLAI  
Sbjct  122  RLT-AGMRPGGFALASGVGELRGLILEIVLTYGLVYTVYATGIDPKRGSVGTIAPLAIGL  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IV AN+ VG PF GA+MNPARAFGPALVGWRW +HWIYWVGP IG GLA L+YE+
Sbjct  181  IVSANILVGGPFDGAAMNPARAFGPALVGWRWNHHWIYWVGPLIGGGLAALMYEY  235



>ref|XP_006441499.1| hypothetical protein CICLE_v10021799mg [Citrus clementina]
 gb|ESR54739.1| hypothetical protein CICLE_v10021799mg [Citrus clementina]
Length=256

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYA GRADEA HPD+MRA L+EF+ST +FVF GEG++LA+DK+ + +    S L V+
Sbjct  2    PPRRYAIGRADEAAHPDTMRAALAEFVSTLIFVFAGEGSILALDKISKATTTSPSDLVVI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALALFAAVASS+N SGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+IVA LLL
Sbjct  62   ALAHALALFAAVASSINTSGGHVNPAVTFGALLGGRISVVRAIYYWIAQLLGAIVAALLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R + +GMRP GF +A+G G G GL+LEI+MTFGL+YTVYAT IDPKRGSLG + PLAI F
Sbjct  122  RFATNGMRPVGFYVASGVGEGHGLVLEIVMTFGLVYTVYATVIDPKRGSLGIVGPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GASMNPARAFGPALVGWRWR HWIYWVGPFIGAGLA LIYE+
Sbjct  182  IVGANILVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFIGAGLAALIYEY  236



>ref|XP_010102791.1| putative aquaporin TIP3-2 [Morus notabilis]
 gb|EXB94104.1| putative aquaporin TIP3-2 [Morus notabilis]
Length=258

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 203/236 (86%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALG-ASGltv  421
            P RRYAFGRADEATHPDSMRATL+EF+ST LFVF GEG++LA+DK+Y++     AS L  
Sbjct  2    PVRRYAFGRADEATHPDSMRATLAEFVSTFLFVFAGEGSILALDKIYKEHGTSSASELVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
            +ALAHA +LFAA+++S+N+SGGHVNPAVTFGALVGGRIS + A+YYW+AQLLG+IVA LL
Sbjct  62   VALAHAFSLFAAISASINISGGHVNPAVTFGALVGGRISVIRAVYYWVAQLLGAIVASLL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            LR+   GMRP GF +A G     GLLLEII+TFGL+YTVYATAIDPKRG++GTIAPLAIA
Sbjct  122  LRLVTVGMRPLGFHVAPGVSEVHGLLLEIILTFGLVYTVYATAIDPKRGNMGTIAPLAIA  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
             I+GAN+ VG PF GASMNPARAFGPALVGWRW+ HWIYWVGPFIG  LAGL+YE+
Sbjct  182  LILGANILVGGPFDGASMNPARAFGPALVGWRWKNHWIYWVGPFIGGALAGLLYEY  237



>ref|XP_006478158.1| PREDICTED: probable aquaporin TIP3-2-like [Citrus sinensis]
 gb|KDO56000.1| hypothetical protein CISIN_1g025197mg [Citrus sinensis]
Length=256

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYA GRADEA HPD+MRA L+EF+ST +FVF GEG++LA+DK+ + +    S L V+
Sbjct  2    PPRRYAIGRADEAAHPDTMRAALAEFVSTLIFVFAGEGSILALDKISKATTTSPSDLVVI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALALFAAVASS+N SGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+IVA LLL
Sbjct  62   ALAHALALFAAVASSINTSGGHVNPAVTFGALLGGRISVVRAIYYWIAQLLGAIVAALLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R + +GMRP GF +A+G G G GL+LEI+MTFGL+YTVYAT IDPKRGSLG + PLAI F
Sbjct  122  RFATNGMRPVGFYVASGVGEGHGLVLEIVMTFGLVYTVYATVIDPKRGSLGIVGPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GASMNPARAFGPALVGWRWR HWIYWVGPF+GAGLA LIYE+
Sbjct  182  IVGANILVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFLGAGLAALIYEY  236



>ref|XP_011046111.1| PREDICTED: probable aquaporin TIP3-2 [Populus euphratica]
Length=258

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 204/234 (87%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRR+ FGRADEATHPDSMRA L+EF+ST +FVF GEG+VLA+DKLY+++   ASGL V+A
Sbjct  2    PRRHEFGRADEATHPDSMRAALAEFVSTFVFVFAGEGSVLALDKLYKETGPLASGLVVVA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHALALF+AVASS+N+SGGHVNPAVTFG+LVGGRIS + A+YYW+AQLLGSIVA LLLR
Sbjct  62   LAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVIRAVYYWVAQLLGSIVAALLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GMRP GF + +G G    LLLE+ +TFG++YTVYATA+DP+RGSLG IAPLAI FI
Sbjct  122  LVTNGMRPVGFHVQSGVGEVHALLLEMALTFGVVYTVYATALDPRRGSLGIIAPLAIGFI  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GASMNPARAFGPAL+GWRWR HWIYWVGPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGASMNPARAFGPALIGWRWRSHWIYWVGPFLGGGLAALIYEY  235



>ref|XP_004299448.1| PREDICTED: probable aquaporin TIP3-2-like [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 203/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RRY FGRADEATHPDS+RATL+EF++T +FVF GEG++LA+ K+Y+DS    + L  +
Sbjct  4    PYRRYEFGRADEATHPDSIRATLAEFIATFIFVFAGEGSILALGKIYKDSDTSVAELIAI  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF+A+++S+N+SGGHVNPAVTFGAL+GGRIS + A YYW+AQLLG+IVA L+L
Sbjct  64   ALAHAFALFSAISASINISGGHVNPAVTFGALIGGRISVVRAFYYWVAQLLGAIVASLVL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMR  GF++A G G   GL+LEI+MTFGL+YTVYATAIDPKRGSLGTIAPLAI F
Sbjct  124  RLVTNGMRTVGFNVAPGVGEWHGLVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPLAIGF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GASMNPARAFGPALVGWRW+ HWIYW+GPFIG GLAGLIYE+
Sbjct  184  IVGANILVGGPFDGASMNPARAFGPALVGWRWKNHWIYWLGPFIGGGLAGLIYEY  238



>ref|XP_008375083.1| PREDICTED: probable aquaporin TIP3-2 [Malus domestica]
Length=256

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYAFGRADE THPDS+RATL+E ++T +FVF GEG+ LA+ K+Y+DS   AS L  +
Sbjct  2    PPRRYAFGRADEVTHPDSIRATLAELVATFIFVFAGEGSALALGKIYKDSGTSASELIAI  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA +LF+A+++S+NVSGGHVNPAVTFGAL+GGR+S + ALYYW+AQLLG+IVA LLL
Sbjct  62   ALAHAFSLFSAISASINVSGGHVNPAVTFGALLGGRLSVVRALYYWVAQLLGAIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R+  +GMR  GF++A+G     GL+LEI++TFGL+YTVYATAIDPKRGSLGTIAPLAI F
Sbjct  122  RLVTNGMRTVGFNVASGVAEVHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF GA MNPARAFGPALVGWRWR HWIYWVGP +G GLA LIYE+
Sbjct  182  IVGANILVGGPFDGACMNPARAFGPALVGWRWRNHWIYWVGPLLGGGLAALIYEY  236



>ref|XP_008351935.1| PREDICTED: probable aquaporin TIP-type alpha [Malus domestica]
Length=255

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 202/234 (86%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFGRADEATHPDS+RATL+EF++T +FVF GEG+ LA+ K+Y+DS   AS L  +A
Sbjct  2    PRRYAFGRADEATHPDSIRATLAEFVATFIFVFAGEGSALALGKIYKDSGTSASELIAIA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHA +LF+A+++S+NVSGGHVNPAVTFGAL+GGR+S + AL YW+AQLLG+IVA LLLR
Sbjct  62   LAHAFSLFSAISASINVSGGHVNPAVTFGALLGGRLSVVRALCYWVAQLLGAIVASLLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GMR  GF++A+G G G GL+LEI++TFGL+YTVYATAIDPKRGSLGTIAPLAI  +
Sbjct  122  LVTNGMRTVGFNVASGIGEGHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIGLV  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GA MNPARAFGPALVG RWR HWIYWVGPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGACMNPARAFGPALVGGRWRNHWIYWVGPFLGGGLAALIYEY  235



>ref|XP_003619795.1| Tonoplast intrinsic protein [Medicago truncatula]
 gb|AES76013.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=255

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 196/233 (84%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRYAFGR DEA HPDS+RAT++EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  +AL
Sbjct  4    RRYAFGRVDEAYHPDSIRATIAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLAVAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV+SS++VSGGHVNPAVTFGAL+GGRIS L A+YYWIAQLLG+IVA LLLR+
Sbjct  64   AHAFALFAAVSSSMHVSGGHVNPAVTFGALIGGRISVLRAVYYWIAQLLGAIVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF LA G G G GL+LEIIMTFGLMYTVYATAIDPKRGS+G IAPLAI  IV
Sbjct  124  VTNNMRPGGFHLARGIGVGHGLILEIIMTFGLMYTVYATAIDPKRGSIGAIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG PF GA MNPA AFGP+LVGWRW YHWI+WVGPFIGA LA LIYE+
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWRWHYHWIFWVGPFIGAALAALIYEY  236



>ref|XP_010918027.1| PREDICTED: aquaporin TIP3-1-like [Elaeis guineensis]
Length=256

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 198/232 (85%), Gaps = 1/232 (0%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R+AFGR ++A HPD+MRA LSEF+ TA+FVF GEG+VL+++KLYRD++  A GL ++A+A
Sbjct  6    RFAFGRTEDAVHPDTMRAALSEFIGTAIFVFAGEGSVLSLEKLYRDTST-AGGLVMVAIA  64

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HALA F AV+ + N SGGH+NPAVTFGALVGGRIS + A+YYW+AQLLG+I+A LLLRV+
Sbjct  65   HALAFFVAVSIAFNTSGGHINPAVTFGALVGGRISLIHAVYYWVAQLLGAIIASLLLRVT  124

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              GMRP GFSL +G G    +LLEI++TFGL+YTVYATAIDPKRG LGTIAPLAI FIVG
Sbjct  125  TGGMRPLGFSLGSGIGEWHAVLLEIVLTFGLVYTVYATAIDPKRGYLGTIAPLAIGFIVG  184

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            AN+  G PF GASMNPARAFGPALVGWRWR HW+YW+GPF+GAGLAGL YEF
Sbjct  185  ANILAGGPFDGASMNPARAFGPALVGWRWRRHWVYWLGPFVGAGLAGLTYEF  236



>ref|XP_009389231.1| PREDICTED: aquaporin TIP3-1-like [Musa acuminata subsp. malaccensis]
Length=254

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 201/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRR+AFGRA++A HPD+MRA LSEF++TALFVF  EG+VL++ KLY+D++  A GL V+
Sbjct  2    PPRRFAFGRAEDAVHPDTMRAALSEFIATALFVFAAEGSVLSLGKLYKDTST-AGGLVVV  60

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHALAL  AV+ SLN+SGGHVNPAVT GALVGGRIS +LA++YW+AQLLG++VA LLL
Sbjct  61   AIAHALALSVAVSVSLNISGGHVNPAVTLGALVGGRISLILAVFYWVAQLLGAVVAALLL  120

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GF +A+G   G  +LLEI+MTFGL+YTVYATAIDP+RG LG IAPLAI F
Sbjct  121  RLATGGMRPLGFGVASGVSEGHAVLLEIVMTFGLVYTVYATAIDPRRGHLGIIAPLAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I+GAN+  G PF GA+MNPARAFGPA+VGWRW+ HW+YWVGP +GA LAGLIYEF
Sbjct  181  ILGANILAGGPFDGAAMNPARAFGPAVVGWRWKSHWVYWVGPLVGAALAGLIYEF  235



>ref|XP_011017549.1| PREDICTED: probable aquaporin TIP3-2 [Populus euphratica]
Length=258

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 201/234 (86%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFG+ADEAT PD+MRA L+E +ST +FVF GEG++LA+DKLY+ +   ASGL V++
Sbjct  2    PRRYAFGKADEATRPDAMRAALAELVSTFIFVFAGEGSILALDKLYKGTGPPASGLLVVS  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHALALF+AVASS+N+SGGHVNPAVTFG+LVGGRIS + A+ YW+AQLLGSI A LLLR
Sbjct  62   LAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVIRAVSYWVAQLLGSIFAALLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +G+RP GF + +G G   GLLLE+ +TFGL+YTVYATAIDPKRGSLG IAPLAI F+
Sbjct  122  LVTNGLRPTGFHVQSGVGEVHGLLLEMALTFGLVYTVYATAIDPKRGSLGIIAPLAIGFV  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GASMNPARAFGPAL+GWRWR HWIYWVGPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGASMNPARAFGPALIGWRWRNHWIYWVGPFLGGGLAALIYEY  235



>ref|XP_010540050.1| PREDICTED: probable aquaporin TIP3-2 [Tarenaya hassleriana]
Length=267

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 207/240 (86%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EF+ST +FVF GEG++LA+DKLY D+A  +      GL
Sbjct  7    REYVFGRADEATHPDSIRATLAEFISTFVFVFAGEGSILALDKLYWDTAAHSGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGH+NPAVTFGAL+GGRIS + A++YWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHLNPAVTFGALIGGRISVIRAIFYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF ++ G G   GL++EII+T+GL+YTVY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGMRPVGFHVSHGVGEVHGLVMEIILTYGLVYTVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  +VGAN+ VG PF GASMNPARAFGPALVGWRW+ HWIYWVGPFIG GLAGL+YE+ I
Sbjct  187  IGLVVGANILVGGPFEGASMNPARAFGPALVGWRWKSHWIYWVGPFIGGGLAGLVYEYMI  246



>ref|XP_007099759.1| Beta-tonoplast intrinsic protein [Theobroma cacao]
 gb|EOY20304.1| Beta-tonoplast intrinsic protein [Theobroma cacao]
Length=255

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 209/237 (88%), Gaps = 1/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRRYAFGR+DEATHPDSMRATL+EFLST +FVF GEG++LA+DK+Y+D++   +GL ++
Sbjct  2    PPRRYAFGRSDEATHPDSMRATLAEFLSTLIFVFAGEGSILALDKMYKDASTTPAGLVMV  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL+LF+ VA S NVSGGHVNPAVTFGAL+GGRISF+ A+YYW+AQLLG+IVACLLL
Sbjct  62   ALAHALSLFSGVAVSFNVSGGHVNPAVTFGALLGGRISFIRAVYYWVAQLLGAIVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
             V+  GMRP GF++A+G G   GL+LEI++T+GL+YTVYATAIDPKRGSLGTIAPLAI  
Sbjct  122  LVT-AGMRPAGFTVASGVGELRGLVLEIVLTYGLVYTVYATAIDPKRGSLGTIAPLAIGL  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            IVGAN+ VG PF GA+MNPARAFGPALVGWRW  HWIYWVGP +G GLAGLIYE+ I
Sbjct  181  IVGANILVGGPFDGAAMNPARAFGPALVGWRWNNHWIYWVGPLLGGGLAGLIYEYMI  237



>gb|KEH42879.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=258

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/233 (70%), Positives = 196/233 (84%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRYAFGR DEA HPDS+RAT++EF ST +FVF GEG+ LA+ K+Y+D+   +  L VLA+
Sbjct  4    RRYAFGRMDEANHPDSIRATVAEFFSTCIFVFAGEGSALALRKIYKDAGASSGELLVLAI  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA +LFAA++SS++VSGGH+NPAVTFGAL+GGRIS L ALYYW+AQLLGS VA LLLR+
Sbjct  64   AHAFSLFAAISSSMHVSGGHINPAVTFGALLGGRISVLRALYYWVAQLLGSFVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRPQ F++A G G G+ L+LEI MTFGLMY VYATAIDPKRG++GTIAPLAIA +V
Sbjct  124  VTNNMRPQAFNVAFGVGAGNALVLEIAMTFGLMYVVYATAIDPKRGTIGTIAPLAIALVV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA MNPARAFGPALVGWRW YHWI+WVGPF+GA +A L+YE+
Sbjct  184  GANILAGGPFDGACMNPARAFGPALVGWRWHYHWIFWVGPFLGAAIAALLYEY  236



>ref|XP_008797218.1| PREDICTED: aquaporin TIP3-1-like [Phoenix dactylifera]
Length=257

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 203/236 (86%), Gaps = 2/236 (1%)
 Frame = +2

Query  245  PPR-RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            PPR R+AFGR ++A  PD+MRA LSEF+ TA+FVF GEG+VL+++KLY+D++  ASGL +
Sbjct  2    PPRPRFAFGRTEDAVQPDTMRAALSEFIGTAIFVFAGEGSVLSLEKLYKDTST-ASGLVM  60

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
            +A+AHALALF AV+ + N+SGGH+NPAVTFGALVGGRIS + A+ YW+AQLLG+IVA LL
Sbjct  61   VAIAHALALFVAVSIAFNISGGHINPAVTFGALVGGRISVIHAVCYWVAQLLGAIVASLL  120

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            LRV+  GMRP GFSL +G G    +LLEI+MTFGL+YTVYATAIDPKRG LGTIAPLAI 
Sbjct  121  LRVATGGMRPLGFSLGSGIGEWHAVLLEIVMTFGLVYTVYATAIDPKRGHLGTIAPLAIG  180

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            F+VGAN+  G PF GASMNPARAFGPALVGWRWR HW+YW+GPF+GAG+AG++YE+
Sbjct  181  FVVGANILAGGPFDGASMNPARAFGPALVGWRWRRHWVYWLGPFVGAGIAGVMYEY  236



>ref|XP_008800430.1| PREDICTED: aquaporin TIP3-1-like [Phoenix dactylifera]
Length=255

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 197/232 (85%), Gaps = 1/232 (0%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R+ FGR ++A HPD+MRA LSEF+ TALFVF GEG+VL+++KLYRD++  A GL ++A+A
Sbjct  6    RFTFGRTEDAVHPDTMRAALSEFIGTALFVFAGEGSVLSLEKLYRDTST-AGGLVMVAIA  64

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HALA F AV+ + N SGGH+NPAVTFGALVGGRIS + A+YYW+AQLLG+IVA LLL ++
Sbjct  65   HALAFFVAVSIAFNTSGGHINPAVTFGALVGGRISVIRAIYYWVAQLLGAIVASLLLWLT  124

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              GMRP GFSL +G G    ++LEI++TFGL+YTVYATAIDPKRG LGTIAPLAI FIVG
Sbjct  125  TGGMRPLGFSLGSGIGEWHAVVLEIVLTFGLVYTVYATAIDPKRGHLGTIAPLAIGFIVG  184

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            AN+  G PF GASMNPARAFGPALVGWRWR HW+YW+GPF+GAGLAGLIYEF
Sbjct  185  ANILAGGPFDGASMNPARAFGPALVGWRWRSHWVYWLGPFVGAGLAGLIYEF  236



>ref|XP_009397951.1| PREDICTED: aquaporin TIP3-1-like [Musa acuminata subsp. malaccensis]
Length=254

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 201/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            PPRR+AFGR D+A HPD+MRA LSEF++TALFVF  EG++L++ KLY+D++  A GL V+
Sbjct  2    PPRRFAFGRTDDAVHPDTMRAALSEFIATALFVFAAEGSILSLGKLYKDTST-AGGLVVV  60

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHALAL  AVA + N+SGGHVNPAVT GALVGGRIS + A++YW+AQLLG++VA LLL
Sbjct  61   AIAHALALAVAVAIAFNISGGHVNPAVTLGALVGGRISLVRAVFYWVAQLLGAVVAALLL  120

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GFS+A+G      +LLEI+MTFGL+YTVYATAIDPKRG LGTIAPLAI F
Sbjct  121  RLATGGMRPVGFSVASGVSDWHAVLLEIVMTFGLVYTVYATAIDPKRGHLGTIAPLAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I+GAN+  G PF GA+MNPARAFGPAL+GWRW++HW+YWVGPFIGA LAG++YEF
Sbjct  181  ILGANILAGGPFDGAAMNPARAFGPALIGWRWKHHWVYWVGPFIGAALAGVMYEF  235



>ref|XP_010549592.1| PREDICTED: probable aquaporin TIP3-2 [Tarenaya hassleriana]
Length=266

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 204/240 (85%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+E +ST +FVF GEG++LA+DKLY D A  +      GL
Sbjct  8    RAYGFGRADEATHPDSIRATLAELISTFVFVFAGEGSILALDKLYWDHAAHSGTNTPGGL  67

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTFGALVGGRIS + A+YYWIAQLLG+I+AC
Sbjct  68   VLVALAHALALFAAVSAAINVSGGHVNPAVTFGALVGGRISVIRAVYYWIAQLLGAILAC  127

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +  G G   GLL+EII+T+GL+YTVY+TAIDPKRGS+G IAPLA
Sbjct  128  LLLRLATNGLRPVGFHVTHGVGEVHGLLMEIILTYGLVYTVYSTAIDPKRGSIGIIAPLA  187

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  I+GAN+ VG PF GASMNPARAFGPALVGWRW+ HWIYWVGPFIG GLAGLIYE+ I
Sbjct  188  IGLILGANMLVGGPFEGASMNPARAFGPALVGWRWKNHWIYWVGPFIGGGLAGLIYEYMI  247



>ref|XP_006372278.1| aquaporin TIP-type alpha family protein [Populus trichocarpa]
 gb|ERP50075.1| aquaporin TIP-type alpha family protein [Populus trichocarpa]
Length=258

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 199/234 (85%), Gaps = 0/234 (0%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRYAFG+ADEAT PD+MRA L+E +ST +FVF GEG++LA+DKLY+ +   ASGL V+A
Sbjct  2    PRRYAFGKADEATRPDAMRAALAELVSTFIFVFAGEGSILALDKLYKGTGPPASGLLVVA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHALALF+AVASS+N+SGGHVNPAVTFG+LVGGRIS + A+ YW+AQLLGSI A LLLR
Sbjct  62   LAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVIRAVSYWVAQLLGSIFAALLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GM P GF + +  G   GLLLE+ +TFGL+YTVYATAIDPKRGSLG IAPLAI F+
Sbjct  122  LVTNGMIPAGFHVQSEVGEVHGLLLEMALTFGLVYTVYATAIDPKRGSLGIIAPLAIGFV  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+ VG PF GASMNPARAFGPALVGWRWR HWIYWVGPF+G GLA LIYE+
Sbjct  182  VGANILVGGPFDGASMNPARAFGPALVGWRWRNHWIYWVGPFLGGGLAALIYEY  235



>ref|XP_003536182.1| PREDICTED: probable aquaporin TIP-type alpha [Glycine max]
 gb|KHN14746.1| Putative aquaporin TIP-type alpha [Glycine soja]
Length=254

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 197/233 (85%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY FGR +EA+HPDS+RA L+EFLST +FVF GEG+ LA+ ++Y++    A  L V+AL
Sbjct  4    RRYEFGRMNEASHPDSIRAALAEFLSTCIFVFAGEGSALALRQIYKEPGSSAGELVVIAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAA+++S++VSGGHVNPAVTFGAL+GGRIS L A+YYW+AQLLGSIVA LLLR+
Sbjct  64   AHAFALFAAISASMHVSGGHVNPAVTFGALLGGRISVLRAVYYWVAQLLGSIVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRPQGFS++ G G   GL+LEI +TFGLMYTVYATAIDPKRGS+G+IAPLAI F+V
Sbjct  124  VTNNMRPQGFSVSIGLGAFHGLVLEIALTFGLMYTVYATAIDPKRGSIGSIAPLAIGFVV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA MNPARAFGPA+VGWRW YHWI+WVGPFIGA LA L+YE+
Sbjct  184  GANILAGGPFDGACMNPARAFGPAMVGWRWHYHWIFWVGPFIGAALAALLYEY  236



>ref|NP_177462.1| aquaporin TIP3-1 [Arabidopsis thaliana]
 sp|P26587.1|TIP31_ARATH RecName: Full=Aquaporin TIP3-1; AltName: Full=Alpha-tonoplast 
intrinsic protein; Short=Alpha-TIP; AltName: Full=Tonoplast 
intrinsic protein 3-1; Short=AtTIP3;1; Contains: RecName: Full=Aquaporin 
TIP3-1, N-terminally processed [Arabidopsis thaliana]
 gb|AAG52132.1|AC010556_14 tonoplast intrinsic protein, alpha (alpha-TIP); 45552-44536 [Arabidopsis 
thaliana]
 emb|CAA45114.1| tonoplast intrinsic protein: alpha-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32748.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAL36410.1| putative tonoplast intrinsic protein alpha-TIP [Arabidopsis thaliana]
 gb|AAM51414.1| putative tonoplast intrinsic protein alpha-TIP [Arabidopsis thaliana]
 gb|AEE35427.1| aquaporin TIP3-1 [Arabidopsis thaliana]
 prf||1908432A tonoplast intrinsic protein alpha
Length=268

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 202/238 (85%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY + A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGALVGGR++ + A+YYWIAQLLG+I+AC
Sbjct  67   ILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF LA+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLTTNGMRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG+ LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGSALAALIYEY  244



>gb|ACU18941.1| unknown [Glycine max]
Length=254

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 196/233 (84%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY FGR  EA+HPDS+RA L+EFLST +FVF GEG+ LA+ ++Y++    A  L V+AL
Sbjct  4    RRYEFGRMSEASHPDSIRAALAEFLSTCIFVFAGEGSALALRQIYKEPGSSAGELVVIAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAA+++S++VSGGHVNPAVTFGAL+GGRIS L A+YYW+AQLLGSIVA LLLR+
Sbjct  64   AHAFALFAAISASMHVSGGHVNPAVTFGALLGGRISILRAVYYWVAQLLGSIVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRPQGFS++ G G   GL+LEI +TFGLMYTVYATAIDPKRGS+G+IAPLAI F+V
Sbjct  124  VTNNMRPQGFSVSIGLGALHGLVLEIALTFGLMYTVYATAIDPKRGSIGSIAPLAIGFVV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA MNPARAFGPA+VGWRW YHWI+WVGPFIGA LA L+YE+
Sbjct  184  GANILAGGPFDGACMNPARAFGPAMVGWRWHYHWIFWVGPFIGAALAALLYEY  236



>ref|XP_002887476.1| alpha-tonoplast intrinsic protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63735.1| alpha-tonoplast intrinsic protein [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 202/238 (85%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGR+S + A+YYW+AQLLG+I+AC
Sbjct  67   ILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRLSAIRAIYYWVAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLATNGMRPVGFRVASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG+ LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGSALAALIYEY  244



>ref|XP_006599671.1| PREDICTED: probable aquaporin TIP-type alpha [Glycine max]
 gb|KHN24473.1| Putative aquaporin TIP-type alpha [Glycine soja]
Length=255

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY+FGRADEATHPDSMRATL+EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  +AL
Sbjct  4    RRYSFGRADEATHPDSMRATLAEFASTFIFVFAGEGSSLALVKIYQDSAFSAGELLAVAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV+SS++VSGGHVNPAVTFGAL+GGRIS L A+YYWIAQ+LG+IVA L+LR+
Sbjct  64   AHAFALFAAVSSSMHVSGGHVNPAVTFGALIGGRISVLRAVYYWIAQILGAIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF +  G G G  L+LEIIMTFGLMYTVY TAIDPKRGS+  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVGQGVGVGHMLILEIIMTFGLMYTVYGTAIDPKRGSVSNIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG PF GA MNPA AFGP+LVGWRW  HWI+WVGP IGA LA L+YE+
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWRWHQHWIFWVGPLIGAALAALVYEY  236



>ref|XP_006390582.1| hypothetical protein EUTSA_v10019492mg [Eutrema salsugineum]
 gb|ESQ27868.1| hypothetical protein EUTSA_v10019492mg [Eutrema salsugineum]
Length=265

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +G+RP GF LA+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLSTNGLRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN  VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANTLVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>emb|CDY66321.1| BnaCnng50290D [Brassica napus]
Length=266

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDRAAHAGTDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV+++ NVSGGHVNPAVTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAANVSGGHVNPAVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF LA+G G G+GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLTTNGMRPVGFRLASGVGAGNGLVLEIILTFGLVYVVYSTMIDPKRGSLGVIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_003534069.1| PREDICTED: probable aquaporin TIP-type alpha [Glycine max]
 gb|KHM99767.1| Putative aquaporin TIP-type alpha [Glycine soja]
Length=255

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRYAFGRADEATHPDSMRATL+EF+ST +FVF GEG+ LA+ K+Y+DSA  A  L  +AL
Sbjct  4    RRYAFGRADEATHPDSMRATLAEFVSTFIFVFAGEGSGLALVKIYQDSAFSAGELLAVAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AH  ALFAAV++S++VSGGHVNPAVTFGAL+GGRIS L A+YYWIAQ+LG+IVA L+LR+
Sbjct  64   AHGFALFAAVSASMHVSGGHVNPAVTFGALIGGRISVLRAVYYWIAQILGAIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF +  G G G  L+LEI+MTFGLMYTVY TAIDPKRG++  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVGQGVGVGHMLILEIVMTFGLMYTVYGTAIDPKRGAVSNIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG PF GA MNPA AFGP+LVGWRW  HWI+WVGP IGA LA L+YE+
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWRWHQHWIFWVGPLIGAALAALVYEY  236



>emb|CDX72962.1| BnaC06g34100D [Brassica napus]
Length=265

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 202/238 (85%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSA--LGAS---Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  +G +   GL
Sbjct  7    RTYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHVGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS +LA+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAILAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GFSLA+G    +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLATNGMRPVGFSLASGVKAHNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +  IVGAN+ +G PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA  IYEF
Sbjct  187  VGLIVGANILMGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAAFIYEF  244



>ref|XP_006301877.1| hypothetical protein CARUB_v10022350mg [Capsella rubella]
 gb|EOA34775.1| hypothetical protein CARUB_v10022350mg [Capsella rubella]
Length=265

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 201/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   ILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLATNGMRPVGFRVASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_010037056.1| PREDICTED: probable aquaporin TIP3-2 [Eucalyptus grandis]
 ref|XP_010042549.1| PREDICTED: probable aquaporin TIP3-2 [Eucalyptus grandis]
 gb|KCW48687.1| hypothetical protein EUGRSUZ_K02339 [Eucalyptus grandis]
Length=262

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 199/239 (83%), Gaps = 3/239 (1%)
 Frame = +2

Query  242  APPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR-DSALG--ASG  412
            AP R Y FGRA+EATHPDS+RATL+E LST +FVF GEG+ LA+DKLY  D+ +   AS 
Sbjct  3    APARAYVFGRANEATHPDSLRATLAELLSTFIFVFAGEGSALALDKLYPIDTGVTRPASS  62

Query  413  ltvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVA  592
            L  +ALAH LALFAAVASS+N+SGGHVNPAVT GALVGGRISF+ A+YYW+AQLLG+I+A
Sbjct  63   LIAVALAHGLALFAAVASSINISGGHVNPAVTLGALVGGRISFIRAIYYWVAQLLGAILA  122

Query  593  CLLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPL  772
             LLLR+   GMRP GF L +G G  +GLLLEI+MTFGL+YTVYATAIDPKRGSLG IAPL
Sbjct  123  SLLLRLVTAGMRPVGFILGSGVGEMNGLLLEIVMTFGLVYTVYATAIDPKRGSLGIIAPL  182

Query  773  AIAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            AI  IV AN+ VG PF GASMNPA AFGPALVGWRWR+HWIYW+GP IG  LAGLIYE+
Sbjct  183  AIGLIVAANILVGGPFDGASMNPALAFGPALVGWRWRHHWIYWLGPLIGGALAGLIYEY  241



>emb|CDX96453.1| BnaA07g30640D [Brassica napus]
Length=265

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 201/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSA--LGAS---Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  +G +   GL
Sbjct  7    RTYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHVGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +GMRP GFSLA+G    +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLSTNGMRPVGFSLASGVKAHNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +  IVGAN+ +G PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA  IYEF
Sbjct  187  VGLIVGANILMGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAAFIYEF  244



>emb|CDY11123.1| BnaC06g23750D [Brassica napus]
 emb|CDX68239.1| BnaA07g22790D [Brassica napus]
Length=265

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R YAFGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY   A  A      GL
Sbjct  7    RAYAFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWSHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +GMRP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLSTNGMRPVGFRVASGVGAVNGLILEIILTFGLVYVVYSTLIDPKRGSLGVIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  VGLIVGANILVGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAALIYEY  244



>dbj|BAO18638.1| tonoplast intrinsic protein 3;1, partial [Solanum lycopersicum]
Length=237

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = +2

Query  308  TLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalahalalfaavasslnvsGG  487
            TLSEFLST +FVF GEG+VLA+DKLY D ALGAS LT +ALAHA +LFAAVASS+NVSGG
Sbjct  1    TLSEFLSTFIFVFAGEGSVLALDKLYPDRALGASRLTAIALAHAFSLFAAVASSMNVSGG  60

Query  488  HVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWG  667
            H+NPAVTFGALVGGR+S L A+YYWI QLLG++VA  LLR++ DG+RP GF++A+G G G
Sbjct  61   HINPAVTFGALVGGRVSVLRAMYYWIGQLLGAVVASALLRLATDGLRPVGFAVASGVGNG  120

Query  668  SGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPAR  847
            + L++EI+MTFGL+YTVYATAIDPKRGSLG IAPLAIAFIVGANV VG PF GASMNPAR
Sbjct  121  NALVMEIVMTFGLVYTVYATAIDPKRGSLGIIAPLAIAFIVGANVLVGGPFEGASMNPAR  180

Query  848  AFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            AFGPALVGWRWR HWIYWVGPFIGA +AG+IYEFG+
Sbjct  181  AFGPALVGWRWRNHWIYWVGPFIGAAIAGIIYEFGL  216



>ref|XP_010471374.1| PREDICTED: aquaporin TIP3-1 [Camelina sativa]
Length=265

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 201/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY + A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWNHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLATNGLRPVGFRVASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_010476946.1| PREDICTED: probable aquaporin TIP3-2 [Camelina sativa]
Length=267

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 199/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDSMRATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSMRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G     GL++EII+TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPVGFHVASGVSELHGLVMEIILTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEY  244



>ref|XP_010459395.1| PREDICTED: probable aquaporin TIP3-2 [Camelina sativa]
Length=267

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 199/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDSMRATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSMRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTFSALIGGRISVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G     GL++EII+TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPVGFHVASGVSELHGLVMEIILTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEY  244



>gb|ACU23484.1| unknown [Glycine max]
Length=255

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY+FGRADEATHPDSMRATL+EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  +AL
Sbjct  4    RRYSFGRADEATHPDSMRATLAEFASTFIFVFAGEGSSLALVKIYQDSAFSAGELLAVAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV+SS++VSGGHVNPAVTFGAL+GGRIS L A+YYWIAQ+LG+IVA L+LR+
Sbjct  64   AHAFALFAAVSSSMHVSGGHVNPAVTFGALIGGRISVLRAVYYWIAQILGAIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF +  G G G  L+LEIIMTFGLMYTVY TAIDPKRG +  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVGQGVGVGHMLILEIIMTFGLMYTVYGTAIDPKRGFVSNIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG PF GA MNPA AFGP+LVGWRW  HWI+WVGP IGA LA L+YE+
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWRWHQHWIFWVGPLIGAALAALVYEY  236



>ref|XP_004512692.1| PREDICTED: probable aquaporin TIP-type alpha-like [Cicer arietinum]
Length=255

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRYAFGRADEATHPDS+RAT++EF ST +FVF GEG+ LA+ K+Y+DSA  A  L   AL
Sbjct  4    RRYAFGRADEATHPDSIRATIAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLATAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV++S++VSGGH+NPAVTFGAL+GGRIS L A+YYWIAQLLG++VA LLLR+
Sbjct  64   AHAFALFAAVSASMHVSGGHINPAVTFGALIGGRISVLRAVYYWIAQLLGAVVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF +  G G G  L+LEIIMTFGLMYTVYATAIDPKRG++G IAPLAI  IV
Sbjct  124  VTNNMRPAGFHVGDGIGSGHALILEIIMTFGLMYTVYATAIDPKRGTIGAIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+ VG  F GA MNPA AFGP+LVGWRW  HWI+W+GPFIGA LA +IYE+ I
Sbjct  184  GANILVGGAFDGACMNPALAFGPSLVGWRWHQHWIFWLGPFIGAALAAIIYEYVI  238



>ref|XP_010498157.1| PREDICTED: probable aquaporin TIP3-2 [Camelina sativa]
Length=267

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 199/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDSMRATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSMRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAVA+++NVSGGHVNPAVTF AL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVAAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G     GL++EII+TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPVGFHVASGVSELHGLVMEIILTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEY  244



>ref|XP_002890250.1| beta-tonoplast intrinsic protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66509.1| beta-tonoplast intrinsic protein [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 199/240 (83%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWIAQLLGAIIAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G     GL++EII+TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPIGFHVASGVSELHGLVMEIILTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN  VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANTLVGGPFDGASMNPARAFGPALVGWRWNNHWIYWVGPFIGGALAALIYEYMI  246



>gb|KFK41757.1| hypothetical protein AALP_AA2G168300 [Arabis alpina]
Length=266

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 202/238 (85%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLY--RDSALGAS---Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY   ++ +G +   GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWSHEAVVGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++N+SGGHVNPAVTFGAL+GGR+S + A+YYWIAQLLG+++AC
Sbjct  67   VLVALAHAFALFAAVSAAINISGGHVNPAVTFGALIGGRLSVIRAIYYWIAQLLGAVLAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLATNGMRPVGFRVASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>ref|NP_173223.1| beta-tonoplast intrinsic protein [Arabidopsis thaliana]
 sp|O22588.1|TIP32_ARATH RecName: Full=Probable aquaporin TIP3-2; AltName: Full=Beta-tonoplast 
intrinsic protein; Short=Beta-TIP; AltName: Full=Tonoplast 
intrinsic protein 3-2; Short=AtTIP3;2; Contains: RecName: 
Full=Probable aquaporin TIP3-2, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAF97261.1|AC034106_4 Identical to beta-tonoplast intrinsic protein (beta-TIP) from 
Arabidopsis thaliana gb|AF026275 and contains a MIP (major 
intrinsic protein) PF|00230 domain. ESTs gb|R64952, gb|AI999191 
come from this gene [Arabidopsis thaliana]
 gb|AAB84183.1| beta-tonoplast intrinsic protein [Arabidopsis thaliana]
 dbj|BAF00920.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29639.1| beta-tonoplast intrinsic protein [Arabidopsis thaliana]
Length=267

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 200/240 (83%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGRIS + A+YYW+AQL+G+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G     GLL+EII+TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPVGFHVASGVSELHGLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_010416107.1| PREDICTED: aquaporin TIP3-1-like [Camelina sativa]
Length=265

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY + A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWNHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDP RGSLG IAPLA
Sbjct  127  LLLRLATNGLRPVGFRVASGVGAVNGLVLEIILTFGLVYVVYSTLIDPTRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_006303840.1| hypothetical protein CARUB_v10012552mg [Capsella rubella]
 gb|EOA36738.1| hypothetical protein CARUB_v10012552mg [Capsella rubella]
Length=267

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 199/240 (83%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RTYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTFSALIGGRISVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A G     GL++EI++TF L+Y VY+TAIDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGLRPVGFHVAYGVSELHGLVMEIVLTFALVYVVYSTAIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANILVGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_010428229.1| PREDICTED: aquaporin TIP3-1-like [Camelina sativa]
Length=265

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEAT PDS+RATL+EFLST +FVF  EG++L++DKLY + A  A      GL
Sbjct  7    RAYGFGRADEATPPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWNHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G+RP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG IAPLA
Sbjct  127  LLLRLATNGLRPVGFRVASGVGVVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGPFSGASMNPARAFGPALVGWRWHDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_009127978.1| PREDICTED: aquaporin TIP3-1 [Brassica rapa]
 emb|CDY48045.1| BnaA02g16380D [Brassica napus]
Length=266

 Score =   293 bits (749),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 196/238 (82%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  A      GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHAGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             + ALAHA ALFAAV+++ NVSGGH NPAVTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLAALAHAFALFAAVSAAANVSGGHANPAVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +GMRP GF LA+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLATNGMRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTMIDPKRGSLGVIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  IVGAN+ VG  F+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIVGANILVGGQFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAALIYEY  244



>ref|XP_003555545.1| PREDICTED: probable aquaporin TIP-type alpha-like [Glycine max]
 gb|KHN05007.1| Putative aquaporin TIP-type alpha [Glycine soja]
Length=254

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 196/233 (84%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY FGR +EA+HPDS+RA L EFLST +FVF GEG+ LA+ ++Y++    A  L V+AL
Sbjct  4    RRYEFGRMNEASHPDSIRAALVEFLSTCIFVFAGEGSALALRQIYKEPGSSAGELVVIAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAA+++S++VSGGHVNPAVTFGAL+GGRIS L ALYYW+AQLLGSIVA LLLR+
Sbjct  64   AHAFALFAAISASMHVSGGHVNPAVTFGALLGGRISVLRALYYWVAQLLGSIVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRPQGFS++ G G   GL+LEI +TFGLMYTVYATAIDPKRGS+G+IAPLAIAF+V
Sbjct  124  VTNNMRPQGFSVSIGLGAFHGLILEIALTFGLMYTVYATAIDPKRGSIGSIAPLAIAFVV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA MNPARAFGPA+VGWRW YHWI+WVGP IGA LA L+YE+
Sbjct  184  GANILAGGPFDGACMNPARAFGPAMVGWRWHYHWIFWVGPLIGAALAALLYEY  236



>ref|XP_008437248.1| PREDICTED: probable aquaporin TIP3-2 [Cucumis melo]
Length=284

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 200/263 (76%), Gaps = 28/263 (11%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR------------  388
            PPRRYAFGRADEATHPDS+RATL+EF+ST +FVF GEG+VLA+DK++R            
Sbjct  2    PPRRYAFGRADEATHPDSIRATLAEFISTFIFVFAGEGSVLALDKIFRPADYGSYGHGSY  61

Query  389  ----------------DSALGASGltvlalahalalfaavasslnvsGGHVNPAVTFGAL  520
                            D+   AS L V+A+AHA ALF+AVA+S+N+SGGHVNPAVTFGAL
Sbjct  62   GRGGHGYGHGYGRKGADTGRAASDLVVIAIAHAFALFSAVAASINISGGHVNPAVTFGAL  121

Query  521  VGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTF  700
            +GGRIS + A +YW+AQ+LG+I+A LLLR++  GMRP GF +++G     G LLEII+TF
Sbjct  122  IGGRISLIRAFFYWVAQILGAIIASLLLRLATGGMRPMGFFVSSGVSELHGFLLEIILTF  181

Query  701  GLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPARAFGPALVGWRW  880
             L+YTVYATAIDPKRGSLGTIAPLAI  IVGAN+ VG  F GA MNPARAFGP+LVGWRW
Sbjct  182  ALVYTVYATAIDPKRGSLGTIAPLAIGLIVGANILVGGAFDGACMNPARAFGPSLVGWRW  241

Query  881  RYHWIYWVGPFIGAGLAGLIYEF  949
              HWIYW+GP +G GLA L+YE+
Sbjct  242  DNHWIYWIGPLLGGGLAALVYEY  264



>ref|XP_010248450.1| PREDICTED: aquaporin TIP3-1-like [Nelumbo nucifera]
Length=255

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALG-ASGltvla  427
            RR+A G ++EATHP+S+RATL+EF+ST +FVF GEG+VLA+ KLY    +  ASGL  +A
Sbjct  5    RRFAVGGSEEATHPESLRATLAEFVSTTMFVFAGEGSVLALGKLYGSPGVSSASGLVAVA  64

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            +AHA ALF AV+ + N+SGGHVNPAVT GALVGGRI+ L AL +W+AQLLG+IVA LLLR
Sbjct  65   VAHAFALFVAVSIASNISGGHVNPAVTLGALVGGRITLLRALLFWVAQLLGAIVAALLLR  124

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
             + D MRP GF++  G G    L+LEI+MTFGL+YTVYATAIDPKRGSLGTIAPLAI  I
Sbjct  125  FTTDDMRPVGFAVGHGIGEWHALVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPLAIGLI  184

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+  G PF GASMNPARAFGPALVGWRW+ HWIYW+GP +GA LAGL+YEF
Sbjct  185  VGANILAGGPFDGASMNPARAFGPALVGWRWKNHWIYWIGPLVGAALAGLVYEF  238



>ref|XP_009104826.1| PREDICTED: aquaporin TIP3-1-like [Brassica rapa]
Length=274

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 197/238 (83%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R YAFGRADEAT PDS+RATL+EFLS  +FVF  EG++L++DKLY   A  A      GL
Sbjct  16   RAYAFGRADEATPPDSIRATLAEFLSPFVFVFAAEGSILSLDKLYWSHAAHAGTNTPGGL  75

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNP VTFGAL+GGR+S + A+YYWIAQLLG+I+AC
Sbjct  76   VLVALAHAFALFAAVSAAINVSGGHVNPDVTFGALIGGRLSAIRAIYYWIAQLLGAILAC  135

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +GMRP GF +A+G G  +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  136  LLLRLSTNGMRPVGFRVASGVGAVNGLILEIILTFGLVYVVYSTLIDPKRGSLGVIGPLA  195

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +  IVGAN+ VG PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  196  VGLIVGANILVGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAALIYEY  253



>ref|XP_004137540.1| PREDICTED: probable aquaporin TIP3-2-like [Cucumis sativus]
 gb|KGN64227.1| hypothetical protein Csa_1G043290 [Cucumis sativus]
Length=289

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 200/268 (75%), Gaps = 33/268 (12%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR------------  388
            PPRRYAFGRADEATHPDS+RATL+EF+ST +FVF GEG+VLA+DK++R            
Sbjct  2    PPRRYAFGRADEATHPDSIRATLAEFISTFIFVFAGEGSVLALDKIFRPADYGSYGHGSY  61

Query  389  ---------------------DSALGASGltvlalahalalfaavasslnvsGGHVNPAV  505
                                 D+   AS L V+A+AHA ALF+AVA+S+N+SGGHVNPAV
Sbjct  62   GHGSYGRGGYSYGHGYGRKGTDTGRAASDLVVIAIAHAFALFSAVAASINISGGHVNPAV  121

Query  506  TFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLE  685
            TFGAL+GGRIS + A +YW+AQ+LG+I+A LLLR++  GMRP GF +++G     G LLE
Sbjct  122  TFGALIGGRISLIRAFFYWVAQILGAIIASLLLRLATGGMRPMGFFVSSGVSELHGFLLE  181

Query  686  IIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPARAFGPAL  865
            II+TF L+YTVYATAIDPKRGSLGTIAPLAI  IVGAN+ VG  F GA MNPARAFGP+L
Sbjct  182  IILTFALVYTVYATAIDPKRGSLGTIAPLAIGLIVGANILVGGAFDGACMNPARAFGPSL  241

Query  866  VGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGWRW  HWIYW+GP IG GLA L+YE+
Sbjct  242  VGWRWDNHWIYWIGPLIGGGLAALVYEY  269



>emb|CDX81850.1| BnaC08g37510D [Brassica napus]
Length=267

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 197/240 (82%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEA+HPDS+RATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RTYGFGRADEASHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAA+++++NVSGGHVNPAVTF ALVGGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAISAAINVSGGHVNPAVTFAALVGGRLSVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G RP GF +A+G     GLL+EII+TF L+Y  Y+T IDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGSRPIGFHVASGVSELHGLLMEIILTFALVYVFYSTVIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGP+LVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANMLVGGPFEGASMNPARAFGPSLVGWRWHNHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_006416665.1| hypothetical protein EUTSA_v10008480mg [Eutrema salsugineum]
 gb|ESQ35018.1| hypothetical protein EUTSA_v10008480mg [Eutrema salsugineum]
Length=267

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 196/238 (82%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RAYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVT GAL GGRIS + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAVSAAINVSGGHVNPAVTLGALFGGRISVIRAVYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G RP G+ +A+G G   GLL+EII+TF L+Y VY+T+IDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGSRPIGYHVASGVGELHGLLMEIILTFALVYVVYSTSIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I  I GAN+ VG PF GASMNPAR FGPALVGWRW  HWIYWVGPFIG  LA LIYE+
Sbjct  187  IGLIFGANMLVGGPFDGASMNPARTFGPALVGWRWHNHWIYWVGPFIGGALAALIYEY  244



>pir||T10251 membrane protein MP23 precursor - cucurbit
 dbj|BAA08107.1| MP23 precursor [Cucurbita cv. Kurokawa Amakuri]
Length=279

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 200/258 (78%), Gaps = 23/258 (9%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR------------  388
            PPRRYAFGRADEATHPDS+RATL+EF+ST +FVF GEG+VLA+DK++             
Sbjct  2    PPRRYAFGRADEATHPDSIRATLAEFISTFIFVFAGEGSVLALDKIFSPADYGSYGHGGY  61

Query  389  -----------DSALGASGltvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRI  535
                       D+  GAS L V+A+AHA ALF+AVA+S+N+SGGHVNPAVTFGAL+GGRI
Sbjct  62   SHGDGYGRRRTDTGRGASDLVVIAIAHAFALFSAVAASINISGGHVNPAVTFGALLGGRI  121

Query  536  SFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYT  715
            S +  ++YW+AQ+LG+IVA LLLR++  GMRP GF +++G     G LLEI++TF L+YT
Sbjct  122  SLIRGIFYWVAQILGAIVASLLLRLATGGMRPMGFFVSSGISEMHGFLLEIVLTFALVYT  181

Query  716  VYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWI  895
            VYATAIDPKRGSLGTIAPLAI  IVGAN+ VG  F GA MNPARAFGP+LVGWRW  HWI
Sbjct  182  VYATAIDPKRGSLGTIAPLAIGLIVGANILVGGAFDGACMNPARAFGPSLVGWRWDNHWI  241

Query  896  YWVGPFIGAGLAGLIYEF  949
            YW+GP +G GLA L+YE+
Sbjct  242  YWIGPLLGGGLAALVYEY  259



>ref|XP_009149235.1| PREDICTED: probable aquaporin TIP3-2 [Brassica rapa]
Length=267

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 196/240 (82%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGR DEATHPDS+RATL+EFLST +FVF GEG++L++DKLY D+A         GL
Sbjct  7    RTYGFGRTDEATHPDSIRATLAEFLSTFVFVFAGEGSILSLDKLYWDTAAHTGIDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF ALVGGR+S + A+YYW+AQLLG+I+AC
Sbjct  67   LLVALAHALALFAAVSAAINVSGGHVNPAVTFAALVGGRLSVIRAIYYWVAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +G RP GF +A+G     GLL+EII+TF L+Y  Y+T IDPKRGS+G IAPLA
Sbjct  127  LLLRLSTNGKRPIGFHVASGVSELHGLLMEIILTFALVYVFYSTVIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGP+LVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANMLVGGPFDGASMNPARAFGPSLVGWRWDNHWIYWVGPFIGGALAALIYEYMI  246



>emb|CDY19176.1| BnaC05g13770D [Brassica napus]
Length=267

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 196/240 (82%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF GEG++L++DKLY D+          GL
Sbjct  7    RTYGFGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILSLDKLYWDTEAHTGTDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF AL+GGR+S + A+YYW+AQLLG+I+AC
Sbjct  67   LLVALAHALALFAAVSAAINVSGGHVNPAVTFAALIGGRLSVIRAIYYWVAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +G RP GF +A+G     GLL+EII+TF L+Y  Y+T IDPKRGS+G IAPLA
Sbjct  127  LLLRLSTNGKRPIGFHVASGVSELHGLLMEIILTFALVYIFYSTVIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGP+LVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANMLVGGPFDGASMNPARAFGPSLVGWRWENHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_009117640.1| PREDICTED: probable aquaporin TIP3-2 [Brassica rapa]
 emb|CDY21731.1| BnaA09g44820D [Brassica napus]
Length=267

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 197/240 (82%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGRADEA+HPDS+RATL+EF+ST +FVF GEG++LA+DKLY D+A         GL
Sbjct  7    RTYGFGRADEASHPDSIRATLAEFVSTFVFVFAGEGSILALDKLYWDTAAHTGTDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAA+++++NVSGGHVNPAVTF ALVGGR+S + A+YYWIAQLLG+I+AC
Sbjct  67   VLVALAHALALFAAISAAINVSGGHVNPAVTFAALVGGRLSVIRAIYYWIAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR++ +G RP GF +A+G     GLL+EII+TF L+Y  Y+T IDPKRGS+G IAPLA
Sbjct  127  LLLRLATNGSRPIGFHVASGVSELHGLLMEIILTFALVYVFYSTVIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGP+LVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANMLVGGPFEGASMNPARAFGPSLVGWRWHNHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_004164504.1| PREDICTED: probable aquaporin TIP3-2-like [Cucumis sativus]
Length=328

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 200/268 (75%), Gaps = 33/268 (12%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR------------  388
            PPRRYAFGRADEATHPDS+RATL+EF+ST +FVF GEG+VLA+DK++R            
Sbjct  2    PPRRYAFGRADEATHPDSIRATLAEFISTFIFVFAGEGSVLALDKIFRPADYGSYGHGSY  61

Query  389  ---------------------DSALGASGltvlalahalalfaavasslnvsGGHVNPAV  505
                                 D+   AS L V+A+AHA ALF+AVA+S+N+SGGHVNPAV
Sbjct  62   GHGSYGRGGYSYGHGYGRKGTDTGRAASDLVVIAIAHAFALFSAVAASINISGGHVNPAV  121

Query  506  TFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLE  685
            TFGAL+GGRIS + A +YW+AQ+LG+I+A LLLR++  GMRP GF +++G     G LLE
Sbjct  122  TFGALIGGRISLIRAFFYWVAQILGAIIASLLLRLATGGMRPMGFFVSSGVSELHGFLLE  181

Query  686  IIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPARAFGPAL  865
            II+TF L+YTVYATAIDPKRGSLGTIAPLAI  IVGAN+ VG  F GA MNPARAFGP+L
Sbjct  182  IILTFALVYTVYATAIDPKRGSLGTIAPLAIGLIVGANILVGGAFDGACMNPARAFGPSL  241

Query  866  VGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGWRW  HWIYW+GP IG GLA L+YE+
Sbjct  242  VGWRWDNHWIYWIGPLIGGGLAALVYEY  269



>emb|CDY26214.1| BnaA06g12030D [Brassica napus]
Length=267

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 195/240 (81%), Gaps = 5/240 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGAS-----Gl  415
            R Y FGR DEATHPDS+RATL+EFLST +FVF GEG++L++D LY D+A         GL
Sbjct  7    RTYGFGRTDEATHPDSIRATLAEFLSTFVFVFAGEGSILSLDTLYWDTAAHTGIDTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHALALFAAV++++NVSGGHVNPAVTF ALVGGR+S + A+YYW+AQLLG+I+AC
Sbjct  67   LLVALAHALALFAAVSAAINVSGGHVNPAVTFAALVGGRLSVIRAIYYWVAQLLGAILAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +G RP GF +A+G     GLL+EII+TF L+Y  Y+T IDPKRGS+G IAPLA
Sbjct  127  LLLRLSTNGKRPIGFHVASGVSELHGLLMEIILTFALVYVFYSTVIDPKRGSIGIIAPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            I  IVGAN+ VG PF GASMNPARAFGP+LVGWRW  HWIYWVGPFIG  LA LIYE+ I
Sbjct  187  IGLIVGANMLVGGPFDGASMNPARAFGPSLVGWRWDNHWIYWVGPFIGGALAALIYEYMI  246



>ref|XP_004495487.1| PREDICTED: probable aquaporin TIP-type alpha-like [Cicer arietinum]
Length=262

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY FG  +EA H DS+RATL+E +ST +FVF GEG+ LA+ K+Y+D+   A  L VLAL
Sbjct  4    RRYTFGSLEEANHGDSIRATLAELISTCIFVFAGEGSALALTKIYKDAGSSAGELVVLAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AH+ +LFAA++S+ +VSGGHVNPAVTFGAL+GGRIS + ALYYWIAQLLGS+VA LLLR+
Sbjct  64   AHSFSLFAAISSTAHVSGGHVNPAVTFGALLGGRISVIRALYYWIAQLLGSVVAALLLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRPQ FS+A G G G  L+LEI MTFGLMYTVYATAIDPKRG++GTIAPLAI  +V
Sbjct  124  VTNNMRPQAFSVAVGVGAGQSLILEIAMTFGLMYTVYATAIDPKRGTVGTIAPLAIGLVV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+  G PF GA MNPARAFGPALVGWRW +HWIYWVGP +GA +A L+YE+ I
Sbjct  184  GANILAGGPFDGACMNPARAFGPALVGWRWHFHWIYWVGPLLGAAIAALLYEYVI  238



>ref|XP_010248431.1| PREDICTED: aquaporin TIP3-1-like [Nelumbo nucifera]
Length=259

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 189/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGA-SGltvla  427
            R++A G ++EATHPDS+RA L+EF+ST +FVF GEG+VLA+ KLY    + + SGL  +A
Sbjct  5    RKFAVGGSEEATHPDSLRAALAEFVSTTMFVFAGEGSVLALGKLYGIPGVSSGSGLVAVA  64

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHA ALF AV+ + N+SGGHVNPAVT GALVGGRI+ L AL +W+AQLLG+IVA LLLR
Sbjct  65   LAHAFALFVAVSIASNISGGHVNPAVTLGALVGGRITLLRALLFWVAQLLGAIVAALLLR  124

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
             + D MRP GF++  G G    L+LE++MTFGL+YTVYATA+DPKRG LGTIAPLAI  I
Sbjct  125  FTTDDMRPVGFAVGPGIGQLHALVLEVVMTFGLVYTVYATALDPKRGPLGTIAPLAIGLI  184

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            VGAN+  G PF GASMNPARAFGPALVGW W+ HWIYW+GP +GA LAGL+YEF
Sbjct  185  VGANILAGGPFDGASMNPARAFGPALVGWHWKNHWIYWIGPLVGAALAGLVYEF  238



>ref|XP_006848638.1| hypothetical protein AMTR_s00171p00047680 [Amborella trichopoda]
 gb|ERN10219.1| hypothetical protein AMTR_s00171p00047680 [Amborella trichopoda]
Length=254

 Score =   284 bits (727),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 190/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RR   GR +EA HPD  RA L+EF+ST +FVF GEG+VLA  K+ R+ A  A GL  +
Sbjct  2    PVRRIPIGRPEEARHPDWARALLAEFVSTFIFVFAGEGSVLAHGKISREVATPA-GLVSV  60

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA +L  AVA+ +N+SGGH+NPAVTF AL+GGRIS L A +YW+AQLLGSIVA LLL
Sbjct  61   ALAHAFSLAVAVAAGMNISGGHINPAVTFSALLGGRISLLRAFFYWVAQLLGSIVASLLL  120

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
             ++ DGMRP GFS+A+G G  + LLLEI+MTFGL+YT +ATA+DPKRG++GT+APLAI F
Sbjct  121  LLTTDGMRPFGFSVASGVGEWNALLLEIVMTFGLVYTFFATAVDPKRGTMGTMAPLAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G PF GASMNPARAFGPALVGWRW  HWIYWVGPF+GAGLAGLIYE
Sbjct  181  IVGANILAGGPFDGASMNPARAFGPALVGWRWSNHWIYWVGPFVGAGLAGLIYE  234



>pir||T10253 membrane protein MP28 - cucurbit
 dbj|BAA08108.1| MP28 [Cucurbita cv. Kurokawa Amakuri]
Length=269

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 196/247 (79%), Gaps = 12/247 (5%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYR------------  388
            PPRRYA GRADEATHPDS+RATL+EFLST +FVF GEG+VLA+DK+++            
Sbjct  2    PPRRYAVGRADEATHPDSVRATLAEFLSTFIFVFAGEGSVLALDKIFKPADYGSYGRRGG  61

Query  389  DSALGASGltvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIA  568
            D+   AS L V+A+AHA ALF+AVA+S+NVSGGHVNPAVTFG L+GGRIS + A +YW+A
Sbjct  62   DTGRTASDLVVIAIAHAFALFSAVAASINVSGGHVNPAVTFGVLLGGRISLIRAFFYWVA  121

Query  569  QLLGSIVACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRG  748
            Q+LG+IVA L+LR++  GMRP GF +++G     G LLEI++TF L+Y VYATA+DPKRG
Sbjct  122  QILGAIVASLILRLATGGMRPMGFFVSSGISELHGFLLEILLTFALVYVVYATAVDPKRG  181

Query  749  SLGTIAPLAIAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGL  928
            SL TIAPLAI  IVGAN+ VG  F GA MNPARAFGP+LVGWRW  HWIYW+GP +G GL
Sbjct  182  SLETIAPLAIGLIVGANILVGGVFDGACMNPARAFGPSLVGWRWDNHWIYWIGPLLGGGL  241

Query  929  AGLIYEF  949
            A L+YE+
Sbjct  242  AALVYEY  248



>ref|XP_002467022.1| hypothetical protein SORBIDRAFT_01g018430 [Sorghum bicolor]
 gb|EER94020.1| hypothetical protein SORBIDRAFT_01g018430 [Sorghum bicolor]
Length=266

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 194/236 (82%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLY-RDSALGASGltv  421
            P RR+  GR+++ATHPD++RA +SEF++TA+FVF  EG+VL++ K+Y  D+A  ASGL  
Sbjct  7    PGRRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYYHDTASTASGLVT  66

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
            +ALAHALAL  AVA ++NVSGGHVNPAVTFGALVGGRIS + A++YW+AQLLG++ A LL
Sbjct  67   VALAHALALAVAVAVAVNVSGGHVNPAVTFGALVGGRISLVRAVFYWVAQLLGAVAATLL  126

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            LR++  G RP GF+LA+G G    +LLE  MTFGLMY  YAT +DPKRG +GTIAPLA+ 
Sbjct  127  LRLATGGARPPGFALASGVGDWHAVLLEAAMTFGLMYAYYATVVDPKRGHVGTIAPLAVG  186

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            F++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  187  FMLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEY  242



>ref|NP_001105032.1| aquaporin TIP3-1 [Zea mays]
 sp|Q9ATL7.1|TIP31_MAIZE RecName: Full=Aquaporin TIP3-1; AltName: Full=Tonoplast intrinsic 
protein 3-1; AltName: Full=ZmTIP3-1; AltName: Full=ZmTIP3;1 
[Zea mays]
 gb|AAK26771.1| tonoplast membrane integral protein ZmTIP3-1 [Zea mays]
 gb|AFW68504.1| aquaporin TIP3-1 [Zea mays]
Length=262

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RR+  GR+++ATHPD++RA +SEF++TA+FVF  EG+VL++ K+Y D +  A GL  +
Sbjct  7    PGRRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHDMST-AGGLVAV  65

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALAL  AVA ++N+SGGHVNPAVTFGALVGGR+S + A+ YW+AQLLG++ A LLL
Sbjct  66   ALAHALALAVAVAVAVNISGGHVNPAVTFGALVGGRVSLVRAVLYWVAQLLGAVAATLLL  125

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GF+LA+G G    +LLE +MTFGLMY  YAT IDPKRG +GTIAPLA+ F
Sbjct  126  RLATGGMRPPGFALASGVGDWHAVLLEAVMTFGLMYAYYATVIDPKRGHVGTIAPLAVGF  185

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            ++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  186  LLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEY  240



>ref|XP_007152506.1| hypothetical protein PHAVU_004G136000g [Phaseolus vulgaris]
 gb|ESW24500.1| hypothetical protein PHAVU_004G136000g [Phaseolus vulgaris]
Length=256

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY+FGRADEATHPDSMRA+L+EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  LAL
Sbjct  4    RRYSFGRADEATHPDSMRASLAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLALAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV++S++VSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLGSIVA L+LR+
Sbjct  64   AHAFALFAAVSASMHVSGGHVNPAVTFGALIGGRISVIRAVYYWIAQLLGSIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF ++ G G G   +LE++MTFGLMYTVY TAIDPKRG++  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVSPGVGVGHMFILEVVMTFGLMYTVYGTAIDPKRGAVSNIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+ VG PF GA MNPA AFGP+LVGW+W  HWI+WVGP +GA LA L+YE+ +
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWQWHQHWIFWVGPLLGAALAALVYEYAV  238



>ref|XP_010933299.1| PREDICTED: aquaporin TIP3-1-like [Elaeis guineensis]
Length=248

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 193/232 (83%), Gaps = 8/232 (3%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R+AFG       PD+MRA LSEF+ TA+FVF GEG+VL+++KLY+D++  A GL ++A+A
Sbjct  6    RFAFG-------PDTMRAALSEFIGTAIFVFAGEGSVLSLEKLYKDTST-AGGLVMVAVA  57

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HALALF AV+ + N+SGGH+NPAVTFGAL+GGRIS + A+ YW+AQLLG+IVA LLLR++
Sbjct  58   HALALFVAVSIAFNISGGHINPAVTFGALIGGRISLIHAVCYWVAQLLGAIVASLLLRIT  117

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              GMRP GFSL +G G    +LLEI++TFGL+YTVYATAIDPKRG LGTIAPLAI F+VG
Sbjct  118  TGGMRPLGFSLGSGIGEWHAVLLEIVLTFGLVYTVYATAIDPKRGHLGTIAPLAIGFVVG  177

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            AN+  G PF GASMNPARAFGPALVGWRW  HW+YW+GPF+G GLAG+IYE+
Sbjct  178  ANILAGGPFDGASMNPARAFGPALVGWRWGRHWVYWLGPFVGGGLAGIIYEY  229



>ref|NP_001241721.1| aquaporin TIP3.1 [Zea mays]
 gb|ACG24116.1| aquaporin TIP3.1 [Zea mays]
Length=266

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 191/237 (81%), Gaps = 2/237 (1%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSAL--GASGlt  418
            P RR+  GR+++ATHPD++RA +SEF++TA+FVF  EG+VL++ K+Y D +    A GL 
Sbjct  9    PGRRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHDHSTISTAGGLV  68

Query  419  vlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACL  598
             +ALAHAL L  AVA ++NVSGGHVNPAVTFGALVGGR+S + A+ YW AQLLG++ A L
Sbjct  69   AVALAHALGLAVAVAVAVNVSGGHVNPAVTFGALVGGRVSLVRAVLYWAAQLLGAVAATL  128

Query  599  LLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAI  778
            LLR++  G RP GF+LA+G G G  +LLE +MTFGL+Y  YAT +DPKRG LGTIAPLA+
Sbjct  129  LLRLATGGARPPGFALASGVGDGHAVLLEAVMTFGLVYAYYATVVDPKRGHLGTIAPLAV  188

Query  779  AFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
             F++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  189  GFLLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEY  245



>ref|XP_004982756.1| PREDICTED: aquaporin TIP3-1-like [Setaria italica]
Length=262

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RR+  GR+++ATHPD++RA +SEFL+TA+FVF  EG+VL++ K+Y D +  A GL  +
Sbjct  7    PGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSVLSLGKMYHDMST-AGGLVAV  65

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHALAL  AVA ++N+SGGHVNPA+TFGAL+GGRIS + A++YW+AQLLG+I A LLL
Sbjct  66   ALAHALALSVAVAVAVNISGGHVNPAITFGALIGGRISLVRAVFYWVAQLLGAIAASLLL  125

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GF+LA+G G    +LLE  MTFGLMY  YAT IDPKRGS+GTI PLA+ F
Sbjct  126  RLATGGMRPPGFALASGVGDWHAVLLEAAMTFGLMYAYYATVIDPKRGSVGTIGPLAVGF  185

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            ++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAG+AGL+YE+
Sbjct  186  LLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGVAGLVYEY  240



>ref|NP_001064933.1| Os10g0492600 [Oryza sativa Japonica Group]
 sp|Q9FWV6.1|TIP31_ORYSJ RecName: Full=Probable aquaporin TIP3-1; AltName: Full=Tonoplast 
intrinsic protein 3-1; Short=OsTIP3;1 [Oryza sativa Japonica 
Group]
 gb|AAG13544.1|AC023240_17 putative beta-tonoplast intrinsic protein [Oryza sativa Japonica 
Group]
 gb|AAP54406.1| Aquaporin TIP3.1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAC79357.1| tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF26847.1| Os10g0492600 [Oryza sativa Japonica Group]
 gb|EAY79036.1| hypothetical protein OsI_34146 [Oryza sativa Indica Group]
 gb|EAZ16527.1| hypothetical protein OsJ_32001 [Oryza sativa Japonica Group]
 dbj|BAG99486.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 194/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RR+  GR+++ATHPD++RA +SEFL+TA+FVF  EG++L++ KLY+D +    GL  +
Sbjct  8    PGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYQDMST-PGGLVAV  66

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHALAL  AVA ++N+SGGHVNPA+TFGAL+GGR+S + AL+YW+AQLLG++VA LLL
Sbjct  67   SLAHALALAVAVAVAVNISGGHVNPAITFGALLGGRLSLIRALFYWLAQLLGAVVATLLL  126

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  GMRP GF+LA+G G    +LLE  MTFGLMY  YAT IDPKRG +GTIAPLA+ F
Sbjct  127  RLTTGGMRPPGFALASGVGDWHAVLLEATMTFGLMYAYYATVIDPKRGHVGTIAPLAVGF  186

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            ++GAN+  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  187  LLGANMLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFVGAGLAGLLYEY  241



>ref|XP_010069542.1| PREDICTED: probable aquaporin TIP3-2 [Eucalyptus grandis]
 gb|KCW57923.1| hypothetical protein EUGRSUZ_H00668 [Eucalyptus grandis]
Length=259

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 193/238 (81%), Gaps = 1/238 (0%)
 Frame = +2

Query  239  MAPP-RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGl  415
            M PP R Y   R DEATHPDS+RA L+EF ST +FVF  EG++ A+DK+Y D+    + L
Sbjct  1    MPPPVRSYVLRREDEATHPDSIRAALAEFFSTFIFVFAAEGSIFALDKMYTDTGTTVTSL  60

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALA AL+L AAVASS++VSGGH+NPA+TFGALVGGRIS + A+YYWIAQLLG+IVA 
Sbjct  61   IMIALASALSLSAAVASSIHVSGGHLNPAITFGALVGGRISLIRAIYYWIAQLLGAIVAT  120

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+   GMRP G  LA+GEG    LLLE +MTFGL+YT YATAIDPKRGSLG I PLA
Sbjct  121  LLLRLITAGMRPLGLILASGEGELRELLLEAVMTFGLVYTFYATAIDPKRGSLGIIGPLA  180

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I FI+GAN+ VG PF GASMNPARAFGPALV WRWR+HWIYW+GPFIGA LAGLIYEF
Sbjct  181  IGFILGANILVGGPFDGASMNPARAFGPALVEWRWRHHWIYWLGPFIGAALAGLIYEF  238



>tpg|DAA49507.1| TPA: aquaporin TIP3-2 [Zea mays]
Length=266

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 190/235 (81%), Gaps = 2/235 (1%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSAL--GASGltvl  424
            RR+  GR+++ATHPD++RA +SEF++TA+FVF  EG+VL++ K+Y D +    A GL  +
Sbjct  11   RRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHDHSTISTAGGLVAV  70

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL L  AVA ++NVSGGHVNPAVTFGALVGGR+S + A+ YW AQLLG++ A LLL
Sbjct  71   ALAHALGLAVAVAVAVNVSGGHVNPAVTFGALVGGRVSLVRAVLYWAAQLLGAVAATLLL  130

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  G RP GF+LA+G G G  +LLE +MTFGL+Y  YAT +DPKRG LGTIAPLA+ F
Sbjct  131  RLATGGARPPGFALASGVGDGHAVLLEAVMTFGLVYAYYATVVDPKRGHLGTIAPLAVGF  190

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            ++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  191  LLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEY  245



>ref|XP_002262978.1| PREDICTED: probable aquaporin TIP3-2 [Vitis vinifera]
Length=260

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 199/238 (84%), Gaps = 1/238 (0%)
 Frame = +2

Query  239  MAPPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRD-SALGASGl  415
            M PPRRYAFGRA+EATHPDSMRATLSE ++T +FVF GEG+VLA+ KLY   +AL    L
Sbjct  1    MMPPRRYAFGRAEEATHPDSMRATLSELVATFIFVFAGEGSVLALGKLYAGATALTVPAL  60

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAH LALFAAV++S+NVSGGHVNPAVTFGALVGGRIS L ALYYW+AQLLG+++A 
Sbjct  61   VMVALAHGLALFAAVSASINVSGGHVNPAVTFGALVGGRISLLRALYYWVAQLLGAVLAA  120

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR +  G+RP GF++A+G      +LLEI MTFGL+YTVYATAIDPKRGSLG IAPLA
Sbjct  121  LLLRFATGGLRPVGFTVASGYDEWHAMLLEIAMTFGLVYTVYATAIDPKRGSLGVIAPLA  180

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I FIVGAN+ VG  F GASMNPARAFGPALVGWRWRY W+YWVGP +G  LA LIYEF
Sbjct  181  IGFIVGANILVGGAFDGASMNPARAFGPALVGWRWRYQWVYWVGPLVGGALAALIYEF  238



>dbj|BAI66441.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 193/233 (83%), Gaps = 1/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            R +  GR+++ATHPD++RA +SEFL+TA+FVF  EG++L++ KLY D +  A GL  +AL
Sbjct  11   RGFTMGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYHDMST-AGGLVAVAL  69

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHALAL  AV+ ++N+SGGHVNPA+TFGAL+GGRI+ + AL+YWIAQLLG+IVA LLLR+
Sbjct  70   AHALALAVAVSVAVNISGGHVNPAITFGALLGGRITLVRALFYWIAQLLGAIVASLLLRL  129

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            +  GMRP GFSLA+G G    +LLE +MTFGLMY  YAT IDPKRG +GTI PLA+ F++
Sbjct  130  TTGGMRPPGFSLASGVGDWHAVLLEAVMTFGLMYAYYATLIDPKRGHVGTIGPLAVGFLL  189

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA+MNPAR FGPALVGWRWR+HW+YW+GPF+G+G+AGL+YE+
Sbjct  190  GANILAGGPFDGAAMNPARVFGPALVGWRWRHHWVYWLGPFLGSGIAGLLYEY  242



>ref|NP_001105045.1| aquaporin TIP3-2 [Zea mays]
 sp|Q9AT75.1|TIP32_MAIZE RecName: Full=Aquaporin TIP3-2; AltName: Full=Tonoplast intrinsic 
protein 3-2; AltName: Full=ZmTIP3-2; AltName: Full=ZmTIP3;2 
[Zea mays]
 gb|AAK26848.1| tonoplast membrane integral protein ZmTIP3-2 [Zea mays]
Length=266

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 189/235 (80%), Gaps = 2/235 (1%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSAL--GASGltvl  424
            RR+  GR+++ATHPD++RA +SEF++TA+FVF  EG+VL++ K+Y D +    A GL  +
Sbjct  11   RRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHDHSTISTAGGLVAV  70

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL L  AVA ++NVSGGHVNPAVTFGALVGGR+S + A+ YW AQLLG++ A LLL
Sbjct  71   ALAHALGLAVAVAVAVNVSGGHVNPAVTFGALVGGRVSLVRAVLYWAAQLLGAVAATLLL  130

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R++  G RP GF+LA+G G G  +LLE +MTFG +Y  YAT +DPKRG LGTIAPLA+ F
Sbjct  131  RLATGGARPPGFALASGVGDGHAVLLEAVMTFGFVYAYYATVVDPKRGHLGTIAPLAVGF  190

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            ++GANV  G PF GA MNPAR FGPALVGWRWR+HW+YW+GPF+GAGLAGL+YE+
Sbjct  191  LLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEY  245



>sp|P23958.1|TIPA_PHAVU RecName: Full=Probable aquaporin TIP-type alpha; AltName: Full=Alpha 
TIP; AltName: Full=Tonoplast intrinsic protein alpha 
[Phaseolus vulgaris]
 emb|CAA44669.1| tonoplast intrinsic protein [Phaseolus vulgaris]
Length=256

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY+FGR DEATHPDSMRA+L+EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  LAL
Sbjct  4    RRYSFGRTDEATHPDSMRASLAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLALAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV++S++VSGGHVNPAV+FGAL+GGRIS + A+YYWIAQLLGSIVA L+LR+
Sbjct  64   AHAFALFAAVSASMHVSGGHVNPAVSFGALIGGRISVIRAVYYWIAQLLGSIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF ++ G G G   +LE++MTFGLMYTVY TAIDPKRG++  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVSPGVGVGHMFILEVVMTFGLMYTVYGTAIDPKRGAVSYIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+ VG PF GA MNPA AFGP+LVGW+W  HWI+WVGP +GA LA L+YE+ +
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWQWHQHWIFWVGPLLGAALAALVYEYAV  238



>gb|AGV54386.1| aquaporin TIP-type alpha-like protein [Phaseolus vulgaris]
Length=256

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RRY+FGR DEATHPDSMRA+L+EF ST +FVF GEG+ LA+ K+Y+DSA  A  L  LAL
Sbjct  4    RRYSFGRTDEATHPDSMRASLAEFASTFIFVFAGEGSGLALVKIYQDSAFSAGELLALAL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA ALFAAV++S++VSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLGSIVA L+LR+
Sbjct  64   AHAFALFAAVSASMHVSGGHVNPAVTFGALIGGRISVIRAVYYWIAQLLGSIVAALVLRL  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              + MRP GF ++ G G G   +L ++MTFGLMYTVY TAIDPKRG++  IAPLAI  IV
Sbjct  124  VTNNMRPSGFHVSPGVGVGHMFILXVVMTFGLMYTVYGTAIDPKRGAVSNIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+ VG PF GA MNPA AFGP+LVGW+W  HWI+WVGP +GA LA L+YE+ +
Sbjct  184  GANILVGGPFDGACMNPALAFGPSLVGWQWHQHWIFWVGPLLGAALAALVYEYAV  238



>emb|CBI26397.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRD-SALGASGltv  421
            PPRRYAFGRA+EATHPDSMRATLSE ++T +FVF GEG+VLA+ KLY   +AL    L +
Sbjct  2    PPRRYAFGRAEEATHPDSMRATLSELVATFIFVFAGEGSVLALGKLYAGATALTVPALVM  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
            +ALAH LALFAAV++S+NVSGGHVNPAVTFGALVGGRIS L ALYYW+AQLLG+++A LL
Sbjct  62   VALAHGLALFAAVSASINVSGGHVNPAVTFGALVGGRISLLRALYYWVAQLLGAVLAALL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            LR +  G+RP GF++A+G      +LLEI MTFGL+YTVYATAIDPKRGSLG IAPLAI 
Sbjct  122  LRFATGGLRPVGFTVASGYDEWHAMLLEIAMTFGLVYTVYATAIDPKRGSLGVIAPLAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+ VG  F GASMNPARAFGPALVGWRWRY W+YWVGP +G  LA LIYEF
Sbjct  182  FIVGANILVGGAFDGASMNPARAFGPALVGWRWRYQWVYWVGPLVGGALAALIYEF  237



>dbj|BAL14718.1| tonoplast intrinsic protein 3;1 [Triticum aestivum]
Length=263

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            R    GR+++ATHPD++RA +SEFL+TA+FVF  EG++L++ KLY D +  A GL  +AL
Sbjct  11   RGXTMGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYHDMST-AGGLVAVAL  69

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHALAL  AV+ ++N+SGGHV+PA+TFGAL+GGRI+ + AL+YWIAQLLG+IVA LLLR+
Sbjct  70   AHALALAVAVSVTVNISGGHVBPAITFGALLGGRITLVRALFYWIAQLLGAIVASLLLRL  129

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            +  GMRP GFSLA+G G    +LLE +MTFGLMY  YAT IDPKRG +GTI PLA+ F++
Sbjct  130  TTGGMRPPGFSLASGVGDWHAVLLEAVMTFGLMYAYYATLIDPKRGHVGTIGPLAVGFLL  189

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA+MNPAR FGPALVGWRWR+HW+YW+GPF+G+G+AGL+YE+
Sbjct  190  GANILAGGPFDGAAMNPARVFGPALVGWRWRHHWVYWLGPFLGSGIAGLLYEY  242



>gb|EMT18736.1| Putative aquaporin TIP3-1 [Aegilops tauschii]
Length=249

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  263  FGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalahal  442
             GR+++ATHPD++RA +SEFL+TA+FVF  EG++L++ KLY D +  A GL  +ALAHAL
Sbjct  1    MGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYHDMST-AGGLVAVALAHAL  59

Query  443  alfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDG  622
            AL  AV+ ++N+SGGHVNPA+TFGAL+GGRI+ + AL+YWIAQLLG++VA LLLR++  G
Sbjct  60   ALAVAVSVAVNISGGHVNPAITFGALLGGRITLVRALFYWIAQLLGALVASLLLRLTTGG  119

Query  623  MRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANV  802
            MRP GFSLA+G G    +LLE +MTFGLMY  YAT IDPKRG +GTI PLA+ F++GAN+
Sbjct  120  MRPPGFSLASGVGDWHAVLLEAVMTFGLMYAYYATLIDPKRGHVGTIGPLAVGFLLGANI  179

Query  803  FVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
              G PF GA+MNPAR FGPALVGWRWR+HW+YW+GPF+G+GLAGL+YE+
Sbjct  180  LAGGPFDGAAMNPARVFGPALVGWRWRHHWVYWLGPFLGSGLAGLLYEY  228



>ref|XP_003574110.1| PREDICTED: aquaporin TIP3-1 [Brachypodium distachyon]
Length=265

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            R +  GR+++ATHPD++RA +SEFL+TA+FVF  EG++L++ KLY D +  A GL  +AL
Sbjct  12   RGFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYHDMST-AGGLVAVAL  70

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHALAL  AV+ ++N+SGGHVNPA+TFGAL+GGRI+ + AL+YW+AQLLG+IVA LLLR+
Sbjct  71   AHALALAVAVSVAVNISGGHVNPAITFGALLGGRITLVRALFYWVAQLLGAIVASLLLRL  130

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            +  GMRP GFSLAAG      +LLE +MTFGLMY  YAT +DPKRGS+GTI PLA+ F++
Sbjct  131  TTGGMRPPGFSLAAGVRDWHAVLLEAVMTFGLMYAYYATVMDPKRGSVGTIGPLAVGFLL  190

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G PF GA MNPAR FGPALVGWRW +HW+YWVGPF+GAG+AGL+YE+
Sbjct  191  GANMLAGGPFDGAGMNPARVFGPALVGWRWGHHWVYWVGPFLGAGIAGLLYEY  243



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 178/235 (76%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD+++A L+EF+ST +FVF G G+ +A  KL    A   +GL   
Sbjct  2    PISRIAIGRREEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   AIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  GM    FSL+ G G G+ L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFTTGGMEIGAFSLSNGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPALV W W  HW+YWVGP IG GLAGLIYEF
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPALVSWAWSNHWVYWVGPLIGGGLAGLIYEF  236



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 178/235 (76%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD+++A L+EF+ST +FVF G G+ +A  KL    A   +GL   
Sbjct  2    PISRIAIGRTEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   AIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  GM    FSL+ G G G+ L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFTTGGMEIGAFSLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGP IG GLAGLIYEF
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPAVVSWTWNNHWVYWVGPLIGGGLAGLIYEF  236



>emb|CAB39758.1| major intrinsic protein [Picea abies]
Length=253

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P RR A GRA+EATHPDS+RA L+EF ST +FVF GEG+V+A  KL    +   SGL  +
Sbjct  2    PVRRIALGRAEEATHPDSIRAALAEFFSTLIFVFAGEGSVMAYAKLTGGDSTTPSGLVAV  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL LF AVA ++N+SGGHVNPAVTFGAL+GG IS L  + YWIAQLLG++VA LLL
Sbjct  62   ALAHALGLFVAVAVAINISGGHVNPAVTFGALMGGHISILRGILYWIAQLLGAVVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +G     F++++G G  + ++LEI+MTFGL+YTVYATAID KRGSLGTIAPLAI F
Sbjct  122  KFTTNGRSTSPFAVSSGVGSWNAVVLEIVMTFGLVYTVYATAIDAKRGSLGTIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPARAFGPALV  +WRYHWIYWVGP IG G AGL+YE+
Sbjct  182  IVGANILAGGAFDGASMNPARAFGPALVSGKWRYHWIYWVGPLIGGGFAGLLYEW  236



>ref|XP_010042457.1| PREDICTED: probable aquaporin TIP3-2 [Eucalyptus grandis]
Length=257

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            R Y   R DEATHPDS+RA L+EF ST +FVF  EG++ A+DK+Y D+    + L ++AL
Sbjct  7    RSYVLRREDEATHPDSIRAALAEFFSTFIFVFAAEGSIFALDKMYTDTGTTVTSLIMIAL  66

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            A AL+L AAVASS++VSGGH+NPA+TFGALVGGRIS + A+YYWIAQLLG+IVA LLLR+
Sbjct  67   ASALSLSAAVASSIHVSGGHLNPAITFGALVGGRISLIRAIYYWIAQLLGAIVATLLLRL  126

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
                 RP G  LA+GEG    LLLE +MTFGL+YT YATAIDPKRGSLG I PLAI FI+
Sbjct  127  I---TRPLGLILASGEGELRELLLEAVMTFGLVYTFYATAIDPKRGSLGIIGPLAIGFIL  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            GAN+ VG PF GASMNPARAFGPALV WRWR+HWIYW+GPFIGA LAGLIYEF +
Sbjct  184  GANILVGGPFDGASMNPARAFGPALVEWRWRHHWIYWLGPFIGAALAGLIYEFMV  238



>ref|XP_009105968.1| PREDICTED: aquaporin TIP3-1-like [Brassica rapa]
Length=265

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 201/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSA--LGAS---Gl  415
            R Y FGRADEATHPDS+RATL+EFLST +FVF  EG++L++DKLY D A  +G +   GL
Sbjct  7    RTYGFGRADEATHPDSLRATLAEFLSTFVFVFAAEGSILSLDKLYWDHAAHVGTNTPGGL  66

Query  416  tvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVAC  595
             ++ALAHA ALFAAV++++NVSGGHVNPAVTFGAL+GGRIS + A+YYWIAQLLG+++AC
Sbjct  67   VLVALAHAFALFAAVSAAINVSGGHVNPAVTFGALIGGRISAIRAIYYWIAQLLGALLAC  126

Query  596  LLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLA  775
            LLLR+S +GMRP GFSLA+G    +GL+LEII+TFGL+Y VY+T IDPKRGSLG I PLA
Sbjct  127  LLLRLSTNGMRPVGFSLASGVKAHNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIGPLA  186

Query  776  IAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +  IVGAN+ +G PF+GASMNPARAFGPALVGWRW  HWIYWVGPFIG  LA  IYEF
Sbjct  187  VGLIVGANILMGGPFSGASMNPARAFGPALVGWRWDDHWIYWVGPFIGGALAAFIYEF  244



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 177/235 (75%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  + GR +EATHPD++RA L+EF+ T +FVF G G+ +A +KL  D A   SGL   
Sbjct  2    PIRNISVGRPEEATHPDALRAALAEFICTLIFVFAGSGSGMAFNKLTNDGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL+AG G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFTTGGLAVPAFSLSAGVGTLNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+F G  FTGASMNPA AFGPA+V W W  HWIYW GP +G G+AG++YEF
Sbjct  182  IVGANIFAGGAFTGASMNPAVAFGPAVVSWSWAGHWIYWAGPLVGGGIAGIVYEF  236



>gb|ABK22410.1| unknown [Picea sitchensis]
Length=255

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 180/234 (77%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P +R A GRADEA HPD++RA L+EF+S  +FVF GEG+V+A  KL  D +   +GL   
Sbjct  4    PFQRVAVGRADEAYHPDTLRAALAEFISAIIFVFAGEGSVIAFSKLSDDGSTTPAGLVAE  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH +ALF AVA + N+SGGHVNPAVTFGALVGG I+ +  ++YWIAQ+LG+ VAC LL
Sbjct  64   ALAHGIALFIAVAVASNISGGHVNPAVTFGALVGGHITLVRGIFYWIAQMLGATVACGLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +GM    FSL++G G G+ L+ EI+MTFGL+YTVYATAIDP RG+LGTIAP+ I F
Sbjct  124  KYTTNGMSIGVFSLSSGVGLGNALVFEIVMTFGLVYTVYATAIDPNRGTLGTIAPICIGF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GA MNPARAFGPALV W W+ HWI+WVGP IG GLAG I+E
Sbjct  184  IVGANILAGGAFDGACMNPARAFGPALVSWTWKNHWIFWVGPLIGGGLAGAIFE  237



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 176/235 (75%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD++RA L+EF+ST +FVF GEG+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AVA   N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VACLLL
Sbjct  62   SVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +   +G     F+L++G G  + ++ EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YWVGP IG GLAG++YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEF  236



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 176/235 (75%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD++RA L+EF+ST +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PINRIAVGRPEEATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G    +  +LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWENHWVYWAGPLIGGGLAGLVYEF  236



>ref|XP_004143284.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN48203.1| hypothetical protein Csa_6G448110 [Cucumis sativus]
Length=250

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 179/235 (76%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST +FVF G+G+ +A +KL  D A   +GL   
Sbjct  2    PIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFNKLTNDGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +  + G+    F+L+AG G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KF-VTGLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  FTGASMNPA AFGP++V W W  HWIYW GP IG GLAGLIYEF
Sbjct  181  IVGANILAGGAFTGASMNPAVAFGPSVVSWSWESHWIYWAGPLIGGGLAGLIYEF  235



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRTDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP IG G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYE  235



>ref|XP_004168293.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1-like [Cucumis 
sativus]
Length=250

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 178/235 (76%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST  FVF G+G+ +A +KL  D A   +GL   
Sbjct  2    PIRNIAIGRPEEATHPDALKAGLAEFISTLXFVFAGQGSGIAFNKLTNDGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +  + G+    F+L+AG G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KF-VTGLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  FTGASMNPA AFGP++V W W  HWIYW GP IG GLAGLIYEF
Sbjct  181  IVGANILAGGAFTGASMNPAVAFGPSVVSWSWESHWIYWAGPLIGGGLAGLIYEF  235



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +   +    F L++G G  + L+ EI+MTFGL+YTVYATA+DPK+GSLGTIAPLAI F
Sbjct  122  KFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HWIYWVGP IG GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEF  236



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G G  +  + EI+MTFGL+YTVYATAIDPK+GSLGTIAP+AI F
Sbjct  122  KFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEF  236



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 178/235 (76%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR  EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PIRNIAVGRPAEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +GM    FSL++G G  +  +LEI+MTFGL+YTVYATAIDPK+GSLGTIAP+AI F
Sbjct  122  KFATNGMTTSAFSLSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG G+AGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWANHWVYWAGPLIGGGIAGLVYEF  236



>gb|ABK22242.1| unknown [Picea sitchensis]
Length=258

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 177/234 (76%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P +R   GRADE  HPD++RA L+EF+S  +FVF GEG+V+A  KL  D +   +GL   
Sbjct  4    PFQRVEVGRADETYHPDTLRAALAEFISAIIFVFAGEGSVIAFSKLSHDGSTTPAGLVAE  63

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH +ALF AVA + N+SGGHVNPAVTFGALVGG I+ +  ++YWIAQ+LG+ VAC LL
Sbjct  64   ALAHGIALFIAVAVASNISGGHVNPAVTFGALVGGHITLVRGIFYWIAQMLGATVACGLL  123

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +GM    FSL++G G G+ L+ EI+MTFGL+YTVYATAIDP R SLGTIAP+ I F
Sbjct  124  KYTTNGMSIGVFSLSSGVGLGNALVFEIVMTFGLVYTVYATAIDPNRCSLGTIAPICIGF  183

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GA MNPARAFGPALV W W+ HWI+WVGP IG GLAG ++E
Sbjct  184  IVGANILAGGAFDGACMNPARAFGPALVSWTWKNHWIFWVGPLIGGGLAGAVFE  237



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAVGRPDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYE  235



>ref|NP_001284655.1| aquaporin TIP1-1 [Cucumis melo]
 gb|AGW99230.1| aquaporin TIP1-1 [Cucumis melo]
Length=250

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 177/235 (75%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST +FVF G+G+ +A  KL  D A   +GL   
Sbjct  2    PIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFSKLTNDGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +  + G+    F L+AG G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KF-VTGLPTGSFGLSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  FTGASMNPA AFGP++V W W  HW+YW GP IG GLAGLIYEF
Sbjct  181  IVGANILAGGAFTGASMNPAVAFGPSVVSWSWESHWVYWAGPLIGGGLAGLIYEF  235



>ref|XP_009411359.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + A GR +EATHP +++A L+EF+ T +FVF G+G+ +A +KL  D A   +GL   
Sbjct  2    PFSQIAIGRPEEATHPSALKAALAEFICTLIFVFAGQGSGMAYNKLTSDGAATPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH  ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L+    W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGLETGTFGLSGVSAW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG PF+GASMNPA +FGPALV W W + WIYW+GP IG GLAG++YEF
Sbjct  181  IVGANILVGGPFSGASMNPAVSFGPALVSWSWTHQWIYWLGPLIGGGLAGIVYEF  235



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G G  +  + EI+MTFGL+YTVYATAIDPK+GSLGTIAP+AI F
Sbjct  122  KFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA  FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVPFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEF  236



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 175/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  D A   SG+   
Sbjct  2    PINRIAVGTREEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTGDGAATPSGVISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGSIVACLLL
Sbjct  62   AIAHAFALFVAVSIGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSIVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S +GM    FSL++G    +  + EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFSTNGMSTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATALDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW GP IG GLAGL+YE 
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWAGPLIGGGLAGLVYEL  236



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GRADEAT PD+++A L+EF+ST +FVF G G+ +A +KL  +     SGL   
Sbjct  2    PIRNIAVGRADEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGGTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGA++  G  F+GASMNPA AFGPA+V W W  HW+YW GP IG G+AGLIYE
Sbjct  182  IVGADILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYE  235



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD+++A L+EF+ST +FVF G G+ +A  KL    A   +GL   
Sbjct  2    PISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VAC LL
Sbjct  62   AIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+ G G G+ L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFTTGGLEIGTFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW GP IG GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWNNHWVYWAGPLIGGGLAGLIYEF  236



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRPDEATRPDALRAALAEFISTMIFVFAGSGSGMAFNKLTDNGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +V+  G+    F L+AG G  +  + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KVATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAVDPKAGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYE 
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWDWTNHWVYWAGPLVGGGLAGLIYEL  236



>ref|XP_008350342.1| PREDICTED: aquaporin TIP1-1-like [Malus domestica]
Length=252

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL  D+A   SGL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV  S N+SGGHVNPAVTFGA +GG IS L  L YWIAQLLG+ VAC LL
Sbjct  62   ALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            ++  +G     FSL+ G G  +  + EI+MTFGL+YTVYATAIDPK+GS+GTIAP+AI F
Sbjct  122  KLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IGAG+AG+IYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEF  236



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD+++A L+EF ST +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PVSRIAVGRPEEATHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTSNGSATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            AL+HA ALF AV+   N+SGGHVNPAVTFGA VGG I+    + YWIAQLLGS VACLLL
Sbjct  62   ALSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G    +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFATGGLTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPALV W W+ HW+YWVGP IG GLAG++YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWKNHWVYWVGPLIGGGLAGIVYE  235



>gb|AEQ29861.1| aquaporin TIP1 [Malus prunifolia]
Length=252

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL  D+A   SGL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTVDAATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV  S N+SGGHVNPAVTFGA +GG IS L  L YWIAQLLG+ VAC LL
Sbjct  62   ALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            ++  +G     FSL+ G G  +  + EI+MTFGL+YTVYATAIDPK+GS+GTIAP+AI F
Sbjct  122  KLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IGAG+AG+IYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEF  236



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EAT PD+++A L+EF+ST +FVF GEG+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGAATPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEF  236



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAVGRPEEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYE  235



>ref|XP_004304478.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 175/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P +  A GR ++A HPD+++A L+EF+ST +FVF GEG+ +A +KL  D A   +GL   
Sbjct  2    PIQNIAVGRPEDAYHPDALKAGLAEFISTLIFVFAGEGSGMAFNKLTDDGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+ + N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +   +G     F+L++G G  +  + EI+MTFGL+YTVYATA+DPKRGS+GTIAP+AI F
Sbjct  122  KFVTNGQTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKRGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEF  236



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +EATHPD+++A L+EF+ST +FVF G G+ +A  KL    A   +GL   
Sbjct  2    PISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   AIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+ G G G+ L+LEI+MTFGL+YTVYATA+DP +GSLGTIAP+AI F
Sbjct  122  KFTTGGLEIGAFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPNKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW GP IG GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWANHWVYWAGPLIGGGLAGLVYEF  236



>ref|XP_009349744.1| PREDICTED: aquaporin TIP1-1-like [Pyrus x bretschneideri]
Length=252

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL  D+A   +GL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+ S N+SGGHVNPAVTFGA +GG IS L  + YWIAQLLG+ VAC LL
Sbjct  62   ALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +   +G     FSL++G G  +  + EI+MTFGL+YTVYATAIDPK GS+GTIAP+AI F
Sbjct  122  KFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKNGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W+ HW+YW GP IGAGLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWQNHWVYWAGPLIGAGLAGLIYEF  236



>ref|XP_008387528.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Malus domestica]
Length=252

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL  D+A   SGL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV  S N+SGGHVNPAVTFGA +GG IS L  L YWIAQLLG+ VAC LL
Sbjct  62   ALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            ++  +G     FSL+ G G  +  + EI+MTFGL+YTVYATAIDPK+GS+GTIAP+AI F
Sbjct  122  KLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IGAG AG+IYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGXAGVIYEF  236



>dbj|BAB12722.1| gamma tonoplast intrinsic protein [Pyrus communis]
Length=252

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL  D+A   +GL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+ S N+SGGHVNPAVTFGA +GG IS L  + YWIAQLLG+ VAC LL
Sbjct  62   ALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +   +G     FSL++G G  +  + EI+MTFGL+YTVYATAIDPK GS+GTIAP+AI F
Sbjct  122  KFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKNGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IGAGLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGLAGLIYEF  236



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G  +EAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAVGSPNEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYE  235



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R    GR +EATHPD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIPVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +   +    F L++G G  + L+ EI+MTFGL+YTVYATA+DPK+GSLGTIAPLAI F
Sbjct  122  KFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            I GAN+  G  F GASMNPA +FGPALV W W  HWIYWVGP IG GLAGLIYEF
Sbjct  182  IEGANILAGGAFDGASMNPAVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEF  236



>gb|ACX37451.1| tonoplast intrinsic protein [Hevea brasiliensis]
Length=252

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD+++A L+EF+ST +FVF GEG+ +A  KL  + A   +GL   
Sbjct  2    PIRNIAVGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFSKLTNNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+   GF+L++G G  +  + EI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  KFSTGGLTTAGFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAG++YE 
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWAGPLIGGGLAGVVYEL  236



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AH L LF AV+   N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VACLLL
Sbjct  62   SIAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +   M    F L++G G  + ++ EI+MTFGL+YTVYATAIDPK+G LG IAPLAI F
Sbjct  122  KFATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGDLGVIAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HWIYW+GP IG GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEF  236



>gb|KFK33580.1| hypothetical protein AALP_AA5G032300 [Arabis alpina]
Length=253

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 174/236 (74%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTENGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGAL+GG I+ L  + YWIAQLLGS+VAC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGALLGGNITLLRGILYWIAQLLGSVVACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L AG G  + L+LEI+MTFGL+YTVYATAIDPK GSLGTIAP+AI 
Sbjct  122  LQFATGGLPVPAFGLGAGVGSLNALVLEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G PF+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIY+F
Sbjct  182  FIVGANILAGGPFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYDF  237



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EAT PD+++A L+EF+ST +FVF GEG+ +A +KL  +     SGL   
Sbjct  2    PIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGVATPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YW AQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G G  +  + EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  KFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEF  236



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRPEEATKPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQL GS+VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLAGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_009129499.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
 emb|CDY48983.1| BnaA02g28130D [Brassica napus]
 emb|CDY28539.1| BnaC02g36210D [Brassica napus]
Length=253

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 174/236 (74%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  L YWIAQLLGS+VAC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+AG G  +GL+ EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI 
Sbjct  122  LQFATGGLAVPAFGLSAGVGTLNGLVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HWIYWVGP +G GLAG+IY+F
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWSWSNHWIYWVGPLVGGGLAGIIYDF  237



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   AVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_007202475.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
 gb|EMJ03674.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
Length=252

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EA HPD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGRPEEAYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH   LF AV+ S N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VAC LL
Sbjct  62   ALAHGFGLFVAVSVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R + +      F+L+ G G  +  + EI+MTFGL+YTVYATAIDPKRGS+GTIAP+AI F
Sbjct  122  RFATNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAIDPKRGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +VGAN+  G  F GASMNPA +FGPALV W W  HWIYW GP IG GLAGLIYEF
Sbjct  182  VVGANILAGGAFDGASMNPAVSFGPALVSWNWHNHWIYWAGPLIGGGLAGLIYEF  236



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  AFGR +EAT PD+++A  +EF+ T +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PIRNIAFGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SG HVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGXHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S +GM    FSL++G    +  + EI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  KFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYE  235



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 174/234 (74%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GRA+EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  +++   +GL   
Sbjct  2    PISRIAIGRAEEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNASTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLG++VAC LL
Sbjct  62   SLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGAVVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+    W +  + EI+MTFGL+YTVYATAIDPK+GSLG IAP+AI F
Sbjct  122  KFATGGLTTSAFGLSGVSVW-NAFVFEIVMTFGLVYTVYATAIDPKKGSLGIIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  FTGASMNPA +FGPA+V W W  HW+YW GP IG GLAGLIYE
Sbjct  181  IVGANILAGGAFTGASMNPAVSFGPAVVSWSWDSHWVYWAGPLIGGGLAGLIYE  234



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST +FVF G G+ +A +KL    A   +GL   
Sbjct  2    PIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH  ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L++G G  +  + EI+MTFGL+YTVYATA+DPKRG+LG IAPLAI  
Sbjct  122  KFATSGLGVPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAVDPKRGNLGVIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGGGLAGLVYEF  236



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   AVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPPFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>ref|XP_011077300.1| PREDICTED: aquaporin TIP1-1 [Sesamum indicum]
Length=252

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R   GR +EAT PD+++A L+EF+ST LFV+ GEG+ +A +KL  D A   +GL   
Sbjct  2    PISRITVGRTEEATRPDALKAALAEFISTLLFVYAGEGSGMAFNKLTSDGAATPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+ + N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLG++VACLLL
Sbjct  62   AVAHAFALFVAVSIAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGAVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G    +  + E +MTFGL+YTVYATA+DPKRGSLGTIAP+AI F
Sbjct  122  KFTTGGLTTSAFALSSGVSVWNAFIFETVMTFGLVYTVYATAVDPKRGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW GP +G GLAGL+YE 
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWDNHWVYWAGPLVGGGLAGLVYEL  236



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EA HPD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PFRNIAVGRPEEAAHPDALKAALAEFISTLIFVFAGSGSSMAYNKLTDNGASTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LA+  ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAYGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +G+    F L++G G  +  + EI+MTFGL+YTVYATA+DPK+GS+G IAPLAI  
Sbjct  122  KFATNGLSIPAFGLSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSVGVIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W+ HW+YW GP IG G+AGL+YEF
Sbjct  182  IVGANILAGGAFEGASMNPAVSFGPALVSWTWKNHWVYWAGPLIGGGIAGLVYEF  236



>dbj|BAD04010.1| tonoplast intrinsic protein [Prunus persica]
Length=252

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EA HPD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGRPEEAYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH   LF AV+ S N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VAC LL
Sbjct  62   ALAHGFGLFVAVSVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R + +      F+L+ G G  +  + EI+MTFGL+YTVYATAIDPKRGS+GTIAP+AI F
Sbjct  122  RFAPNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAIDPKRGSVGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            +VGAN+  G  F GASMNPA +FGPALV W W  HWIYW GP IG GLAGLIYEF
Sbjct  182  VVGANILAGGAFDGASMNPAVSFGPALVSWNWHNHWIYWAGPLIGGGLAGLIYEF  236



>gb|AFN53695.1| putative tonoplast intrinsic protein [Linum usitatissimum]
Length=426

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 192/246 (78%), Gaps = 12/246 (5%)
 Frame = +2

Query  248  PRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvla  427
            PRRY FGRADEA HPDSMRAT++E +ST +FVF GEG+VLA+DKLY+++   ASGL ++A
Sbjct  2    PRRYEFGRADEAIHPDSMRATIAELVSTFIFVFAGEGSVLALDKLYKETGPPASGLVMIA  61

Query  428  lahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLR  607
            LAHALALFAAVA+S+NVSGGHVNPAVTFG LVGGRIS + A+YYWIAQLLGSIVA LLLR
Sbjct  62   LAHALALFAAVAASINVSGGHVNPAVTFGCLVGGRISVVRAIYYWIAQLLGSIVASLLLR  121

Query  608  VSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            +  +GMRP GF + +G G   GL+LEI++TFGL+Y VYATAIDPKRGS+G +APLAI  +
Sbjct  122  LVTNGMRPVGFYVTSGVGEMHGLILEIVLTFGLVYVVYATAIDPKRGSIGIMAPLAIGLV  181

Query  788  VGANVFVGAPFTGASMNPARAFGPALVG-WRWR-YHWIYW----------VGPFIGAGLA  931
            VGAN+ VG PF GA+MNPARAFGP+L    RW  Y+  +W              + +GLA
Sbjct  182  VGANILVGGPFDGAAMNPARAFGPSLGRLLRWNTYNHFHWNISEEIIRETADAMVSSGLA  241

Query  932  GLIYEF  949
             L Y++
Sbjct  242  ALGYQY  247



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 171/233 (73%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            R  A GR +EAT PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   ++
Sbjct  4    RNIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAASI  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AH L LF AV+   N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VACLLL+ 
Sbjct  64   AHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKF  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            +   M    F L++G G  + ++ EI+MTFGL+YTVYATAIDPK+G LG IAPLAI FIV
Sbjct  124  ATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+  G  F GASMNPA +FGPALV W W  HWIYW+GP IG GLAGLIYEF
Sbjct  184  GANILAGGAFDGASMNPAVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEF  236



>ref|XP_010502579.1| PREDICTED: aquaporin TIP1-2 [Camelina sativa]
Length=253

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 170/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G    E THPD++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+ AC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G     F L+AG G  +GL+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEF  237



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT PD+++A  +EF+ T +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PTRNIAIGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N SGGHVNPAVT GA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHAFALFVAVSVGANTSGGHVNPAVTSGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S +GM    FSL++G    +  + EI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  KFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYE  235



>ref|XP_010425366.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 170/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G    E THPD++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AVA   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+ AC L
Sbjct  62   AALAHAFGLFVAVAVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G     F L+AG G  +GL+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEF  237



>gb|AHA84270.1| nodulin-26 [Phaseolus vulgaris]
Length=250

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 176/234 (75%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT+PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA  LF AV+   N+SGGHVNPAVTFGA +GG I+FL  + Y IAQLLGS+VA LLL
Sbjct  62   SIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
                    P  F L+AG G G+ L+LEI+MTFGL+YTVYATAIDPKRGSLGTIAP+AI F
Sbjct  122  AFVTSSTVPA-FGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ +G  F+GA+MNPA  FGPA+V W W  +WIYWVGPFIG GLAGLIYE
Sbjct  181  IVGANILLGGAFSGAAMNPAVTFGPAVVSWTWTNNWIYWVGPFIGGGLAGLIYE  234



>gb|AAD39372.1|AF118381_1 tonoplast intrinsic protein [Brassica napus]
Length=253

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 172/236 (73%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  L YWIAQLLGS+VACLL
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACLL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+AG    +G + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HWIYW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEF  237



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G  +EATHPD+++A L+EF+ST +FVF G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAIGGREEATHPDALKAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VA LLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVAALLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +    G+    F+L+AG G  + ++ EI++TFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFVTGGLAVPTFNLSAGVGVWNAVVFEIVITFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+    PF GASMNPA +FGPALV W W  HW+YWVGP IG GLAGLIYEF
Sbjct  182  IVGANILAAGPFDGASMNPAVSFGPALVSWSWSNHWVYWVGPLIGGGLAGLIYEF  236



>gb|AAF82790.1|AF275315_1 water-selective transport intrinsic membrane protein 1 [Lotus 
japonicus]
Length=251

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 176/234 (75%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD++R+ L+EF+ST +FVF G G+ +A +KL  D A   +GL   
Sbjct  2    PIRNIAIGAPQEATHPDTLRSALAEFISTFIFVFAGSGSGIAYNKLTDDGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+ S N+SGGHVNPAVTFG  VGG ISFL  + Y IAQLLGSIVA LLL
Sbjct  62   SIAHAFALFVAVSISANISGGHVNPAVTFGLFVGGNISFLRGVIYIIAQLLGSIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
               + G+    F L+AG G G+ L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  AF-VTGLAVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ +G  F GASMNPA +FGPA+V W W  HWIYWVGP +G G+AGLIYE
Sbjct  181  IVGANILLGGAFDGASMNPAVSFGPAVVSWSWSNHWIYWVGPLVGGGIAGLIYE  234



>dbj|BAA12711.1| VM23 [Raphanus sativus]
 emb|CDY13639.1| BnaA06g32840D [Brassica napus]
Length=253

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 172/236 (73%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLL
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+AG    +G + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HWIYW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEF  237



>ref|XP_002316308.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|ABK94058.1| unknown [Populus trichocarpa]
 gb|EEF02479.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 177/234 (76%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R AFG   EA+HPD++RA L+EF+S  +FVF G G+ +A +KL  +++   SGL   
Sbjct  2    PINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGAL+GG I+ L ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L++G G  + L+ EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAALVYD  235



>emb|CDX83623.1| BnaC07g23630D [Brassica napus]
Length=253

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 171/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFGRAD-EATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G    E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQGEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLL
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+AG    +G + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HWIYW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEF  237



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD+++A L+EF ST +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PIRNIAVGRPEETYHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G    +  +LEI+MTFGL+YTVYATAIDPK+G++G +AP+AI F
Sbjct  122  KFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAIDPKKGNIGIVAPMAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGLIYE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWAGPLIGGGLAGLIYE  235



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 177/234 (76%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R AFG   EA+HPD++RA L+EF+S  +FVF G G+ +A +KL  +++   SGL   
Sbjct  2    PINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGAL+GG I+ L ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGALMGGNITLLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L++G G  + L+ EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAALVYD  235



>gb|AFQ23566.1| aquaporin TIP1 [Hedychium coronarium]
Length=249

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 172/234 (74%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +E THP +++A ++EF+ST +FVF G+G+ +A +KL  D A   +GL   
Sbjct  2    PISRIAIGTTEEVTHPTTLKAAVAEFISTLIFVFAGQGSGIAFNKLTSDGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AH   LF AVA   N+SGGHVNPAVTFG  VGG I+   A++YWIAQLLGS VACLLL
Sbjct  62   SIAHGFGLFVAVAVGANISGGHVNPAVTFGVFVGGNITLFRAIWYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R +  G+    F L+ G G    ++LEI+MTFGL+YTVYATA+DPK+G+LGTIAP+AI F
Sbjct  122  RFT-TGLATGTFGLSTGVGVWQAVVLEIVMTFGLVYTVYATAVDPKKGTLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA AFGPALV W W + WIYWVGP IG G+AG++YE
Sbjct  181  IVGANILVGGAFDGASMNPAIAFGPALVSWSWTHQWIYWVGPLIGGGIAGVVYE  234



>gb|ADE76384.1| unknown [Picea sitchensis]
Length=253

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E THPD+++A L+E +ST +FVF GEG+ +A  KL  D++   +GL  +
Sbjct  2    PFRGLAVGRPEEVTHPDTLKAALAEGISTLIFVFAGEGSGMAFAKLTGDASSTPAGLVAV  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH LALF AVA S N+SGGHVNPAVTFGALVGG I+ L  + YW+ QL+G+ VACLLL
Sbjct  62   ALAHGLALFVAVAVSANISGGHVNPAVTFGALVGGHITLLRGILYWLVQLIGATVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
              +  G+    FSL++G G G+ L+ EI+MTFGL+YTVYATAIDPK+G+L TIAPL I F
Sbjct  122  DFTTGGLSTTAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAIDPKKGTLATIAPLCIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IV AN+  G  F GASMNPARAFGPALV W    HWIYWVGP IG GLAG +YE 
Sbjct  182  IVSANILAGGAFDGASMNPARAFGPALVSWTRENHWIYWVGPLIGGGLAGFVYEL  236



>ref|XP_007162793.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
 gb|AFW90515.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54305.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54392.1| nodulin-26 [Phaseolus vulgaris]
 gb|AGV54457.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|AHA84233.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|ESW34787.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
Length=250

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 175/234 (75%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EAT+PD+++A L+EF+ST +FVF G G+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA  LF AV+   N+SGGHVNPAVTFGA +GG I+FL  + Y IAQLLGS+VA LLL
Sbjct  62   SIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
                    P  F L+AG G G+ L+LEI+MTFGL+YTVYATAIDPKRGSLGTIAP+AI F
Sbjct  122  AFVTSSTVPA-FGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ +G  F+GA+MNPA  FGPA+V W W  +WIYWVGP IG GLAGLIYE
Sbjct  181  IVGANILLGGAFSGAAMNPAVTFGPAVVSWTWTNNWIYWVGPLIGGGLAGLIYE  234



>ref|XP_009382161.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 169/234 (72%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + A G   EATHP +++A L+EF+ T +FVF G+G+ +A +KL  D A    GL   
Sbjct  2    PITQIAIGTTAEATHPTALKAALAEFICTFIFVFAGQGSGMAYNKLTSDGAATPEGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH  ALF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGLETGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG PF GASMNPA +FGPALV W W + W+YW+GP IG  LAG++YE
Sbjct  181  IVGANILVGGPFDGASMNPAVSFGPALVSWSWTHQWVYWLGPLIGGALAGIVYE  234



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = +2

Query  260  AFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalaha  439
            AFG   EA  PD+++A L+EF+S  +FVF GEG+ +A +KL  D A   +GL   +LAH 
Sbjct  7    AFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTSDGATTPAGLVAASLAHG  66

Query  440  lalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLD  619
             ALF AV+   N+SGGHVNPAVTFGA VGG I+F+ ++ YWIAQLLGS+VACLLL+ S  
Sbjct  67   FALFVAVSVGANISGGHVNPAVTFGAFVGGHITFIRSILYWIAQLLGSVVACLLLKFSTG  126

Query  620  GMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGAN  799
            G+    F+L++G G  + ++ EI+MTFGL+YTVYATA+DPK+G++G IAPLAI FIVGAN
Sbjct  127  GLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPLAIGFIVGAN  186

Query  800  VFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            +  G  F GASMNPA +FGPA+V W W  HW+YW+GPF+GAG+A ++YE
Sbjct  187  ILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFVGAGIAAIVYE  235



>ref|XP_010514297.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G    E THPD++RA L+EF+ST +FVF G G+ +A +KL    A   SGL  
Sbjct  2    PTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAYNKLTNYGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+ AC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G     F L+AG G  +GL+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGLAGLIYEF  237



>ref|XP_008801219.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +EATHP +++A L+EF+ST +FVF G+G+ +A  KL    A   +GL   
Sbjct  2    PISRIAIGTREEATHPSALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+ + N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHAFGLFVAVSVAANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   L+LEI+MTFGL+YTVYATA+DPKRGSLGTIAP+AI F
Sbjct  122  RFSTGGLSTGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATALDPKRGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGANV  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YE 
Sbjct  181  IVGANVLAGGAFDGASMNPAVSFGPALVSWSWDAHWVYWAGPLIGGGLAGLVYEL  235



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 177/234 (76%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPDS+RA L+EF+ST +FVF G G+ +A +KL   ++   +GL   
Sbjct  2    PINRIAVGTPGEASHPDSLRAALAEFISTLIFVFAGSGSGMAFNKLTDSASTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGAL+GG I+ L ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F L++G G  + ++ EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIGAG+A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAGIAALVYD  235



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EAT PD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G G  +  +LEI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLIYEF  236



>ref|XP_009152050.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
Length=253

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 171/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VACLL
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+AG    +G + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G   +GASMNPA AFGPA+V W W  HWIYW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGASSGASMNPAVAFGPAVVSWTWTNHWIYWAGPLVGGGLAGLIYEF  237



>ref|XP_010911210.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +EATHP ++RA L+E +ST +FVF G+G+ +A  KL   S+   +GL   
Sbjct  2    PISRIAIGTREEATHPSALRAALAELISTLIFVFAGQGSGMAFSKLTGGSSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+ + N+SGGHVNPAVTFGA VGG I+ L  + YW AQLLGS +AC LL
Sbjct  62   SLAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTIACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   L+LEI+MTFGL+YTVYATA+DPKRG+LGTIAP+AI F
Sbjct  122  RFSTGGLSTGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATAVDPKRGNLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YWVGP IG GLAGL+YEF
Sbjct  181  IVGANILAGGAFDGASMNPAVSFGPALVSWSWSDHWVYWVGPLIGGGLAGLVYEF  235



>gb|KDP43963.1| hypothetical protein JCGZ_05430 [Jatropha curcas]
Length=254

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 0/224 (0%)
 Frame = +2

Query  275  DEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalahalalfa  454
            ++ THP +++A L+EF+STA+FVF GEG+ +A +KL  D +   +G+ + +LAHA  LF 
Sbjct  15   EDITHPGAIKAALAEFISTAIFVFAGEGSGMAFNKLTDDGSSTPAGIIMASLAHAFGLFI  74

Query  455  avasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQ  634
             VA++ N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL+ S  GM   
Sbjct  75   GVATAANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTHGMTTS  134

Query  635  GFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGA  814
             F+L++G    + L+ EI+MTFGL+YTVYATAIDP++G LGTIAP+AI FIVGANV  G 
Sbjct  135  AFALSSGVNVWNALVFEIVMTFGLVYTVYATAIDPRKGQLGTIAPIAIGFIVGANVLAGG  194

Query  815  PFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
             F GASMNPA +FGPALV W W +HW+YW GP IG GLAGLIYE
Sbjct  195  AFEGASMNPAVSFGPALVSWDWTHHWVYWAGPLIGGGLAGLIYE  238



>gb|AFQ98316.1| MIP6 [Eutrema halophilum]
Length=253

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 170/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VAC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI 
Sbjct  122  LTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEF  237



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EAT PD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G G  +  +LEI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLVGGGLAGLIYEF  236



>ref|XP_006395549.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
 gb|ESQ32835.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
Length=253

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 170/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VAC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI 
Sbjct  122  LTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAGLIYEF
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEF  237



>gb|AAT65835.2| tonoplast intrinsic protein gamma [Salicornia herbacea]
Length=254

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 174/236 (74%), Gaps = 2/236 (1%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  ++A HP++++A L+EF+ST +FV+ G+G+ +A  KL   +A   +GL   
Sbjct  2    PINRIAVGTTEDARHPNTLKAGLAEFISTLIFVYAGQGSGMAFAKLTAGAANTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A++H  ALF AVA   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   AISHGFALFVAVAVGANISGGHVNPAVTFGAFIGGNITLLNGIVYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEG-WGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            + S  G++   F+L  GE  WG+  ++EI+MTFGL+YTVYATA+DPK+G++G IAPLAI 
Sbjct  122  KFSTGGLQTSAFALCEGETVWGA-FVMEIVMTFGLVYTVYATALDPKKGNIGIIAPLAIG  180

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
             IVGAN+  G  F GASMNPA +FGPALV W W  HWIYW GP IGAG+AGLIYEF
Sbjct  181  LIVGANILAGGAFDGASMNPAVSFGPALVSWNWANHWIYWAGPLIGAGIAGLIYEF  236



>ref|NP_001237062.1| uncharacterized protein LOC100527509 [Glycine max]
 gb|ACU16605.1| unknown [Glycine max]
Length=249

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 175/237 (74%), Gaps = 1/237 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+EF+ST +FVF G G+ +A ++L  + A   +GL   
Sbjct  2    PIRNIAVGRPEEATHPDTLKAALAEFISTFIFVFAGSGSGIAYNRLTDNGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+FL  + Y IAQLLGSIVA LLL
Sbjct  62   SIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITFLRGIVYVIAQLLGSIVASLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
                    P  F L+AG G G+ L+LEI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  AFVTASTVPA-FGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEFGI  955
            IVGAN+ +G  F+GA+MNPA  FGPA+V W W  HWIYW GP IG G+AGL+YE  +
Sbjct  181  IVGANILLGGAFSGAAMNPAVTFGPAVVSWTWTNHWIYWAGPLIGGGIAGLVYELSL  237



>emb|CAC85291.1| putative tonoplast intrinsic protein [Posidonia oceanica]
Length=250

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 173/235 (74%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A GR +E TH D+++ATL+EF+ST +FVF GEG+ +A + L  D    AS L   
Sbjct  2    PFSRIAMGRREEVTHGDALKATLAEFISTLIFVFAGEGSGIAYNNLSGDGDTTASSLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH L LF AV+   N+SGGHVNPAVTFGA VGG I+FL  + YW  QLLGSIVACLLL
Sbjct  62   ALAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNITFLRGILYWHGQLLGSIVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +    GM   GF+++    W + L+ EI+MTFGL+YTVYATAIDPK+G++GTIAPLAI  
Sbjct  122  KFVTGGMTTGGFAVSGVSVW-NALVFEIVMTFGLVYTVYATAIDPKKGAIGTIAPLAIGL  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IV AN+FVG  FTGASMNPA AFGPALV W W  HWIYWVGP +GA +AG++Y+ 
Sbjct  181  IVAANIFVGGVFTGASMNPAVAFGPALVSWNWVNHWIYWVGPLVGAAIAGIVYQL  235



>ref|XP_011022886.1| PREDICTED: aquaporin TIP1-3 [Populus euphratica]
Length=252

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 176/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPDS+RA L+EF+S  +FVF G G+ +A +KL   ++   +GL   
Sbjct  2    PINRIAVGTPGEASHPDSLRAALAEFISMLIFVFAGSGSGMAFNKLTDSASTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGAL+GG I+ L ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F L++G G  + ++ EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIGAG+A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAGIAALVYD  235



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 173/235 (74%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +EATHP +++A L+EF+ST +FVF G+G+ +A  KL   +A   +GL   
Sbjct  2    PIPRIAVGTQEEATHPGTLKAALAEFISTLIFVFAGQGSGMAFSKLTGGAATTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFG  +GG I+ L ++ YWIAQLLGS VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGVFIGGNITLLRSIIYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F+L+    W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RYSTGGLSTGSFALSGVSVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YEF
Sbjct  181  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDDHWVYWAGPLIGGGLAGLVYEF  235



>ref|XP_011018806.1| PREDICTED: aquaporin TIP1-1 [Populus euphratica]
Length=252

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EAT PD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGHYHEATRPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G    +  +LEI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFTTGGLETSAFALSSGVSVWNAFVLEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLIYEF  236



>gb|ABK23010.1| unknown [Picea sitchensis]
Length=253

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 179/235 (76%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +EATHPD+++A L+E +ST +FVF GEG+ +A DKL  D++   +GL  +
Sbjct  2    PFRGIAVGRPEEATHPDALKAALAEGISTLIFVFAGEGSGMAFDKLTNDASTTPAGLVAV  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHAL LF AVA   N+SGGHVNPAVTFGA VGG I+ L  + YW AQL+G+ VACLLL
Sbjct  62   ALAHALGLFVAVAVGANISGGHVNPAVTFGAFVGGHITLLRGILYWFAQLIGATVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G G G+ ++ EI+MTFGL+YTVYATAIDPK+GSLGTIAP+ I F
Sbjct  122  KFTTGGLSTSAFSLSSGVGVGNAVVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPICIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPARAFGPALV W W  HWIYWVGP +G GLAG+IYE 
Sbjct  182  IVGANILAGGAFDGASMNPARAFGPALVSWTWENHWIYWVGPLLGGGLAGVIYEL  236



>gb|AHW81522.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-c]
 gb|AHW81534.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-n]
Length=494

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR DEAT PD+++A L+EF+ST +FV  G G+ +A +KL  + A   SGL   
Sbjct  2    PIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACL+L
Sbjct  62   AVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLIL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F L+AG G  +  + EI+MTFGL+YTVYATAIDPK GSLGTIAP+AI F
Sbjct  122  KFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G G+AGLIYE
Sbjct  182  IVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYE  235



>gb|AFU51578.1| aquaporin [Gladiolus hybrid cultivar]
Length=259

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 173/241 (72%), Gaps = 7/241 (3%)
 Frame = +2

Query  245  PPR------RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGA  406
            PPR      R A G  +EA HP +++A  +EF+ST +FVF G+G+ +A  KL  D    A
Sbjct  5    PPRITEFQARIAVGHREEAWHPGTIKAAFAEFISTVIFVFAGQGSGMAYAKLTNDGVTTA  64

Query  407  SGltvlalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSI  586
            +GL V A+AHA  LF AV+ S N+SGGHVNPAVTFGA +GG I+F   L Y IAQLLGS 
Sbjct  65   AGLIVAAVAHAFGLFVAVSVSANISGGHVNPAVTFGAFLGGHITFFRGLVYIIAQLLGST  124

Query  587  VACLLLRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIA  766
            V+CLLLR    G+    FSL+    W  GL+LEI+MTFGL+YTVYATA+DPK GSLGTIA
Sbjct  125  VSCLLLRFCTGGLATGSFSLSGVSVW-EGLVLEIVMTFGLVYTVYATALDPKNGSLGTIA  183

Query  767  PLAIAFIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            P+AI FIVGAN+ VG  F+GASMNPA +FGPALV W W  HW+YW GP IG GLAG+IYE
Sbjct  184  PIAIGFIVGANILVGGAFSGASMNPAVSFGPALVSWSWSNHWVYWAGPLIGGGLAGIIYE  243

Query  947  F  949
             
Sbjct  244  L  244



>ref|XP_010696310.1| PREDICTED: probable aquaporin TIP1-2 [Beta vulgaris subsp. vulgaris]
Length=254

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R + G  DEA HPD++R+ L+EF+ST +FVF G+G+ +A  KL   +A   +GL   
Sbjct  2    PISRISVGTPDEARHPDTLRSGLAEFISTLIFVFAGQGSGMAFAKLTEGAANTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AVA   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+ AC LL
Sbjct  62   SIAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNITLLNGIVYWIAQLLGSVAACALL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+ A      + L++EI+MTFGL+YTVYATAIDPK+G++G IAPLAI  
Sbjct  122  KFATGGLETAAFACATDVSAWNALVMEIVMTFGLVYTVYATAIDPKKGNIGIIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA++ W W  HWIYWVGP IGAG+AGLIYEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVMSWNWTNHWIYWVGPLIGAGIAGLIYEF  236



>ref|XP_006436063.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 ref|XP_006486051.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|ESR49303.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 gb|KDO67730.1| hypothetical protein CISIN_1g025464mg [Citrus sinensis]
Length=252

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 173/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPD+++A L+EF S  +FVF G+G+ +A  KL    A   +GL   
Sbjct  2    PIYRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA VGG I+ L ++ YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G    + ++ EI+MTFGL+YTVYATA+DPK+G+LGTIAP+AI F
Sbjct  122  KFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIGA +A ++Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAAIVYD  235



>ref|XP_002465859.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
 gb|EER92857.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
Length=250

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   E  HP +++A L+EF+ST +FVF G+G+ +A  KL    A   SGL   
Sbjct  2    PISRIAVGTHHEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTSGGATTPSGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+    L YW+AQLLGS VAC LL
Sbjct  62   AVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   +++EI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGLATGTFGLTGVSVW-EAVVMEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  FTGASMNPA +FGPALV W W Y W+YWVGP IG GLAG+IYE 
Sbjct  181  IVGANILVGGAFTGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYEL  235



>gb|KDP29873.1| hypothetical protein JCGZ_18448 [Jatropha curcas]
Length=252

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 171/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD++RA L+EF S  +FVF GEG+ +A +KL  D +   +GL   
Sbjct  2    PITRIAIGNPGEASQPDALRAALAEFFSMVIFVFAGEGSGMAFNKLTSDGSSTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G    + ++ EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KYATGGLETSAFALSSGVSAWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YWVGP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPLIGAAIAALVYD  235



>ref|XP_009337569.1| PREDICTED: aquaporin TIP1-3 [Pyrus x bretschneideri]
Length=252

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPD++RA L+EF S  +FVF GEG+ +A +KL  +++   SGL   
Sbjct  2    PINRIAVGTPGEASHPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G    GFSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G++G +AP+AI  
Sbjct  122  KFATGGWETAGFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGIVAPIAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW GP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWTHHWVYWAGPLIGAAIAALVYD  235



>emb|CDP00041.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPD+++A  +EF ST +FVF GEG+ +A++KL  +    ASGL   
Sbjct  2    PIYRIAIGTPGEASHPDALKAAAAEFFSTLIFVFAGEGSGMALNKLTNNGPQTASGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A++HA ALF AV+   N+SGGHVNPAVTFGAL+GG I+ L ++ YWIAQLLGS VACLLL
Sbjct  62   AISHAYALFVAVSIGANISGGHVNPAVTFGALIGGNITLLRSISYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +++  G+    F+L++G   G+ L+LE +MTFGL+YTVYATA+DPK+G++G +APLAI F
Sbjct  122  KLATGGLETPAFTLSSGVSVGNALVLEAVMTFGLVYTVYATAVDPKKGNIGVVAPLAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGPA+V   W + W+YW GP +GA +A L+Y+
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPAVVSGVWTHQWVYWAGPMLGAAIAALVYD  235



>ref|XP_010933183.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 166/235 (71%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  DEATHP +++A  +EF+ST +FVF G+G+ +A  KL    +   +GL   
Sbjct  2    PISRIAIGTRDEATHPSALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS  ACLLL
Sbjct  62   SLAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTAACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R    G+    F L     W    +LEI+MTFGL+YTVYATA+DPKRGSLGTIAP+AI F
Sbjct  122  RFCTGGLATGTFGLTGVTVW-EAFVLEIVMTFGLVYTVYATAVDPKRGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YEF
Sbjct  181  IVGANILVGGAFDGASMNPAVSFGPALVSWSWDDHWVYWGGPLIGGGLAGLVYEF  235



>ref|XP_010669827.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA HPD+++A L+EF S  +FVF G+G+ +A  +L  +    ++G+   
Sbjct  2    PLYRMAMGSPGEAGHPDALKAALAEFFSMIIFVFAGQGSGMAFSRLKDNGTSPSTGVIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA  L  AV+   N+SGGHVNPAVTFGA VGG I+FL A+ YWI QLLGS+VAC LL
Sbjct  62   SLAHAFGLIVAVSVGANISGGHVNPAVTFGAFVGGHITFLRAILYWIGQLLGSVVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
              +  GM    F+L+ G    + L+ EI+MTFGL+YTVYA A+DPK+G+LGTIAP+AI F
Sbjct  122  HFATGGMEVSAFALSGGVTSWNALVFEIVMTFGLVYTVYALAVDPKKGNLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G PF GASMNPA +FGPA+V W W +HW+YW+GPFIGA LA +IY+
Sbjct  182  IVGANILAGGPFDGASMNPAVSFGPAVVSWTWTHHWVYWLGPFIGAALAAIIYD  235



>gb|AAB17284.1| tonoplast intrinsic protein [Mesembryanthemum crystallinum]
Length=253

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 173/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  + GRA+EA HP++++  L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRDISVGRAEEAAHPETLKQALAEFISTLIFVFAGEGSGMAFAKLTAGAAATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ++AHA ALF AV+   N+SGGHVNPAVTFGA +GG IS L  + YWIAQL GS VACLLL
Sbjct  62   SVAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNISLLRGIVYWIAQLAGSSVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L+A     + L+ EI+MTFGL+YTVYATAID KRG+LG IAP+AI F
Sbjct  122  KFATGGLETSAFALSADVTVWNALVFEIVMTFGLVYTVYATAIDHKRGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  FTGASMNPA +FGPALV W W  HW+YWVGP IG GLAG+IYE
Sbjct  182  IVGANILVGGAFTGASMNPAVSFGPALVSWTWNNHWVYWVGPLIGGGLAGVIYE  235



>gb|AHJ09607.1| aquaporin protein 26 [Camellia sinensis]
Length=258

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 170/233 (73%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RR A G  +EATHP +++A L+EF+ST +FVF G+G+ +A +K+   S    SGL   A+
Sbjct  11   RRIAVGNREEATHPAALKAALAEFISTLIFVFAGQGSGMAFNKITHSSFTTPSGLIAAAI  70

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA  LF AVA S N+SGGHVNPAVTFGA +GG I+ L  L YWIAQLLGS+VACLLL+ 
Sbjct  71   AHAFGLFVAVAISANISGGHVNPAVTFGACLGGHITILRGLLYWIAQLLGSVVACLLLKF  130

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              +GM    F L++G    +G ++EI++TFGL+YTVYATA+D K+G LG IAPLAI  IV
Sbjct  131  VTNGMTTTAFGLSSGLNVWNGFVMEIVLTFGLVYTVYATALDSKKGELGIIAPLAIGLIV  190

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG  F GASMNPA +FGPA+V W W  HWIYW GP IG+ LA +IYE 
Sbjct  191  GANILVGGAFDGASMNPAVSFGPAVVSWSWDNHWIYWAGPLIGSALAAIIYEL  243



>gb|AJA04408.1| tonoplast intrinsic protein [Chorispora bungeana]
Length=252

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E THP ++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS+VAC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGVLYWIAQLLGSVVACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L+ +  G+    F L+ G G  +  + EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LQFATGGLPVPAFGLSEGVGSLNAFVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAG+IYE
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWSNHWVYWAGPLVGGGLAGVIYE  236



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 170/235 (72%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   E T PD+++A L+EF+ST +FVF GEG+ +A  KL   ++   +GL   
Sbjct  2    PIRNIAVGHYHETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+    + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGVLYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +    G+    F+L++G G  +  +LEI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  KFVTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGLIYE 
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPALVSWSWTNHWVYWAGPLIGGGLAGLIYEL  236



>ref|XP_010422715.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=252

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 169/232 (73%), Gaps = 0/232 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            S  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  IV
Sbjct  124  STGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            GAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGAG+A ++Y+
Sbjct  184  GANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAGIAAIVYD  235



>gb|AHI54565.1| tonoplastic intrinsic protein [Camellia japonica]
Length=258

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 170/233 (73%), Gaps = 0/233 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
            RR A G  +EATHP +++A L+EF+ST +FVF G+G+ +A +K+   S    SGL   A+
Sbjct  11   RRIAVGNREEATHPAALKAALAEFISTLIFVFAGQGSGMAFNKITHTSFTTPSGLIAAAI  70

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            AHA  LF AVA S N+SGGHVNPAVTFGA +GG I+ L  L YWIAQLLGS+VACLLL+ 
Sbjct  71   AHAFGLFVAVAISANISGGHVNPAVTFGACLGGHITILRGLLYWIAQLLGSVVACLLLKF  130

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
              +GM    F L++G    +G ++EI++TFGL+YTVYATA+D K+G LG IAPLAI  IV
Sbjct  131  VTNGMTTTAFGLSSGVNVWNGFVMEIVLTFGLVYTVYATALDSKKGELGIIAPLAIGLIV  190

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            GAN+ VG  F GASMNPA +FGPA+V W W  HWIYW GP IG+ LA +IYE 
Sbjct  191  GANILVGGAFDGASMNPAVSFGPAVVSWSWDDHWIYWAGPLIGSALAAIIYEL  243



>gb|ABK25915.1| unknown [Picea sitchensis]
Length=253

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 177/235 (75%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E THP +++A L+E +ST +FVF GEG+ +A  KL  D++   +GL  +
Sbjct  2    PFRGVAIGRPEEVTHPTALKAALAELISTLIFVFAGEGSGMAFAKLTSDASTTPAGLVAV  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH L LF AVA   N+SGGHVNPAVTFGALVGG I+ L  + YWIAQL+G+ VACLLL
Sbjct  62   ALAHGLGLFVAVAVGANISGGHVNPAVTFGALVGGHITLLRGILYWIAQLIGATVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G G G+ L+ EI+MTFGL+YTVYATAIDPK+G+LGTIAP+ I F
Sbjct  122  KYTTGGLSTSAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAIDPKKGTLGTIAPICIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPARAFGPALV W W  HWIYWVGP +G GLAG+IYE 
Sbjct  182  IVGANILAGGAFDGASMNPARAFGPALVSWTWENHWIYWVGPLLGGGLAGVIYEL  236



>ref|XP_006286822.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
 gb|EOA19720.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
Length=252

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 169/232 (73%), Gaps = 0/232 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            S  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  IV
Sbjct  124  STGGMETSAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            GAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGAG+A ++Y+
Sbjct  184  GANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAGIAAIVYD  235



>gb|ACB71282.1| tonoplast intrinsic protein [Tamarix hispida]
Length=252

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   +A HPD++RA L+EF+S  +FVF GEG+ +A +KL  D +   +GL   
Sbjct  2    PIRNIAVGSPADARHPDALRAALAEFISVLIFVFAGEGSGMAFNKLTDDGSATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAH  ALF AV+   N+SGGHVNPAVTFGA +GG IS L ++ YWIAQ LGS+VACLLL
Sbjct  62   ALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRSILYWIAQCLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++     + L+LEI+MTFGL+YTVYATA+DPK+G++G IAP+AI F
Sbjct  122  KFATGGLTTSAFALSSDVTVWNALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPMAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPA+V W W   W+YW+GPF+GAG+A LIYE 
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPAVVSWSWDDPWVYWLGPFLGAGIAALIYEL  236



>ref|XP_008241379.1| PREDICTED: aquaporin TIP1-1 [Prunus mume]
Length=252

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 166/233 (71%), Gaps = 0/233 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A GR +E  HPD++RA L+EF+ST +FVF GEG+ +A  KL   +A   +GL   
Sbjct  2    PIRNIAVGRPEETYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH   LF  VA S N+SGGHVNPAVTFGA VGG IS L  + YWIAQLLGS VAC LL
Sbjct  62   SLAHGFGLFVGVAVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +      F+L+ G G  +  + EI+MTFGL+YTVYATAIDPKRGS+GTIAP+AI  
Sbjct  122  KFATNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAIDPKRGSVGTIAPIAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIY  943
            +VGANV  G  F GASMNPA +FGPALV W W  HW+YW GP IG G+AGLIY
Sbjct  182  VVGANVLAGGAFDGASMNPAVSFGPALVSWSWHNHWVYWAGPLIGGGVAGLIY  234



>ref|XP_009421351.1| PREDICTED: probable aquaporin TIP1-2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 172/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P    A G   EA+HPD+++A+L+EF+ST +FVF GEG+ +A +KL  D +   +GL   
Sbjct  2    PIGSIAIGAPGEASHPDTIKASLAEFISTLIFVFAGEGSGMAFNKLTNDGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH  ALF AV+   N+SGGHVNPAVTFGA +GG IS +  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHGFALFVAVSVGANISGGHVNPAVTFGAFLGGNISLIRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +++  G+    FSL++     + ++ EI+MTFGL+YTVYATA+DP++G LG IAP+AI F
Sbjct  122  KLATGGLETSAFSLSSDVSVWNAVVFEIVMTFGLVYTVYATAVDPRKGDLGVIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YWVGP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWVGPLIGAAIAALVYD  235



>dbj|BAM44345.1| vacuolar aluminum transporter [Hydrangea macrophylla]
Length=252

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + A G   EA++PD++RA L+EF S  +FVF GEG+ +A +K+  +S+   SGL   
Sbjct  2    PIYKIAIGTPGEASNPDALRAALAEFFSMLIFVFAGEGSGMAFNKITNNSSTTPSGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+FL ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITFLRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++     + L+ EI+MTFGL+YTVYA A+DPK+G+LG IAP+AI F
Sbjct  122  KFATGGLETSAFALSSNVSVWNALVFEIVMTFGLVYTVYALAVDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F G SMNPA +FGPA+V W W +HW+YW+GP IGA +A LIY+
Sbjct  182  IVGANILVGGAFDGGSMNPAVSFGPAVVSWTWTHHWVYWLGPMIGAAIAALIYD  235



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G + E    D+++A L+EF+S  +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +L+HA ALF AV+   N+SGGHVNPAVTFGA VGG I+   ++ YWIAQLLGS+VACLLL
Sbjct  62   SLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L+ G   G+ L+ EI+MTFGL+YTVYATA+DPK+G LG IAP+AI F
Sbjct  122  KFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGDLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YWVGPF GA +A ++YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAIVYE  235



>ref|XP_008788358.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=414

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R A G  +EATHP++++A L+EF+ T +FVF G+G+ +A  KL   SA   +GL   +LA
Sbjct  169  RIAIGTREEATHPNALKAALAEFICTLIFVFAGQGSGMAFSKLTGGSATTPAGLVAASLA  228

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HA  LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS +AC LLR S
Sbjct  229  HAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTIACFLLRFS  288

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              G+    F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI FIVG
Sbjct  289  TGGLSTGTFGLTGISVW-EALVLEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVG  347

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            AN+  G  F GASMNPA +FGPALV W W  HW+YW GP IG GLAGL+YEF
Sbjct  348  ANILAGGAFDGASMNPAVSFGPALVSWSWNNHWVYWAGPLIGGGLAGLVYEF  399



>ref|XP_002322910.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93416.1| unknown [Populus trichocarpa]
 gb|ABK93851.1| unknown [Populus trichocarpa]
 gb|EEF04671.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 169/235 (72%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   E T PD+++A L+EF+ST +FVF GEG+ +A  KL   ++   +GL   
Sbjct  2    PIRNIAVGHYRETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA +GG I+    + YWIAQLLGS VACLLL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +    G+    F+L+ G G  +  +LEI+MTFGL+YTVYATAIDPK+G+LG IAP+AI F
Sbjct  122  KFVTGGLETSAFALSTGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGLIYE 
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPALVSWSWTNHWVYWAGPLVGGGLAGLIYEL  236



>ref|XP_007218847.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
 gb|EMJ20046.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
Length=252

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + A G   EA+HPD++RA  +EF ST +FVF GEG+ +A +KL  + +   SGL   
Sbjct  2    PINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTNNGSTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G     FSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G++G +AP+AI  
Sbjct  122  KFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGIVAPIAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW GP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWTHHWVYWAGPLIGAAVAALVYD  235



>ref|XP_010428353.1| PREDICTED: aquaporin TIP1-3 [Camelina sativa]
Length=252

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 168/232 (72%), Gaps = 0/232 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            S  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  IV
Sbjct  124  STGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            GAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A ++Y+
Sbjct  184  GANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYD  235



>ref|XP_003518658.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN27207.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 169/231 (73%), Gaps = 0/231 (0%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R A G   EA  PD++RA  +EF S  +FVF GEG+ +A  KL  +     +GL   +L+
Sbjct  5    RIAIGTPGEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPAGLIAASLS  64

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L ++ YWIAQLLGS+VAC+LL+ +
Sbjct  65   HAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACILLKSA  124

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              GM   GFSL+ G    + L+ EI+MTFGL+YTVYATA+DPK+G++G +AP+AI FIVG
Sbjct  125  TGGMETTGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGVVAPIAIGFIVG  184

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            AN+ VG  F GASMNPA +FGPA+V W W +HW+YWVGPFIGA +A +IY+
Sbjct  185  ANILVGGAFDGASMNPAVSFGPAVVTWSWTHHWVYWVGPFIGAAIAAVIYD  235



>ref|XP_002876978.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53237.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E  HP+++RA L+EF+ST +FVF G G+ +A +KL  + A   SGL  
Sbjct  2    PTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFG L+GG I+ L  + YWIAQLLGS+ AC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G     F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP +G GLAG+IY+F
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAIVSWTWTNHWVYWAGPLVGGGLAGIIYDF  237



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G + E    D+++A L+EF+S  +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +L+HA ALF AV+   N+SGGHVNPAVTFGA VGG I+   ++ YWIAQLLGS+VACLLL
Sbjct  62   SLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L+ G   G+ L+ EI+MTFGL+YTVYATA+DPK+G LG IAP+AI F
Sbjct  122  KFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGDLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YWVGPF GA +A ++YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAVVYE  235



>emb|CAB61841.1| putative gamma tonoplast intrinsic protein (TIP) [Sporobolus 
stapfianus]
Length=250

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 168/234 (72%), Gaps = 2/234 (1%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   E THP +++A L+EF+ST +FVF G+G+ +A  KL        S L   
Sbjct  2    PMRNIAVGNTQEVTHPGALKAALAEFISTLIFVFAGQGSGVAYSKL-SGGITTPSSLISA  60

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+ S N+SGGHVNPAVTFGA +GG IS   ++ YWIAQLLGSIVACLLL
Sbjct  61   AVAHAFALFVAVSVSANISGGHVNPAVTFGAFLGGNISLFRSILYWIAQLLGSIVACLLL  120

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R    G+    F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  121  RFVTGGLPTGTFGLTGISVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  179

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGP+LV W W  HW+YWVGPFIGA LA LIY+
Sbjct  180  IVGANILVGGAFDGASMNPAVSFGPSLVSWSWNNHWVYWVGPFIGAALAALIYD  233



>ref|XP_008233574.1| PREDICTED: aquaporin TIP1-3 [Prunus mume]
Length=252

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + A G   EA+HPD++RA  +EF ST +FVF GEG+ +A +KL  + +   SGL   
Sbjct  2    PINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G     FSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G++G +AP+AI  
Sbjct  122  KFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGIVAPIAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW GP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWSHHWVYWAGPLIGAAIAALVYD  235



>ref|XP_010554597.1| PREDICTED: aquaporin TIP1-3 [Tarenaya hassleriana]
Length=253

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+HPD+++A  +EF S  +FVF GEG+ +A +KL  +     SGL   
Sbjct  2    PINRIAIGAPGEASHPDAIKAAFAEFFSMVIFVFAGEGSGMAYNKLTGNGPATPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +L+HA  L  AV+   N+SGGHVNPAVTFGA VGG I+ L A+ YWIAQLLGS+VACLLL
Sbjct  62   SLSHAFGLVVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            ++   G+    F+L++G    + ++LEI+MTFGL+YTVYATA+DPK+G +G IAPLAI  
Sbjct  122  KIGTGGLETSAFALSSGVTPWNAVVLEIVMTFGLVYTVYATAVDPKKGDIGVIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW+GPF+GA +A + Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTHHWVYWLGPFVGAAIAAIAYD  235



>gb|KFK30698.1| hypothetical protein AALP_AA6G016000 [Arabis alpina]
Length=252

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 170/233 (73%), Gaps = 2/233 (1%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGKATPSGLIAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAG-EGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFI  787
            S  GM    FSL+ G E W + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  I
Sbjct  124  STGGMETGAFSLSHGVEPW-NAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLI  182

Query  788  VGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            VGAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A ++Y+
Sbjct  183  VGANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYD  235



>emb|CDP08994.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD+++A L+EF+S  +FVF GEG+ +A  KL  + +   +GL   
Sbjct  2    PISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGSGMAFSKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+ + N+SGGHVNPAVTFGA +GG I+ L ++ YWIAQLLG++VACLLL
Sbjct  62   AIAHAFALFVAVSVAANISGGHVNPAVTFGAFLGGHITLLRSVLYWIAQLLGAVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    FSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G LG IAP+AI F
Sbjct  122  KFSTGGLETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATALDPKKGDLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPF+GA +A ++YE 
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWTGHWVYWLGPFVGAAIAAIVYEL  236



>ref|NP_189283.1| aquaporin TIP1-2 [Arabidopsis thaliana]
 sp|Q41963.2|TIP12_ARATH RecName: Full=Aquaporin TIP1-2; AltName: Full=Gamma-tonoplast 
intrinsic protein 2; Short=Gamma-TIP2; AltName: Full=Salt stress-induced 
tonoplast intrinsic protein; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=AtTIP1;2; Contains: RecName: 
Full=Aquaporin TIP1-2, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16271.1|AF428341_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 gb|AAL31945.1|AF419613_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAB01832.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
 gb|AAL84998.1| AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAH30470.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77174.1| aquaporin TIP1-2 [Arabidopsis thaliana]
Length=253

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  245  PPRRYAFG-RADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltv  421
            P R  A G   +E  HP+++RA L+EF+ST +FVF G G+ +A +K+  + A   SGL  
Sbjct  2    PTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVA  61

Query  422  lalahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLL  601
             ALAHA  LF AV+   N+SGGHVNPAVTFG L+GG I+ L  + YWIAQLLGS+ AC L
Sbjct  62   AALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFL  121

Query  602  LRVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            L  +  G     F L+AG G  + L+ EI+MTFGL+YTVYATA+DPK GSLGTIAP+AI 
Sbjct  122  LSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIG  181

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+  G  F+GASMNPA AFGPA+V W W  HW+YW GP IG GLAG+IY+F
Sbjct  182  FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDF  237



>sp|P50156.1|TIP11_ORYSJ RecName: Full=Probable aquaporin TIP1-1; AltName: Full=Tonoplast 
intrinsic protein 1-1; Short=OsTIP1;1; AltName: Full=rTIP1 
[Oryza sativa Japonica Group]
 gb|AAK98737.1|AC090485_16 Tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAA05017.1| gamma-Tip [Oryza sativa]
 gb|ABF93961.1| aquaporin TIP-type, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY88537.1| hypothetical protein OsI_10010 [Oryza sativa Indica Group]
 gb|EAZ25574.1| hypothetical protein OsJ_09399 [Oryza sativa Japonica Group]
 gb|ABP48112.1| water channel protein [Oryza sativa Japonica Group]
 dbj|BAG96434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   E  HP +++A L+EF+ST +FVF G+G+ +A  KL    A   +GL   
Sbjct  2    PIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+    L YWIAQLLGS VAC LL
Sbjct  62   AVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGLATGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGPALV W W   W+YWVGP IG GLAG+IYE
Sbjct  181  IVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYE  234



>ref|XP_008442728.1| PREDICTED: aquaporin TIP1-1-like [Cucumis melo]
Length=253

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 170/230 (74%), Gaps = 0/230 (0%)
 Frame = +2

Query  260  AFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalaha  439
            A GR +EATHP +++A L+EF+ST +FVF G+G+ LA  KL  +S    +GL + ++AH 
Sbjct  9    AVGRPEEATHPAALKAALAEFISTLIFVFAGQGSGLAFSKLTHNSPTTPAGLIIASIAHG  68

Query  440  lalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLD  619
             ALF  V+++ N+SGGH+NPAVTFGAL+GG I+ L  + YWIAQLLG++VA LLL+  + 
Sbjct  69   FALFVGVSTAANISGGHLNPAVTFGALLGGNITILRGILYWIAQLLGAVVANLLLKFVIV  128

Query  620  GMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGAN  799
             +   GF   AG G     + EI+MTFGL+YTVYATAIDPKRG LG IAP+AI  IVGAN
Sbjct  129  DVAITGFLPTAGVGIWEAFVFEIVMTFGLVYTVYATAIDPKRGELGVIAPIAIGLIVGAN  188

Query  800  VFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            + VG PFTGASMNPA AFGPA++ W W  HWIYW GP IG GLAG++YE 
Sbjct  189  ILVGGPFTGASMNPAVAFGPAVISWSWVNHWIYWAGPLIGGGLAGIVYEL  238



>ref|XP_008463493.1| PREDICTED: aquaporin TIP1-3-like isoform X1 [Cucumis melo]
Length=253

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 171/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  ++ FG   EA+ PD+++A+ +EF S  +F+F G+G+ LA DKL    +  ASGL + 
Sbjct  2    PIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIMA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGALVGG ISF  ++ YWIAQLLGS+VAC LL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G     F L++G    +G +LE +MTFGL+YTVYATAIDPKR +LG IAP++I F
Sbjct  122  KFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAIDPKRENLGIIAPISIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA  FGPA+V W W +HW+YW+GP  GA +A ++Y+
Sbjct  182  IVGANILVGGAFDGASMNPAVTFGPAVVTWSWTHHWVYWLGPMTGATIAAVVYD  235



>ref|XP_006649396.1| PREDICTED: probable aquaporin TIP1-1-like [Oryza brachyantha]
Length=250

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 164/234 (70%), Gaps = 1/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   E  HP +++A  +EF+ST +FVF G+G+ +A  KL    A   SGL   
Sbjct  2    PIRNIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGATTPSGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+    L YW+AQLLGS VAC LL
Sbjct  62   AVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G+    F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGLATGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGPALV W W   W+YWVGP IG GLAG+IYE
Sbjct  181  IVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYE  234



>ref|XP_004137844.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 ref|XP_004161262.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN59003.1| Tonoplast intrinsic protein [Cucumis sativus]
Length=253

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 170/230 (74%), Gaps = 0/230 (0%)
 Frame = +2

Query  260  AFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlalaha  439
            A GR +EATHP +++A L+EF+ST +FVF G+G+ LA  KL  +S    +GL + ++AH 
Sbjct  9    AVGRPEEATHPAALKAALAEFISTLIFVFAGQGSGLAFSKLTHNSPTTPAGLVIASIAHG  68

Query  440  lalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLD  619
             ALF  V+++ N+SGGH+NPAVTFGAL+GG I+ L  + YWIAQLLG++VA LLL+  + 
Sbjct  69   FALFVGVSTAANISGGHLNPAVTFGALLGGNITILRGILYWIAQLLGAVVANLLLKFVIV  128

Query  620  GMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGAN  799
             +   GF   AG G     + EI+MTFGL+YTVYATAIDPKRG +G IAP+AI  IVGAN
Sbjct  129  DVAITGFLPTAGVGIWEAFVFEIVMTFGLVYTVYATAIDPKRGEVGVIAPIAIGLIVGAN  188

Query  800  VFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            + VG PFTGASMNPA AFGPA++ W W  HWIYW GP IG GLAG++YE 
Sbjct  189  ILVGGPFTGASMNPAVAFGPAVISWSWANHWIYWAGPLIGGGLAGIVYEL  238



>ref|NP_192056.1| aquaporin TIP1-3 [Arabidopsis thaliana]
 sp|O82598.1|TIP13_ARATH RecName: Full=Aquaporin TIP1-3; AltName: Full=Gamma-tonoplast 
intrinsic protein 3; Short=Gamma-TIP3; AltName: Full=Tonoplast 
intrinsic protein 1-3; Short=AtTIP1;3; Contains: RecName: 
Full=Aquaporin TIP1-3, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAC62778.1| F11O4.1 [Arabidopsis thaliana]
 emb|CAB77717.1| putative water channel protein [Arabidopsis thaliana]
 gb|ABE66039.1| major intrinsic family protein/MIP family protein [Arabidopsis 
thaliana]
 gb|AEE82031.1| aquaporin TIP1-3 [Arabidopsis thaliana]
Length=252

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     +GL   
Sbjct  2    PINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +L+HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL
Sbjct  62   SLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +VS  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  
Sbjct  122  KVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A ++Y+
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYD  235



>ref|XP_002872891.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49150.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 167/232 (72%), Gaps = 0/232 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAVLYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            S  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G +APLAI  IV
Sbjct  124  STGGMETAAFSLSHGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIVAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            GAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A  +Y+
Sbjct  184  GANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAAIAATVYD  235



>ref|XP_010922400.1| PREDICTED: aquaporin TIP1-3-like [Elaeis guineensis]
Length=252

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD+++A ++EF S  +FVF GEG+ +A  KL  D     SGL   
Sbjct  2    PLNRIAIGEPGEASQPDALKAAVAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA AL  AV+   N+SGGHVNPAVTFGA VGG ++ L A+ YWIAQLLGS+VAC+LL
Sbjct  62   ALAHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNVTLLRAILYWIAQLLGSVVACILL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  GM+   F+++A     +  +LEI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFATGGMKTAAFAVSADVTPMNAFVLEIVMTFGLVYTVYATAVDPKKGNLGVIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW++W+GP IGA LA ++Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWDHHWVFWLGPMIGAALAAIVYD  235



>ref|XP_008788076.1| PREDICTED: aquaporin TIP1-3-like [Phoenix dactylifera]
Length=252

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 168/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD+++A L+EF S  +FVF GEG+ +A  KL  D     SGL   
Sbjct  2    PMNRIAIGEPGEASRPDALKAALAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            AL+HA AL  AV+   N+SGGHVNPAVTFGA VGG I+ L A+ YW+AQLLGS+VAC+LL
Sbjct  62   ALSHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWMAQLLGSVVACILL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +    GM+   F+++A     +  + EI+MTFGL+YTVYATA+DPK+G+LG IAP+AI F
Sbjct  122  KFGTGGMKTAAFAVSADVTPMNAFVFEIVMTFGLVYTVYATAVDPKKGNLGVIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW+GP IGA LA ++Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWDHHWVYWLGPMIGAALAAIVYD  235



>gb|ABK28617.1| unknown [Arabidopsis thaliana]
Length=253

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     +GL   
Sbjct  2    PINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +L+HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ L A+ YWIAQLLG++VACLLL
Sbjct  62   SLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            +VS  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  
Sbjct  122  KVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A ++Y+
Sbjct  182  IVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYD  235



>ref|XP_006396348.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
 gb|ESQ37801.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
Length=252

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 168/232 (72%), Gaps = 0/232 (0%)
 Frame = +2

Query  251  RRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlal  430
             R A G   EA+ PD++RA  +EF S  +FVF G+G+ +A  KL  D     SGL   +L
Sbjct  4    NRIAIGTPGEASGPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASL  63

Query  431  ahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRV  610
            +HA ALF AV+   NVSGGHVNPAVTFGA +GG I+ + A+ YWIAQLLG++VACLLL+V
Sbjct  64   SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLMRAILYWIAQLLGAVVACLLLKV  123

Query  611  SLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIV  790
            S  GM    FSL+ G    + ++ EI+MTFGL+YTVYATA+DPK+G +G IAPLAI  IV
Sbjct  124  STGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIV  183

Query  791  GANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            GAN+ VG  F GASMNPA +FGPA+V W W  HW+YWVGPFIGA +A ++Y+
Sbjct  184  GANILVGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWVGPFIGAAIAAIVYD  235



>ref|XP_008343557.1| PREDICTED: aquaporin TIP1-3 [Malus domestica]
Length=252

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD++RA L+EF S  +FVF GEG+ +A +KL  +++   SGL   
Sbjct  2    PINRIAVGTPGEASQPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G     FSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G++G +AP+AI  
Sbjct  122  KFATGGWETAXFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGIVAPIAIGL  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W +HW+YW GP IGA +A L+Y+
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWSWTHHWVYWAGPLIGAAIAALVYD  235



>gb|ADU25490.1| tonoplastic intrinsic protein [Helianthemum almeriense]
Length=252

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  + +   +GL   
Sbjct  2    PIRNIAVGGPSEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA  LF AV+   N+SGGHVNPAVTFGA +GG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   ALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + + +G     F+L++G G  +  +LEI+MTFGL+YTVYATA+DPK+G++G IAP+AI F
Sbjct  122  KFATNGQTTSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATALDPKKGNIGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW GP +G GLAGL+YEF
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWNWENHWVYWAGPLVGGGLAGLVYEF  236



>gb|AFS50011.1| hypothetical protein [Dendrobium catenatum]
Length=250

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 174/236 (74%), Gaps = 3/236 (1%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G  +EA HP +++A L+EF+ST +FVF G G+ +A  KL    A   +GL   
Sbjct  2    PITRIAIGSREEAYHPGALKAALAEFISTVIFVFAGRGSGVAYSKLTPGGASTPAGLLTA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+++ N+SGGHVNPAVTFG  +GG I+    L YW+AQLLG++VACLLL
Sbjct  62   AVAHAFALFVAVSAAANISGGHVNPAVTFGLFLGGNITLFRGLLYWVAQLLGAVVACLLL  121

Query  605  RVSLDGMRPQG-FSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIA  781
            RVS  G  P G F L     W + L+LEII+TFGL+YTVYATA+DPKRGS+GTIAPLAI 
Sbjct  122  RVS-TGFLPVGSFGLTDISDW-NALVLEIILTFGLVYTVYATAVDPKRGSVGTIAPLAIG  179

Query  782  FIVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            FIVGAN+ +G  F GASMNPA +FGPA+V W W++HW+YW GP IG GLAG++YE 
Sbjct  180  FIVGANILIGGVFDGASMNPAVSFGPAVVSWEWKHHWVYWAGPLIGGGLAGIVYEL  235



>ref|XP_009624595.1| PREDICTED: aquaporin TIP1-3 [Nicotiana tomentosiformis]
Length=252

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  + + G   EA+ PD+++A L+EF+S  +FVF GEG+ +A  KL    A   +GL   
Sbjct  2    PISKISLGNLAEASQPDALKAALAEFISMLIFVFAGEGSGMAFGKLTNGGAATPAGLISA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+   ++ YWIAQLLGS+VAC+LL
Sbjct  62   AIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L+ G    + ++ EI+MTFGL+YTVYATAIDPKRG+LG IAP+AI F
Sbjct  122  KFATGGLETSAFALSTGVTPWNAVVFEIVMTFGLVYTVYATAIDPKRGNLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPF+GA +A L+YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWNSHWVYWLGPFVGAAIAALVYE  235



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P    A G   E    D+++A L+EF+ST +FVF GEG+ +A +KL  D +   +GL   
Sbjct  2    PITSIAIGSPAEVGQADALKAALAEFISTLIFVFAGEGSGMAFNKLTSDGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH  ALF AV+   N+SGGHVNPAVTFGA VGG I+ + ++ YW+ QLLGS+VACLLL
Sbjct  62   SLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLMRSILYWVGQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    F+L++G    + L+ EI+MTFGL+YTVYATA+DP++G+LGTIAP+AI F
Sbjct  122  KFATGGLETSAFALSSGVSSWNALVFEIVMTFGLVYTVYATAVDPRKGNLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  F GASMNPA +FGPA+V W W  HW+YW+GPFIG G+A ++YE
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWLGPFIGGGIAAVVYE  235



>gb|EYU18933.1| hypothetical protein MIMGU_mgv1a012390mg [Erythranthe guttata]
Length=252

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   E   P++++A ++EF+S  +FVF GEG+ +A  KL    A   +G+T  
Sbjct  2    PISRVAVGTPAEVRQPEAIKAAVAEFISMLIFVFAGEGSGMAFAKLTGGGASTPAGMTAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            ALAHA ALF AV+   N+SGGHVNPAVTFGA VGG IS   ++ YWIAQLLGS+VACLLL
Sbjct  62   ALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLFRSILYWIAQLLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
              +  G+    F+L++G    + L+ EI+MTFGL+YTVYATA+DPK+G +G IAP+AI F
Sbjct  122  NFATGGLETSAFALSSGVTVWNALVFEIVMTFGLVYTVYATAVDPKKGDIGVIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            IVGAN+  G  FTGASMNPA +FGPA+V W W  HW+YWVGPF+GAG+A LIYE
Sbjct  182  IVGANILAGGAFTGASMNPAVSFGPAVVSWTWASHWVYWVGPFVGAGIAALIYE  235



>emb|CDQ12452.1| tonoplast intrinsic protein 3;1, partial [Vicia faba var. minor]
Length=177

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  GHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVSLDGMRPQGFSLAAGEGW  664
            GHVNPAVTFGAL+GGRIS L A+YYWIAQLLGS+VA LLLR+  D MRPQ F+LA   G 
Sbjct  1    GHVNPAVTFGALIGGRISVLKAVYYWIAQLLGSVVASLLLRLVTDNMRPQAFNLAKNVGA  60

Query  665  GSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVGANVFVGAPFTGASMNPA  844
            G GLLLEI +TFGLMY VYATAIDPKRG++G+IAPLAI  +VGANV  G PF GA MNPA
Sbjct  61   GHGLLLEIAVTFGLMYVVYATAIDPKRGTIGSIAPLAIGLVVGANVLAGGPFDGACMNPA  120

Query  845  RAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            RAFGPALVGWRW YHWI+WVGP IGA +A +IYE+
Sbjct  121  RAFGPALVGWRWDYHWIFWVGPLIGAAIAAVIYEY  155



>ref|NP_001104896.1| aquaporin TIP1-1 [Zea mays]
 sp|O64964.1|TIP11_MAIZE RecName: Full=Aquaporin TIP1-1; AltName: Full=Tonoplast intrinsic 
protein 1-1; AltName: Full=ZmTIP1-1; AltName: Full=ZmTIP1;1; 
Short=ZmTIP1 [Zea mays]
 gb|AAC09245.1| tonoplast intrinsic protein [Zea mays]
 gb|AAO86709.1| tonoplast water channel [Zea mays]
 gb|ACF85770.1| unknown [Zea mays]
 gb|ACF85962.1| unknown [Zea mays]
 gb|ACG23904.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG24935.1| aquaporin TIP1.1 [Zea mays]
 gb|ACN31200.1| unknown [Zea mays]
 gb|ACN33327.1| unknown [Zea mays]
Length=250

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 163/235 (69%), Gaps = 1/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   E  HP +++A  +EF+ST +FVF G+G+ +A  KL        +GL   
Sbjct  2    PINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            A+AHA ALF AV+   N+SGGHVNPAVTFGA VGG I+    L YW+AQLLGS VAC LL
Sbjct  62   AVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            R S  G     F L     W   L+LEI+MTFGL+YTVYATA+DPK+GSLGTIAP+AI F
Sbjct  122  RFSTGGQATGTFGLTGVSVW-EALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF  180

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+ VG  F GASMNPA +FGPALV W W Y W+YWVGP IG GLAG+IYE 
Sbjct  181  IVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYEL  235



>ref|XP_007139266.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
 gb|ESW11260.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
Length=252

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 166/231 (72%), Gaps = 0/231 (0%)
 Frame = +2

Query  254  RYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvlala  433
            R A G   EA  PD++RA  +EF S  +FVF GEG+ +A  KL  +      GL   +L+
Sbjct  5    RIAIGSPAEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPVGLIAASLS  64

Query  434  halalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLLRVS  613
            HA  LF AV+   N SGGHVNPAVTFGA VGG I+ L ++ YWIAQLLGS+VAC+LL+ +
Sbjct  65   HAFGLFVAVSVGANHSGGHVNPAVTFGAFVGGNITLLRSILYWIAQLLGSVVACILLKSA  124

Query  614  LDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAFIVG  793
              GM   GFSL+ G    + L+ E++MTFGL+YTVYATA+DPK+G++G +AP+AI F+VG
Sbjct  125  TGGMETSGFSLSPGVSVWNALIFEVVMTFGLVYTVYATAVDPKKGNVGIVAPIAIGFLVG  184

Query  794  ANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYE  946
            AN+ VG  F GASMNPA +FGPA+V W+W  HW+YW GPFIGA LA +IY+
Sbjct  185  ANILVGGAFDGASMNPAVSFGPAVVTWQWTNHWVYWAGPFIGAALAAIIYD  235



>gb|ADO17795.1| tonoplast intrinsic protein [Jatropha curcas]
Length=252

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 160/219 (73%), Gaps = 0/219 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P R  A G   EATHPD+++A L+EF+ST +FVF GEG+ +A +KL  + A   +GL   
Sbjct  2    PIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAH   LF AV+   N+SGGHVNPAVTFGA VGG I+ L  + YWIAQLLGS VACLLL
Sbjct  62   SLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + S  G+    F+L++G G  +  + EI+MTFGL+YTVYATAIDPK+GSLGTIAP+AI F
Sbjct  122  KFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYW  901
            IVGAN+  G  F GASMNPA +FGPALV W W  HW+YW
Sbjct  182  IVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYW  220



>gb|AGD98709.1| aquaporin protein 6 [Camellia sinensis]
Length=252

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 169/235 (72%), Gaps = 0/235 (0%)
 Frame = +2

Query  245  PPRRYAFGRADEATHPDSMRATLSEFLSTALFVFIGEGAVLAIDKLYRDSALGASGltvl  424
            P  R A G   EA+ PD+++A L+EF+S  +FVF GEGA +A  KL    +   +GL   
Sbjct  2    PISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGAGMAFSKLTDGGSTTPAGLVAA  61

Query  425  alahalalfaavasslnvsGGHVNPAVTFGALVGGRISFLLALYYWIAQLLGSIVACLLL  604
            +LAHA ALF AV+   N+SGGHVNPAVTFGA +GG I+ L ++ YWIAQ LGS+VACLLL
Sbjct  62   SLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITLLRSILYWIAQCLGSVVACLLL  121

Query  605  RVSLDGMRPQGFSLAAGEGWGSGLLLEIIMTFGLMYTVYATAIDPKRGSLGTIAPLAIAF  784
            + +  G+    FSL++G    + L+ EI+MTFGL+YTVYATA+DPK+G LG IAP+AI F
Sbjct  122  KFATGGLETSAFSLSSGVTVWNALVFEIVMTFGLVYTVYATALDPKKGDLGIIAPIAIGF  181

Query  785  IVGANVFVGAPFTGASMNPARAFGPALVGWRWRYHWIYWVGPFIGAGLAGLIYEF  949
            IVGAN+  G  F  ASMNPA +FGPA+V W W  HW+YW+GPFIG+ +A L+YE 
Sbjct  182  IVGANILAGGAFDDASMNPAVSFGPAVVSWTWDSHWVYWLGPFIGSAIAALVYEL  236



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3237541576564