BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22092_g3_i1 len=857 path=[7699:0-30 4008:31-79 10158:80-98
4076:99-133 4111:134-856]

Length=857
                                                                      Score     E

ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.8    7e-23   
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    90.5    1e-22   
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.8    2e-22   
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    95.9    3e-22   
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    91.7    4e-22   
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein   98.2    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.4    4e-22   
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         96.7    1e-21   
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         97.4    2e-21   
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         97.4    2e-21   
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg           97.8    3e-21   
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                    95.5    3e-21   
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.8    3e-21   
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.8    4e-21   
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    98.2    4e-21   
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       101   5e-21   Gossypium hirsutum [American cotton]
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         98.2    8e-21   
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         97.8    1e-20   
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   100   1e-20   
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             100   2e-20   
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      100   2e-20   
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    99.8    2e-20   
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g           99.4    3e-20   
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         99.4    3e-20   
gb|KDP39331.1|  hypothetical protein JCGZ_01088                       97.4    2e-19   
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative            96.3    2e-19   Ricinus communis
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                     96.7    3e-19   Gossypium hirsutum [American cotton]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         96.7    3e-19   
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         96.3    3e-19   
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                  96.3    3e-19   
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    96.3    4e-19   
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  95.5    4e-19   
emb|CDP21869.1|  unnamed protein product                              95.9    5e-19   
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  95.1    6e-19   
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    95.9    6e-19   
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    95.5    1e-18   
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    94.7    1e-18   
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    94.7    1e-18   
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         94.7    1e-18   
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                     94.0    2e-18   
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g           94.0    2e-18   
dbj|BAE71216.1|  putative NAD dependent epimerase                     94.0    2e-18   Trifolium pratense [peavine clover]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                         94.0    2e-18   
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    93.2    3e-18   
gb|AFK49564.1|  unknown                                               93.6    3e-18   
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                93.2    4e-18   
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         92.8    5e-18   Vitis vinifera
emb|CAN83418.1|  hypothetical protein VITISV_041351                   92.4    8e-18   Vitis vinifera
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    92.4    9e-18   
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170        92.0    9e-18   
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    92.4    1e-17   
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    92.0    1e-17   
emb|CDY64583.1|  BnaCnng44170D                                        92.0    1e-17   
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         92.0    1e-17   
emb|CDY18087.1|  BnaA01g23480D                                        92.0    1e-17   
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    90.9    2e-17   
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  91.7    2e-17   
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg           89.4    8e-17   
dbj|BAJ86203.1|  predicted protein                                    89.4    1e-16   
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    89.0    1e-16   
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                     89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                               89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926           89.0    1e-16   
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    88.6    1e-16   
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         88.2    2e-16   
emb|CDY53207.1|  BnaC03g74010D                                        88.2    2e-16   
emb|CDX92990.1|  BnaA03g37120D                                        88.2    2e-16   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    88.2    2e-16   
emb|CDX77481.1|  BnaA07g06190D                                        87.8    3e-16   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    88.2    3e-16   
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.8    3e-16   
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         87.8    3e-16   
emb|CDX85133.1|  BnaC07g07730D                                        87.8    3e-16   
ref|NP_001062295.1|  Os08g0526100                                     87.8    4e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)         87.8    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    87.4    4e-16   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.4    4e-16   
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.4    5e-16   
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    87.0    5e-16   
gb|EEC83914.1|  hypothetical protein OsI_29969                        87.8    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.0    6e-16   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                        87.4    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520        87.0    7e-16   Sorghum bicolor [broomcorn]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    86.3    8e-16   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    86.7    1e-15   
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  85.9    2e-15   
ref|NP_001147328.1|  protein capI                                     84.7    2e-15   Zea mays [maize]
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130        85.9    2e-15   Sorghum bicolor [broomcorn]
gb|EEC84839.1|  hypothetical protein OsI_31939                        85.5    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001063595.1|  Os09g0504000                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg           85.5    2e-15   
ref|XP_001769370.1|  predicted protein                                85.1    3e-15   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein    85.1    3e-15   
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         84.7    3e-15   
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.0    3e-15   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...  85.1    3e-15   Zea mays [maize]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                  84.7    3e-15   
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein   80.1    3e-15   Populus trichocarpa [western balsam poplar]
gb|EPS60141.1|  hypothetical protein M569_14661                       84.3    4e-15   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg           84.3    4e-15   
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268            84.3    4e-15   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.7    4e-15   
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836           84.3    5e-15   
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.3    5e-15   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.3    5e-15   
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         84.0    6e-15   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    84.0    6e-15   
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.0    6e-15   
emb|CDO97699.1|  unnamed protein product                              84.0    7e-15   
dbj|BAJ99315.1|  predicted protein                                    84.0    8e-15   
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    83.6    9e-15   
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         83.2    9e-15   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    83.2    1e-14   
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         83.2    1e-14   
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    83.2    1e-14   
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         83.2    1e-14   
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    83.2    1e-14   
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                     83.2    1e-14   Gossypium hirsutum [American cotton]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.8    1e-14   
gb|ACN26174.1|  unknown                                               80.9    1e-14   Zea mays [maize]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         82.8    1e-14   
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         82.8    1e-14   
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g           82.8    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         82.8    1e-14   Vitis vinifera
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699            77.0    1e-14   
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.8    2e-14   Vitis vinifera
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                  82.8    2e-14   
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         82.4    2e-14   
ref|XP_001761984.1|  predicted protein                                82.4    2e-14   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.4    2e-14   
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    82.4    2e-14   
ref|NP_001048359.1|  Os02g0791500                                     82.4    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.4    2e-14   
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         82.4    2e-14   
ref|XP_001767292.1|  predicted protein                                82.0    3e-14   
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.0    3e-14   
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.6    3e-14   
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                    81.6    3e-14   
ref|XP_001754001.1|  predicted protein                                81.6    3e-14   
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         81.6    4e-14   
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                  81.6    4e-14   
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    81.6    4e-14   
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         81.6    4e-14   
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    81.3    4e-14   
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630        81.3    4e-14   Sorghum bicolor [broomcorn]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         81.3    5e-14   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                         82.0    5e-14   
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    81.3    5e-14   
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg           81.3    6e-14   
ref|NP_001142515.1|  hypothetical protein                             80.9    6e-14   Zea mays [maize]
ref|XP_001751991.1|  predicted protein                                80.9    6e-14   
emb|CDY04398.1|  BnaC02g28500D                                        80.9    6e-14   
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         80.9    7e-14   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    80.9    7e-14   
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    78.2    7e-14   
gb|KDP28767.1|  hypothetical protein JCGZ_14538                       80.5    8e-14   
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                  78.2    9e-14   
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.5    9e-14   
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.5    9e-14   
emb|CAN73016.1|  hypothetical protein VITISV_004388                   80.5    9e-14   Vitis vinifera
gb|AAM61323.1|  nucleotide sugar epimerase, putative                  80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg              80.1    1e-13   
ref|XP_001759693.1|  predicted protein                                80.1    1e-13   
dbj|BAJ85817.1|  predicted protein                                    80.1    1e-13   
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                     80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    80.1    1e-13   
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    1e-13   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  80.1    1e-13   
emb|CDX86716.1|  BnaA09g21060D                                        80.1    1e-13   
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    80.1    1e-13   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         80.1    1e-13   
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684           80.1    1e-13   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174            80.1    1e-13   
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.1    1e-13   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  80.1    1e-13   
emb|CDX94504.1|  BnaC09g23320D                                        80.1    1e-13   
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                  80.1    1e-13   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                  79.7    1e-13   
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.1    1e-13   
ref|NP_001105911.1|  LOC732831                                        80.1    1e-13   Zea mays [maize]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                  80.1    1e-13   
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.7    1e-13   
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    79.7    1e-13   
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                      79.7    1e-13   
emb|CDX97356.1|  BnaA02g21470D                                        79.7    2e-13   
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    79.7    2e-13   
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                  79.7    2e-13   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         79.7    2e-13   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg           79.7    2e-13   
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg           79.7    2e-13   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.3    2e-13   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.3    2e-13   
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    79.3    2e-13   
emb|CDY67756.1|  BnaA03g56770D                                        79.3    2e-13   
emb|CDX95646.1|  BnaC03g25270D                                        79.3    2e-13   
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...  79.3    2e-13   
gb|KDP38751.1|  hypothetical protein JCGZ_04104                       79.3    2e-13   
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg           77.0    2e-13   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         79.3    2e-13   
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.3    2e-13   
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160        79.3    2e-13   
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg           76.6    2e-13   
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         79.3    2e-13   
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         79.3    2e-13   
gb|ABK25339.1|  unknown                                               79.3    2e-13   Picea sitchensis
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    79.3    2e-13   
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    2e-13   
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    2e-13   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    79.3    2e-13   
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                  79.0    3e-13   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.0    3e-13   
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.0    3e-13   
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    79.0    3e-13   
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g           79.0    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                  79.0    3e-13   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  79.0    3e-13   
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         79.0    3e-13   
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein   79.0    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g           79.0    3e-13   
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         78.6    3e-13   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative            78.6    3e-13   Ricinus communis
gb|AAK93670.1|  putative nucleotide sugar epimerase                   78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         78.6    4e-13   
emb|CDY63064.1|  BnaAnng18570D                                        78.6    4e-13   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                     78.6    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    78.6    4e-13   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...  78.6    4e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ABR16292.1|  unknown                                               78.6    4e-13   Picea sitchensis
gb|EAY99954.1|  hypothetical protein OsI_21957                        78.6    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                  78.6    4e-13   
gb|EPS64795.1|  hypothetical protein M569_09984                       77.8    5e-13   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg              78.2    5e-13   
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920        78.2    5e-13   Sorghum bicolor [broomcorn]
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg           78.2    5e-13   
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         78.2    5e-13   
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.2    5e-13   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    78.2    6e-13   
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.2    6e-13   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                  78.2    6e-13   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.8    6e-13   
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    78.2    6e-13   
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                     78.2    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         78.2    6e-13   
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                 77.8    6e-13   
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    78.2    6e-13   
dbj|BAK06545.1|  predicted protein                                    78.2    6e-13   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.8    6e-13   
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    77.8    6e-13   
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    77.8    6e-13   
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg           77.8    7e-13   
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                    77.8    7e-13   
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.8    7e-13   
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.8    7e-13   
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg           77.8    7e-13   
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg           77.8    7e-13   
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.8    7e-13   
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    77.8    8e-13   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.8    8e-13   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                  77.8    8e-13   
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                     77.8    8e-13   Gossypium hirsutum [American cotton]
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    77.8    8e-13   
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg           77.4    8e-13   
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.4    8e-13   
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.4    9e-13   
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g           77.4    9e-13   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.4    9e-13   
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    77.4    9e-13   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                       77.4    9e-13   
ref|XP_001761086.1|  predicted protein                                77.0    1e-12   
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg              77.0    1e-12   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.0    1e-12   
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.0    1e-12   
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         76.6    1e-12   
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                         76.6    2e-12   
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    74.7    2e-12   
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    76.6    2e-12   
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg           76.6    2e-12   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    76.6    2e-12   
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    76.6    2e-12   
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    76.6    2e-12   
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         76.3    2e-12   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                  76.3    2e-12   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         76.3    2e-12   
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative            76.3    3e-12   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                    76.3    3e-12   
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    76.3    3e-12   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    75.9    3e-12   
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.9    3e-12   
emb|CDY70926.1|  BnaCnng70410D                                        75.9    3e-12   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.9    3e-12   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    3e-12   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         75.9    3e-12   
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.9    3e-12   
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.9    3e-12   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    75.9    3e-12   
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                     75.9    3e-12   
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110        75.9    3e-12   
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.9    4e-12   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg           75.9    4e-12   
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    4e-12   
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    74.3    4e-12   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         75.9    4e-12   
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                  75.5    4e-12   
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg           75.5    4e-12   
gb|EPS72617.1|  hypothetical protein M569_02133                       75.5    4e-12   
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         75.5    4e-12   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.5    4e-12   
emb|CDY39205.1|  BnaA03g50170D                                        75.5    4e-12   
emb|CDX72242.1|  BnaC07g42640D                                        75.5    4e-12   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    75.1    5e-12   
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                         72.8    5e-12   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    75.1    6e-12   
emb|CDP21367.1|  unnamed protein product                              75.1    6e-12   
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.1    6e-12   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         74.7    7e-12   
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         74.7    7e-12   
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    74.3    9e-12   
ref|XP_001781238.1|  predicted protein                                74.3    1e-11   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630        74.3    1e-11   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                     74.3    1e-11   
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         74.3    1e-11   
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    74.3    1e-11   
emb|CDP09891.1|  unnamed protein product                              74.3    1e-11   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg              73.9    1e-11   
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    73.9    1e-11   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                     73.9    1e-11   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g           73.6    2e-11   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g           73.6    2e-11   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    73.6    2e-11   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  73.2    3e-11   
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.8    3e-11   
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.8    3e-11   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  72.4    4e-11   
ref|XP_001777338.1|  predicted protein                                72.8    4e-11   
emb|CBI18845.3|  unnamed protein product                              70.9    4e-11   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.4    5e-11   
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.6    8e-11   
emb|CAN60968.1|  hypothetical protein VITISV_008097                   71.6    8e-11   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    71.6    8e-11   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.6    8e-11   
emb|CBI24539.3|  unnamed protein product                              70.9    9e-11   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg           71.2    1e-10   
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                  70.9    1e-10   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    70.9    1e-10   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    70.9    1e-10   
gb|EPS73152.1|  hypothetical protein M569_01604                       70.9    1e-10   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    70.5    2e-10   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938            70.1    2e-10   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183            70.1    2e-10   
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    69.7    4e-10   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                         69.7    4e-10   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    69.7    4e-10   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    69.3    5e-10   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.6    8e-10   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.6    9e-10   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.6    9e-10   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.6    1e-09   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.2    1e-09   
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                         67.8    1e-09   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030        68.2    1e-09   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  68.2    1e-09   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                 67.4    2e-09   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg           67.4    2e-09   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    67.4    2e-09   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    67.0    3e-09   
dbj|BAJ88176.1|  predicted protein                                    67.0    4e-09   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    66.6    4e-09   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         66.6    5e-09   
ref|NP_001049561.1|  Os03g0249500                                     66.6    5e-09   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g           66.2    5e-09   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                      66.2    6e-09   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                       66.2    6e-09   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    66.2    7e-09   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                       65.9    8e-09   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    65.5    1e-08   
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    65.1    1e-08   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    65.1    1e-08   
ref|WP_020559072.1|  NAD dependent epimerase/dehydratase              62.0    1e-07   
ref|XP_002504144.1|  predicted protein                                60.5    4e-07   
ref|WP_038095738.1|  capsular biosynthesis protein CpsI               56.6    6e-07   
ref|WP_039386438.1|  hypothetical protein                             59.7    7e-07   
gb|AFW73830.1|  hypothetical protein ZEAMMB73_770166                  56.6    7e-07   
ref|WP_038084328.1|  capsular biosynthesis protein CpsI               56.6    9e-07   
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                         59.3    9e-07   
ref|WP_019645719.1|  hypothetical protein                             59.3    1e-06   
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase              58.5    2e-06   
ref|WP_009552387.1|  nucleoside-diphosphate-sugar epimerase           58.2    2e-06   
ref|WP_013179120.1|  epimerase                                        57.0    5e-06   
ref|WP_010226857.1|  UDP-glucuronate 5'-epimerase                     56.6    7e-06   
ref|WP_036997098.1|  UDP-glucuronate 5-epimerase                      56.6    7e-06   
ref|WP_018864896.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  56.6    8e-06   
ref|WP_018941321.1|  NAD dependent epimerase/dehydratase              56.6    8e-06   
ref|WP_018176093.1|  NAD dependent epimerase/dehydratase              56.6    8e-06   
ref|WP_018144022.1|  NAD dependent epimerase/dehydratase              56.6    8e-06   
ref|WP_019612082.1|  NAD dependent epimerase/dehydratase              56.6    8e-06   
gb|EKD95969.1|  hypothetical protein ACD_24C00236G0008                56.2    9e-06   
ref|WP_018983082.1|  NAD dependent epimerase/dehydratase              56.2    9e-06   
ref|XP_003060215.1|  protein arginine methyltransferase               56.2    1e-05   
ref|WP_006341506.1|  NAD-dependent epimerase                          56.2    1e-05   
ref|WP_013924154.1|  NAD-dependent epimerase                          56.2    1e-05   
gb|KIA76468.1|  UDP-glucuronate 4-epimerase 4                         56.2    1e-05   
ref|WP_018878551.1|  hypothetical protein                             54.3    1e-05   
dbj|GAK34593.1|  putative 37.6 kDa protein in cld 5'region            56.2    1e-05   
ref|WP_018881841.1|  hypothetical protein                             54.7    1e-05   
ref|WP_019592786.1|  hypothetical protein                             54.3    1e-05   
ref|WP_019584594.1|  hypothetical protein                             54.7    1e-05   
ref|WP_008842667.1|  UDP-glucuronate 5'-epimerase                     55.8    1e-05   
ref|WP_027289889.1|  hypothetical protein                             55.8    1e-05   
ref|WP_027709070.1|  capsular biosynthesis protein CpsI               55.5    2e-05   
ref|WP_019025549.1|  hypothetical protein                             54.7    2e-05   
ref|WP_011951691.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  55.5    2e-05   
ref|WP_018138355.1|  hypothetical protein                             54.7    2e-05   
ref|WP_028032856.1|  hypothetical protein                             55.5    2e-05   
ref|WP_030089715.1|  hypothetical protein                             55.5    2e-05   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase              55.5    2e-05   
ref|WP_019024820.1|  hypothetical protein                             54.7    2e-05   
ref|WP_007625500.1|  UDP-glucuronate 5'-epimerase                     55.1    2e-05   
emb|CEG01274.1|  Nucleotide sugar epimerase                           55.5    2e-05   
ref|WP_018862514.1|  hypothetical protein                             54.3    2e-05   
ref|WP_034222141.1|  capsular biosynthesis protein CpsI               55.1    2e-05   
ref|WP_018868571.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  54.7    2e-05   
ref|WP_019592126.1|  NAD dependent epimerase/dehydratase              55.1    2e-05   
ref|WP_008435989.1|  NAD-dependent epimerase/dehydratase              55.1    2e-05   
ref|WP_015094545.1|  UDP-glucuronate 5 -epimerase                     55.1    2e-05   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)        55.1    3e-05   
ref|WP_017925880.1|  NAD dependent epimerase/dehydratase              55.1    3e-05   
ref|WP_038995062.1|  UDP-glucuronate 5-epimerase                      55.1    3e-05   
ref|WP_020146287.1|  NAD dependent epimerase/dehydratase              55.1    3e-05   
ref|WP_018174687.1|  NAD dependent epimerase/dehydratase              54.7    3e-05   
ref|WP_014248472.1|  UDP-glucose/glucuronate epimerase                54.7    3e-05   
ref|WP_027492442.1|  capsular biosynthesis protein CpsI               54.7    3e-05   
ref|WP_012982031.1|  NAD-dependent epimerase/dehydratase              54.7    3e-05   
ref|WP_018875225.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  54.7    3e-05   
ref|WP_018994655.1|  NAD dependent epimerase/dehydratase              54.7    3e-05   
ref|WP_018867566.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  54.7    3e-05   
ref|WP_008084481.1|  nucleoside-diphosphate-sugar epimerase           54.7    3e-05   
ref|WP_015447938.1|  nucleoside-diphosphate-sugar epimerase           54.7    3e-05   
ref|WP_018881379.1|  NAD dependent epimerase/dehydratase              54.7    3e-05   
ref|WP_007508153.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  54.7    3e-05   
ref|WP_027484939.1|  capsular biosynthesis protein CpsI               54.7    3e-05   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI               54.7    3e-05   
ref|WP_009669670.1|  NAD-dependent epimerase/dehydratase              54.7    4e-05   
emb|CBA27698.1|  Protein capI                                         53.1    5e-05   
ref|WP_018649040.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  54.3    5e-05   
ref|WP_021132243.1|  nucleoside-diphosphate-sugar epimerase           54.3    5e-05   
ref|WP_003610550.1|  NAD-dependent epimerase/dehydratase              53.9    6e-05   
ref|WP_018872035.1|  NAD dependent epimerase/dehydratase              53.9    6e-05   
gb|KDD74739.1|  NAD dependent epimerase/dehydratase                   53.9    6e-05   
ref|WP_027312633.1|  capsular biosynthesis protein CpsI               53.9    6e-05   
ref|WP_019088527.1|  NAD-dependent epimerase                          53.9    6e-05   
ref|WP_003624230.1|  NAD-dependent epimerase                          53.9    6e-05   
ref|WP_009787825.1|  NAD-dependent epimerase                          53.9    6e-05   
ref|WP_034152563.1|  UDP-glucuronate 5-epimerase                      53.9    6e-05   
ref|WP_026444165.1|  capsular biosynthesis protein CpsI               53.9    7e-05   
ref|WP_034680088.1|  capsular biosynthesis protein CpsI               53.5    7e-05   
ref|WP_007919479.1|  MULTISPECIES: nucleoside-diphosphate-sugar e...  53.5    7e-05   
ref|WP_028097751.1|  hypothetical protein                             53.5    7e-05   
ref|WP_024868287.1|  capsular biosynthesis protein CpsI               53.5    7e-05   
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    53.9    7e-05   
ref|WP_039742914.1|  capsular biosynthesis protein CpsI               53.5    7e-05   
ref|WP_007973829.1|  nucleoside-diphosphate-sugar epimerase           53.5    8e-05   
ref|WP_035038771.1|  protein CapI                                     53.5    8e-05   
ref|WP_035352287.1|  protein CapI                                     53.5    8e-05   
ref|WP_005220977.1|  hypothetical protein                             53.5    8e-05   
ref|WP_020400341.1|  hypothetical protein                             53.5    8e-05   
gb|KDE19916.1|  hypothetical protein AZ09_10205                       53.5    9e-05   
ref|WP_011398658.1|  nucleoside-diphosphate-sugar epimerase           53.5    9e-05   
ref|WP_004813072.1|  hypothetical protein                             53.5    9e-05   
ref|WP_028622110.1|  UDP-glucuronate 5-epimerase                      53.5    9e-05   
ref|WP_008303431.1|  NAD-dependent epimerase/dehydratase              53.5    9e-05   
ref|WP_027921354.1|  UDP-glucuronate 5-epimerase                      53.5    9e-05   
ref|WP_012974764.1|  NAD-dependent epimerase/dehydratase              53.1    9e-05   
ref|WP_038096479.1|  capsular biosynthesis protein CpsI               50.1    9e-05   
emb|CDX19289.1|  Uncharacterized 37.6 kDa protein in cld 5'region     53.1    9e-05   
ref|WP_038057237.1|  capsular biosynthesis protein CpsI               50.4    9e-05   
ref|WP_034900611.1|  protein CapI                                     53.1    9e-05   
ref|WP_034705487.1|  capsular biosynthesis protein CpsI               53.1    9e-05   
gb|KFL92095.1|  Nucleotide sugar epimerase                            53.1    1e-04   
ref|WP_013942574.1|  NAD-dependent epimerase                          53.1    1e-04   
ref|WP_007807145.1|  protein CapI                                     53.1    1e-04   
ref|WP_027611609.1|  UDP-glucuronate 5-epimerase                      53.1    1e-04   
ref|WP_003226284.1|  Nucleoside-diphosphate-sugar epimerase           53.1    1e-04   
ref|WP_003631040.1|  NAD-dependent epimerase                          52.8    1e-04   
ref|WP_023794561.1|  hypothetical protein                             50.8    1e-04   
ref|WP_008990343.1|  3-beta hydroxysteroid dehydrogenase              52.8    1e-04   
ref|WP_020083694.1|  hypothetical protein                             52.8    1e-04   
ref|WP_014240523.1|  UDP-glucose/glucuronate epimerase                52.8    1e-04   
ref|WP_026377125.1|  capsular biosynthesis protein CpsI               52.8    1e-04   
ref|WP_005296792.1|  hypothetical protein                             52.8    1e-04   
ref|WP_025109888.1|  UDP-glucuronate 5-epimerase                      52.8    1e-04   
ref|WP_005149875.1|  hypothetical protein                             52.8    1e-04   
ref|WP_027884291.1|  3-beta hydroxysteroid dehydrogenase              52.8    1e-04   
ref|WP_038369591.1|  UDP-glucuronate 5-epimerase                      52.8    1e-04   
gb|EZP26540.1|  UDP-glucuronate 5 -epimerase                          52.8    1e-04   
ref|WP_036192572.1|  capsular biosynthesis protein CpsI               52.8    1e-04   
ref|WP_028995746.1|  hypothetical protein                             52.8    1e-04   
gb|EQB13105.1|  NAD dependent epimerase/dehydratase                   52.8    1e-04   
ref|WP_017165470.1|  NAD dependent epimerase/dehydratase              50.4    1e-04   
ref|WP_007961340.1|  nucleoside-diphosphate-sugar epimerase           52.8    1e-04   
ref|WP_038527232.1|  protein CapI                                     52.8    1e-04   



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score = 97.8 bits (242),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG+SVLVTGAAGFVGSHCS+ALKKRGDGVLG+DNFNS    SLKR RQKL
Sbjct  91   VRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPSLKRGRQKL  150

Query  5    L  3
            L
Sbjct  151  L  151


 Score = 37.4 bits (85),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  228  HLLSSAFYGGGASWEKHVH  172
            +LLSSAFYGGGA+WEK V 
Sbjct  74   NLLSSAFYGGGAAWEKQVR  92



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score = 90.5 bits (223),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TP   NG SVLVTGAAGFVGSH SLALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  92   VRRSATPSRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVLGLDNFNSYYDPSLKRARQNL  151

Query  5    L  3
            L
Sbjct  152  L  152


 Score = 43.5 bits (101),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSN------RATNHLLSSAFYGGGASWEKHVH  172
            + F     PP+A +++N        T++LLSSAFYGGGASWEK V 
Sbjct  48   IFFFTINYPPLASDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVR  93



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score = 97.8 bits (242),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG+SVLVTGAAGFVGSHCS+ALKKRGDGVLG+DNFNS    SLKR RQKL
Sbjct  95   VRHSSTPRRVNGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPSLKRGRQKL  154

Query  5    L  3
            L
Sbjct  155  L  155


 Score = 36.2 bits (82),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -3

Query  225  LLSSAFYGGGASWEKHVH  172
            LLSS+FYGGGA+WEK V 
Sbjct  79   LLSSSFYGGGAAWEKQVR  96



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score = 95.9 bits (237),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R SSTPR  NG+SVLVTGAAGFVGSHCS+ALKKRGDGVLG+DNFNS     LKR RQKL
Sbjct  91   VRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPLLKRGRQKL  150

Query  5    L  3
            L
Sbjct  151  L  151


 Score = 37.0 bits (84),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -3

Query  225  LLSSAFYGGGASWEKHVH  172
            LLSSAFYGGGA+WEK V 
Sbjct  75   LLSSAFYGGGAAWEKQVR  92



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score = 91.7 bits (226),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP   NG SVLVTGAAGFVGSH SLALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  92   VRRSSTPSRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVLGLDNFNSYYDPSLKRARQNL  151

Query  5    L  3
            L
Sbjct  152  L  152


 Score = 41.2 bits (95),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 6/46 (13%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSN------RATNHLLSSAFYGGGASWEKHVH  172
            + F     PP+A ++ N        T++L+SSAFYGGGASWEK V 
Sbjct  48   IFFFTINYPPLASDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVR  93



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score = 98.2 bits (243),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NG+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    +LKRARQKL
Sbjct  93   VRHSSTPKRRNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKL  152

Query  5    L  3
            L
Sbjct  153  L  153


 Score = 34.3 bits (77),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 7/47 (15%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRATNH---LLSSAFY----GGGASWEKHVH  172
            + F     PP++DN  N A  H    LS+AF+    GGGA+WEK V 
Sbjct  48   ILFFTLNYPPLSDNIPNHAHLHHHNFLSTAFFTSSAGGGAAWEKQVR  94



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score = 97.4 bits (241),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR +NG SVLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  90   VRHSSTPRRSNGFSVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAL  149

Query  5    L  3
            L
Sbjct  150  L  150


 Score = 35.0 bits (79),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 4/44 (9%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRATNH----LLSSAFYGGGASWEKHVH  172
            + F     PP++ +S N    H     L+SAFYG GA+WEK V 
Sbjct  48   IFFFTLNHPPLSSDSPNHVPLHHHQNFLASAFYGNGATWEKQVR  91



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score = 96.7 bits (239),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R SSTPR  NG S+LVTGAAGFVG+HCS+ALKKRGDGVLGLDNFN     SLKRARQKL
Sbjct  90   VRQSSTPRRPNGFSILVTGAAGFVGTHCSIALKKRGDGVLGLDNFNRYYDPSLKRARQKL  149

Query  5    L  3
            L
Sbjct  150  L  150


 Score = 34.3 bits (77),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -3

Query  255  DNSSNRATNHLLSSAFYGGGASWEKHVH  172
            +N+S   T+   SS FYG GA+WEK V 
Sbjct  64   NNASIHTTSRFFSSGFYGSGATWEKQVR  91



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score = 97.4 bits (241),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKR+RQ L
Sbjct  98   VRKSATPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQAL  157

Query  5    L  3
            L
Sbjct  158  L  158


 Score = 32.7 bits (73),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 26/48 (54%), Gaps = 8/48 (17%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRA-----TNHLLSSAFYGGGA---SWEKHVH  172
            + F     PP++D+    A     T++ LSSAFYGGG    +WEK V 
Sbjct  52   ILFFTLNYPPLSDHVGGGANHVHTTHNFLSSAFYGGGVGGTAWEKQVR  99



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score = 97.4 bits (241),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKR+RQ L
Sbjct  98   VRKSATPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQAL  157

Query  5    L  3
            L
Sbjct  158  L  158


 Score = 32.7 bits (73),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 26/48 (54%), Gaps = 8/48 (17%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRA-----TNHLLSSAFYGGGA---SWEKHVH  172
            + F     PP++D+    A     T++ LSSAFYGGG    +WEK V 
Sbjct  52   ILFFTLNYPPLSDHVGGGANHVHTTHNFLSSAFYGGGVGGTAWEKQVR  99



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score = 97.8 bits (242),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NGMSVLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  94   VRHSSTPKRPNGMSVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAL  153

Query  5    L  3
            L
Sbjct  154  L  154


 Score = 32.0 bits (71),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 26/48 (54%), Gaps = 8/48 (17%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRA-----TNHLLSSAFYGGGA---SWEKHVH  172
            + F     PP++D+    A     T++ LSSAFYGGG    +WEK V 
Sbjct  48   IFFFTINYPPLSDHMGGGAHHVHTTHNFLSSAFYGGGVGGTAWEKQVR  95



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score = 95.5 bits (236),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+    SLKRARQ L
Sbjct  93   VRHSATPRRQNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSLKRARQAL  152

Query  5    L  3
            L
Sbjct  153  L  153


 Score = 34.3 bits (77),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 7/47 (15%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRATNH------LLSSAFYGGG-ASWEKHVH  172
            + F     PP++ +S    T+H       LSSAFYGGG A+WEK V 
Sbjct  48   ILFFTLNYPPLSSSSDTPNTHHSFHHHNFLSSAFYGGGGATWEKQVR  94



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score = 97.8 bits (242),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NGMSVLVTGAAGFVGSHCS+ALKKRGDGVLGLDNFN+    SLKRARQ L
Sbjct  98   VRHSSTPRRLNGMSVLVTGAAGFVGSHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSL  157

Query  5    L  3
            L
Sbjct  158  L  158


 Score = 31.6 bits (70),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 10/50 (20%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRATNHL------LSSAFYG----GGASWEKHVH  172
            L F+   + P   + +  + NHL      LSSAFYG    GGA+WEK V 
Sbjct  50   LVFIFTLNYPPLSSENGSSGNHLHTHRNFLSSAFYGGSDQGGAAWEKQVR  99



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Fragaria vesca 
subsp. vesca]
Length=451

 Score = 97.8 bits (242),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NGMSVLVTGAAGF+GSHCSLALKKRGDGVLGLDNFNS    SLKRARQ +
Sbjct  96   VRHSSTPKRPNGMSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAM  155

Query  5    L  3
            L
Sbjct  156  L  156


 Score = 31.6 bits (70),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 31/66 (47%), Gaps = 16/66 (24%)
 Frame = -3

Query  345  RLNHSVAIVAPHFLTKGQLCFVHFQDPPVADNSSNRATNHL-----LSSAFYGGGA---S  190
            R+   VA+V   F T           PP++ +S    ++ L     LSSAFYGGG    +
Sbjct  40   RVTLLVALVLIFFFT--------LNYPPLSSSSDQNGSHRLHNTNFLSSAFYGGGVGGTA  91

Query  189  WEKHVH  172
            WEK V 
Sbjct  92   WEKQVR  97



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 98.2 bits (243),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NG+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    +LKRARQKL
Sbjct  92   VRHSSTPKRRNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKL  151

Query  5    L  3
            L
Sbjct  152  L  152


 Score = 31.2 bits (69),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (57%), Gaps = 6/46 (13%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRAT---NHLLSSAFY---GGGASWEKHVH  172
            + F     PP++DN  N A    ++ LS+AF+    GGA+WEK V 
Sbjct  48   ILFFTLNYPPLSDNIPNHAHPPHHNFLSTAFFTSSAGGAAWEKQVR  93



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +RLSSTPR TNG SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+    SLKRARQ L
Sbjct  94   VRLSSTPRRTNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSLKRARQNL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score = 98.2 bits (243),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NGMSVLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  94   VRHSSTPKRPNGMSVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAL  153

Query  5    L  3
            L
Sbjct  154  L  154


 Score = 30.4 bits (67),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 26/48 (54%), Gaps = 8/48 (17%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRA-----TNHLLSSAFYGGGA---SWEKHVH  172
            + F     PP++++    A     T++ LSSAFYGGG    +WEK V 
Sbjct  48   IFFFTINYPPLSEHMGGGAHHVHTTHNFLSSAFYGGGVGGTAWEKQVR  95



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score = 97.8 bits (242),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NGMSVLVTGAAGFVGSHCS+ALKKRGDGVLGLDNFN+    SLKRARQ L
Sbjct  98   VRHSSTPRRLNGMSVLVTGAAGFVGSHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSL  157

Query  5    L  3
            L
Sbjct  158  L  158


 Score = 29.6 bits (65),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 26/43 (60%), Gaps = 13/43 (30%)
 Frame = -3

Query  267  PPV-ADNSSNRATNHL------LSSAFYG----GGASWEKHVH  172
            PP+ A+N+S    NHL      LSSAFYG    GGA+WEK V 
Sbjct  59   PPLSAENAS--PGNHLHTHRNFLSSAFYGGSDHGGAAWEKQVR  99



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGM+VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  107  VRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKL  166

Query  5    L  3
            L
Sbjct  167  L  167



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGM+VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  107  VRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKL  166

Query  5    L  3
            L
Sbjct  167  L  167



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGM+VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  107  VRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKL  166

Query  5    L  3
            L
Sbjct  167  L  167



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NG+SVLVTGAAGFVGSHCS+ALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  92   VRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNSYYDPSLKRARQKL  151

Query  5    L  3
            L
Sbjct  152  L  152



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  NG+SVLVTGAAGFVGSHCS+ALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  92   VRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNSYYDPSLKRARQKL  151

Query  5    L  3
            L
Sbjct  152  L  152



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQKL
Sbjct  96   VRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKL  155

Query  5    L  3
            L
Sbjct  156  L  156



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG SVLVTGAAGFVGSHCSLALKKRGDGVLG+DNFN     SLKRARQKL
Sbjct  95   VRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGIDNFNDYYDPSLKRARQKL  154

Query  5    L  3
            L
Sbjct  155  L  155



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  +G+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+    SLKRARQ+L
Sbjct  39   VRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSLKRARQQL  98

Query  5    L  3
            L
Sbjct  99   L  99



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=453

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGAAGF+GSHCSLALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  93   VRHSSTPRRVNGFSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNDYYDPSLKRARQNL  152

Query  5    L  3
            L
Sbjct  153  L  153



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +RLSS PR  NG SVLVTGAAGFVGSHCS+ALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  97   VRLSSAPRRPNGFSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNDYYDPSLKRARQNL  156

Query  5    L  3
            L
Sbjct  157  L  157



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  90   VRHSSTPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNDYYDPSLKRARQAL  149

Query  5    L  3
            L
Sbjct  150  L  150



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGAAGF+GSHCSLALKKRGDGVLGLDNFN+    SLKRARQ L
Sbjct  93   VRHSSTPRRPNGFSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNNYYDPSLKRARQNL  152

Query  5    L  3
            L
Sbjct  153  L  153



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGAAGFVG+HC+LALKKRGDGVLGLDNFNS    SLKRARQ L
Sbjct  89   VRHSSTPRRPNGFSVLVTGAAGFVGTHCALALKKRGDGVLGLDNFNSYYDPSLKRARQSL  148

Query  5    L  3
            L
Sbjct  149  L  149



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR  NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  59   VRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNPYYDPSLKRARQHL  118

Query  5    L  3
            L
Sbjct  119  L  119



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRAR+ L
Sbjct  90   VRHSATPRRPNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARRDL  149

Query  5    L  3
            L
Sbjct  150  L  150



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR  NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  59   VRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNPYYDPSLKRARQHL  118

Query  5    L  3
            L
Sbjct  119  L  119



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG++VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKR+RQ +
Sbjct  104  VRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQAM  163

Query  5    L  3
            L
Sbjct  164  L  164



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+ PR  +GMSVLVTGAAGFVGSHCSL+LKKRGDGVLGLDNFNS    SLK
Sbjct  128  PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCSLSLKKRGDGVLGLDNFNSYYDPSLK  187

Query  23   RARQKLL  3
            RARQ LL
Sbjct  188  RARQHLL  194



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG SVLVTGAAGFVGSHCSLALKKRGDGV+GLDNFN+    SLKRARQ L
Sbjct  87   VRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVVGLDNFNTYYDPSLKRARQAL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP   NG+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQ  
Sbjct  91   VRHSSTPHRPNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQDQ  150

Query  5    L  3
            L
Sbjct  151  L  151



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP   NG+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS    SLKRARQ  
Sbjct  95   VRHSSTPHRPNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQDQ  154

Query  5    L  3
            L
Sbjct  155  L  155



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG++VLVTGAAGFVGSHCSLALK+RGDGVLGLDNFN+    SLKRARQ +
Sbjct  80   LRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRRGDGVLGLDNFNAYYDPSLKRARQAM  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG++VLVTGAAGFVGSHCSLALK+RGDGVLGLDNFN+    SLKRARQ +
Sbjct  80   LRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRRGDGVLGLDNFNAYYDPSLKRARQAM  139

Query  5    L  3
            L
Sbjct  140  L  140



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NG +VLVTGAAGFVGSHCSLALKKRGDGV+GLDNFN+    SLKRARQ L
Sbjct  87   VRHSATPRRPNGFTVLVTGAAGFVGSHCSLALKKRGDGVIGLDNFNNYYDPSLKRARQDL  146

Query  5    L  3
            L
Sbjct  147  L  147



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG++VLVTGAAGFVGSHCSLALK+RGDGVLGLDNFN+    SLKRARQ +
Sbjct  80   LRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRRGDGVLGLDNFNAYYDPSLKRARQAM  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score = 93.2 bits (230),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR+ +G++VLVTGAAGFVG+HCSLALKKRGDGV+GLDNFNS    SLKRARQ L
Sbjct  95   VRRSATPRSPSGLTVLVTGAAGFVGTHCSLALKKRGDGVVGLDNFNSYYNPSLKRARQSL  154

Query  5    L  3
            L
Sbjct  155  L  155


 Score = 26.2 bits (56),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = -3

Query  225  LLSSAFYGGGASWEKHVH  172
            LLSSA   GGA+WE+ V 
Sbjct  79   LLSSAVTYGGAAWEREVR  96



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR  NG +VLVTGAAGFVGSHCSLALKKRGDGV+GLDNFNS    SLKRARQ L
Sbjct  87   VRHSAIPRRPNGFTVLVTGAAGFVGSHCSLALKKRGDGVIGLDNFNSYYDPSLKRARQAL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR  NG +VLVTGAAGFVGSHCSLALKKRGDGV+GLDNFNS    SLKRARQ L
Sbjct  87   VRHSAIPRRPNGFTVLVTGAAGFVGSHCSLALKKRGDGVIGLDNFNSYYDPSLKRARQAL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGA GFVG+HCSLALKKRGDGVLGLDNFN     SLKRARQ +
Sbjct  87   VRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKRGDGVLGLDNFNDYYDPSLKRARQAM  146

Query  5    L  3
            L
Sbjct  147  L  147



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGA GFVG+HCSLALKKRGDGVLGLDNFN     SLKRARQ +
Sbjct  87   VRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKRGDGVLGLDNFNDYYDPSLKRARQAM  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR   G+SVLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKR+RQ L
Sbjct  92   VRRSATPRHPGGLSVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNL  151

Query  5    L  3
            L
Sbjct  152  L  152



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTPR  NG SVLVTGAAGFVGSH SLALKKRGDGVLGLDNFN     SLKRARQ L
Sbjct  83   VRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVLGLDNFNDYYDPSLKRARQAL  142

Query  5    L  3
            L
Sbjct  143  L  143



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR   GM+VLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKR+RQ L
Sbjct  89   VRRSATPRRHGGMTVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNL  148

Query  5    L  3
            L
Sbjct  149  L  149



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  +G++VLVTGAAGFVG+HCSLALKKRGDGV+GLDNFNS    SLKRARQ L
Sbjct  93   VRSSATPRRPSGLTVLVTGAAGFVGTHCSLALKKRGDGVVGLDNFNSYYDPSLKRARQSL  152

Query  5    L  3
            L
Sbjct  153  L  153



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  100  VRQSSTPKRPHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQEL  159

Query  5    L  3
            L
Sbjct  160  L  160



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  100  VRQSSTPKRPHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQEL  159

Query  5    L  3
            L
Sbjct  160  L  160



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SSTP+  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  100  VRQSSTPKRPHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQEL  159

Query  5    L  3
            L
Sbjct  160  L  160



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score = 90.9 bits (224),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SS P+  NG  VLVTGAAGFVGSHC+LALKKRGDGV+G+DNFNS    SLKRARQ+L
Sbjct  86   VRHSSIPKKINGKVVLVTGAAGFVGSHCALALKKRGDGVIGIDNFNSYYDPSLKRARQEL  145

Query  5    L  3
            L
Sbjct  146  L  146


 Score = 26.2 bits (56),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 3/27 (11%)
 Frame = -3

Query  252  NSSNRATNHLLSSAFYGGGASWEKHVH  172
            N+SN+    L S   +GGGA WEK V 
Sbjct  64   NNSNQHGRRLFS---FGGGAGWEKKVR  87



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR   G+SVLVTGAAGFVG+HCSLALK RGDGVLGLDNFNS    SLKR+RQKL
Sbjct  91   VRRSATPRRRGGLSVLVTGAAGFVGTHCSLALKXRGDGVLGLDNFNSYYDPSLKRSRQKL  150

Query  5    L  3
            L
Sbjct  151  L  151



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+ALKKRGDGVLG DNFN     SLKRARQ+L
Sbjct  101  VRQSSTAKRPHGLSVLVTGAAGFVGSHCSIALKKRGDGVLGFDNFNDYYDPSLKRARQQL  160

Query  5    L  3
            L
Sbjct  161  L  161



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR   GMSVLVTGAAGFVG+HC+LAL+ RGDGVLGLDNFN+    +LKRARQ+L
Sbjct  112  VRRSATPRRDGGMSVLVTGAAGFVGAHCALALRARGDGVLGLDNFNAYYEPALKRARQRL  171

Query  5    L  3
            L
Sbjct  172  L  172



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SS P+  NG  VLVTGAAGFVGSHC LALKKRGDGV+G+DNFNS    SLKRARQ+L
Sbjct  85   VRHSSIPKKINGKVVLVTGAAGFVGSHCGLALKKRGDGVIGIDNFNSYYDPSLKRARQEL  144

Query  5    L  3
            +
Sbjct  145  M  145



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCSLAL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  100  VRQSSTAKRPHGLSVLVTGAAGFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLKRARQEL  159

Query  5    L  3
            L
Sbjct  160  L  160



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCSLAL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  100  VRQSSTAKRPHGLSVLVTGAAGFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLKRARQEL  159

Query  5    L  3
            L
Sbjct  160  L  160



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCSLAL+KRGDGVLG DNFN     SLKRARQ+L
Sbjct  101  VRQSSTAKRPHGLSVLVTGAAGFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLKRARQEL  160

Query  5    L  3
            L
Sbjct  161  L  161



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R+S+ P  TNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   VRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R+S+ P  TNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   VRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN    +SLKRARQ L
Sbjct  95   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDTSLKRARQNL  154

Query  5    L  3
            L
Sbjct  155  L  155



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN    +SLKRARQ L
Sbjct  96   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDTSLKRARQNL  155

Query  5    L  3
            L
Sbjct  156  L  156



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN    +SLKRARQ L
Sbjct  96   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDTSLKRARQNL  155

Query  5    L  3
            L
Sbjct  156  L  156



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ L
Sbjct  93   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQHL  152

Query  5    L  3
            L
Sbjct  153  L  153



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR   G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+    SLKRARQ+L
Sbjct  114  VRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGRGDGVVGLDNFNAYYDPSLKRARQRL  173

Query  5    L  3
            L
Sbjct  174  L  174



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TP    G+ VLVTGAAGFVG+HCSLALKKRGDGVLGLDNFNS    SLKR+RQ L
Sbjct  89   VRRSATPHRPGGLFVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNL  148

Query  5    L  3
            L
Sbjct  149  L  149



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ L
Sbjct  94   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQHL  153

Query  5    L  3
            L
Sbjct  154  L  154



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCS+AL+KRGDGVLG DNFN     SLKRARQ L
Sbjct  96   VRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKRGDGVLGFDNFNDYYDPSLKRARQHL  155

Query  5    L  3
            L
Sbjct  156  L  156



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNS    SLKRARQ+L
Sbjct  112  VRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPSLKRARQRL  171

Query  5    L  3
            L
Sbjct  172  L  172



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNS    SLKRARQ+L
Sbjct  111  VRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPSLKRARQRL  170

Query  5    L  3
            L
Sbjct  171  L  171



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R+S+ P  TNG SV+VTGAAGFVGSH SLALKKRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   VRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_003572425.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=477

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  NGMSVLVTGAAGFVG HC++AL  RGDGV+GLDNFN+    SLKR+RQ+L
Sbjct  108  VRRSATPRRANGMSVLVTGAAGFVGFHCAMALAARGDGVVGLDNFNAYYDVSLKRSRQRL  167

Query  5    L  3
            L
Sbjct  168  L  168



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR  +G+SVLVTGAAGFVG+HCSLALK+RGDGV+G+DNFN+    +LKR+RQ L
Sbjct  94   VRRSATPRRADGLSVLVTGAAGFVGTHCSLALKRRGDGVVGVDNFNAYYDPALKRSRQVL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+ PR++NG+ VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  78   PAWEKKIKASTKPRSSNGLCVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ+LL
Sbjct  138  RARQELL  144



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNS    SLKRARQ+L
Sbjct  199  VRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPSLKRARQRL  258

Query  5    L  3
            L
Sbjct  259  L  259



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR  +G+SVLVTGAAGFVG+HCSLALK+RGDGV+GLDNFN+    +LKR+RQ L
Sbjct  94   VRRSAAPRRPDGLSVLVTGAAGFVGTHCSLALKRRGDGVVGLDNFNAYYDPALKRSRQAL  153

Query  5    L  3
            L
Sbjct  154  L  154



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNS    SLKRARQ+L
Sbjct  257  VRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPSLKRARQRL  316

Query  5    L  3
            L
Sbjct  317  L  317



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+TPR    +SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+    SLKRARQ+L
Sbjct  107  VRRSATPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNAYYDPSLKRARQRL  166

Query  5    L  3
            L
Sbjct  167  L  167



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+ PR++NGM VLVTGAAGFVG+H S ALK+RG+GVLGLDNFN     SLK
Sbjct  78   PAWEKKIKASAKPRSSNGMCVLVTGAAGFVGTHVSAALKRRGNGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ+LL
Sbjct  138  RARQELL  144



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNS     LKRARQ+L
Sbjct  110  VRKSAKPRKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNSYYDPELKRARQRL  169

Query  5    L  3
            L
Sbjct  170  L  170



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 44/51 (86%), Gaps = 4/51 (8%)
 Frame = -1

Query  143  NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            NG SVLVTGAAGFVGSHCS+ALKKRGDGVLG DNFN     SLKRARQKLL
Sbjct  110  NGFSVLVTGAAGFVGSHCSIALKKRGDGVLGFDNFNDYYDPSLKRARQKLL  160



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score = 84.7 bits (208),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ P    G+SVLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNS    SLKRARQ L
Sbjct  111  VRRSARPSRDGGISVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNSYYDPSLKRARQAL  170

Query  5    L  3
            L
Sbjct  171  L  171


 Score = 25.4 bits (54),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 1/18 (6%)
 Frame = -3

Query  225  LLSSAFYGGGASWEKHVH  172
            L+SSA YGG A+WEK V 
Sbjct  96   LMSSASYGG-AAWEKEVR  112



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ P    G+SVLVTGAAGFVG+HCSLALK RGDGVLGLDNFNS    SLKRARQ L
Sbjct  116  VRRSARPSRDGGISVLVTGAAGFVGTHCSLALKARGDGVLGLDNFNSYYDPSLKRARQAL  175

Query  5    L  3
            L
Sbjct  176  L  176



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFN+     LKRARQ+L
Sbjct  114  VRRSAKPRKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRL  173

Query  5    L  3
            L
Sbjct  174  L  174



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR   G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFN+     LKRARQ+L
Sbjct  114  VRRSAKPRKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRL  173

Query  5    L  3
            L
Sbjct  174  L  174



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSHCSL L+KRGDGVLG DNFN     +LKRARQ L
Sbjct  102  VRQSSTAKRQHGLSVLVTGAAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQAL  161

Query  5    L  3
            L
Sbjct  162  L  162



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S TP+  NG+ VLVTGAAGFVGSH SLALKKRGDG++G+DNFN     SLKRARQ++
Sbjct  95   VRQSCTPKRENGLVVLVTGAAGFVGSHVSLALKKRGDGLVGIDNFNDYYEVSLKRARQEM  154

Query  5    L  3
            L
Sbjct  155  L  155



>gb|AFW61553.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR    +SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+    SLKRARQ+L
Sbjct  105  VRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNAYYDPSLKRARQRL  164

Query  5    L  3
            L
Sbjct  165  L  165



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+TPR   G+SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   IRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPSLKKARKAL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +   G+SVLVTGAAGFVGSHCSL L+KRGDGVLG DNFN     +LKRARQ L
Sbjct  104  VRQSSTAKRPRGLSVLVTGAAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQAL  163

Query  5    L  3
            L
Sbjct  164  L  164



>ref|NP_001150944.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
 gb|ACG41039.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR    +SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+    SLKRARQ+L
Sbjct  105  VRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNAYYDPSLKRARQRL  164

Query  5    L  3
            L
Sbjct  165  L  165



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +  +G+SVLVTGAAGFVGSH SLAL+KRGDGVLG DNFN     SLKRARQ L
Sbjct  98   VRQSSTAKRPHGLSVLVTGAAGFVGSHASLALRKRGDGVLGFDNFNDYYDPSLKRARQDL  157

Query  5    L  3
            L
Sbjct  158  L  158



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score = 80.1 bits (196),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     +LKRARQ L
Sbjct  80   VRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPTLKRARQAL  139

Query  5    L  3
            L
Sbjct  140  L  140


 Score = 29.3 bits (64),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (61%), Gaps = 2/41 (5%)
 Frame = -3

Query  291  LCFVHFQDPPVADNSSNRATNHLLSSAFYGGGASWEKHVHS  169
            + FV F   P + ++S+ +  +L S+ +  GGA+WEK V +
Sbjct  44   VIFVFFYRSPPSSSNSDLSRRYLTSATW--GGAAWEKRVRT  82



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R  NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFNS    SLKRAR+++
Sbjct  78   VRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPSLKRARKRI  137

Query  5    L  3
            L
Sbjct  138  L  138



>ref|XP_006440401.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
 gb|ESR53641.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
Length=427

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     I  S+ PR+T+G++VLVTGAAGFVGSH SLALKKRGDGVLGLDNFN    +SLK
Sbjct  65   PQWEKQIVKSTRPRSTSGLTVLVTGAAGFVGSHVSLALKKRGDGVLGLDNFNNYYETSLK  124

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  125  KARKGLL  131



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score = 84.3 bits (207),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  +  NGM VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS    SLKRARQ+L
Sbjct  89   VRHSARTKRENGMVVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYDPSLKRARQEL  148

Query  5    L  3
            L
Sbjct  149  L  149


 Score = 24.6 bits (52),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 16/39 (41%), Gaps = 2/39 (5%)
 Frame = -3

Query  288  CFVHFQDPPVADNSSNRATNHLLSSAFYGGGASWEKHVH  172
             F H   PP     +   + H  + A   GG+ WEK V 
Sbjct  54   AFFHISAPPAVQ--TGLESRHFGNRALTWGGSKWEKQVR  90



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ P    G+SVLVTGAAGFVG+HCSLALK RGDGV+GLDNFNS    SLKRARQ L
Sbjct  112  MRQSARPSRDGGISVLVTGAAGFVGTHCSLALKARGDGVVGLDNFNSYYDPSLKRARQAL  171

Query  5    L  3
            L
Sbjct  172  L  172



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  +  NGM VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS    SLKRARQ+L
Sbjct  84   VRHSARTKRENGMVVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYDPSLKRARQEL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +   G+SVLVTGAAGFVGSHCSL L+KRGDGVLG DNFN     +LKRARQ L
Sbjct  102  VRQSSTAKRPRGLSVLVTGAAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQAL  161

Query  5    L  3
            L
Sbjct  162  L  162



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 5/62 (8%)
 Frame = -1

Query  173  IRLSSTPR-ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQK  9
            I+ S+ PR A  GMSVLVTGAAGFVG+HC+LAL+ RGDGVLGLDNFNS    SLKRARQ 
Sbjct  112  IKKSAKPRKADGGMSVLVTGAAGFVGTHCALALRARGDGVLGLDNFNSYYDPSLKRARQG  171

Query  8    LL  3
            +L
Sbjct  172  VL  173



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+ PR + G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   IRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_006477270.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Citrus sinensis]
 gb|KDO63776.1| hypothetical protein CISIN_1g042406mg [Citrus sinensis]
Length=424

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     I  S+ PR+T G++VLVTGAAGFVGSH SLALKKRGDGVLGLDNFN    +SLK
Sbjct  62   PQWEKQIVKSTRPRSTRGLTVLVTGAAGFVGSHVSLALKKRGDGVLGLDNFNNYYETSLK  121

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  122  KARKGLL  128



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SST +   G+SVLVTGAAGFVGSHCSL L+KRGDGVLG DNFN     +LKRARQ L
Sbjct  102  VRQSSTAKRPRGLSVLVTGAAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQAL  161

Query  5    L  3
            L
Sbjct  162  L  162



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     I+ S+  R+ NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  80   PDWEKRIKASAKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDQSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQALL  146



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+ PR   G+SVLVTGA GFVG+HCSLALK RGDGV+GLDNFNS    +LKR RQ L
Sbjct  101  IRRSAKPRRDGGLSVLVTGAGGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQAL  160

Query  5    L  3
            L
Sbjct  161  L  161



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN     SLK
Sbjct  78   PAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ LL
Sbjct  138  RARQALL  144



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN     SLK
Sbjct  78   PAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ LL
Sbjct  138  RARQALL  144



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN+    SLK
Sbjct  75   PAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLK  134

Query  23   RARQKLL  3
            RARQ LL
Sbjct  135  RARQALL  141



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN     SLK
Sbjct  78   PAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ LL
Sbjct  138  RARQALL  144



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+TNG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  78   PAWEKRIKASAKIRSTNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ LL
Sbjct  138  RARQTLL  144



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+T R   GMSVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  80   IRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPSLKKAREAL  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN+    SLK
Sbjct  81   PAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLK  140

Query  23   RARQKLL  3
            RARQ LL
Sbjct  141  RARQALL  147



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=435

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG SVLVTGAAGFVG+H S ALKKRGDGVLGLDNFN     SLK
Sbjct  78   PAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ+LL
Sbjct  138  RARQELL  144



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  RA NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  70   PAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPSLK  129

Query  23   RARQKLL  3
            RARQ LL
Sbjct  130  RARQALL  136



>gb|ACN26174.1| unknown [Zea mays]
Length=249

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  32   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGVDNFNAYYDPSLK  91

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  92   KARRALL  98



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN+    SLK
Sbjct  75   PSWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLK  134

Query  23   RARQKLL  3
            RARQ LL
Sbjct  135  RARQALL  141



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  85   VRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQAL  144

Query  5    L  3
            L
Sbjct  145  L  145



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+    +NGMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+    SLKRAR+ L
Sbjct  79   IRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSLKRARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  RA NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  76   PAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLK  135

Query  23   RARQKLL  3
            RARQ LL
Sbjct  136  RARQALL  142



>ref|XP_002965132.1| hypothetical protein SELMODRAFT_82699 [Selaginella moellendorffii]
 gb|EFJ33970.1| hypothetical protein SELMODRAFT_82699 [Selaginella moellendorffii]
Length=83

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = -1

Query  137  MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            M VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS    SLKRARQ+LL
Sbjct  1    MVVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYDPSLKRARQELL  49



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  RA NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  76   PAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLK  135

Query  23   RARQKLL  3
            RARQ LL
Sbjct  136  RARQALL  142



>ref|XP_007039971.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOY24472.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=431

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            I  S+ PR+T G +VLVTGA+GFVG+H SLALK+RGDGVLGLDNFN     +LKRARQK 
Sbjct  80   IHKSARPRSTAGHTVLVTGASGFVGTHVSLALKRRGDGVLGLDNFNQYYDPALKRARQKF  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    +NGMSVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  74   VRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKNL  133

Query  5    L  3
            L
Sbjct  134  L  134



>ref|XP_001761984.1| predicted protein [Physcomitrella patens]
 gb|EDQ73088.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 4/58 (7%)
 Frame = -1

Query  164  SSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            S TP   NG+ VLVTGAAGFVGSH SLALKKRGDG++G+DNFN     SLKRARQ+LL
Sbjct  96   SCTPERENGLVVLVTGAAGFVGSHVSLALKKRGDGLVGIDNFNDYYEVSLKRARQELL  153



>ref|XP_008664162.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Zea mays]
 tpg|DAA48160.1| TPA: hypothetical protein ZEAMMB73_095571 [Zea mays]
Length=450

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+ PR    +SVLVTGAAGFVG HCSLAL  RGDGV+GLDNFN+    SLKRARQ+L
Sbjct  79   VRRSAAPRRDGALSVLVTGAAGFVGLHCSLALSARGDGVVGLDNFNAYYDPSLKRARQRL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFNS    SLK
Sbjct  79   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNSYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRSLL  145



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFNS    SLK
Sbjct  79   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNSYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRSLL  145



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVGSH S ALK+RGDGVLG+DNFN+    SLK
Sbjct  77   PNFEKRVRASAKIRSRNGISVLVTGAAGFVGSHVSAALKRRGDGVLGIDNFNNYYDPSLK  136

Query  23   RARQKLL  3
            RARQ LL
Sbjct  137  RARQALL  143



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  RA NG+SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     SLK
Sbjct  80   PAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGVDNFNDYYDPSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQALL  146



>ref|XP_001767292.1| predicted protein [Physcomitrella patens]
 gb|EDQ67973.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 4/58 (7%)
 Frame = -1

Query  164  SSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            S TP   +G+ VLVTGAAGFVGSH SLALKKRGDG++G+DNFN     SLKRARQKLL
Sbjct  96   SCTPERDDGLVVLVTGAAGFVGSHVSLALKKRGDGLVGIDNFNDYYEVSLKRARQKLL  153



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  81   VRASAKIRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQAL  140

Query  5    L  3
            L
Sbjct  141  L  141



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  80   PSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQALL  146



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  88   PAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLK  147

Query  23   RARQKLL  3
            RARQ LL
Sbjct  148  RARQALL  154



>ref|XP_001754001.1| predicted protein [Physcomitrella patens]
 gb|EDQ81323.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 4/56 (7%)
 Frame = -1

Query  158  TPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            T R  N ++VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS    SLKRARQ+LL
Sbjct  91   TNREDNALTVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYEVSLKRARQELL  146



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    +NGMSVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+    +LK+AR+ L
Sbjct  74   VRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDPTLKKARKNL  133

Query  5    L  3
            L
Sbjct  134  L  134



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  80   PAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQALL  146



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  79   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNAYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARKALL  145



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S   RA NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  92   PSWEKRVRNSGRVRAPNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  151

Query  23   RARQKLL  3
            RARQ LL
Sbjct  152  RARQALL  158



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGVLGLDNFNS    SLK
Sbjct  79   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVLGLDNFNSYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRALL  145



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  79   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGVDNFNAYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARKALL  145



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    + GMSVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+    SLKRAR+ L
Sbjct  82   VRTSAQIHRSGGMSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDPSLKRARKNL  141

Query  5    L  3
            L
Sbjct  142  L  142



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+ P    G+SVLVTGA GFVG+HCSLALK RGDGV+GLDNFNS    +LKR RQ+L
Sbjct  109  IRRSAKPGRDGGLSVLVTGAGGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQQL  168

Query  5    L  3
            L
Sbjct  169  L  169



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            IR S+    +NGMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+     LKRAR+ L
Sbjct  79   IRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPLLKRARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  RA NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  82   PAFEKRVRSSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  141

Query  23   RARQKLL  3
            +ARQ LL
Sbjct  142  KARQALL  148



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  79   IRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVVGVDNFNAYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRALL  145



>ref|XP_001751991.1| predicted protein [Physcomitrella patens]
 gb|EDQ83426.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            I   S  R  N ++VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS    SLKRARQ+L
Sbjct  86   IHSGSPNRNDNALTVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYEVSLKRARQEL  145

Query  5    L  3
            L
Sbjct  146  L  146



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR++ G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  77   VRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  136

Query  5    L  3
            L
Sbjct  137  L  137



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR+S+  R  +G+SVLVTGAAGFVGSH S+AL KRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   IRVSAEVRRAHGISVLVTGAAGFVGSHVSIALHKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NGMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  79   VRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKNL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_010413058.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Camelina 
sativa]
Length=234

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRA--TNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----S  30
            P     IR S+  R   TNG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     S
Sbjct  80   PAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPS  139

Query  29   LKRARQKLL  3
            LKRARQ LL
Sbjct  140  LKRARQALL  148



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  83   VRSSARIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQAL  142

Query  5    L  3
            L
Sbjct  143  L  143



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 78.2 bits (191),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R   G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  72   PAWEKRVRSSARVRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  131

Query  23   RARQKLL  3
            RARQ LL
Sbjct  132  RARQALL  138


 Score = 26.2 bits (56),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 26/59 (44%), Gaps = 3/59 (5%)
 Frame = -3

Query  345  RLNHSVAIVAPHFLTKGQLCFVHFQDPPVADNSSNRATNHLLSSAFYGGGASWEKHVHS  169
            R   SVA +A   L    L F+ F   PV   SSN   +      +  GG +WEK V S
Sbjct  25   RWQSSVAKLAFWSLVFVGLIFIFFYRSPV---SSNPDPSRRSLRTYSWGGPAWEKRVRS  80



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     SLKRARQ L
Sbjct  89   VRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGIDNFNDYYDPSLKRARQAL  148

Query  5    L  3
            L
Sbjct  149  L  149



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  78   PAWEKRIKASAKIRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            RARQ LL
Sbjct  138  RARQTLL  144



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+   A NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLK
Sbjct  70   PAWEKRVRSSAKVXARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLK  129

Query  23   RARQKLL  3
            RARQ LL
Sbjct  130  RARQALL  136



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     +R S+  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN    +SLK
Sbjct  59   PAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLK  118

Query  23   RARQKLL  3
            R+RQ LL
Sbjct  119  RSRQALL  125



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN     SLK AR+KL
Sbjct  80   VRASAQIHRHNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNDYYDPSLKMARKKL  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 5/62 (8%)
 Frame = -1

Query  173  IRLSSTPR-ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQK  9
            +R S  PR   N + VLVTGAAGFVGSH SLAL+KRGDGV+GLDNFNS    SLKRARQ+
Sbjct  80   VRQSCLPRREDNPLVVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNSYYEVSLKRARQE  139

Query  8    LL  3
            LL
Sbjct  140  LL  141



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGA+GFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  80   IRASAAPRRPPGSAAGAGMSVLVTGASGFVGAHCSLALRKRGDGVVGIDNFNAYYDPSLK  139

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  140  KARKALL  146



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     +R S+  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN    +SLK
Sbjct  74   PAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLK  133

Query  23   RARQKLL  3
            R+RQ LL
Sbjct  134  RSRQALL  140



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NGMSVLVTGAAGFVGSH S+ALKKRGDGV+G+DNFN+    SLK+AR+ L
Sbjct  79   VRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGDGVVGIDNFNNYYDPSLKKARKNL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 79.3 bits (194),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R + G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  85   PAWEKCVRSSARVRRSGGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDPSLK  144

Query  23   RARQKLL  3
            RARQ LL
Sbjct  145  RARQALL  151


 Score = 25.0 bits (53),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (47%), Gaps = 1/47 (2%)
 Frame = -3

Query  309  FLTKGQLCFVHFQDPPVADNSSNRATNHLLSSAFYGGGASWEKHVHS  169
            FL    L    F  P   ++SS      L ++A +GG A WEK V S
Sbjct  48   FLAIALLVAFFFLSPTTPNSSSTSGRRSLRNAAPWGGPA-WEKCVRS  93



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  84   VRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  143

Query  5    L  3
            L
Sbjct  144  L  144



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  84   VRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NGMSVLVTGAAGFVGSH S+ALKKRGDGV+G+DNFN+    SLK+AR+ L
Sbjct  79   VRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGDGVVGIDNFNNYYDPSLKKARKDL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR+S+  R   G+SVLVTGAAGFVGSH S+AL KRGDGV+GLDNFNS    SLK+AR+ L
Sbjct  79   IRVSAEVRRPQGISVLVTGAAGFVGSHVSIALHKRGDGVVGLDNFNSYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+  +  NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS     LKRARQ L
Sbjct  94   VRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDPFLKRARQGL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+  +  NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFNS     LKRARQ L
Sbjct  94   VRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDPFLKRARQGL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG +VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  87   VRASAQVRSRNGFAVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQGL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  83   VRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  142

Query  5    L  3
            L
Sbjct  143  L  143



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  83   VRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  142

Query  5    L  3
            L
Sbjct  143  L  143



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     +R S+  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN    +SLK
Sbjct  79   PDWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLK  138

Query  23   RARQKLL  3
            R+RQ LL
Sbjct  139  RSRQALL  145



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S++PR      A  G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+D+FNS    SLK
Sbjct  57   IRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDSFNSYYDPSLK  116

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  117  KARRALL  123



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG +VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  87   VRASAQIRSRNGFAVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQGL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL++RGDGV+G+DNFN+    SLK
Sbjct  79   IRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRRGDGVVGVDNFNAYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRALL  145



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPR------ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S+ PR      A  GMSVLVTGAAGFVG+HCSLAL++RGDGV+G+DNFN+    SLK
Sbjct  79   IRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRRGDGVVGVDNFNAYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRALL  145



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     +LKRARQ L
Sbjct  80   VRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPTLKRARQAL  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NGMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    +LK+AR+ L
Sbjct  79   VRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPTLKKARKNL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     SLKRARQ L
Sbjct  89   VRSSARVRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGIDNFNDYYDPSLKRARQAL  148

Query  5    L  3
            L
Sbjct  149  L  149



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  77   VRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  136

Query  5    L  3
            L
Sbjct  137  L  137



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  77   VRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  136

Query  5    L  3
            L
Sbjct  137  L  137



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            P     +R S+  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN    +SLK
Sbjct  74   PHWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLK  133

Query  23   RARQKLL  3
            R+RQ LL
Sbjct  134  RSRQALL  140



>ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum lycopersicum]
Length=445

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+ PR+  G +VLVTGAAGFVG+H SL LK+RGDGVLGLDNFN      LK+ARQ L
Sbjct  94   VRASARPRSKTGFTVLVTGAAGFVGTHVSLGLKRRGDGVLGLDNFNQYYDVGLKKARQSL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  83   VRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  142

Query  5    L  3
            L
Sbjct  143  L  143



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R  +G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  80   PAWEKRVRSSARVRTRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQALL  146



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +RLS+  R+ + +SVLVTGAAGFVGSH S ALK+RGDGV+GLDNFNS    SLK
Sbjct  50   PQWEKRVRLSARSRSGH-LSVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSLK  108

Query  23   RARQKLL  3
            RARQKLL
Sbjct  109  RARQKLL  115



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +RLS+  R+ + +SVLVTGAAGFVGSH S ALK+RGDGV+GLDNFNS    SLK
Sbjct  50   PQWEKRVRLSARSRSGH-LSVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSLK  108

Query  23   RARQKLL  3
            RARQKLL
Sbjct  109  RARQKLL  115



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+  R   G+SVLVTGAAGFVGSH SLAL+KRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  79   IRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNTYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPR-ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SL  27
            P     IR S+  R ++NGM+VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SL
Sbjct  76   PAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSALKRRGDGVIGLDNFNDYYDPSL  135

Query  26   KRARQKLL  3
            KRARQ LL
Sbjct  136  KRARQALL  143



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPR-ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SL  27
            P     IR S+  R ++NGM+VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SL
Sbjct  76   PAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSALKRRGDGVIGLDNFNDYYDPSL  135

Query  26   KRARQKLL  3
            KRARQ LL
Sbjct  136  KRARQALL  143



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  78   PDWEKRVRSSARVRTRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  137

Query  23   RARQKLL  3
            R RQ LL
Sbjct  138  RTRQALL  144



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    T GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ +
Sbjct  79   VRTSAQIHRTGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKSM  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score = 77.0 bits (188),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATN-GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SL  27
            P     +R S+  R +N G++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SL
Sbjct  76   PAWEKHLRASARIRTSNNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPSL  135

Query  26   KRARQKLL  3
            KRARQ LL
Sbjct  136  KRARQALL  143


 Score = 26.2 bits (56),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 4/64 (6%)
 Frame = -3

Query  351  FPRLNHSVAIVAPHFLTKGQLCFVH---FQDPPVADNSSNRATNHLLSSAFYGGGASWEK  181
            F RL    ++    F +   LC +     + PP  + S +  +   L +  YGG A WEK
Sbjct  22   FHRLRFQSSLTKFAFFSFFLLCLISILFLRSPPSVNPSQSDPSRRSLRTYSYGGPA-WEK  80

Query  180  HVHS  169
            H+ +
Sbjct  81   HLRA  84



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPR-ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SL  27
            P     IR S+  R ++NGM+VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SL
Sbjct  76   PAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSALKRRGDGVIGLDNFNDYYDPSL  135

Query  26   KRARQKLL  3
            KRARQ LL
Sbjct  136  KRARQALL  143



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+     NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  80   VRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKHL  139

Query  5    L  3
            L
Sbjct  140  L  140



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S   R  N   VLVTGAAGF+G+H SLALKKRGDGVLGLDNFN     SLK
Sbjct  80   PAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKRGDGVLGLDNFNDYYDPSLK  139

Query  23   RARQKLL  3
            RARQ LL
Sbjct  140  RARQSLL  146



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score = 76.6 bits (187),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R   G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  69   PAWEKRVRSSARLRFRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLK  128

Query  23   RARQKLL  3
            RARQ LL
Sbjct  129  RARQALL  135


 Score = 26.6 bits (57),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 26/59 (44%), Gaps = 3/59 (5%)
 Frame = -3

Query  345  RLNHSVAIVAPHFLTKGQLCFVHFQDPPVADNSSNRATNHLLSSAFYGGGASWEKHVHS  169
            R   SVA +A   L    L F+ F   PV   SSN   +      +  GG +WEK V S
Sbjct  22   RWQSSVAKLAFWSLVFVGLIFIFFYRSPV---SSNPDPSRRSLRTYSWGGPAWEKRVRS  77



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+ PR+  G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN      LK+AR  L
Sbjct  94   VRASARPRSKTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+ PR+  G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN      LK+AR  L
Sbjct  94   VRASARPRSKTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGL  153

Query  5    L  3
            L
Sbjct  154  L  154



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S   +  NG+ VLVTGAAGFVGSH SLALKKRGDGVLG+DNFN+    SLK
Sbjct  72   PDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVSLALKKRGDGVLGIDNFNNYYDPSLK  131

Query  23   RARQKLL  3
            R+RQ++L
Sbjct  132  RSRQRVL  138



>ref|XP_006363737.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Solanum tuberosum]
Length=446

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSS----LKRARQKL  6
            +R S+ PR+  G +VLVTGAAGFVG+H SL LK+RGDGVLGLDNFN      LK+ARQ L
Sbjct  94   VRASARPRSKTGFTVLVTGAAGFVGTHVSLGLKRRGDGVLGLDNFNQYYDVGLKKARQGL  153

Query  5    L  3
            L
Sbjct  154  L  154



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     +LKRARQ L
Sbjct  84   VRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFNDYYDPTLKRARQAL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            I+ S+  R+ NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLKRARQ+L
Sbjct  84   IKSSAKIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQEL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  86   VRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  145

Query  5    L  3
            L
Sbjct  146  L  146



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R  +G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  75   PAWEKRVRSSARVRTRHGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  134

Query  23   RARQKLL  3
            RARQ LL
Sbjct  135  RARQALL  141



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 4/50 (8%)
 Frame = -1

Query  140  GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            GMSVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFNS    SLK+AR+ LL
Sbjct  100  GMSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNSYYDPSLKKARKALL  149



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            I+ S+  R+ NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLKRARQ+L
Sbjct  84   IKSSAKIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQEL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_010539138.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Tarenaya hassleriana]
Length=445

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 9/69 (13%)
 Frame = -1

Query  197  ERPGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----S  30
            E+P RS     S+    + GMSVLVTGAAGFVGSH SLAL+KRGDGV+GLDNFNS    S
Sbjct  80   EKPVRS-----SAQIHRSGGMSVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNSYYDPS  134

Query  29   LKRARQKLL  3
            LK+AR+ LL
Sbjct  135  LKKARKALL  143



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     +LKRARQ L
Sbjct  84   VRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFNDYYDPTLKRARQAL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R SS    + GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  81   VRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKSL  140

Query  5    L  3
            L
Sbjct  141  L  141



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  85   VRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  144

Query  5    L  3
            L
Sbjct  145  L  145



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGAAGFVG+H S+AL +RGDGVLGLDNFN      LKRARQ L
Sbjct  85   VRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRRGDGVLGLDNFNHYYDPKLKRARQGL  144

Query  5    L  3
            L
Sbjct  145  L  145



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+    + GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+    SLK+AR+ L
Sbjct  79   IRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+ NG +VLVTGAAGFVG+H S ALK+RGDGVLG+DNFN     SLKRARQ L
Sbjct  81   VRASARVRSRNGFAVLVTGAAGFVGTHVSAALKRRGDGVLGIDNFNEYYDPSLKRARQLL  140

Query  5    L  3
            L
Sbjct  141  L  141



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR S+    + GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+    SLK+AR+ L
Sbjct  79   IRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSLKKARKSL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_002509598.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50985.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=437

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 4/58 (7%)
 Frame = -1

Query  164  SSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            S+ P++ +G++VLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN     SLKR RQK+L
Sbjct  86   SARPKSRSGLTVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNHYYDVSLKRGRQKVL  143



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  84   VRKSARPRSHGGLTVLVTGASGFVGTHVSIALQRRGDGVLGLDNFNRYYDPKLKRARQGL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R   G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  73   PAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  132

Query  23   RARQKLL  3
            RARQ LL
Sbjct  133  RARQALL  139



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R   G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  73   PAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  132

Query  23   RARQKLL  3
            RARQ LL
Sbjct  133  RARQALL  139



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  84   VRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  143

Query  5    L  3
            L
Sbjct  144  L  144



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R + GMSVLVTG AGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  77   VRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKAL  136

Query  5    L  3
            L
Sbjct  137  L  137



>dbj|BAD36515.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
 dbj|BAD72456.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
Length=453

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DN+NS    SLK
Sbjct  91   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDNYNSYYDPSLK  150

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  151  KARRALL  157



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S   +   G+ VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN     SLKRARQ L
Sbjct  85   VRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNDYYDQSLKRARQGL  144

Query  5    L  3
            L
Sbjct  145  L  145



>gb|EAY99954.1| hypothetical protein OsI_21957 [Oryza sativa Indica Group]
Length=453

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DN+NS    SLK
Sbjct  91   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDNYNSYYDPSLK  150

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  151  KARRALL  157



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR+  G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  84   VRKSARPRSRGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  143

Query  5    L  3
            L
Sbjct  144  L  144



>gb|EPS64795.1| hypothetical protein M569_09984, partial [Genlisea aurea]
Length=350

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 4/60 (7%)
 Frame = -1

Query  170  RLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            R++ + +    +SVLVTGAAGF+GSH +LALK+RGDGV+GLDNFNS    SLKRARQKLL
Sbjct  4    RVAKSGKPRGHLSVLVTGAAGFIGSHAALALKRRGDGVVGLDNFNSYYDPSLKRARQKLL  63



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+  R+  G+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLKRARQ L
Sbjct  87   VRASAKIRSRTGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQAL  146

Query  5    L  3
            L
Sbjct  147  L  147



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN+    SLK
Sbjct  79   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNNYYDPSLK  138

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  139  KARRALL  145



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLKRARQKL  6
            +R S+ PR   G++VLVTGA+GFVG+H S+AL++RGDGVLGLDNFN      LKRARQ L
Sbjct  85   VRKSARPRTHGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGL  144

Query  5    L  3
            L
Sbjct  145  L  145



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNG-MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SL  27
            P     +R S+  R +NG M+VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SL
Sbjct  75   PAWEKRVRASAQIRTSNGAMTVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSL  134

Query  26   KRARQKLL  3
            KRARQ LL
Sbjct  135  KRARQALL  142



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ +G+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     +LK
Sbjct  79   PAWEKRIKASAKVRSHSGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPTLK  138

Query  23   RARQKLL  3
            RARQ LL
Sbjct  139  RARQALL  145



>ref|XP_009395225.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=433

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            IR SS      GMSVLVTGAAGFVG+H SLAL++RGDGV+GLDNFN+    SLK+ARQ +
Sbjct  79   IRESSAASRPGGMSVLVTGAAGFVGTHVSLALRRRGDGVVGLDNFNNYYDPSLKKARQAM  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     I+ S+  R+ +G+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     +LK
Sbjct  79   PAWEKRIKASAKVRSHSGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPTLK  138

Query  23   RARQKLL  3
            RARQ LL
Sbjct  139  RARQALL  145



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 8/64 (13%)
 Frame = -1

Query  170  RLSSTPR----ATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRAR  15
            RL S+ R     TNG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     SLKRAR
Sbjct  82   RLRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPSLKRAR  141

Query  14   QKLL  3
            Q LL
Sbjct  142  QALL  145



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = -1

Query  170  RLSSTPRATNG-MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            R+ S+ R+ +G  +VLVTGAAGFVGSH S ALK+RGDGV+GLDNFNS    SLKRARQKL
Sbjct  55   RVKSSARSRSGHFTVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSLKRARQKL  114

Query  5    L  3
            L
Sbjct  115  L  115



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRA--TNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----S  30
            P     IR S+  R   TNG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     S
Sbjct  81   PAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPS  140

Query  29   LKRARQKLL  3
            LKRARQ LL
Sbjct  141  LKRARQALL  149



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLK  24
            P     +R S+  R   G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN     SLK
Sbjct  73   PAWEKRVRSSARLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLK  132

Query  23   RARQKLL  3
            RARQ LL
Sbjct  133  RARQALL  139



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRA--TNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----S  30
            P     IR S+  R   TNG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     S
Sbjct  82   PAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPS  141

Query  29   LKRARQKLL  3
            LKRARQ LL
Sbjct  142  LKRARQALL  150



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    + GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  79   VRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKAL  138

Query  5    L  3
            L
Sbjct  139  L  139



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = -1

Query  191  PGRSTFIRLSSTPRA--TNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----S  30
            P     IR S+  R   TNG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN     S
Sbjct  80   PAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYDPS  139

Query  29   LKRARQKLL  3
            LKRARQ LL
Sbjct  140  LKRARQALL  148



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN     SLK
Sbjct  82   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNKYYDPSLK  141

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  142  KARRALL  148



>ref|XP_010323223.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Solanum lycopersicum]
Length=425

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 4/54 (7%)
 Frame = -1

Query  152  RATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            R+  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+    SLK+AR+ LL
Sbjct  82   RSHGGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSLKKARKNLL  135



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 10/67 (15%)
 Frame = -1

Query  173  IRLSSTPRATNG------MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN----SSLK  24
            IR S++PR   G      +SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN     SLK
Sbjct  80   IRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFNKYYDPSLK  139

Query  23   RARQKLL  3
            +AR+ LL
Sbjct  140  KARRALL  146



>ref|XP_006343570.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=425

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 4/54 (7%)
 Frame = -1

Query  152  RATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKLL  3
            R+  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN+    SLK+AR+ LL
Sbjct  82   RSHGGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSLKKARKNLL  135



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  IRLSSTPRATNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNS----SLKRARQKL  6
            +R S+    + GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+    SLK+AR+ L
Sbjct  79   VRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSLKKARKAL  138

Query  5    L  3
            L
Sbjct  139  L  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1688554632492