BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22073_g2_i2 len=1818 path=[1121:0-327 433:328-353 1474:354-402
1523:403-429 25:430-490 86:491-516 1635:517-667 1786:668-672
1791:673-698 1817:699-873 1992:874-1371 2490:1372-1817]

Length=1818
                                                                      Score     E

ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        737   0.0      
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    724   0.0      
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    723   0.0      
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    714   0.0      
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    707   0.0      
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    703   0.0      
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                695   0.0      
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    691   0.0      
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    686   0.0      
emb|CDP17394.1|  unnamed protein product                                679   0.0      
emb|CAN64374.1|  hypothetical protein VITISV_018664                     677   0.0      Vitis vinifera
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        677   0.0      Vitis vinifera
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         665   0.0      
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    662   0.0      Vitis vinifera
emb|CBI17109.3|  unnamed protein product                                673   0.0      
emb|CBI17112.3|  unnamed protein product                                660   0.0      
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        651   0.0      Vitis vinifera
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    647   0.0      
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        648   0.0      
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             643   0.0      
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    639   0.0      
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    638   0.0      
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         638   0.0      Ricinus communis
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         637   0.0      
emb|CDP07008.1|  unnamed protein product                                638   0.0      
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    635   0.0      
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             634   0.0      
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        634   0.0      
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    634   0.0      
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        632   0.0      
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    632   0.0      
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             632   0.0      
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    630   0.0      
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    631   0.0      
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         630   0.0      
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         630   0.0      Ricinus communis
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    628   0.0      
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             622   0.0      
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    621   0.0      
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    619   0.0      
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    617   0.0      
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             616   0.0      
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       617   0.0      
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    616   0.0      
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    615   0.0      
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    614   0.0      
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    613   0.0      
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    613   0.0      
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        611   0.0      Vitis vinifera
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             612   0.0      
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   615   0.0      
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             610   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    608   0.0      
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    606   0.0      
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           607   0.0      
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   607   0.0      
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    603   0.0      
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    602   0.0      
ref|XP_010651746.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    599   0.0      
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    599   0.0      
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    598   0.0      
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   598   0.0      
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    598   0.0      
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    596   0.0      
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    597   0.0      
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    597   0.0      
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    597   0.0      
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             596   0.0      Populus trichocarpa [western balsam poplar]
emb|CAN65360.1|  hypothetical protein VITISV_036071                     598   0.0      Vitis vinifera
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    595   0.0      
emb|CAN63232.1|  hypothetical protein VITISV_004830                     593   0.0      Vitis vinifera
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    595   0.0      
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     593   0.0      
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    593   0.0      
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         587   0.0      
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    590   0.0      
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    589   0.0      
emb|CBI17110.3|  unnamed protein product                                585   0.0      
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    587   0.0      
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    585   0.0      
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    583   0.0      
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    583   0.0      
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             580   0.0      
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    578   0.0      
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     575   0.0      
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    574   0.0      
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    572   0.0      
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    570   0.0      
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     570   0.0      
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        570   0.0      
ref|XP_009591854.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    565   0.0      
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        567   0.0      
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg             567   0.0      
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                    567   0.0      
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   562   0.0      
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    561   0.0      
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g            562   0.0      
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    561   0.0      
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             561   0.0      
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    561   0.0      
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             561   0.0      
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    560   0.0      
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             561   0.0      
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    558   0.0      
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                    558   0.0      
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             554   0.0      
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     558   0.0      
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    556   0.0      
emb|CDY09173.1|  BnaA02g05990D                                          556   0.0      
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         555   0.0      
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             554   0.0      
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    551   0.0      
gb|KDO55292.1|  hypothetical protein CISIN_1g036751mg                   551   0.0      
ref|XP_008458664.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    546   0.0      
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             547   0.0      
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     547   0.0      
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   545   0.0      
ref|XP_006378926.1|  hypothetical protein POPTR_0009s00740g             543   0.0      
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    550   0.0      
emb|CDP14439.1|  unnamed protein product                                539   0.0      
ref|XP_007150133.1|  hypothetical protein PHAVU_005G129500g             536   0.0      
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        537   0.0      Vitis vinifera
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         536   0.0      
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             536   0.0      
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    532   2e-180   
ref|XP_009356965.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    530   3e-180   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         528   4e-180   
ref|XP_006369368.1|  hypothetical protein POPTR_0001s220902g            530   8e-180   
ref|XP_006424409.1|  hypothetical protein CICLE_v10030113mg             531   1e-179   
ref|XP_006485335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    528   3e-179   
gb|KDO44737.1|  hypothetical protein CISIN_1g038117mg                   527   2e-178   
emb|CBI17113.3|  unnamed protein product                                529   2e-177   
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         524   2e-177   Ricinus communis
ref|XP_006369365.1|  hypothetical protein POPTR_0001s220902g            523   5e-177   
ref|XP_006424411.1|  hypothetical protein CICLE_v10028519mg             519   2e-176   
gb|KCW50727.1|  hypothetical protein EUGRSUZ_J00403                     518   2e-175   
emb|CAN64373.1|  hypothetical protein VITISV_018663                     526   3e-175   Vitis vinifera
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        518   6e-175   
ref|XP_010493397.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    516   6e-175   
gb|KCW50433.1|  hypothetical protein EUGRSUZ_J00172                     517   2e-174   
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             516   2e-174   Populus trichocarpa [western balsam poplar]
emb|CDY09174.1|  BnaA02g06000D                                          512   1e-172   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    513   2e-172   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         508   3e-171   Ricinus communis
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             503   3e-170   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         505   1e-169   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    500   1e-167   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    517   8e-167   
ref|XP_010421084.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    491   3e-165   
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         486   3e-164   
ref|NP_197677.2|  Serine carboxypeptidase S28 family protein            486   5e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    483   5e-163   
ref|XP_011004991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    486   7e-163   
ref|XP_011005222.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    484   4e-162   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    481   6e-161   
ref|XP_004172321.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    479   1e-160   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    477   4e-159   
ref|XP_006494702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    471   1e-158   
ref|XP_006494706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    469   7e-158   
gb|KCW50728.1|  hypothetical protein EUGRSUZ_J00403                     471   1e-157   
emb|CBI17114.3|  unnamed protein product                                469   8e-157   
emb|CDP07009.1|  unnamed protein product                                467   1e-155   
ref|XP_006436579.1|  hypothetical protein CICLE_v10033867mg             462   5e-154   
ref|XP_006424410.1|  hypothetical protein CICLE_v10030022mg             461   2e-153   
gb|KCW50734.1|  hypothetical protein EUGRSUZ_J00406                     460   9e-153   
ref|XP_006369369.1|  hypothetical protein POPTR_0001s220902g            456   1e-151   
gb|ABR16397.1|  unknown                                                 452   3e-149   Picea sitchensis
ref|XP_006408697.1|  hypothetical protein EUTSA_v10002179mg             446   8e-148   
emb|CDX71016.1|  BnaC03g11000D                                          444   4e-147   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    441   1e-145   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        443   1e-145   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    442   3e-145   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    442   5e-145   
gb|KCW50724.1|  hypothetical protein EUGRSUZ_J00402                     437   2e-144   
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        440   4e-144   
gb|KCW50731.1|  hypothetical protein EUGRSUZ_J004041                    433   5e-144   
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    434   6e-144   
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    439   6e-144   
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             439   7e-144   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    437   2e-143   
gb|KHN29944.1|  Lysosomal Pro-X carboxypeptidase                        431   4e-143   
ref|XP_008344905.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   6e-143   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    436   9e-143   Vitis vinifera
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                435   1e-142   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           436   1e-142   
emb|CDP10629.1|  unnamed protein product                                436   2e-142   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             434   2e-142   
gb|ABR17702.1|  unknown                                                 434   3e-142   Picea sitchensis
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    434   4e-142   
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   6e-142   
emb|CBI30345.3|  unnamed protein product                                432   2e-141   
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        432   2e-141   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        432   2e-141   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   2e-141   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   3e-141   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             432   3e-141   Populus trichocarpa [western balsam poplar]
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             431   7e-141   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    441   8e-141   
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    430   1e-140   
emb|CDY20293.1|  BnaC04g36630D                                          430   1e-140   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    429   2e-140   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    430   3e-140   
emb|CDY46135.1|  BnaA04g14230D                                          429   4e-140   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    429   4e-140   
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              428   1e-139   
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    428   1e-139   
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         427   1e-139   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         428   1e-139   Ricinus communis
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             427   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   2e-139   
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        427   4e-139   
ref|XP_006388622.1|  hypothetical protein POPTR_0135s002102g            421   4e-139   
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         426   5e-139   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    427   5e-139   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    426   6e-139   
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         426   6e-139   Ricinus communis
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        426   7e-139   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             426   7e-139   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    426   8e-139   
ref|XP_008344907.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   1e-138   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    425   1e-138   
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             417   2e-138   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           424   2e-138   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    424   6e-138   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        423   6e-138   
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        423   1e-137   
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        422   2e-137   
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        422   2e-137   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          422   3e-137   
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    422   3e-137   
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    421   4e-137   
emb|CDP10200.1|  unnamed protein product                                421   5e-137   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        420   1e-136   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         420   1e-136   
gb|EPS74090.1|  hypothetical protein M569_00662                         419   1e-136   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   2e-136   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   2e-136   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   3e-136   
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          419   4e-136   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                418   5e-136   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    417   7e-136   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        419   7e-136   
emb|CBI18675.3|  unnamed protein product                                417   2e-135   
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         417   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    417   2e-135   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    417   3e-135   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        416   3e-135   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    426   5e-135   
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        416   5e-135   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    416   5e-135   
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         416   6e-135   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    415   1e-134   
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    415   2e-134   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    415   2e-134   
ref|XP_006494707.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    409   3e-134   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    414   3e-134   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        414   3e-134   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    414   3e-134   
ref|NP_001058206.1|  Os06g0647400                                       414   8e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        413   8e-134   
ref|XP_006378927.1|  hypothetical protein POPTR_0009s00740g             407   1e-133   
emb|CDY45627.1|  BnaCnng13350D                                          412   1e-133   
gb|EEC81080.1|  hypothetical protein OsI_23902                          414   1e-133   Oryza sativa Indica Group [Indian rice]
emb|CDY08753.1|  BnaA06g24710D                                          412   1e-133   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   2e-133   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   2e-133   
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   2e-133   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    410   2e-133   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        412   2e-133   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    411   3e-133   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    410   5e-133   
ref|XP_001776094.1|  predicted protein                                  411   5e-133   
ref|XP_008349805.1|  PREDICTED: uncharacterized protein LOC103413093    433   7e-133   
gb|KCW50729.1|  hypothetical protein EUGRSUZ_J00403                     405   1e-132   
dbj|BAJ87416.1|  predicted protein                                      410   1e-132   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    409   2e-132   
dbj|BAJ92142.1|  predicted protein                                      410   2e-132   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    409   3e-132   
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    409   3e-132   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          410   6e-132   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    407   7e-132   
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            408   1e-131   
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    408   1e-131   
ref|XP_006369373.1|  hypothetical protein POPTR_0001s221002g            400   2e-131   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             407   2e-131   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             407   2e-131   
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    407   2e-131   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    406   3e-131   
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     407   5e-131   
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    405   7e-131   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    407   7e-131   
dbj|BAJ86079.1|  predicted protein                                      405   1e-130   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              405   2e-130   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   404   2e-130   
gb|EPS59259.1|  hypothetical protein M569_15548                         402   2e-130   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    403   5e-130   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             402   1e-129   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         402   2e-129   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    402   2e-129   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             402   2e-129   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    401   2e-129   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        401   3e-129   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     399   4e-129   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        400   7e-129   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    401   7e-129   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    401   7e-129   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             400   1e-128   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        400   1e-128   
gb|KCW50736.1|  hypothetical protein EUGRSUZ_J00407                     391   3e-128   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    399   5e-128   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    397   1e-127   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    396   2e-127   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    397   2e-127   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        394   3e-127   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     397   3e-127   
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       396   4e-127   
ref|XP_006369370.1|  hypothetical protein POPTR_0001s220902g            391   4e-127   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   6e-127   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    396   6e-127   
emb|CDP02648.1|  unnamed protein product                                395   6e-127   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   6e-127   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              396   7e-127   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           395   9e-127   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        396   2e-126   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   2e-126   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    393   2e-126   
ref|XP_004139566.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    387   3e-126   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    393   4e-126   
emb|CDM83096.1|  unnamed protein product                                394   4e-126   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    393   4e-126   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   2e-125   
ref|NP_001044360.1|  Os01g0767100                                       391   3e-125   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        391   3e-125   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         391   4e-125   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              389   6e-125   
dbj|BAK01568.1|  predicted protein                                      390   9e-125   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        389   1e-124   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    391   1e-124   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     390   2e-124   
gb|AFW87518.1|  putative serine peptidase S28 family protein            404   3e-124   
dbj|BAK05623.1|  predicted protein                                      387   1e-123   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     379   2e-123   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        386   2e-123   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    386   2e-123   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             385   3e-123   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    385   3e-123   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        384   2e-122   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        385   2e-122   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    382   1e-121   
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           379   4e-121   
gb|ABR17682.1|  unknown                                                 380   5e-121   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          380   7e-121   
ref|XP_002299661.1|  hypothetical protein POPTR_0001s22070g             376   2e-120   
gb|AAM15096.1|  putative prolylcarboxypeptidase                         377   2e-120   
gb|AFW87519.1|  putative serine peptidase S28 family protein            380   2e-120   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    376   7e-120   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               377   8e-120   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        374   9e-120   
gb|AFW84965.1|  putative serine peptidase S28 family protein            375   4e-119   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              374   5e-119   
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          375   1e-118   
gb|EAY75958.1|  hypothetical protein OsI_03875                          373   6e-118   
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    369   1e-117   
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    371   2e-117   
ref|XP_004151265.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    365   3e-117   
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     367   9e-117   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  368   1e-116   
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    369   2e-116   
gb|EAY80009.1|  hypothetical protein OsI_35177                          367   4e-116   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  358   5e-116   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          368   6e-116   
ref|NP_001065793.1|  Os11g0156200                                       366   1e-115   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      365   2e-115   
gb|EEE66119.1|  hypothetical protein OsJ_22160                          361   4e-115   
emb|CDX68714.1|  BnaC01g07390D                                          358   2e-114   
gb|KDO36924.1|  hypothetical protein CISIN_1g023602mg                   354   4e-114   
gb|AIA26578.1|  serine protease                                         357   5e-114   
ref|XP_006495294.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    353   8e-114   
ref|XP_006484930.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    350   8e-113   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          360   2e-112   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    353   9e-112   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    351   2e-111   
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             352   6e-111   
ref|XP_006430124.1|  hypothetical protein CICLE_v10011529mg             346   7e-109   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        352   9e-109   
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        347   1e-108   
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             345   4e-108   
ref|XP_006388624.1|  hypothetical protein POPTR_0135s00220g             338   3e-107   
ref|XP_008385547.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   5e-106   
ref|XP_008360152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   7e-106   
gb|KDO60325.1|  hypothetical protein CISIN_1g023618mg                   332   2e-105   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   7e-105   
ref|XP_004295647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    329   2e-104   
ref|XP_010675581.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   4e-103   
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             332   6e-103   
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    328   5e-102   
ref|XP_010676045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    327   2e-101   
emb|CDY09175.1|  BnaA02g06010D                                          325   3e-101   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    323   3e-100   
gb|KDO44739.1|  hypothetical protein CISIN_1g047044mg                   317   5e-100   
ref|XP_010424236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    315   1e-98    
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  317   2e-97    
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    317   7e-97    
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    314   2e-96    
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    312   8e-96    
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    314   9e-96    
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    310   3e-95    
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        311   6e-95    
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    309   7e-95    
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        306   2e-94    
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    310   2e-94    
ref|NP_001072639.1|  lysosomal Pro-X carboxypeptidase precursor         310   4e-94    
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        309   6e-94    
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    309   9e-94    
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        307   1e-93    
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181              307   1e-93    
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    308   1e-93    
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    308   1e-93    
ref|NP_001033253.1|  lysosomal Pro-X carboxypeptidase precursor         308   1e-93    
ref|XP_006055696.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        308   2e-93    
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        308   2e-93    
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    307   3e-93    
ref|XP_006436577.1|  hypothetical protein CICLE_v10033555mg             300   3e-93    
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           306   5e-93    
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    306   6e-93    
gb|KDO36925.1|  hypothetical protein CISIN_1g023602mg                   298   6e-93    
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        306   6e-93    
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor            306   7e-93    
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        306   8e-93    
gb|AAH26424.1|  Prcp protein                                            305   8e-93    
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    305   2e-92    
gb|AAH55022.1|  Prcp protein                                            305   2e-92    
ref|XP_002532920.1|  catalytic, putative                                296   3e-92    
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             304   3e-92    
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        305   3e-92    
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    305   4e-92    
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    305   5e-92    
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         304   5e-92    
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    304   5e-92    
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    303   5e-92    
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    304   5e-92    
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   5e-92    
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    304   6e-92    
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        304   6e-92    
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   6e-92    
ref|XP_001628070.1|  predicted protein                                  302   7e-92    
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    304   7e-92    
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   8e-92    
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   1e-91    
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        307   1e-91    
ref|XP_004019472.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    304   1e-91    
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   1e-91    
ref|XP_003507065.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   1e-91    
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   1e-91    
ref|XP_007236792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   2e-91    
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   2e-91    
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   2e-91    
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   2e-91    
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   2e-91    
ref|XP_008018493.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   2e-91    
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   3e-91    
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   3e-91    
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   3e-91    
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   3e-91    
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        300   4e-91    
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   4e-91    
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   4e-91    
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    302   4e-91    
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   4e-91    
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   4e-91    
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    301   5e-91    
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    301   5e-91    
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        299   5e-91    
ref|XP_010361179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   6e-91    
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    301   6e-91    
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   6e-91    
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        299   7e-91    
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   7e-91    
ref|XP_006577089.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    298   7e-91    
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   7e-91    
ref|XP_010002716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   8e-91    
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   8e-91    
gb|KDO70542.1|  hypothetical protein CISIN_1g0106561mg                  297   8e-91    
gb|ACE75287.1|  prolylcarboxypeptidase                                  301   1e-90    
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        299   1e-90    
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   1e-90    
ref|XP_006424416.1|  hypothetical protein CICLE_v10028929mg             291   1e-90    
gb|KFU94741.1|  Lysosomal Pro-X carboxypeptidase                        298   2e-90    
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        298   2e-90    
ref|XP_001175153.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   2e-90    
ref|XP_004051942.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   2e-90    
ref|XP_004590083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   2e-90    
ref|NP_001125428.1|  lysosomal Pro-X carboxypeptidase precursor         300   2e-90    
ref|XP_002754795.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   3e-90    



>ref|XP_009631310.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=523

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/477 (74%), Positives = 402/477 (84%), Gaps = 2/477 (0%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRLTPL E+IL R S+  SS  +  L   F T+YY QTLDHFNYGP+SY+TFKQRYI
Sbjct  44    HKIPRLTPLLENIL-RDSNTLSSSSSFTLPKAFETYYYTQTLDHFNYGPKSYSTFKQRYI  102

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++S YWGG+ SNSPIFA+LGAES ID DP  IGFLTD APRFKALLVYIEHRYYGKSIPF
Sbjct  103   INSNYWGGSNSNSPIFAYLGAESSIDSDPLGIGFLTDFAPRFKALLVYIEHRYYGKSIPF  162

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             GTMEEA+ +E  RGYFNSAQA+ADYAE+LL++K K+ AQ+SPIIV GGSYGGMLASWFR+
Sbjct  163   GTMEEALKDEDRRGYFNSAQAIADYAELLLHVKEKFSAQNSPIIVIGGSYGGMLASWFRM  222

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKEVS+ CY+TIRKSWS+IDKIAS+
Sbjct  223   KYPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEVSKTCYRTIRKSWSIIDKIASR  282

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              NGLS LS+KFK C  L S  ELKDYLDS Y TAAQY++PP YPVT VCGGIDGA KG+ 
Sbjct  283   NNGLSYLSRKFKTCSHLNSSSELKDYLDSIYATAAQYNKPPTYPVTVVCGGIDGAHKGSH  342

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             +LDRIHAG+V  +GN TCY+   YN P SET +GWRWQTCSEM MPIGRG  DTMF+ AP
Sbjct  343   VLDRIHAGIVASQGNLTCYNTNFYNQP-SETSMGWRWQTCSEMVMPIGRGKNDTMFYSAP  401

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++ +F   C   YGV PRPHWITTYYGGHD+KL+LH+F SNIIFSNGLRDPYSSAGVL+
Sbjct  402   FNLDEFIDACKSNYGVSPRPHWITTYYGGHDVKLILHRFASNIIFSNGLRDPYSSAGVLQ  461

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             DIS ++ AV+TRNGSHCLDI  +  TDPDWLT QRK EVEII+ WITKYY +L ALK
Sbjct  462   DISHSLRAVHTRNGSHCLDILTSKPTDPDWLTMQRKTEVEIIEGWITKYYADLNALK  518



>ref|XP_009779688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=509

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/478 (72%), Positives = 400/478 (84%), Gaps = 2/478 (0%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTK-PLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             HKIPRLTPL E+IL+ S++  SS  +   L   F T+YY QTLDHFNYGP+SY+TFKQRY
Sbjct  28    HKIPRLTPLVENILKDSNTLSSSSSSSFTLPKEFETYYYTQTLDHFNYGPKSYSTFKQRY  87

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             I++SKYWGG+ S+S IFA+LGAES ID DP  IGFLTD APRFKALLVY+EHRYYGKSIP
Sbjct  88    IINSKYWGGSNSSSTIFAYLGAESSIDGDPLGIGFLTDFAPRFKALLVYMEHRYYGKSIP  147

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FGTMEEA+ +E  RGYFNSAQA+ADYAE+LL++K K+ AQ+SPIIV GGSYGGMLASWFR
Sbjct  148   FGTMEEALKDEDRRGYFNSAQAIADYAELLLHVKEKFSAQNSPIIVIGGSYGGMLASWFR  207

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             +KYPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKEVS  CY+TIRKSWS+IDKIAS
Sbjct  208   MKYPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEVSNTCYRTIRKSWSIIDKIAS  267

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             + NGLS LS+KFK C  L +  ELKDYLDS Y TAAQY+ PP YPVT VCGGIDGA KG+
Sbjct  268   RKNGLSYLSRKFKTCSHLNNSSELKDYLDSIYATAAQYNTPPTYPVTVVCGGIDGAHKGS  327

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
              +LDRI+AG+V  +G   CY+  +YN P SET +GWRWQTCSEM MPIGRG  +TMF+  
Sbjct  328   HVLDRIYAGIVAFQGKLKCYNTNLYNQP-SETYMGWRWQTCSEMVMPIGRGKNETMFYSD  386

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF++ +F   C  YYGV PRPHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL
Sbjct  387   PFNLDEFVDACKSYYGVSPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVL  446

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             +DIS ++ AV+TRNGSHCLDI  +  TDP+WLT QRK EVEII+ WITKYY +L ALK
Sbjct  447   QDISHSLRAVHTRNGSHCLDILTSKPTDPEWLTMQRKTEVEIIEGWITKYYADLNALK  504



>ref|XP_004250994.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/480 (70%), Positives = 397/480 (83%), Gaps = 3/480 (1%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRLTPL E+I+Q  S+  SS     L   F T+YY+QTLDHFNYGP+SY+TFKQRYI
Sbjct  26    HKIPRLTPLIENIIQDHSNTFSSSSRNDLPKEFETYYYKQTLDHFNYGPKSYSTFKQRYI  85

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SKYWGG+ SNSPIFA+LGAES ID DP  IGFLTD AP+FKALLVY+EHRYYG+SIPF
Sbjct  86    INSKYWGGSNSNSPIFAYLGAESSIDRDPLGIGFLTDFAPQFKALLVYMEHRYYGESIPF  145

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              TMEEA+ +E +RGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR+
Sbjct  146   KTMEEALKDEDSRGYFNSAQAIADYAELLLHIKQKYSAKNSPIIVIGGSYGGMLASWFRM  205

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S +CY TIRKSW++IDKIAS 
Sbjct  206   KYPHIALGALASSAPILYFDNITPQNGYYSIVSRDFKEASASCYHTIRKSWAIIDKIASG  265

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              NGLS LS+KFK C  L  P ELK+YLD+ Y  AAQY+ PP YPVT VCGGIDGAPKG+ 
Sbjct  266   KNGLSYLSRKFKTCSKLNDPFELKNYLDTMYSVAAQYNSPPSYPVTIVCGGIDGAPKGSH  325

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             ILDRI AG+V   GN +CY+    NP  SET +GWRWQTCSEM MPIGRG  DTMFF AP
Sbjct  326   ILDRIFAGIVEFNGNSSCYN---MNPMPSETSLGWRWQTCSEMVMPIGRGKNDTMFFSAP  382

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++  F ++C   YGV PRPHW+TTYYGG DIKL+  +F SNIIFSNGLRDPYSSAGVL+
Sbjct  383   FNLNNFIKNCKKMYGVSPRPHWVTTYYGGQDIKLIFQRFASNIIFSNGLRDPYSSAGVLQ  442

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1612
             DISD++LAV+TRNGSHCLDI     +DP+WLT QR  EV+II+ WITKYY +L+A+K+ K
Sbjct  443   DISDSLLAVHTRNGSHCLDILSKMSSDPEWLTMQRNTEVKIIEGWITKYYADLKAIKKGK  502



>ref|XP_006349128.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=504

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/480 (70%), Positives = 395/480 (82%), Gaps = 3/480 (1%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRLTPL ++ILQ  S+  SS     L   F T+YY+QTLDHFNYGP+SY+TFKQRYI
Sbjct  26    HKIPRLTPLIQNILQDHSNTFSSSTNDDLPKEFETYYYKQTLDHFNYGPKSYSTFKQRYI  85

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SKYWGG+ S+SPIFA+LGAES ID DP  +GFLTD AP+FKALLVY+EHRYYG+S PF
Sbjct  86    INSKYWGGSNSSSPIFAYLGAESSIDGDPLGVGFLTDFAPQFKALLVYMEHRYYGESTPF  145

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              TMEEA+ +E TRGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR+
Sbjct  146   KTMEEAVKDEDTRGYFNSAQAIADYAELLLHIKEKYSAKNSPIIVIGGSYGGMLASWFRM  205

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S++CY TIR SW++IDKIAS+
Sbjct  206   KYPHIALGALASSAPILYFDNITPQNGYYSVVSRDFKEASKSCYHTIRNSWAIIDKIASR  265

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              +GLS LS+KFK C  L  P ELKDYLDS Y  AAQY+ PP YPVT VCGGIDGAPKG+ 
Sbjct  266   KSGLSYLSRKFKTCSKLNDPFELKDYLDSMYSVAAQYNSPPSYPVTIVCGGIDGAPKGSH  325

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             ILDRI AG+V   G  +CY+    NP  SET +GWRWQTCSEM MPIGRG+ DTMFF AP
Sbjct  326   ILDRIFAGIVAYSGTSSCYN---MNPKPSETGLGWRWQTCSEMVMPIGRGENDTMFFSAP  382

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++  F  DC   YGV PRPHWITTYYGG DIKL+L +F SNIIFSNGLRDPYSSAGVL+
Sbjct  383   FNLNNFITDCKKKYGVSPRPHWITTYYGGKDIKLILQRFASNIIFSNGLRDPYSSAGVLQ  442

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1612
             DIS ++ AV+TRNGSHCLDI     +DP+WLT QR  EV+II+ WITKYY +L+ALK+ K
Sbjct  443   DISHSLQAVHTRNGSHCLDILSKDSSDPEWLTMQRNTEVKIIEGWITKYYADLKALKKGK  502



>ref|XP_004251370.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/480 (69%), Positives = 393/480 (82%), Gaps = 3/480 (1%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRLTPL E+  Q  S+  SS     L   F T YY+QTLDHFNYGP+SY+TFKQRYI
Sbjct  26    HKIPRLTPLIENKHQDHSNTFSSSTNDDLPKEFETCYYKQTLDHFNYGPKSYSTFKQRYI  85

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SKYWGG+ S+SPIFA+LGAES ID DP  IGFLTD AP+FKALLVY+EHRYYG+S PF
Sbjct  86    INSKYWGGSNSSSPIFAYLGAESSIDSDPLGIGFLTDFAPQFKALLVYMEHRYYGESTPF  145

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              TMEEA+ +E +RGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR+
Sbjct  146   KTMEEALKDEDSRGYFNSAQAIADYAELLLHIKQKYSAKNSPIIVIGGSYGGMLASWFRM  205

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S +CY TIRKSW++IDKIAS 
Sbjct  206   KYPHIALGALASSAPILYFDNITPQNGYYSIVSRDFKEASASCYHTIRKSWAIIDKIASG  265

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              NGLS LS+KFK C  L  P ELKDYLDS Y  AAQY+ PP YPVT VCGGIDGAPKG+ 
Sbjct  266   KNGLSYLSRKFKTCSKLNDPFELKDYLDSMYSEAAQYNSPPSYPVTIVCGGIDGAPKGSH  325

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             ILDRI AG+V  +GN +CY+    NP  SE  +GWRWQTCSEM MPIGRG+ DTMF+  P
Sbjct  326   ILDRIFAGIVAYKGNSSCYN---MNPMPSEEDLGWRWQTCSEMVMPIGRGENDTMFYSDP  382

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++  F +DC   YGV PR HWITTYYGG DIKL+L +F SNIIFSNGLRDPYSSAGVL+
Sbjct  383   FNLNNFIKDCKKKYGVSPRSHWITTYYGGQDIKLILQRFASNIIFSNGLRDPYSSAGVLQ  442

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1612
             DIS+++ AV+TRNGSHCLDI   + +DP+WLT QR  EV+II+ WITKYY +L+A+K+ K
Sbjct  443   DISNSLQAVHTRNGSHCLDILSKTSSDPEWLTMQRNTEVKIIEGWITKYYADLKAIKKGK  502



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/479 (68%), Positives = 396/479 (83%), Gaps = 4/479 (1%)
 Frame = +2

Query  173   HKIPRLTPLY-ESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             HKIPRL+P   E+++ R+     S  T  +S  F+T +Y QTLDHFNY PQSYATF+QRY
Sbjct  26    HKIPRLSPHNKEALILRNPDDVIS--TSAISKDFKTHFYSQTLDHFNYAPQSYATFRQRY  83

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +V+SKYWGG  SNSPIFA+LGAE+P+D+D + IGFL DNAP FK+L VYIEHR+YGKS+P
Sbjct  84    VVNSKYWGGPTSNSPIFAYLGAEAPLDEDQEVIGFLNDNAPHFKSLSVYIEHRFYGKSVP  143

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG ME+AM N T RGYF+SAQA+ADYAE+LL++K+K+ A +SPIIV GGSYGG LASWFR
Sbjct  144   FGKMEDAMKNATLRGYFSSAQAIADYAEILLHVKHKFAAHYSPIIVVGGSYGGKLASWFR  203

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFDNITP+NGYYS+VTKDF+EVS+NCYQTI+ SW+ IDK+AS
Sbjct  204   LKYPHIALGALASSAPVLYFDNITPQNGYYSIVTKDFEEVSKNCYQTIKNSWAEIDKVAS  263

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP GLSILS++FK C  L +  ELKD+LD+ Y  AAQY+ PP YPVT VC GIDGAP G 
Sbjct  264   KPKGLSILSQRFKTCSHLNNSDELKDFLDTMYSVAAQYNHPPTYPVTVVCKGIDGAPAGT  323

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D++ RI AGVV   GNRTCYD   YN P SET VGW WQTCSE+ +PIGRG+ DTMF  A
Sbjct  324   DVIGRIFAGVVSYRGNRTCYDTNAYNYP-SETSVGWEWQTCSEIVIPIGRGENDTMFPAA  382

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF + +F++ C D+YGVPPRPHWITTYYGGHDIKLVL++FGSNIIFSNGLRDPYSS GVL
Sbjct  383   PFDLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGLRDPYSSGGVL  442

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ED+S++++AV T  GSHCLDI  ++KTDPDWL  QRK+E+EII+ W+  YY +L+ALKR
Sbjct  443   EDLSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGWLKTYYSDLQALKR  501



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/490 (66%), Positives = 396/490 (81%), Gaps = 4/490 (1%)
 Frame = +2

Query  146   LSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQS  325
             +    P P+HK PRL+   +  L  S S+     +      F+T++YRQTLDHFNY PQS
Sbjct  27    MQTVTPLPVHKAPRLSLHNKDALLISRSRPGGAISANALLDFKTYFYRQTLDHFNYAPQS  86

Query  326   YATFKQRYIVSSKYWGGAQ-SNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIE  502
             YATF+QRY+V+SKYWGG   +NSPIFA+LGAE+PID+D   +GFL DNAP F +L+V+IE
Sbjct  87    YATFRQRYVVNSKYWGGQSFNNSPIFAYLGAEAPIDNDLSVVGFLNDNAPSFNSLIVFIE  146

Query  503   HRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSY  682
             HRYYGKSIPFGTMEEAM NETTRGYFNSAQA+ADYA +L ++K+++ A  SPIIV GGSY
Sbjct  147   HRYYGKSIPFGTMEEAMKNETTRGYFNSAQAIADYAAILSHIKHQFSAHDSPIIVVGGSY  206

Query  683   GGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKS  862
             GGMLASWFRLKYPH+ALGALASSAPILYFDNITP+NGYYS+VTKDFKEVS+NCY+TIR+S
Sbjct  207   GGMLASWFRLKYPHIALGALASSAPILYFDNITPQNGYYSIVTKDFKEVSDNCYKTIRRS  266

Query  863   WSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCG  1042
             W+ ID++ASKPNGL ILS++FK C  L +  ELKDYL++ Y  AAQY++PP YPVT VC 
Sbjct  267   WAEIDRVASKPNGLDILSQRFKTCSKLNNAEELKDYLETIYAVAAQYNRPPNYPVTMVCR  326

Query  1043  GIDGAPKGA--DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1216
             GIDG   G+  D++ RI AGVV  +GN+TCYD   YN P SET +GW+WQTCSEM MPIG
Sbjct  327   GIDGVHNGSDGDVIGRIFAGVVSYKGNKTCYDMNTYNYP-SETSIGWQWQTCSEMVMPIG  385

Query  1217  RGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNG  1396
             RG  +TMF  APF++ +F + C + YGVPPRPHWITTYYGGHDIKL L++FGSNIIFSNG
Sbjct  386   RGQNETMFPAAPFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNG  445

Query  1397  LRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITK  1576
             LRDPYSS GVLED+S++V+AV TRNGSHCLDI  A+KTDP+WL  QR  E++IIQ W+T 
Sbjct  446   LRDPYSSGGVLEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGWLTT  505

Query  1577  YYVELEALKR  1606
             YY +L++L +
Sbjct  506   YYADLKSLNK  515



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/478 (68%), Positives = 392/478 (82%), Gaps = 7/478 (1%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKI  LTPL ++IL+ S++  +S    P  + F T++Y QTLDHFNYGP+SY+TFKQRYI
Sbjct  30    HKIQTLTPLLKNILKDSNTLSNSSTNLP--NEFETYFYTQTLDHFNYGPKSYSTFKQRYI  87

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SKYWGG+ S+SPIFA+LGAES ID+DP  IGFLTD APRFKALLVY+EHRYYG+SIP 
Sbjct  88    INSKYWGGSNSSSPIFAYLGAESSIDNDPLNIGFLTDFAPRFKALLVYMEHRYYGQSIPL  147

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G +EEA+ ++ TRGYFNSAQA+ADYAE+LL++K ++ A +SPIIV GGSYGGMLASWFRL
Sbjct  148   GKIEEALKDQDTRGYFNSAQAIADYAELLLHVKEQFSAPNSPIIVIGGSYGGMLASWFRL  207

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+A+GALASSAPILYFD+ITP+NGYYS+VTKDF+E SE+CYQTIR SWS+IDKIAS 
Sbjct  208   KYPHIAIGALASSAPILYFDDITPQNGYYSIVTKDFREASESCYQTIRDSWSIIDKIAST  267

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              +GLS LS+KFK C  L +  +LK YLDSTY  AAQYD PP+YPVT +CGGIDGA  G+D
Sbjct  268   KDGLSYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTLICGGIDGATNGSD  327

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             +LDRI AG+V  EGN++CY+     P      +GW WQTCSEM MPIGRG+ DTMF+ +P
Sbjct  328   VLDRIFAGIVAYEGNKSCYNILPGQPD-----LGWDWQTCSEMVMPIGRGENDTMFYSSP  382

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++ QF  DC   YGV PRPHW+TTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL+
Sbjct  383   FNLDQFIEDCKSDYGVSPRPHWVTTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLQ  442

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             D+SD++LAV TRNGSHCLDI  +   DP+WLT QR +EVEII+ WIT Y  +L+ LK 
Sbjct  443   DLSDSLLAVTTRNGSHCLDILTSQPNDPEWLTLQRNREVEIIEGWITTYCADLKVLKN  500



>ref|XP_006349129.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=453

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/451 (71%), Positives = 379/451 (84%), Gaps = 3/451 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  F T+YY+QTLDHFNYGP+SY+TFKQRYI++SKYWGG+ S+SPIFA+LGAES ID DP
Sbjct  4     SHEFETYYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAYLGAESSIDGDP  63

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               +GFLTD AP+FKALLVY+EHRYYG+S PF TMEEA+N+E TRGYFNSAQA+ADYAE+L
Sbjct  64    LGVGFLTDFAPQFKALLVYMEHRYYGESTPFKTMEEAVNDEDTRGYFNSAQAIADYAELL  123

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             L++K KY A++SPIIV GGSYGGMLASWFR+KYPH+ALGALASSAPILYFDNITP+NGYY
Sbjct  124   LHIKEKYSAKNSPIIVIGGSYGGMLASWFRMKYPHIALGALASSAPILYFDNITPQNGYY  183

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
             S+V++DFKE S++CY  IRKSW +I+KIAS+ NGLS LS+KFK C  L  P ELKDYLDS
Sbjct  184   SVVSRDFKEASKSCYHNIRKSWEIINKIASRKNGLSYLSRKFKTCSKLNDPFELKDYLDS  243

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1159
              Y  AAQY+ PP YPVT VCGGIDGAPKG+ +LDRI AG+V  +GN +C++    NP  S
Sbjct  244   MYSEAAQYNSPPNYPVTIVCGGIDGAPKGSHMLDRIFAGIVAYKGNSSCHN---MNPKPS  300

Query  1160  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1339
             ET +GWRWQTC+EM MP+GRG+ DTMF+  PF++  F +DC   YGV PRPHWITTYYGG
Sbjct  301   ETDLGWRWQTCTEMVMPVGRGENDTMFYSDPFNLNNFIKDCKKKYGVSPRPHWITTYYGG  360

Query  1340  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1519
              DIKL+L +F SNIIFSNGLRDPYSSAGVL+DIS +V AV+TRNGSHCLDI     TDP+
Sbjct  361   QDIKLILQRFASNIIFSNGLRDPYSSAGVLQDISHSVQAVHTRNGSHCLDILSKDSTDPE  420

Query  1520  WLTEQRKKEVEIIQSWITKYYVELEALKR*K  1612
             WLT QR  EV+II+ WITK+Y +L+ALK+ K
Sbjct  421   WLTMQRNTEVKIIEGWITKHYADLKALKKGK  451



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/478 (67%), Positives = 384/478 (80%), Gaps = 4/478 (1%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRL+P+  + L+      +      LS  F++++Y QTLDHFNY PQSY  F Q Y+
Sbjct  33    HKIPRLSPIRRTNLRDPDDTLTKAS---LSEDFKSYFYEQTLDHFNYNPQSYTKFNQSYV  89

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SK+WGGA+SNSPI A+LGAE+P+  D + IGFLTDNAPRFKALLVYIEHR+YGKSIP 
Sbjct  90    INSKFWGGAKSNSPILAYLGAEAPLAGDIEAIGFLTDNAPRFKALLVYIEHRFYGKSIPL  149

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ME+ M ++T RGYFNSAQALADYAEVLL++K+K+ AQ+SPIIV GGSYGGMLASWFRL
Sbjct  150   GSMEKVMKSKTVRGYFNSAQALADYAEVLLHVKHKFSAQNSPIIVVGGSYGGMLASWFRL  209

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAP+LYFD+ITP+NGYYS VTKDFKE SE+CYQTIR+SWS IDK+ASK
Sbjct  210   KYPHIALGALASSAPVLYFDDITPQNGYYSTVTKDFKEESEHCYQTIRQSWSEIDKVASK  269

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSILSK+FK C  L S  +LKDYLDS + +AAQY+ PPKYPVTEVC GID APKG D
Sbjct  270   PNGLSILSKRFKTCTPLNSSSQLKDYLDSMFSSAAQYNSPPKYPVTEVCSGIDKAPKGTD  329

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL R  AGVV  + + +CYD   Y   T ET VGW+WQTCSEM MPIGRG  DTMF P+P
Sbjct  330   ILGRTFAGVVSYKKDESCYDMLEYARST-ETNVGWQWQTCSEMVMPIGRGSNDTMFPPSP  388

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++  F ++C   YGV PRPHWITTYYGGHD+KLV  +FGSNIIFSNGL+DPYSS GV E
Sbjct  389   FNLPDFIKNCKSSYGVSPRPHWITTYYGGHDMKLVFQRFGSNIIFSNGLKDPYSSGGVRE  448

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ++S ++LA+YT  GSHCLDI  A ++DP WL  QRK EVEII+ WI +YY ++ ++ +
Sbjct  449   NLSSSLLAIYTVKGSHCLDILAAKESDPSWLVAQRKLEVEIIEEWIKQYYADVHSIGK  506



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/477 (67%), Positives = 387/477 (81%), Gaps = 12/477 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             K+PRL+ +          + S   ++ +S  F+TF+Y QTLDHFNY P+SY TF+QRY++
Sbjct  32    KLPRLSTIL---------RESEIFSELISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVM  82

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             + KYWGGA +++PIFA+LGAE+ +D D   +GF  DNA +FKALLVYIEHRYYG+SIPFG
Sbjct  83    NFKYWGGANASAPIFAYLGAEAALDFDLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFG  142

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N +TRGYFNSAQA+ADYAEVL Y+K K LA++SP+IV GGSYGGMLASWFRLK
Sbjct  143   SREEALKNASTRGYFNSAQAIADYAEVLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLK  202

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE+CY TIR+SWS ID++AS+P
Sbjct  203   YPHVALGALASSAPILYFDDITPQNGYYSIVTKDFREASESCYSTIRESWSEIDRVASEP  262

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLSILSKKF+ C  L    ELKDYL++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DI
Sbjct  263   NGLSILSKKFRTCAELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDI  322

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L RI AGVV   GN +CY+  + NP  +ET  GWRWQTCSEM MPIGRGD DTMF P+PF
Sbjct  323   LSRIFAGVVAYRGNSSCYNTSV-NP--TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPF  379

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             ++  F + C   Y VPPRPHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++
Sbjct  380   NLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKN  439

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             IS TVLA++T NGSHCLDI  A  TDP+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  440   ISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYHADLDATRK  496



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/477 (67%), Positives = 387/477 (81%), Gaps = 12/477 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             K+PRL+ +          + S   ++ +S  F+TF+Y QTLDHFNY P+SY TF+QRY++
Sbjct  40    KLPRLSTIL---------RESEIFSELISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVM  90

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             + KYWGGA +++PIFA+LGAE+ +D D   +GF  DNA +FKALLVYIEHRYYG+SIPFG
Sbjct  91    NFKYWGGANASAPIFAYLGAEAALDFDLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFG  150

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N +TRGYFNSAQA+ADYAEVL Y+K K LA++SP+IV GGSYGGMLASWFRLK
Sbjct  151   SREEALKNASTRGYFNSAQAIADYAEVLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLK  210

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE+CY TIR+SWS ID++AS+P
Sbjct  211   YPHVALGALASSAPILYFDDITPQNGYYSIVTKDFREASESCYSTIRESWSEIDRVASEP  270

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLSILSKKF+ C  L    ELKDYL++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DI
Sbjct  271   NGLSILSKKFRTCAELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDI  330

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L RI AGVV   GN +CY+  + NP  +ET  GWRWQTCSEM MPIGRGD DTMF P+PF
Sbjct  331   LSRIFAGVVAYRGNSSCYNTSV-NP--TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPF  387

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             ++  F + C   Y VPPRPHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++
Sbjct  388   NLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKN  447

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             IS TVLA++T NGSHCLDI  A  TDP+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  448   ISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYHADLDATRK  504



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/471 (65%), Positives = 375/471 (80%), Gaps = 5/471 (1%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL       L+R++       +  +S  F+TF+Y QTLDHFNY P+SY TF QRY+V+
Sbjct  33    IPRL-----GALRRTTRTEPKITSSSVSKDFKTFFYSQTLDHFNYRPESYTTFPQRYVVN  87

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             SKYW GA +++PI  + G E+ +D+D   IGFLTDNAPRFKALLVYIEHR+YGKSIPFG+
Sbjct  88    SKYWSGANTSAPILVFFGEETSLDNDLSDIGFLTDNAPRFKALLVYIEHRFYGKSIPFGS  147

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              E A+ N + RGYF SAQA+ADYA ++L++K  + A++SP+IV GGSYGGMLA+WFRLKY
Sbjct  148   REAALRNASIRGYFTSAQAIADYAAIILHIKKTFFAKNSPVIVIGGSYGGMLAAWFRLKY  207

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PHVALGALASSAPILYFD++ P+ GYY++VTKDFKE SE+CY+TIR+SW  IDK+ASK N
Sbjct  208   PHVALGALASSAPILYFDDLAPQVGYYAIVTKDFKETSESCYETIRESWDEIDKVASKSN  267

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GLSILS KFK CK LK   +LKDYLDS Y  AAQYD PP YP++ VCGGIDGAPKG DIL
Sbjct  268   GLSILSMKFKTCKKLKRTFDLKDYLDSIYSEAAQYDHPPTYPLSIVCGGIDGAPKGTDIL  327

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1258
              RI AGVV   GN++CYD   YN P+ ET +GWRWQTCSEM MPIG G+ D+MF PAPF+
Sbjct  328   GRIFAGVVAYVGNKSCYDMNAYNHPSDETYMGWRWQTCSEMVMPIGHGNNDSMFPPAPFN  387

Query  1259  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1438
             + +F R C   +GV P+PHW+TTYYGGHD+KL+LH+F SNIIFSNGLRDPYSS GVLE+I
Sbjct  388   LNRFIRKCKSLFGVQPQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRDPYSSGGVLENI  447

Query  1439  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             SD+V+AV+T +GSHCLDI    K+DP WL +QRK EV+II++W+ KYY +L
Sbjct  448   SDSVVAVHTIHGSHCLDILPEKKSDPQWLVKQRKTEVQIIEAWLAKYYTDL  498



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/493 (65%), Positives = 387/493 (78%), Gaps = 11/493 (2%)
 Frame = +2

Query  128   STTCGGLSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHF  307
             STTC  +S T P  L    RL      +L R+  +  +  ++ +S  F+TFYY QTLDHF
Sbjct  24    STTC--VSATQPHLL----RL-----GVLGRTFLREPATFSESVSEEFQTFYYNQTLDHF  72

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
             NY P+SY TF+QRY+V+ KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKAL
Sbjct  73    NYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKAL  132

Query  488   LVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIV  667
             LVYIEHRYYGKSIP+G+ EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV
Sbjct  133   LVYIEHRYYGKSIPYGSREEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIV  192

Query  668   FGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQ  847
              G SYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+
Sbjct  193   VGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYK  252

Query  848   TIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPV  1027
             TI +SWS ID++AS+PNGLSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPV
Sbjct  253   TISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPV  312

Query  1028  TEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             T VCGGIDGAP+G+DIL RI AGVV   GN +CY          ETI GW WQTCSE+ +
Sbjct  313   TVVCGGIDGAPEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVI  372

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             PIGRG  DTMF  APF++  FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIF
Sbjct  373   PIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIF  432

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSW  1567
             SNGLRDPYS  GVL++IS++VLA+ T NGSHCLD+  A+ TDP+WL  QRK EVEII+ W
Sbjct  433   SNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGW  492

Query  1568  ITKYYVELEALKR  1606
             I +YYV+L A+ +
Sbjct  493   IAQYYVDLHAITK  505



>emb|CBI17109.3| unnamed protein product [Vitis vinifera]
Length=975

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 380/459 (83%), Gaps = 3/459 (1%)
 Frame = +2

Query  230   KHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWL  409
             + S   ++ +S  F+TF+Y QTLDHFNY P+SY TF+QRY+++ KYWGGA +++PIFA+L
Sbjct  21    RESEIFSELISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYL  80

Query  410   GAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSA  589
             GAE+ +D D   +GF  DNA +FKALLVYIEHRYYG+SIPFG+ EEA+ N +TRGYFNSA
Sbjct  81    GAEAALDFDLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSA  140

Query  590   QALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYF  769
             QA+ADYAEVL Y+K K LA++SP+IV GGSYGGMLASWFRLKYPHVALGALASSAPILYF
Sbjct  141   QAIADYAEVLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYF  200

Query  770   DNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKS  949
             D+ITP+NGYYS+VTKDF+E SE+CY TIR+SWS ID++AS+PNGLSILSKKF+ C  L  
Sbjct  201   DDITPQNGYYSIVTKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNK  260

Query  950   PGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCY  1129
               ELKDYL++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DIL RI AGVV   GN +CY
Sbjct  261   SNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCY  320

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             +  + NP  +ET  GWRWQTCSEM MPIGRGD DTMF P+PF++  F + C   Y VPPR
Sbjct  321   NTSV-NP--TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPR  377

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++IS TVLA++T NGSHCLD
Sbjct  378   PHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLD  437

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             I  A  TDP+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  438   ILPAKSTDPEWLIMQRKTEVEIIESWIAQYHADLDATRK  476


 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 375/476 (79%), Gaps = 12/476 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHF----RTFYYRQTLDHFNYGPQSYATFKQ  343
              +PRL PL   IL+       +P+   +S  F    +TF+Y QTLDHFNY P+SY TF+Q
Sbjct  504   NVPRLGPLSRGILR-------NPEPAAVSESFYKDLKTFFYAQTLDHFNYRPESYKTFRQ  556

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+++ K+WGGA++ +PIFA+LGAE+P+D D   IGF+ DNA RF ALL+YIEHRYYGKS
Sbjct  557   RYVMNFKHWGGAKAGAPIFAYLGAEAPLDGDLVNIGFVNDNAARFNALLIYIEHRYYGKS  616

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ + A+ N +T GYFNSAQA+ADYA VL+++K +  AQ+SP+IV GGSYGGMLASW
Sbjct  617   IPFGSTKVALKNASTLGYFNSAQAIADYAAVLMHVKKRLHAQNSPVIVIGGSYGGMLASW  676

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAPILYFD I PE GYYS+VTKDF+E SE+CY+TIR+SWS ID+I
Sbjct  677   FRLKYPHIALGALASSAPILYFDEIAPEIGYYSIVTKDFREASESCYRTIRRSWSEIDRI  736

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             ASKPNGLSILSK+FK C  L+S  ELKDYLDS Y  AAQY++PP YPVT VC GI+GA K
Sbjct  737   ASKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGASK  796

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
               D L RI  G+V + G R+CYD + +N PT ET +GWRWQ CSEM +PIG    DTMF 
Sbjct  797   RTDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-ETYLGWRWQKCSEMVLPIGHATNDTMFQ  855

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF++ +F ++C+  Y V PRPHW+TTYYGG DIKL+LH+F SNIIFSNGLRDPYSS G
Sbjct  856   PEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRDIKLILHRFASNIIFSNGLRDPYSSGG  915

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDT++AVYTR+GSHCLDI  + K+DP WL  QRK EVEII+ W+ KYY +L
Sbjct  916   VLENISDTLVAVYTRHGSHCLDILPSQKSDPQWLVMQRKMEVEIIKGWMDKYYTDL  971



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/493 (65%), Positives = 387/493 (78%), Gaps = 11/493 (2%)
 Frame = +2

Query  128   STTCGGLSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHF  307
             STTC  +S T P  L    RL      +L R+  +  +  ++ +S  F+TFYY QTLDHF
Sbjct  143   STTC--VSATQPHLL----RL-----GVLGRTFLREPATFSESVSEEFQTFYYNQTLDHF  191

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
             NY P+SY TF+QRY+V+ KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKAL
Sbjct  192   NYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKAL  251

Query  488   LVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIV  667
             LVYIEHRYYGKSIP+G+ EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV
Sbjct  252   LVYIEHRYYGKSIPYGSREEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIV  311

Query  668   FGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQ  847
              G SYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+
Sbjct  312   VGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYK  371

Query  848   TIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPV  1027
             TI +SWS ID++AS+PNGLSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPV
Sbjct  372   TISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPV  431

Query  1028  TEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             T VCGGIDGAP+G+DIL RI AGVV   GN +CY          ETI GW WQTCSE+ +
Sbjct  432   TVVCGGIDGAPEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVI  491

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             PIGRG  DTMF  APF++  FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIF
Sbjct  492   PIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIF  551

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSW  1567
             SNGLRDPYS  GVL++IS++VLA+ T NGSHCLD+  A+ TDP+WL  QRK EVEII+ W
Sbjct  552   SNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGW  611

Query  1568  ITKYYVELEALKR  1606
             I +YYV+L A+ +
Sbjct  612   IAQYYVDLHAITK  624


 Score =   115 bits (287),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  1184  QTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLH  1363
             Q C+E  MP+ RGD DTMF   PF++  F ++C   YGV P PHW TTYYGGH+I+L+LH
Sbjct  2     QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  1364  KFGSNIIFSNGLRDPYSSAG  1423
             +F SNIIFSNGLRDPY+  G
Sbjct  62    RFASNIIFSNGLRDPYAVPG  81



>ref|XP_002271733.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=505

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 375/476 (79%), Gaps = 12/476 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHF----RTFYYRQTLDHFNYGPQSYATFKQ  343
              +PRL PL   IL+       +P+   +S  F    +TF+Y QTLDHFNY P+SY TF+Q
Sbjct  34    NVPRLGPLSRGILR-------NPEPAAVSESFYKDLKTFFYAQTLDHFNYRPESYKTFRQ  86

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+++ K+WGGA++ +PIFA+LGAE+P+D D   IGF+ DNA RF ALL+YIEHRYYGKS
Sbjct  87    RYVMNFKHWGGAKAGAPIFAYLGAEAPLDGDLVNIGFVNDNAARFNALLIYIEHRYYGKS  146

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ + A+ N +T GYFNSAQA+ADYA VL+++K +  AQ+SP+IV GGSYGGMLASW
Sbjct  147   IPFGSTKVALKNASTLGYFNSAQAIADYAAVLMHVKKRLHAQNSPVIVIGGSYGGMLASW  206

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAPILYFD I PE GYYS+VTKDF+E SE+CY+TIR+SWS ID+I
Sbjct  207   FRLKYPHIALGALASSAPILYFDEIAPEIGYYSIVTKDFREASESCYRTIRRSWSEIDRI  266

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             ASKPNGLSILSK+FK C  L+S  ELKDYLDS Y  AAQY++PP YPVT VC GI+GA K
Sbjct  267   ASKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGASK  326

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
               D L RI  G+V + G R+CYD + +N PT ET +GWRWQ CSEM +PIG    DTMF 
Sbjct  327   RTDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-ETYLGWRWQKCSEMVLPIGHATNDTMFQ  385

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF++ +F ++C+  Y V PRPHW+TTYYGG DIKL+LH+F SNIIFSNGLRDPYSS G
Sbjct  386   PEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRDIKLILHRFASNIIFSNGLRDPYSSGG  445

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDT++AVYTR+GSHCLDI  + K+DP WL  QRK EVEII+ W+ KYY +L
Sbjct  446   VLENISDTLVAVYTRHGSHCLDILPSQKSDPQWLVMQRKMEVEIIKGWMDKYYTDL  501



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/476 (64%), Positives = 371/476 (78%), Gaps = 5/476 (1%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL    +       +   S Q K     F+TF+Y QTLDHFNY P SYATF+QRY+++
Sbjct  28    IPRLGAHRKRFQNEPKAMSPSDQFK----DFKTFFYTQTLDHFNYRPDSYATFQQRYVIN  83

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              K+WGG+ S++PIF +LGAE  +D+D    GFL DNAPRFKALLVYIEHRYYGKS+PFG+
Sbjct  84    FKHWGGSNSSAPIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGS  143

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              EEAM N +T GYFNSAQA+ADYA+VLL++K KY A+ SP IV GGSYGGMLA+WFRLKY
Sbjct  144   REEAMKNASTLGYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKY  203

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+ALGALASSAPILYF +  P+ GYY++VTKDFKE S++CY+T+RKSW  I K+AS+PN
Sbjct  204   PHIALGALASSAPILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRKVASRPN  263

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GLS+LSKKF+ CK LK   EL+D+LDS Y   AQYD PP YP++ VCGGIDGAPKG D+L
Sbjct  264   GLSMLSKKFRTCKPLKKTSELEDFLDSLYTDVAQYDDPPTYPLSIVCGGIDGAPKGIDVL  323

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1258
              +I  GVV  +GNR+CYD   Y  PT ET VGWRWQTCSEM MPIG G +DTMF PAPF 
Sbjct  324   GKIFKGVVAYKGNRSCYDMDEYIRPT-ETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFD  382

Query  1259  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1438
             + +F++DC+  +GV P+PHW+TTYYGG D+KL+LH+FGSNIIFSNGLRDPYS+ GVL +I
Sbjct  383   LNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNI  442

Query  1439  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             SD+V+A+ T NGSHCLDI   SK+DP WL  QRK E++II+ WI KY  +L   K 
Sbjct  443   SDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLLEFKE  498



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/476 (65%), Positives = 371/476 (78%), Gaps = 11/476 (2%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P    I++      S+     +S   +TFYY QTLDHFNY PQSYATF+QRY+++
Sbjct  67    IPRLSPTRGIIMEDPDLLSSAA----VSDDLQTFYYPQTLDHFNYQPQSYATFQQRYVMN  122

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              KYWGGA +N+PI A+LGAE+P+D  P  IGFL DNA  F ALLVYIEHRYYGKSIPFG+
Sbjct  123   FKYWGGANNNAPILAYLGAEAPLDGSPTAIGFLNDNAVSFTALLVYIEHRYYGKSIPFGS  182

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              EEA  N +T GYFNSAQA+ADYAE+++++KNK  A +SP+IV GGSYGGMLASW RLKY
Sbjct  183   REEAFKNASTLGYFNSAQAIADYAEIIMHIKNKLRAFYSPVIVVGGSYGGMLASWLRLKY  242

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PHVALGALASSAPILYFD ITP   Y+S+VTKDF+E SE+CYQTIR SWSVIDKIAS+PN
Sbjct  243   PHVALGALASSAPILYFDKITPRGAYFSVVTKDFREASESCYQTIRNSWSVIDKIASQPN  302

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GLS LS  FK CK L    ELK+ L++ Y +AAQYD PP+YPVT VC GIDGA +  DIL
Sbjct  303   GLSSLSMIFKTCKPLNKSSELKNALENMYASAAQYDSPPRYPVTVVCRGIDGANEKQDIL  362

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              +I AGVV   GNR+CY     NPPT  SET VGWRWQTCSEM +PIG G+R TMF P P
Sbjct  363   SKIFAGVVAYRGNRSCY----INPPTNESETTVGWRWQTCSEMVIPIGIGNR-TMFQPEP  417

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +  F + C   +GVPPRPHW+T+YYGGHDIKL+L +FGSNIIFSNGLRDPYS  GVLE
Sbjct  418   FDLNSFIQQCKTIFGVPPRPHWVTSYYGGHDIKLILQRFGSNIIFSNGLRDPYSRGGVLE  477

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +IS+++LAV T NGSHCLDI   + +DP+WL +QR+ EVEI++ WI +YY +L+A+
Sbjct  478   NISESILAVKTVNGSHCLDILAQNASDPEWLVKQRQTEVEIMKGWIAQYYADLKAI  533



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/449 (66%), Positives = 360/449 (80%), Gaps = 1/449 (0%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  F+TF+Y QTLDHFNY P SYATF+QRY+++ K+WGG+ S++PIF +LGAE  +D+D 
Sbjct  7     SQDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDL  66

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
                GFL DNAPRFKALLVYIEHRYYGKS+PFG+ EEAM N +T GYFNSAQA+ADYA VL
Sbjct  67    DVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYAGVL  126

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             L++K KY A+ SP IV GGSYGGMLA+WFRLKYPH+ALGALASSAPILYF +  P+ GYY
Sbjct  127   LHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYY  186

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
             ++VTKDFKE SE+CY+T+RKSW  I K+AS+PNGLS+LSK F+ CK LK   ELKD+LDS
Sbjct  187   TIVTKDFKETSESCYETVRKSWDEIRKVASRPNGLSMLSKTFRTCKPLKETSELKDFLDS  246

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1159
              Y   AQYD PP YP++ VCGGIDGAP G D+L +I  GVV  +GNR+CYD   Y  PT 
Sbjct  247   LYTDVAQYDDPPTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPT-  305

Query  1160  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1339
             ET VGWRWQTCSEM MPIG G +DTMF PAPF + +F++DC+  +GV P+PHW+TTYYGG
Sbjct  306   ETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGG  365

Query  1340  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1519
              D+KL+LH+FGSNIIFSNGLRDPYS+ GVL +ISD+V+A+ T NGSHCLDI   SK+DP 
Sbjct  366   RDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQ  425

Query  1520  WLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             WL  QRK E++II+ WI KY  +L   K 
Sbjct  426   WLVMQRKSEIKIIEEWIAKYENDLLEFKE  454



>ref|XP_006488629.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=494

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/482 (65%), Positives = 375/482 (78%), Gaps = 25/482 (5%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P+ E+ILQ      S+     +S  F+TFYY QTLDHFNY P+SY+TF+QRYI++
Sbjct  31    IPRLSPIRETILQNFEILSSAT----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  359   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A HSP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATHSPVIVIGGSYGGMLAAWFRL  206

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-  1069
             P+         +  + LK   EL+ YL S Y  AAQY+QPP+YPV  +CGGIDGA  G  
Sbjct  267   PD---------EAYEPLKDSYELEGYLKSVYADAAQYNQPPEYPVNMLCGGIDGAALGID  317

Query  1070  -DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
              DIL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ CSEM MPIG  D  TMF
Sbjct  318   NDILSKIFAGVVAYEGNMSCY----VNPPTIETETTVGWRWQRCSEMVMPIGT-DNTTMF  372

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
              P PF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYSS 
Sbjct  373   QPTPFNLSSFIDGCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYSSG  432

Query  1421  GVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             GVLE+ISD V+A+ T NGSHCLDI GA + +DPDWL  QR+ E+EII+ WI+KYY +L+A
Sbjct  433   GVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEGWISKYYADLKA  492

Query  1598  LK  1603
             +K
Sbjct  493   IK  494



>ref|XP_006495097.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Citrus 
sinensis]
Length=502

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/484 (64%), Positives = 375/484 (77%), Gaps = 18/484 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
              IPRL+P   +ILQ      ++     +S  F+TFYY QTLDHFNY P+SY+TF+QRY++
Sbjct  29    NIPRLSPTRGTILQNPEILSAT-----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYVI  83

Query  356   SSKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             + KYWGG        PIF +LG E P+D D   IGFLTDNA RF ALLVYIEHRYYGKSI
Sbjct  84    NFKYWGGGAGADANAPIFVYLGNEGPLDGDISIIGFLTDNAARFNALLVYIEHRYYGKSI  143

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
              FG+ EE + N +T GYFNSAQA+ DYAE+LLY+K K+ A+HSP+IV GGSYGGMLA+WF
Sbjct  144   SFGSREEDLKNSSTLGYFNSAQAVTDYAEILLYIKEKFNARHSPVIVIGGSYGGMLATWF  203

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPHVALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K+A
Sbjct  204   RLKYPHVALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKVA  263

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             SKP+GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDG   G
Sbjct  264   SKPDGLSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGVALG  323

Query  1067  A--DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDT  1234
                DIL +I AGVV  EGN +C+     NPPT  +ET VGWRWQTCSEM +PIG  D  T
Sbjct  324   IDNDILSKIFAGVVAYEGNMSCF----VNPPTIETETTVGWRWQTCSEMVIPIGT-DNTT  378

Query  1235  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1414
             MF PAPF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYS
Sbjct  379   MFQPAPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYS  438

Query  1415  SAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S GVLE+ISD V+A+ T NGSHCLDI GA + +DPDWL  QR+ E+EII+ WI+KYY +L
Sbjct  439   SGGVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEGWISKYYADL  498

Query  1592  EALK  1603
             +A+K
Sbjct  499   KAIK  502



>ref|XP_002523752.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38692.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/475 (64%), Positives = 372/475 (78%), Gaps = 12/475 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P    I+Q       S   + +S    TF+Y QTLDHFNY P+SY TF+QRYI+S
Sbjct  29    IPRLSPTGPRIVQDPEEIFIS---ELVSDDLETFFYNQTLDHFNYNPESYETFQQRYIIS  85

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             SKYWGGA S+SPIF + GAE+P+D D   IGFL DNA +F ALL+YIEHRYYGKS+PFG+
Sbjct  86    SKYWGGANSSSPIFVYFGAEAPLDGDLTVIGFLADNAAQFNALLLYIEHRYYGKSVPFGS  145

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
               EA+ N + RGYFNSAQA+ADYAE+++++K    A++SP+IV GGSYGGMLASWFRLKY
Sbjct  146   QGEALKNGSIRGYFNSAQAIADYAEIIIHVKKNLQAENSPVIVIGGSYGGMLASWFRLKY  205

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+ALGALASSAP+LYFD+ITP++GYYS+ ++DF+E SENCY+TI+KSW+ ID +AS P 
Sbjct  206   PHLALGALASSAPVLYFDDITPQDGYYSIASRDFREASENCYKTIQKSWAEIDGVASMPK  265

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-DI  1075
             GL +LSKKFK CK L    ELKD LDS Y  AAQY++PP YPV  +C GIDGA   + D 
Sbjct  266   GLDVLSKKFKTCKPLTDSDELKDRLDSMYSGAAQYNKPPTYPVNIICSGIDGAASSSNDT  325

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             LD+I AGVV   GNR+CY     NPPT  SET VGWRWQTCSEM +PIGRG+ DTMF P+
Sbjct  326   LDKIFAGVVAYRGNRSCY----INPPTNLSETSVGWRWQTCSEMVIPIGRGN-DTMFPPS  380

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF +  + +DC+  YGV PRPHW+TTYYGGH IKL+L +FGSNIIFSNG+RDPYSS GVL
Sbjct  381   PFDLNGYVQDCNAIYGVRPRPHWVTTYYGGHSIKLILQRFGSNIIFSNGIRDPYSSGGVL  440

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             EDISDT+LAV+T NGSHCLDI  A++ TDP+WL  QRK E+ II+ WI+KYY +L
Sbjct  441   EDISDTILAVHTANGSHCLDILIANETTDPEWLVAQRKTEINIIKGWISKYYDDL  495



>ref|XP_007016018.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33637.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=500

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/485 (64%), Positives = 376/485 (78%), Gaps = 20/485 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQ--TKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             KIPRL+P   +IL++       P+  + P+S   RTFYY QTLDHFNY P+SY TF+QRY
Sbjct  28    KIPRLSPTLGTILEQ-------PEILSAPVSEDLRTFYYTQTLDHFNYNPESYTTFQQRY  80

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI A+LGAESP+D  P  IGFL DNA RFKAL+VYIEHRYYGKSIP
Sbjct  81    VMNSKYWGGANVSAPILAYLGAESPLDGTPAAIGFLNDNAIRFKALIVYIEHRYYGKSIP  140

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA  N +T GYFNSAQA+ADYA +++++K K  A++SP+IV GGSYGGMLASWFR
Sbjct  141   FGSREEAFQNASTLGYFNSAQAIADYAAIIMHIKKKLQARYSPVIVIGGSYGGMLASWFR  200

Query  710   LKYPHVALGALASSAPILYFDNI--TPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             LKYPHVALGALASSAPILYFD I   PE GYYS+VTKDF+E SE CYQTI+KSWS I+++
Sbjct  201   LKYPHVALGALASSAPILYFDEIPLQPEGGYYSVVTKDFREASETCYQTIQKSWSEINRV  260

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             ASKP+GLS LSKKFK C  L S  ELK +L   Y   AQY++PP+YPV+ VCGGIDGA  
Sbjct  261   ASKPHGLSTLSKKFKTCYPLTSSSELKSFLRLMYAYTAQYNRPPRYPVSVVCGGIDGASF  320

Query  1064  GA--DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRD  1231
             G+  DIL +I +GVV   GNR+CY     NP T  SE  +GW WQ CSEM +PIG G+  
Sbjct  321   GSQDDILTKIFSGVVAYYGNRSCY----VNPETNASEIEIGWSWQRCSEMVIPIGIGN-G  375

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
             TM   +PF++  F + C+ +YGVP RPHW+T+YYGGHDIKL+LH+FGSNIIFSNGLRDPY
Sbjct  376   TMLEASPFNLTSFIKQCESFYGVPSRPHWVTSYYGGHDIKLILHRFGSNIIFSNGLRDPY  435

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             SS GVLE+IS+++LAV T NGSHCLDI    +TDP+WL  QRK EV+II+ WI KYY +L
Sbjct  436   SSGGVLENISNSILAVSTVNGSHCLDILAERETDPEWLIRQRKIEVKIIKGWIAKYYADL  495

Query  1592  EALKR  1606
             +A K+
Sbjct  496   KAFKQ  500



>emb|CDP07008.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/484 (63%), Positives = 372/484 (77%), Gaps = 16/484 (3%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRL+P+  + L+      +       S  F++++Y QTLDHFNY P+SY  F Q Y+
Sbjct  32    HKIPRLSPIRRTNLRDPDDTLTKASR---SEDFKSYFYEQTLDHFNYNPKSYTKFNQSYV  88

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SK+WGGA+SNSPIFA+LGAE+P+  D + IGFL DNAPRFKALLVYIEHR+YG S+P 
Sbjct  89    INSKFWGGAKSNSPIFAYLGAEAPLAGDIETIGFLPDNAPRFKALLVYIEHRFYGNSVPH  148

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ME+AM N+  RGYFNSAQALADYAEVL+++K+K+ A+++PIIV GGSYGGMLASWFRL
Sbjct  149   GSMEKAMKNKAIRGYFNSAQALADYAEVLMHVKHKFSAKNAPIIVVGGSYGGMLASWFRL  208

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAP+LYFD+ITP+NGY S+VTK+FKE SE+CYQTIRKSWS ID++ASK
Sbjct  209   KYPHIALGALASSAPVLYFDDITPQNGYDSIVTKNFKEESEHCYQTIRKSWSEIDEVASK  268

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              NGLSILSK+FK C  L SP EL DYL S +  AAQY+ PP+YPV E+C GID AP+G D
Sbjct  269   TNGLSILSKRFKTCAPLSSPSELADYLASMFTMAAQYNAPPRYPVAELCSGIDKAPEGTD  328

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ----------TCSEMAMPIGRG  1222
             IL RI AGVV    + +CYD  I    +    + W+ +          TCSEM MP+G G
Sbjct  329   ILGRIFAGVVSFRKDESCYDGIII---SGSLRIKWQSRSLVCLLFPLLTCSEMVMPMGHG  385

Query  1223  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1402
               DT+F  +PF++  F +DC   YGV PRPHWITTYYGGHDIKL+  +FGSNIIFSNGL+
Sbjct  386   SNDTIFPSSPFNLPDFIKDCKSSYGVSPRPHWITTYYGGHDIKLIFQRFGSNIIFSNGLK  445

Query  1403  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             DPYSSAGV E++SD++LAVYT  GSHCLDI  A KTDP WL  QRK EVEII+ WI +YY
Sbjct  446   DPYSSAGVRENLSDSLLAVYTAKGSHCLDILAAQKTDPSWLVAQRKLEVEIIEGWIKQYY  505

Query  1583  VELE  1594
              +LE
Sbjct  506   ADLE  509



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 375/477 (79%), Gaps = 13/477 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPR++P+ E      ++ H+ P     +   +TFY++Q LDHFNY P+SY TF+QRY+++
Sbjct  30    IPRMSPIPE----WETTLHNHPAIN--TEEVKTFYFKQVLDHFNYRPESYTTFQQRYLIN  83

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              KYWGGA S++PIFA+ GAESPID+ P  +GFLTDNA  F ALLVYIEHRYYGKS+ FG+
Sbjct  84    FKYWGGANSSAPIFAYFGAESPIDNSPNGVGFLTDNAASFNALLVYIEHRYYGKSVQFGS  143

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              EEA+ N +T GYFNSAQALADYA +L ++K    A++SP+IV GGSYGGMLASWFRLKY
Sbjct  144   REEALKNASTIGYFNSAQALADYASILKHVKKTLHAKNSPVIVIGGSYGGMLASWFRLKY  203

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+A+GALASSAPILYFD ITP+NGYYS VT+D++E SE CY+T+ KSWS I +IAS+PN
Sbjct  204   PHLAIGALASSAPILYFDKITPQNGYYSTVTRDYREASETCYETVLKSWSEIRRIASQPN  263

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GL  LS++F  C  L    EL DYL STY  AAQY+QPP+YPV+ +CGGIDG   G+DIL
Sbjct  264   GLVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGESLGSDIL  323

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              +I+AG+V L GN TC      N PT  SET VGWRWQTCSEM +PIG G+ DTMF P P
Sbjct  324   SKIYAGIVALRGNSTCK----VNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFEPIP  378

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++ +++  C + YGV PRPHW+TTYYGGH+IKLVL + GSNIIFSNGLRDPYS  GVL+
Sbjct  379   FNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLD  438

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             +ISD+++AV+T NGSHCLD+  A+++DP WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  439   NISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDALK  495



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/478 (63%), Positives = 375/478 (78%), Gaps = 12/478 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPR++P+ E      +S H  P     +   ++F+++QTLDHFNY P+SY TF+QRY+++
Sbjct  22    IPRMSPVPE----WEASLHHDPVAVD-AEEVKSFFFKQTLDHFNYRPESYTTFQQRYLIN  76

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              KYWGGA S++PIFA+LGAE+PID+ P  IGFL DNAP F ALLVYIEHRYYGKS+PFG+
Sbjct  77    FKYWGGANSSAPIFAYLGAEAPIDNSPNTIGFLIDNAPSFNALLVYIEHRYYGKSVPFGS  136

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              EEA+ N +T GYFNSAQALADYA VL ++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  137   REEALKNASTIGYFNSAQALADYAAVLNHIKKTLHAQNSPVIVIGGSYGGMLASWFRLKY  196

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+A+GALASSAPILYFDNITP+NGYYS+VT+D++E SE CY+TI++SWS I ++AS+PN
Sbjct  197   PHLAIGALASSAPILYFDNITPQNGYYSVVTRDYREASETCYKTIQQSWSEIRRVASQPN  256

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GL  LS+ F  C  L     L DYL   Y +AAQY+ PPKYPV  +CGGIDGA  G+DIL
Sbjct  257   GLVTLSQIFNTCHSLNQVESLIDYLRLMYASAAQYNHPPKYPVNVICGGIDGASDGSDIL  316

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              +I+AGVV L+GN TC      N PT  SET VGWRWQTCSEM +PIG  ++DTMF P P
Sbjct  317   SKIYAGVVALKGNTTC----TINGPTNVSETTVGWRWQTCSEMVIPIGI-EKDTMFEPNP  371

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             FS++++   C   +GV PRPHW+TTYYG H+IKLVL +FGSNIIFSNGL+DPYS  GVLE
Sbjct  372   FSLKRYVEGCKTTFGVSPRPHWVTTYYGAHNIKLVLGRFGSNIIFSNGLKDPYSIGGVLE  431

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             +ISD ++A++T NGSHCLDI  A+++DP+WL +QRKKE++I++ WITKYY +L ALK 
Sbjct  432   NISDNIVAIHTVNGSHCLDILRANESDPEWLVKQRKKEIKIMKRWITKYYADLHALKH  489



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/482 (62%), Positives = 382/482 (79%), Gaps = 14/482 (3%)
 Frame = +2

Query  176   KIPRLTPLYE---SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             KIPRL+P+ E   ++  R++   +   T+ L     TFYY+Q LDHFNY P+SY TF+QR
Sbjct  30    KIPRLSPIAEWETTLHNRATVVATDTDTENLI----TFYYKQVLDHFNYRPESYKTFQQR  85

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++ KYWGGA S++PIFA+LGAE PID  P+ IGFLTDNA  F AL+VYIEHRYYGKS+
Sbjct  86    YLINFKYWGGANSSAPIFAYLGAEEPIDGSPELIGFLTDNAASFNALIVYIEHRYYGKSV  145

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GYFNSAQA+ADYA VL+++K    AQ SP+IV GGSYGGMLASWF
Sbjct  146   PFGSREEALKNASTIGYFNSAQAIADYASVLIHIKKTLHAQKSPVIVIGGSYGGMLASWF  205

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+A+GALASSAPILYFDNITP++GYYS+V++DF+E SE CYQTI KSWS ID++A
Sbjct  206   RLKYPHLAIGALASSAPILYFDNITPQDGYYSVVSRDFREASETCYQTILKSWSEIDRVA  265

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             S+P GLSILS++F  C+ L    ELKDYL + Y ++AQY+ PP+YPVT +CGGID A  G
Sbjct  266   SQPKGLSILSQRFNTCRPLNESSELKDYLINMYASSAQYNHPPRYPVTVICGGIDRASFG  325

Query  1067  ADILDRIHAGVVGLEGNRTCYDPQIYNP-PTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             +DIL +I+AG+V L GN TC   ++  P   SET +GWRWQTCSEM +PIG G+ +TMF 
Sbjct  326   SDILSKIYAGLVALRGNTTC---KVNGPIIVSETTLGWRWQTCSEMVIPIGIGN-NTMFQ  381

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PFS++ +++DC   +GV PRPHW+TTYYGGH I+LVL KFGSNIIFSNGLRDPYSS G
Sbjct  382   PDPFSLKSYAKDCKKQFGVSPRPHWVTTYYGGHSIELVLQKFGSNIIFSNGLRDPYSSGG  441

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASK--TDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             VL++ISD+++A++T NGSHCLDI GA+   +DP+WL EQ K+E+ +++ WI +YY +L A
Sbjct  442   VLKNISDSLVAIHTVNGSHCLDILGANANHSDPEWLVEQWKREIMVMKGWIAQYYDDLVA  501

Query  1598  LK  1603
             L 
Sbjct  502   LN  503



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 364/481 (76%), Gaps = 11/481 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQR----SSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             KIPRL     S  +R    SSS H S          +TFYY Q LDHFNY P SY TF+Q
Sbjct  26    KIPRLGTWQRSTKERDPEISSSLHLS------DDDLKTFYYTQRLDHFNYRPDSYHTFQQ  79

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+V+ KYWGGA+S++PIFA+ GAE P+D+D KYIGFL DNAP+F AL+V+IEHRYYGKS
Sbjct  80    RYMVNFKYWGGAKSSAPIFAFFGAEGPVDEDAKYIGFLRDNAPQFNALIVFIEHRYYGKS  139

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ EEAM N +TRGYFNSAQA+ADYA VLL++K    AQ+SPIIV GGSYGGMLASW
Sbjct  140   IPFGSSEEAMRNASTRGYFNSAQAIADYAAVLLHIKKTLSAQNSPIIVIGGSYGGMLASW  199

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAPILYF+ I P+ GYY +VTKDFKE SE+CYQTIRKSWS ID++
Sbjct  200   FRLKYPHIALGALASSAPILYFNGIAPQAGYYYIVTKDFKETSESCYQTIRKSWSEIDRV  259

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             A KPNGLSILSK+FK C  L    +LKDYLDS Y  AAQY+ P ++PV  VCG ID A K
Sbjct  260   AKKPNGLSILSKRFKTCDKLNKSFDLKDYLDSLYTDAAQYNYPSEHPVKIVCGAIDAAAK  319

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
               DIL +I  GVV  + +R+CYD   YN PT E+ +GWRWQTCSE+ MPIG    D+MF 
Sbjct  320   KTDILGQIFEGVVAYKQHRSCYDMNEYNHPT-ESFLGWRWQTCSEIIMPIGHEKNDSMFP  378

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             PAPF+M+ F ++C   YGV P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYSS G
Sbjct  379   PAPFNMKTFVQECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGG  438

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             VLE IS+TV+AV T NG HCLDI      DP WL  QR  EV+II+ WI +Y  +L AL 
Sbjct  439   VLESISNTVVAVTTVNGCHCLDIQSRKANDPQWLVTQRNTEVKIIKGWIAEYKADLIALT  498

Query  1604  R  1606
             +
Sbjct  499   K  499



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/462 (64%), Positives = 368/462 (80%), Gaps = 9/462 (2%)
 Frame = +2

Query  224   SSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFA  403
             ++ H+ P     +   +TFY++Q LDHFNY P+SY TF+QRY+++ KYWGGA S++PIFA
Sbjct  9     TTLHNHPAIN--TEEVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFA  66

Query  404   WLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFN  583
             + GAESPID+ P  +GFLTDNA  F ALLVYIEHRYYGKS+PFG+ EEA+ N +T GYFN
Sbjct  67    YFGAESPIDNSPNGVGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFN  126

Query  584   SAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPIL  763
             SAQALADYA +L ++K    A++SP+IV GGSYGGMLASWFRLKYPH+A+GALASSAPIL
Sbjct  127   SAQALADYASILKHVKKTLHAKNSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPIL  186

Query  764   YFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGL  943
             YFD ITP+NGYYS VT+D++E SE CY+T+ KSWS I +IAS+PNGL  LS++F  C  L
Sbjct  187   YFDKITPQNGYYSTVTRDYREASETCYETVLKSWSEIRRIASQPNGLVTLSQRFNTCHTL  246

Query  944   KSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRT  1123
                 EL DYL STY  AAQY+QPP+YPV+ +CGGIDG   G+DIL +I+AG+V L GN T
Sbjct  247   NQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGESLGSDILSKIYAGIVALRGNST  306

Query  1124  CYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYG  1297
             C      N PT  SET VGWRWQTCSEM +PIG G+ DTMF P PF++ +++  C + YG
Sbjct  307   CK----VNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFEPIPFNLTRYAEGCKEQYG  361

Query  1298  VPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGS  1477
             V PRPHW+TTYYGGH+IKLVL + GSNIIFSNGLRDPYS  GVL++ISD+++AV+T NGS
Sbjct  362   VSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDNISDSIVAVHTVNGS  421

Query  1478  HCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             HCLD+  A+++DP WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  422   HCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDALK  463



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 366/482 (76%), Gaps = 4/482 (1%)
 Frame = +2

Query  161   PPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFK  340
             P    K+P L    +S +   S+   S  +K      +TF+Y QTLDHFNY P+SY TF+
Sbjct  28    PATQSKMPNLDVFRKSRMVNPSAAKPSSTSK---DDLQTFFYTQTLDHFNYRPESYTTFQ  84

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY+++ KYWGG  S +PIF +LG ES +DDD + IGFLTD+APRF AL+VYIEHRYYGK
Sbjct  85    QRYMINFKYWGGVNSIAPIFVFLGEESSLDDDIESIGFLTDHAPRFNALIVYIEHRYYGK  144

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PF + E++  N  T GYFNSAQALADYAEV++ LK    A+  P+IV GGSYGGMLAS
Sbjct  145   SVPFESWEKSFQNTETLGYFNSAQALADYAEVIIDLKKNLSAEFCPVIVMGGSYGGMLAS  204

Query  701   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             WFRLKYPHVALGALASSAPILYFD+ITP NGYYS+VTKD++E SE+C+ TIR+SWS IDK
Sbjct  205   WFRLKYPHVALGALASSAPILYFDDITPHNGYYSIVTKDYREASESCHDTIRESWSEIDK  264

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  1060
             +AS+ +GLS+LS+KFK C  L +  ELKDYLDS Y   AQ+++PP+  V ++C  IDGAP
Sbjct  265   VASQADGLSVLSQKFKTCSPLNTSFELKDYLDSIYAETAQFNRPPENIVNKICDVIDGAP  324

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
             KG DIL R+ AGVV   GNR+CYD   YN PT +   GWRWQTCSE+ MPIGRG  DTMF
Sbjct  325   KGTDILSRVFAGVVAYMGNRSCYDTNYYNYPT-QGYFGWRWQTCSELVMPIGRGSNDTMF  383

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
               +PF ++ +++ C D YGVPPRPHWITT +GGHDI+LVL KF SNIIFSNGL+DPYSS 
Sbjct  384   PSSPFDLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGLKDPYSSG  443

Query  1421  GVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             GVL +ISD+++A+YT  GSHC+D+Y AS  DP WL  QR+ E+E I+ WI KYYVEL A 
Sbjct  444   GVLANISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGWIEKYYVELAAA  503

Query  1601  KR  1606
              +
Sbjct  504   NQ  505



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 360/487 (74%), Gaps = 2/487 (0%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             KIPRL     S  + +    SS        H +TFYY Q LDHFNY P SY TF+QRYI+
Sbjct  26    KIPRLGTWRRSKEREAQMSSSSSDLGDNHDHLKTFYYTQRLDHFNYRPDSYHTFQQRYII  85

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
               KYWGG +S++PIFA+ GAE P+DDD  Y+GFL DNAP+F AL+VYIEHRYYGKSIPFG
Sbjct  86    DFKYWGGPKSSAPIFAFFGAEGPVDDDIHYVGFLRDNAPQFSALIVYIEHRYYGKSIPFG  145

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEAM N +TRGYFNSAQA+ADYA VLL++K     Q+SPIIV GGSYGGMLASWFRLK
Sbjct  146   SREEAMRNASTRGYFNSAQAIADYAAVLLHIKKTLSVQNSPIIVIGGSYGGMLASWFRLK  205

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPH+ALGALASSAPILYF+ I P+ GYY +VTKDFKE SE CYQTI KSWS ID++A KP
Sbjct  206   YPHIALGALASSAPILYFNGIAPKAGYYYIVTKDFKETSETCYQTISKSWSEIDRVAEKP  265

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLSILSK+FK C+ L    ELKDYLDS Y  AAQY+ P + PV  +C  ID A K  DI
Sbjct  266   NGLSILSKRFKTCEKLSKSFELKDYLDSLYTDAAQYNFPSENPVKVICSAIDAAAKKTDI  325

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L +I  GVV    + +CYD   YN PT ET +GWRWQTCSEM MPIG    D+MF PAPF
Sbjct  326   LGQIFEGVVAFMRHHSCYDMNGYNHPT-ETNLGWRWQTCSEMVMPIGHERNDSMFPPAPF  384

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             +M++F  +C   YGV P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYSS GVLE 
Sbjct  385   NMKRFVHECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGGVLES  444

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*KT  1615
             ISD+V+AV T NG HCLDI      DP+WL  QR KEV+II+ WI +Y  +L AL + +T
Sbjct  445   ISDSVVAVTTVNGCHCLDIQSRKTNDPEWLVRQRNKEVKIIKGWIAEYQADLIALTK-QT  503

Query  1616  KLVILRK  1636
             K    RK
Sbjct  504   KAPTPRK  510



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 374/487 (77%), Gaps = 8/487 (2%)
 Frame = +2

Query  146   LSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQS  325
             LS       ++IPRL+P+  + L  + +  SS     +S  F+TFYY Q+LDHFNY P+S
Sbjct  19    LSNCVTATQYRIPRLSPIGRTFLHNAEAISSS-----ISDDFKTFYYNQSLDHFNYRPES  73

Query  326   YATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEH  505
             Y  F  RYI++ KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEH
Sbjct  74    YTCFPHRYIINFKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAVRFDALLVYIEH  133

Query  506   RYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYG  685
             RYYGKS+PFG+ EEA+ N +T GYF+SAQA+ADYA VLL+LK KY A+ SP+IV GGSYG
Sbjct  134   RYYGKSMPFGSREEALKNASTLGYFSSAQAIADYAAVLLHLKQKYHAKDSPVIVLGGSYG  193

Query  686   GMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSW  865
             GMLA+WFRLKYPHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SW
Sbjct  194   GMLAAWFRLKYPHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSW  253

Query  866   SVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGG  1045
             S I+ IASKPNGLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGG
Sbjct  254   SKIETIASKPNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGG  313

Query  1046  IDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1225
             IDGA  G+ I+ ++ AGV   +GN  CY+    N   +ET VGWRWQ CSEM MP+   +
Sbjct  314   IDGASPGSGIISKVAAGVFAYKGNLPCYNIGPRN--DTETDVGWRWQRCSEMVMPMSTSN  371

Query  1226  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1405
              DTMF P  F ++ F   C   YGV PRPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRD
Sbjct  372   -DTMFPPITFDLRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRD  430

Query  1406  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1585
             PYSS GVL+++SD++LAV+T NGSHCLDI  A++TDP WL EQR+KEV II+ WI++YY 
Sbjct  431   PYSSGGVLQNLSDSLLAVHTLNGSHCLDILRANETDPQWLVEQREKEVSIIEGWISQYYA  490

Query  1586  ELEALKR  1606
             +LE  K+
Sbjct  491   DLEKSKK  497



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 374/491 (76%), Gaps = 18/491 (4%)
 Frame = +2

Query  155   TPP---PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSS----HFRTFYYRQTLDHFNY  313
             TPP    PL+ IPRL+P   +         +  Q K LS+     F TFYY+QTLDHFNY
Sbjct  20    TPPVSASPLN-IPRLSPTGRTF--EHGDYFADGQPKALSNFGPNDFETFYYKQTLDHFNY  76

Query  314   GPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLV  493
              P S++TF+QRY+++SKYWG +  ++PI A+LGAE PIDDD   IGFL++NA + +AL +
Sbjct  77    RPDSFSTFQQRYLINSKYWGSSNVSAPILAYLGAEEPIDDDLSVIGFLSENANQLQALQI  136

Query  494   YIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFG  673
             +IEHRYYGKSIPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV G
Sbjct  137   FIEHRYYGKSIPFGSREEAFQNASTLGYFNSAQAIADYAEILIHVKKQLRAEHSPVIVIG  196

Query  674   GSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQT  850
             GSYGGMLASWFRLKYPHVALGALASSAPILYFDNI  PE GYYS+ TKDF+EVSE CYQT
Sbjct  197   GSYGGMLASWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSIATKDFREVSETCYQT  256

Query  851   IRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVT  1030
             I+KSWS ID+IAS+P GLS+LS+KF+ C  L     L+DYL   Y  AAQY++PP+YPVT
Sbjct  257   IKKSWSEIDEIASQPEGLSVLSRKFQTCSQLLKSSVLEDYLMLMYTGAAQYNRPPRYPVT  316

Query  1031  EVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP--TSETIVGWRWQTCSEMA  1204
              VCGGIDGA  G D L +I AGVV   GN +CY     NPP   SET VGWRWQTCS+M 
Sbjct  317   VVCGGIDGASHGNDTLSKIFAGVVAYRGNESCY----VNPPKNKSETDVGWRWQTCSDMV  372

Query  1205  MPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNII  1384
             MPIG  + D+MF    F ++++   C   YGVPPRPHW TTY+GGHDIKLVL +F SNII
Sbjct  373   MPIGISN-DSMFPANQFDLKEYVESCKAQYGVPPRPHWATTYFGGHDIKLVLSRFASNII  431

Query  1385  FSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1564
             FSNGLRDPYSS GVLE+ISDTV+AV+T+NGSHCLDI GA+ TDPDWL  QRK EV+II+ 
Sbjct  432   FSNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKG  491

Query  1565  WITKYYVELEA  1597
             W++ YY EL A
Sbjct  492   WLSNYYAELRA  502



>gb|KDP43936.1| hypothetical protein JCGZ_05403 [Jatropha curcas]
Length=503

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/479 (65%), Positives = 371/479 (77%), Gaps = 15/479 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
              IPRL+P+   I   S     S     LS    T++Y QTLDHFNY P+SY TF+QRY++
Sbjct  29    NIPRLSPIGPRI---SLEDPESLSESSLSDDLETYFYNQTLDHFNYNPESYNTFQQRYVI  85

Query  356   SSKYWGGAQSN-SPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             SSKYWGG+ S  +PIF + GAE+P+D D   +GFL+DNA +FKALLVYIEHR+YGKSIPF
Sbjct  86    SSKYWGGSNSKYAPIFVYFGAEAPLDGDLYIVGFLSDNAIKFKALLVYIEHRFYGKSIPF  145

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N + RGYFNSAQALADYAE++L++K  + A++SP+IV GGSYGGMLASWFRL
Sbjct  146   GSQEEAVKNASVRGYFNSAQALADYAEIILHVKKTFDAENSPVIVIGGSYGGMLASWFRL  205

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFD+ITP++GYYSLVTKD+KE SE+CYQTI+KSW  ID++AS+
Sbjct  206   KYPHIALGALASSAPILYFDDITPQDGYYSLVTKDYKEASESCYQTIQKSWPEIDQLASQ  265

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA---PK  1063
             PNGL+ILSKKFK CK L    ELKDYLD+ Y  AAQY++PPKYPVT VC GIDG+     
Sbjct  266   PNGLAILSKKFKTCKPLTDVDELKDYLDTMYSGAAQYNKPPKYPVTVVCNGIDGSNTDSD  325

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTM  1237
             G D L +I  GVV   GNRTCY     N PT  SET VGWRWQTCSEM +PIGRG+ DTM
Sbjct  326   GNDTLSKIFGGVVAYRGNRTCY----INSPTNVSETSVGWRWQTCSEMVIPIGRGN-DTM  380

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F P PF +  + +DC   YGVPPRP W+TTYYGGH IKL+L +FGSNIIFSNGLRDPYSS
Sbjct  381   FPPDPFDLNAYVQDCKASYGVPPRPRWVTTYYGGHSIKLILQRFGSNIIFSNGLRDPYSS  440

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              GVL +ISDT++AVYT  GSHCLDI  A+K TDP+WL  QR  E+ II  WI KYY +L
Sbjct  441   GGVLANISDTIVAVYTSEGSHCLDILQANKTTDPEWLVAQRNTEINIIDQWINKYYDDL  499



>ref|XP_002523754.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38694.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=517

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 370/486 (76%), Gaps = 11/486 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQ-TKPLSSH--FRTFYYRQTLDHFNYGPQSYATFKQR  346
             K PRL  L +S +Q      S P+ T  LSS     TF+Y Q LDHFN+ P+SYATFKQR
Sbjct  39    KTPRLRALRKSHIQ------SQPKITTELSSSKDILTFFYPQKLDHFNFKPESYATFKQR  92

Query  347   YIVSSKYWGGAQSNS-PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             Y+++ KYW G    S P+  + GAE  I+DD   IGFL D A  FK LLVYIEHRYYGKS
Sbjct  93    YVINFKYWSGPNRTSVPLLVFFGAEENIEDDVDGIGFLNDIASHFKGLLVYIEHRYYGKS  152

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ +E   N ++ GYF+SAQA+ADYA +++++K KY A+ SP+IV GGSYGGMLASW
Sbjct  153   IPFGSSKEVFRNASSLGYFSSAQAIADYAAIIMHVKKKYSAKTSPVIVIGGSYGGMLASW  212

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPHVALGALASSAPILYF++I P NGYYS+VTKDFKE SE+CYQTIRKSW+ I+K+
Sbjct  213   FRLKYPHVALGALASSAPILYFEDIAPRNGYYSIVTKDFKETSESCYQTIRKSWAEIEKV  272

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             ASK NGLSILSKKFK C  LK   ELKDYLDS Y  AAQY+ PP+YPVT VCGGIDGAPK
Sbjct  273   ASKRNGLSILSKKFKTCNPLKRTFELKDYLDSIYSEAAQYNDPPRYPVTIVCGGIDGAPK  332

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             G D+L RI AGVV   G+R+CYD   YN PT  T + WRWQTCSE+ MPIG  +R+TMF 
Sbjct  333   GTDVLGRIFAGVVAYMGDRSCYDVNGYNHPTDATSLAWRWQTCSELVMPIGH-ERNTMFP  391

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
              +PF++  +++ C   YGV P+PHW+T YYGGHD+KL+LH+F SNIIFSNGL+DPYSS G
Sbjct  392   TSPFNLNSYTQKCKALYGVLPQPHWVTNYYGGHDLKLILHRFASNIIFSNGLKDPYSSGG  451

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             VLE+ISD+++A+ T NGSHCLDI     TDP WL  QRK E+EIIQ WI+KY ++L  LK
Sbjct  452   VLENISDSIVAISTVNGSHCLDIQQTQPTDPHWLVMQRKAEIEIIQGWISKYNIDLHELK  511

Query  1604  R*KTKL  1621
               +T++
Sbjct  512   DERTRV  517



>ref|XP_006487982.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/484 (64%), Positives = 373/484 (77%), Gaps = 18/484 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             KIPRL+P   +ILQ      ++     +S  F+TFYY QTLDHFNY P+SY+TF+QRY++
Sbjct  29    KIPRLSPTRGTILQNPEILSAT-----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYVI  83

Query  356   SSKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             + KYWGG        PIF +LGAE  +D D   IGFLTDNA RF ALLVYIEHRYYGKSI
Sbjct  84    NFKYWGGGAGADAIAPIFVYLGAEEALDGDISVIGFLTDNAARFNALLVYIEHRYYGKSI  143

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GYFNSAQA+ DYA +LLY+K KY A+HSP+IV GGSYGGMLA+WF
Sbjct  144   PFGSREEALKNASTLGYFNSAQAITDYAAILLYIKEKYNARHSPVIVVGGSYGGMLATWF  203

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPHVALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K+A
Sbjct  204   RLKYPHVALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKVA  263

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             SK +GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G
Sbjct  264   SKLDGLSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALG  323

Query  1067  A--DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDT  1234
                D L +I AGVV  +GN+TCY     NPP   SET VG+RWQ CSEM MPIG  D  T
Sbjct  324   TDNDTLSKIFAGVVASKGNKTCY----VNPPINESETTVGYRWQRCSEMVMPIGI-DNTT  378

Query  1235  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1414
             MF P PF    +  DC   YGV  RPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYS
Sbjct  379   MFPPDPFDRSNYIDDCKKLYGVSSRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYS  438

Query  1415  SAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S GVLEDIS++V+A++T NGSHCLDI  A++ +DPDWL  QRK EVEII+ WI+KYY +L
Sbjct  439   SGGVLEDISESVVAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEGWISKYYDDL  498

Query  1592  EALK  1603
             +A++
Sbjct  499   KAVQ  502



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 363/482 (75%), Gaps = 8/482 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLS---SHFRTFYYRQTLDHFNYGPQSYATFKQR  346
              IPRL+P   + L+R+   H   +T   +   + F TFYY QTLDHFN+ P S+ TF+QR
Sbjct  25    NIPRLSPNGGTFLRRNYFAHDQQKTMSAADPINDFETFYYNQTLDHFNFRPDSFNTFQQR  84

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++ K+WGG+  ++PIFA+LG E  ID D   +GFL++NA +F+AL ++IEHRYYGKS+
Sbjct  85    YLINFKHWGGSNVSAPIFAYLGEEEAIDVDLSIVGFLSENAHQFQALQIFIEHRYYGKSV  144

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA  N  T GYFNSAQALADYAEVL+++K K  AQHSP+IV G SYGGMLASWF
Sbjct  145   PFGSREEAFQNADTLGYFNSAQALADYAEVLIHVKKKLHAQHSPVIVIGASYGGMLASWF  204

Query  707   RLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             RLKYPHVALGALASSAPILYFDNI  PE+GYYS+VTKDF+E SE CYQTI+KSWS ID I
Sbjct  205   RLKYPHVALGALASSAPILYFDNIVPPEDGYYSIVTKDFREASETCYQTIKKSWSDIDAI  264

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             AS+P GLS LS+KF  C+ LK   ELK+YLD+ YC AAQY+ PP YPVT VCG IDGA  
Sbjct  265   ASQPEGLSFLSEKFHTCRPLKKSSELKNYLDNLYCNAAQYNSPPSYPVTVVCGAIDGA-S  323

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             G D L +I AGVV   GN +CY  Q  N   +ET +GW WQTCS+M +P+     D+MF 
Sbjct  324   GNDTLTKIFAGVVAFSGNTSCYVNQPRN--LTETDMGWSWQTCSDMVIPMASVSNDSMFP  381

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
                F ++ + + C   YGVPPRPHW+TTY+GGHDIKL L +F SNIIFSNGLRDPYSS G
Sbjct  382   AYQFDLKDYIKSCKAQYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRDPYSSGG  441

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             VLEDISDT++AV+ +NGSHCLDI  A   TDPDWL  QRK EV+II+ WI +YY +L+A 
Sbjct  442   VLEDISDTIVAVHAKNGSHCLDILNADNITDPDWLVNQRKIEVKIIKRWIARYYADLQAF  501

Query  1601  KR  1606
             K+
Sbjct  502   KK  503



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/478 (62%), Positives = 369/478 (77%), Gaps = 8/478 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++IPRL+P+  + L  + +  SS     +S  F+TFYY QTLDHFNY P+SY  F  RYI
Sbjct  28    YRIPRLSPIGRTFLHNAEAIPSS-----ISDDFKTFYYNQTLDHFNYRPESYTCFPHRYI  82

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEHRYYGKS+PF
Sbjct  83    INFKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAARFDALLVYIEHRYYGKSMPF  142

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N +T GYF+SAQA+ADYA VL++LK KY A+ SP+IV GGSYGGMLA+WFRL
Sbjct  143   GSREEALKNASTLGYFSSAQAIADYAAVLIHLKQKYHAKDSPVIVLGGSYGGMLAAWFRL  202

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SWS I+ I SK
Sbjct  203   KYPHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSWSKIEIIGSK  262

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGGIDGA  G+ 
Sbjct  263   PNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGASPGSG  322

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             I+ ++ AGV   +GN +CY+  I     +ET VGWRWQ CSEM MP+   + DTMF P  
Sbjct  323   IISKVAAGVFAYKGNLSCYN--IGPRSETETDVGWRWQRCSEMVMPLSTTN-DTMFPPIT  379

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F ++ F   C   YGV  RPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRDPYSS GVL+
Sbjct  380   FDLKSFVDYCYQLYGVSSRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGGVLQ  439

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ++SD++LAV+T  GSHCLDI  A++TDP WL +QR+ EV II+ WI+KYY +LE  K+
Sbjct  440   NLSDSLLAVHTPKGSHCLDILRANETDPQWLVKQRETEVRIIEGWISKYYADLEKSKK  497



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 361/482 (75%), Gaps = 8/482 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLS---SHFRTFYYRQTLDHFNYGPQSYATFKQR  346
              IPRL+P     L+ +   H   +T   +   + F TFYY QTLDHFN+ P S+ TF+QR
Sbjct  25    NIPRLSPNGGKFLRGNYFAHDQQKTMSAADPINDFETFYYNQTLDHFNFRPDSFNTFQQR  84

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++ K+WGG+  ++PIFA+LG E  IDDD   IGFL++NA +F+AL ++IEHRYYGKS+
Sbjct  85    YLINFKHWGGSNVSAPIFAYLGEEEAIDDDLSIIGFLSENAHQFQALQIFIEHRYYGKSV  144

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA  N  T GYFNSAQALADYAEVL+++K K  AQHSP+IV G SYGGMLASWF
Sbjct  145   PFGSREEAFQNADTLGYFNSAQALADYAEVLIHVKKKLHAQHSPVIVIGASYGGMLASWF  204

Query  707   RLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             RLKYPHVALGALASSAPILYFDNI  PE+GYYS+VTKDF+E SE CYQTI+KSWS ID I
Sbjct  205   RLKYPHVALGALASSAPILYFDNIVPPEDGYYSIVTKDFREASETCYQTIKKSWSEIDAI  264

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
             AS+P GLS LS+KF  C+ L    ELK+YLD+ YC AAQY+ PP YPVT VCGGIDGA  
Sbjct  265   ASQPEGLSFLSEKFHTCRPLIKSSELKNYLDNLYCNAAQYNSPPTYPVTAVCGGIDGA-S  323

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             G D L +I AGVV   GN +CY     N   +ET +GW WQTCS+M +P+     D+MF 
Sbjct  324   GNDTLTKIFAGVVAFSGNTSCYVNHPRN--LTETDMGWSWQTCSDMVIPMTSVSNDSMFP  381

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
                F ++ + + C   YGVPPRPHW TTY+GGHDIKL L +F SNIIFSNGLRDPYSS G
Sbjct  382   AYQFDLKDYIKSCQAQYGVPPRPHWATTYFGGHDIKLALERFASNIIFSNGLRDPYSSGG  441

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             VLEDISDTV+AV+ +NGSHCLD+  A+  TDPDWL  QRK EV+II+ WI KYY +L+A 
Sbjct  442   VLEDISDTVVAVHAKNGSHCLDLLNANNITDPDWLVNQRKIEVKIIKRWIAKYYADLQAF  501

Query  1601  KR  1606
             K+
Sbjct  502   KK  503



>ref|XP_004160098.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=514

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/478 (62%), Positives = 368/478 (77%), Gaps = 9/478 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++ PRL+P+ E  L  S   +S P        F+T+YY QTLDHFNY P+SY TF QRYI
Sbjct  46    NRFPRLSPVGEKFLHHSRVLNSLPLDD-----FKTYYYNQTLDHFNYRPESYTTFPQRYI  100

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF
Sbjct  101   INFKYWGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPF  160

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRL
Sbjct  161   RSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRL  220

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +
Sbjct  221   KYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQ  280

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG      
Sbjct  281   PNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNG  340

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPIG    D MF P+P
Sbjct  341   TLSKIAAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPIGSD--DDMFPPSP  396

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL 
Sbjct  397   FDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLH  456

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             +ISD++LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI+KYY +L+  K+
Sbjct  457   NISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISKYYADLKKYKQ  514



>ref|XP_006424417.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
 gb|ESR37657.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
Length=502

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/484 (65%), Positives = 376/484 (78%), Gaps = 18/484 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
              IPRL+P   +ILQ      ++     +S  F+TFYY QTLDHFNY P+SY+TF+QRY++
Sbjct  29    NIPRLSPTRGTILQNPEILSAT-----ISKDFQTFYYNQTLDHFNYRPESYSTFQQRYVI  83

Query  356   SSKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             + KYWGG        PIF +LGAE  +D D   IGFLTDNA RF ALLVYIEHRYYGKSI
Sbjct  84    NFKYWGGGAGADANAPIFVYLGAEESLDGDISVIGFLTDNAARFNALLVYIEHRYYGKSI  143

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ +EA+ N +T GYFNSAQA+ DYAE+LLY+K KY A+HSP+IV GGSYGGMLA+WF
Sbjct  144   PFGSRKEALKNASTLGYFNSAQAITDYAEILLYIKEKYNARHSPVIVIGGSYGGMLAAWF  203

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH ALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K A
Sbjct  204   RLKYPHAALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKFA  263

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             S+P+GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G
Sbjct  264   SEPDGLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALG  323

Query  1067  A--DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDT  1234
                DIL +I AGVV  +GN+TCY     NPP   SET VG+RWQTCSEM MPIG  D  T
Sbjct  324   TDNDILSKIFAGVVASKGNKTCY----VNPPINESETTVGYRWQTCSEMVMPIGI-DNTT  378

Query  1235  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1414
             MF P PF +  +  DC   YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYS
Sbjct  379   MFPPDPFELSNYIDDCKKLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYS  438

Query  1415  SAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S GVLEDIS++V+A++T NGSHCLDI  A++ +DPDWL  QRK EVEII+ WI+KYY +L
Sbjct  439   SGGVLEDISESVIAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEGWISKYYDDL  498

Query  1592  EALK  1603
             +A++
Sbjct  499   KAVQ  502



>gb|KGN46898.1| hypothetical protein Csa_6G149390 [Cucumis sativus]
Length=511

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 368/478 (77%), Gaps = 9/478 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++ PRL+P+ E  L  S   +S P        F+T+YY QTLDHFNY P+SY TF QRYI
Sbjct  43    NRFPRLSPVGEKFLHHSRVLNSLPLDD-----FKTYYYNQTLDHFNYRPESYTTFPQRYI  97

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF
Sbjct  98    INFKYWGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPF  157

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRL
Sbjct  158   RSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRL  217

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +
Sbjct  218   KYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQ  277

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG      
Sbjct  278   PNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNG  337

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPIG    D MF P+P
Sbjct  338   TLSKIAAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPIGSD--DDMFPPSP  393

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL 
Sbjct  394   FDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLH  453

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             +ISD++LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  454   NISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISEYYADLKKYKQ  511



>ref|XP_004145824.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=507

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 368/478 (77%), Gaps = 9/478 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++ PRL+P+ E  L  S   +S P        F+T+YY QTLDHFNY P+SY TF QRYI
Sbjct  39    NRFPRLSPVGEKFLHHSRVLNSLPLDD-----FKTYYYNQTLDHFNYRPESYTTFPQRYI  93

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF
Sbjct  94    INFKYWGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPF  153

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRL
Sbjct  154   RSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRL  213

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +
Sbjct  214   KYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQ  273

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG      
Sbjct  274   PNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNG  333

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPIG    D MF P+P
Sbjct  334   TLSKIAAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPIGSD--DDMFPPSP  389

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL 
Sbjct  390   FDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLH  449

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             +ISD++LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  450   NISDSLLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISEYYADLKKYKQ  507



>ref|XP_004295650.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 368/486 (76%), Gaps = 17/486 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKH------SSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             KIPRL+P   S++Q +   H      SSP   P    F+TFYY QTLDHFN+   S++TF
Sbjct  26    KIPRLSPTGGSLIQENYWTHGRPGEASSPSFDP--KDFQTFYYNQTLDHFNFRYDSFSTF  83

Query  338   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  517
             +QRY+++SK+WGGA  ++PI A+LG E  ID D   IGFL +NA  F+AL +YIEHRYYG
Sbjct  84    QQRYLINSKHWGGANISAPILAYLGEEDSIDSDLPIIGFLPENAIHFQALQIYIEHRYYG  143

Query  518   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  697
             KSIPFG+ E A  N +TRGYFNSAQALADYAE+L+++K +  A+HSP+IV GGSYGGMLA
Sbjct  144   KSIPFGSREVAFKNASTRGYFNSAQALADYAEILIHVKKQLHAEHSPVIVIGGSYGGMLA  203

Query  698   SWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVI  874
             SWFRLKYPH+ALGALASSAPILYFD+I  P+ GYYS+VT+DF+E SE CYQTI+KSWS I
Sbjct  204   SWFRLKYPHIALGALASSAPILYFDDIVPPDTGYYSIVTRDFREASETCYQTIKKSWSEI  263

Query  875   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG  1054
             D IAS P GLS LSKKF+ C+ L    ELKDYLD+ Y TAAQYD+PP+YPVT VCGGIDG
Sbjct  264   DSIASTPGGLSFLSKKFQTCRPLNKSSELKDYLDTMYSTAAQYDRPPRYPVTVVCGGIDG  323

Query  1055  APKGADILDRIHAGVVGLEGNRTCYDPQIYNPP--TSETIVGWRWQTCSEMAMPIGRGDR  1228
             A    D L +I AGVV   GNR+CY     NPP   +ET VGW WQTCS+M +PI   + 
Sbjct  324   ASSTDDTLTKIFAGVVAYTGNRSCY----VNPPRNLTETDVGWAWQTCSDMVIPINVSN-  378

Query  1229  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1408
             DTMF P  F   ++++DC   YGVPPR +W+TTY+GGHDIKL L +F  NIIFSNGLRDP
Sbjct  379   DTMFPPYKFDSDEYTKDCIATYGVPPRLNWVTTYFGGHDIKLGLSRFAGNIIFSNGLRDP  438

Query  1409  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYV  1585
             YS  GVLE+ISD+V+AVYT+NGSHCLDI  ++  TDPDWL  QRK EV II+ WI KYY 
Sbjct  439   YSIGGVLENISDSVVAVYTKNGSHCLDILISNHITDPDWLVNQRKTEVRIIKGWIAKYYA  498

Query  1586  ELEALK  1603
             +L+ALK
Sbjct  499   DLQALK  504



>ref|XP_009356983.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=507

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/484 (61%), Positives = 364/484 (75%), Gaps = 12/484 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLS-----SHFRTFYYRQTLDHFNYGPQSYATFK  340
              IP L+P   + +Q +   H  P  KPLS     + F TFYY QTLDHFN+ P S+ TF+
Sbjct  29    NIPLLSPNAGTFVQGNYFAHDHP--KPLSAFDPATEFETFYYNQTLDHFNFRPDSFNTFQ  86

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY+++  +WGG+  ++PIFA+LG E  ID D   IGFL++NA +F+AL ++IEHRYYG+
Sbjct  87    QRYLINFNHWGGSNISAPIFAYLGEEEAIDADLSIIGFLSENANQFQALQIFIEHRYYGQ  146

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV G SYGGMLAS
Sbjct  147   SVPFGSREEAFKNASTIGYFNSAQAMADYAEILIHVKKQLRAEHSPVIVIGASYGGMLAS  206

Query  701   WFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             WFRLKYPHVALGALASSAPILYFDNIT PE GYYS+VTKDF+E SE CYQTI+KSWS ID
Sbjct  207   WFRLKYPHVALGALASSAPILYFDNITPPEKGYYSIVTKDFQEASETCYQTIKKSWSEID  266

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA  1057
              IASKP GLS LS KF  C  L +  ELK+YLD  YC AAQY+ PP YPVT  CGGIDG 
Sbjct  267   DIASKPEGLSFLSNKFHTCSPLTTSSELKNYLDGLYCGAAQYNSPPSYPVTVFCGGIDGV  326

Query  1058  PKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
               G D L +I AGVV   GNR+CY  +  N   SET VGW WQTCS+M +PI   + D+M
Sbjct  327   SSGNDTLSKIFAGVVAYSGNRSCYVNEPRN--LSETDVGWSWQTCSDMVIPISVSN-DSM  383

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F P  F +Q++  +C   YGVPPRPHW+T Y+GGHDIKL L++F SNIIFSNGLRDP+S 
Sbjct  384   FPPYQFDLQEYIDNCKAIYGVPPRPHWVTAYFGGHDIKLALYRFASNIIFSNGLRDPFSG  443

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             AGVLE+ISDTV+AV+ +NGSHCLD+  ++  TDPDWL EQRK EV+II+ W+ +YY +L 
Sbjct  444   AGVLENISDTVVAVHAKNGSHCLDVLRSNNITDPDWLVEQRKTEVKIIEGWLAEYYSKLR  503

Query  1595  ALKR  1606
             A K+
Sbjct  504   AFKQ  507



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/483 (61%), Positives = 363/483 (75%), Gaps = 11/483 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLS-----SHFRTFYYRQTLDHFNYGPQSYATFK  340
              IPRL+P   + +Q +      P  KPLS     + F+T YY QTLDHFN+ P S+ TF+
Sbjct  29    NIPRLSPNAGAFVQGNYFARDHP--KPLSAFDPVTEFQTIYYNQTLDHFNFRPDSFNTFQ  86

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY+++ K+WGG+  ++PIFA+LG E  ID D   IGFL++NA +F+AL ++IEHRYYG+
Sbjct  87    QRYLINFKHWGGSNISAPIFAYLGEEEAIDADLSIIGFLSENADKFQALQIFIEHRYYGQ  146

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PFG+ EE   N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV G SYGGMLAS
Sbjct  147   SVPFGSREEGFKNASTIGYFNSAQAMADYAEILIHVKKQLRAEHSPVIVIGASYGGMLAS  206

Query  701   WFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             WFRLKYPHVALGALASSAPILYF++I  PE GYYS+VTKDF+E SE CYQTI+KSWS ID
Sbjct  207   WFRLKYPHVALGALASSAPILYFEDIIPPEKGYYSIVTKDFQEASETCYQTIKKSWSEID  266

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA  1057
              IASKP GLS LS KF+ C  L    ELKDYLDS YC AAQY+ PP YPVT VCGGIDG 
Sbjct  267   DIASKPEGLSFLSNKFRTCSPLTKSSELKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGV  326

Query  1058  PKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
               G D L +I AGVV   GNR+CY  +  N   SET VGW WQTCS++ +P+G  + ++M
Sbjct  327   SSGNDTLSKIFAGVVAYYGNRSCYVNEPRN--LSETDVGWSWQTCSDLVIPMGVSN-ESM  383

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F P  F +Q++   C   YGVPPRPHW TTY+GGHDIKL L++F SNIIFSNGLRDPYSS
Sbjct  384   FPPYQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRDPYSS  443

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLE+ISDTV+AV  +NGSHCLD+  +  TDPDWL EQRK EV+II+ W+ +YY EL A
Sbjct  444   GGVLENISDTVVAVLAKNGSHCLDVLLSDSTDPDWLVEQRKTEVKIIEGWLAEYYGELRA  503

Query  1598  LKR  1606
              ++
Sbjct  504   FEQ  506



>ref|XP_008458665.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Cucumis 
melo]
Length=511

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 366/478 (77%), Gaps = 9/478 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++ PRL+P+ E  L  S + +S P     S  F+T+YY QTLDHFNY P+SY TF QRYI
Sbjct  43    NRFPRLSPIGEKFLHHSRALYSLP-----SDDFKTYYYNQTLDHFNYRPESYTTFLQRYI  97

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGG  S++PIFA+LGAE+PID D  +IGFLTDNA +F ALL+YIEHRYYGKSIPF
Sbjct  98    INFKYWGGPNSSAPIFAYLGAEAPIDGDLNFIGFLTDNAIQFNALLIYIEHRYYGKSIPF  157

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRL
Sbjct  158   RSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRL  217

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I  +AS+
Sbjct  218   KYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIKTVASQ  277

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG      
Sbjct  278   PNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNG  337

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPI     D MF P P
Sbjct  338   TLSKIAAGVFAFRGSISCYINEPRN--ETETDVGWRWQSCSEMVMPI--SSDDDMFPPYP  393

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL 
Sbjct  394   FDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLH  453

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
              ISD++LAV+T NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  454   SISDSLLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGWISEYYADLKKYKQ  511



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 364/478 (76%), Gaps = 6/478 (1%)
 Frame = +2

Query  167   PLHKIPRLTPLYES---ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             P  KIPRL  L  S   +L+ SSS  +   +  LS +F+TF+Y QTLDHFNY P+SY TF
Sbjct  25    PSKKIPRLGVLRGSSLSVLEGSSSLRTV--SVNLSENFQTFFYPQTLDHFNYRPESYTTF  82

Query  338   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  517
             + RY+V+  YWGGA+S + IF +LG ES +D D   IGFL DN  RF ALLVYIEHRYYG
Sbjct  83    QHRYMVNFNYWGGARSAAQIFVYLGEESDLDKDINSIGFLVDNGARFGALLVYIEHRYYG  142

Query  518   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  697
             KS PFG+M++++ N + RGYFNS QALADYAEV++ LK    A  SP+IV GGSYGG+LA
Sbjct  143   KSNPFGSMQKSLQNASRRGYFNSGQALADYAEVIINLKKNLSADSSPVIVVGGSYGGLLA  202

Query  698   SWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             +WFRLKYPHVALGALASSAPILYFD+ITP++GYYSLVTKDF++ SE+CY TI+ SW+ ID
Sbjct  203   AWFRLKYPHVALGALASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEID  262

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA  1057
             K A++ NGL  LSKKF+ CK L+S  +LKDYL++ Y  AAQYD+PP YPVT VC GIDG 
Sbjct  263   KAAAEANGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTVVCNGIDGG  322

Query  1058  PKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +G DILDRI +G+V   GN++CYD    + P SET  GW WQ CSE+ +PIGRG  DTM
Sbjct  323   LQGTDILDRIFSGIVASRGNKSCYDMGQSSFP-SETEEGWNWQVCSELVIPIGRGSNDTM  381

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  APF  ++++  C   YGV PRPHWIT+YYGGH+IKL+L +FGSNIIFSNGLRDPYSS
Sbjct  382   FPAAPFDFKEYADSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSS  441

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              GVLEDIS +++AV+T  GSHCLDI  +++ DP+WL  QR  E+EII  W+ KYY +L
Sbjct  442   GGVLEDISHSIIAVHTPRGSHCLDILPSTEDDPNWLVLQRNVEIEIIHGWLLKYYEDL  499



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 370/489 (76%), Gaps = 14/489 (3%)
 Frame = +2

Query  155   TPP---PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSS----HFRTFYYRQTLDHFNY  313
             TPP    PL+ IPRL+P   +      +  +  Q K LS+     F TFYY+QTLDHFN+
Sbjct  20    TPPVSASPLN-IPRLSPTGGTF--EHGNYFADGQPKALSNFDPNDFETFYYKQTLDHFNF  76

Query  314   GPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLV  493
              P S++TF+QRY+++SKYWGG+  ++PI A+LGAE  +D+    IGFL++NA + +AL +
Sbjct  77    RPDSFSTFQQRYLINSKYWGGSNVSAPILAYLGAEDAVDNSLSSIGFLSENANQLQALQI  136

Query  494   YIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFG  673
             +IEHRYYGKSIPF + EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV G
Sbjct  137   FIEHRYYGKSIPFRSREEAFQNASTLGYFNSAQAIADYAEILIHVKKQLHAEHSPVIVIG  196

Query  674   GSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQT  850
             GSYGGMLASWFRLKYPHVALGALASSAPILYFDNI  PE GYYS+VTKDF+EVSE CYQT
Sbjct  197   GSYGGMLASWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSIVTKDFREVSETCYQT  256

Query  851   IRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVT  1030
             I+KSWS ID+IAS+P GLSILS+KF+ C  L +   L++YL   Y  AAQY++PP+YPVT
Sbjct  257   IKKSWSEIDEIASQPEGLSILSRKFQTCSQLLTSSVLENYLMLMYTGAAQYNRPPRYPVT  316

Query  1031  EVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMP  1210
              VCGGIDGA  G D L +I AGVV   GN++CY  +  N   SET VGW WQTCS+M +P
Sbjct  317   VVCGGIDGASHGNDTLSKIFAGVVAYRGNKSCYVNEPKN--KSETDVGWGWQTCSDMVIP  374

Query  1211  IGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1390
             IG  + D+MF    F +  +   C   YGVPPRPHW TTY+GGHDIKL L  F SNIIFS
Sbjct  375   IGISN-DSMFPANEFDLNDYIETCKAQYGVPPRPHWATTYFGGHDIKLALSGFASNIIFS  433

Query  1391  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWI  1570
             NGLRDPYSS GVLE+ISDTV+AV+T+NGSHCLDI GA+ TDPDWL  QRK EV+II+ W+
Sbjct  434   NGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWL  493

Query  1571  TKYYVELEA  1597
              KYY EL A
Sbjct  494   DKYYAELRA  502



>ref|XP_010100139.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81590.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=652

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/452 (66%), Positives = 356/452 (79%), Gaps = 8/452 (2%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  + TF+Y QTLDHFNY P+SY+TF+QRY+V+SKYWGG  SN+PIFA LGAE+P+D   
Sbjct  206   SEDYETFFYNQTLDHFNYRPESYSTFQQRYVVNSKYWGG--SNAPIFAHLGAEAPLDAGA  263

Query  440   -KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  616
                IGFLTDNAP FKALL+YIEHRYYGKSIPFG+ EEA+ N +T GYFNSAQA+ADYAE+
Sbjct  264   LSAIGFLTDNAPEFKALLIYIEHRYYGKSIPFGSREEALKNASTLGYFNSAQAIADYAEI  323

Query  617   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  796
             LL++K K+ A+ SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILYFDNITP++GY
Sbjct  324   LLHVKRKFHAEKSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFDNITPQDGY  383

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             YS+VTKDF E SE+CY+TI+KSWS ID++A+ PNGLSILS+KF  C+ L+   ELK YL 
Sbjct  384   YSIVTKDFIEASESCYKTIQKSWSEIDRVAALPNGLSILSEKFHTCRPLEKSSELKRYLR  443

Query  977   STYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNP  1150
               Y TAAQY+ PP+YPV+ +CGGIDGA      DIL +I  G+     N TCY  Q  N 
Sbjct  444   IMYATAAQYNHPPRYPVSVICGGIDGANDIDDHDILGKIFLGLSSYITNSTCYVNQPRN-  502

Query  1151  PTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTY  1330
               SET VGW WQTCSEM +PIG  + +TMF  +PF +Q F  +C   Y VPPRPHW+TTY
Sbjct  503   -LSETDVGWNWQTCSEMVIPIGISN-NTMFSASPFELQDFINECKAAYDVPPRPHWVTTY  560

Query  1331  YGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKT  1510
             YGG DIKL+L +F SNIIFSNGLRDPYSS GVLE+IS +V+AV T  GSHCLDI+ A +T
Sbjct  561   YGGKDIKLILRRFASNIIFSNGLRDPYSSGGVLENISKSVVAVTTTKGSHCLDIHRAKET  620

Query  1511  DPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             DPDWL +QRK EV II+ WI +YY +LEA  +
Sbjct  621   DPDWLVKQRKIEVNIIKRWIAQYYFDLEAFNK  652


 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 139/209 (67%), Gaps = 17/209 (8%)
 Frame = +2

Query  299  DHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRF  478
            DHFNY P+S  T + +YIV+ K+WGGA + SPIF +   E+PID      GF+ D A RF
Sbjct  10   DHFNYKPESDTTSQHKYIVNFKHWGGANTCSPIFVYTRHEAPIDAAVSGAGFMVDLASRF  69

Query  479  KALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSP  658
              LL+YIE    G S PFG+ EEA  N +T G+F+S Q LADYA+++  LK    A+   
Sbjct  70   NGLLLYIE----GDSTPFGSAEEAFQNASTLGFFSSTQTLADYAQLITDLKKNLSAE---  122

Query  659  IIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSEN  838
                      MLASWFRLKYPHV  G  ASSAPILYFD+ITP+N Y+ +VTKDF+E SE+
Sbjct  123  ----------MLASWFRLKYPHVIAGDSASSAPILYFDDITPQNAYHVIVTKDFRETSES  172

Query  839  CYQTIRKSWSVIDKIASKPNGLSILSKKF  925
            CY TIR+SWS ID++A++  GL  L+  F
Sbjct  173  CYNTIRQSWSEIDRVAAEKGGLEKLNTLF  201



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 357/472 (76%), Gaps = 2/472 (0%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             K+PRL        +    K       P    FRTFYY QTLDHFNY P+SY TF+ RY+V
Sbjct  33    KVPRLGVHGPYGARNHLGKVKVQSLAPSDQEFRTFYYNQTLDHFNYRPESYKTFQHRYVV  92

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             S K+W G  + +PIF +LG ES ++DD  YIG L+DNA RF AL VYIEHR+YG+SIPF 
Sbjct  93    SFKHWRGPDTMAPIFVYLGEESSLNDDLGYIGILSDNAARFGALQVYIEHRFYGESIPFV  152

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ +   RGYF+SAQ LADYAEV+L++K K+ A  SP+IVFGGSYGGMLA+WFRLK
Sbjct  153   SREEALKDANLRGYFSSAQTLADYAEVILHIKKKHSADSSPVIVFGGSYGGMLAAWFRLK  212

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAP+LYFDNITP NGYY++VTKDFKE SE+CY+TI++SW  IDK+A+K 
Sbjct  213   YPHVALGALASSAPVLYFDNITPSNGYYTVVTKDFKESSESCYKTIKQSWFEIDKVAAKA  272

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             +GLSIL KKF  CK L++  ELK++LDS +  AAQYD+PP+YPV  VC GID AP+G+D+
Sbjct  273   DGLSILQKKFNTCKPLEAATELKNFLDSLFSVAAQYDRPPRYPVDLVCKGIDSAPEGSDV  332

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             LDRI +G+V   G + CY+   +   +SET+ GW WQTCSE+ +PIGRG  DTMF   PF
Sbjct  333   LDRIFSGIVAYFGKKPCYNLDAFF--SSETLEGWTWQTCSELVIPIGRGSNDTMFPAEPF  390

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
              ++++  +C   +GVPPRPHWITTYYGGH  K VL +FGSNIIFSNGLRDPYSS GVLE+
Sbjct  391   DLKEYIEECKSAFGVPPRPHWITTYYGGHHFKEVLRRFGSNIIFSNGLRDPYSSGGVLEN  450

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             ISD++LAVYT  G+HC+DI  A+  DPDW+  QR  E+EII  WI KYY +L
Sbjct  451   ISDSILAVYTTKGAHCMDILPATIGDPDWVVLQRNIEIEIINGWILKYYQDL  502



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 350/443 (79%), Gaps = 1/443 (0%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  F+ ++Y QTLDHFNY P+SYATFKQRY+++ K+WGGA S++PIF +LG ESP+D+  
Sbjct  59    SEDFKDYFYEQTLDHFNYRPESYATFKQRYVINYKFWGGANSSAPIFVYLGEESPLDNYI  118

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               IGFLTD+AP+F AL+V+IEHRYYG+S+PFG+MEEA  N +T GYF+S+QALADYAEV+
Sbjct  119   DAIGFLTDHAPKFNALVVFIEHRYYGQSVPFGSMEEAFQNASTLGYFSSSQALADYAEVI  178

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             LY+K    A+  P++V GGSYGGMLA+WFRLKYPH+ALGALASSAPILYF++ITP+NGYY
Sbjct  179   LYIKKSLSAESCPVVVIGGSYGGMLAAWFRLKYPHIALGALASSAPILYFEDITPQNGYY  238

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
             S+VTKDF+E SENCY TIR+SWS IDK AS+PNGLS+L+KKFK C  L    ELKDYL++
Sbjct  239   SIVTKDFRETSENCYNTIRQSWSEIDKTASQPNGLSVLTKKFKTCFPLNLSSELKDYLET  298

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1159
              Y +AAQYD+PP +PV+ +C  ID   KGAD+L ++ AG+V  +GN++CYD + +   T 
Sbjct  299   IYNSAAQYDRPPTFPVSAICSAIDNTSKGADLLSKVFAGLVAYKGNQSCYDTKEFKYST-  357

Query  1160  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1339
             ET  GW WQ CSEM MPIGRG  DTMF  APF++  F + C   YG+ PR +WITT +GG
Sbjct  358   ETKRGWNWQRCSEMVMPIGRGSNDTMFQAAPFNLTNFKQRCKRLYGISPRSNWITTQFGG  417

Query  1340  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1519
             HDI+LVL +FG NIIFSNGLRDPYSS  VL++ISD+++A+YT  GSHC+DI      DP 
Sbjct  418   HDIELVLKRFGGNIIFSNGLRDPYSSGSVLKNISDSLVAIYTTQGSHCMDILPELPDDPK  477

Query  1520  WLTEQRKKEVEIIQSWITKYYVE  1588
             WL  QR +E++II  WI +YY++
Sbjct  478   WLVMQRNQEIKIIGQWIKQYYMD  500



>ref|XP_007016019.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33638.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=468

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/447 (66%), Positives = 348/447 (78%), Gaps = 8/447 (2%)
 Frame = +2

Query  272   RTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIG  451
             + F   +TLDHFNY P+SYATF+QRY+++ ++WGGA + +PI  +LGAESP+  D   IG
Sbjct  27    KLFTTLKTLDHFNYKPESYATFQQRYVLNFQHWGGANATAPILVYLGAESPLGGDLSGIG  86

Query  452   FLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLK  631
             FL DNA  FKAL VYIEHRYYGKSIPF + +EA  N +T GYFNSAQA+ADYA++++++K
Sbjct  87    FLHDNAAPFKALCVYIEHRYYGKSIPFRSRKEAFKNASTLGYFNSAQAIADYADIIMHIK  146

Query  632   NKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVT  811
              K  A  SP+IV GGSYGGMLASWFRLKYPHVALGALASSAPILYF+NITP   YYS+V+
Sbjct  147   KKLHAMSSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFNNITPSGAYYSIVS  206

Query  812   KDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCT  991
             KDF+E SE CYQTIRKSWS IDKIASK +GLS LSKKFK C+ L S  E K+YLD+ Y  
Sbjct  207   KDFREASETCYQTIRKSWSEIDKIASKHHGLSTLSKKFKTCEPLTSSSEFKNYLDTMYTG  266

Query  992   AAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SET  1165
             AAQYD+PP YPV EVC GIDG+ K  DIL +I  GVV   GNRTCY     N PT  SET
Sbjct  267   AAQYDRPPSYPVNEVCRGIDGSKK-QDILSKIFDGVVAYYGNRTCY----LNQPTSDSET  321

Query  1166  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1345
               GWRWQTCSEM MPIG G+ +TMF P PF +  F ++C  YYGVP RPHWIT+YYGG D
Sbjct  322   DQGWRWQTCSEMVMPIGVGE-NTMFQPDPFDLDSFIKNCKGYYGVPARPHWITSYYGGQD  380

Query  1346  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1525
             IKL+L +FGSNIIFSNGLRDPYSS GVLE++SD++LAV T  GSHCLDI    +TDP+WL
Sbjct  381   IKLILQRFGSNIIFSNGLRDPYSSGGVLENLSDSILAVSTVKGSHCLDIQPKRETDPEWL  440

Query  1526  TEQRKKEVEIIQSWITKYYVELEALKR  1606
              EQRK  V+II+ W+ KYY +L+A KR
Sbjct  441   VEQRKTVVKIIKGWMAKYYADLKAFKR  467



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/481 (61%), Positives = 360/481 (75%), Gaps = 16/481 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P  E  L   ++  S+           TFYY+Q LDHFNY P+SY TF QRY+++
Sbjct  30    IPRLSPFQEKTLHDIATLVSNDPKD-----VETFYYKQVLDHFNYNPESYNTFNQRYLIN  84

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              KYWGGA S++PIF + G E PID  PK IGF+ + AP FKALLVYIEHRYYGKS+PFG+
Sbjct  85    FKYWGGANSSAPIFVYFGPEQPIDGSPKSIGFMVEKAPTFKALLVYIEHRYYGKSVPFGS  144

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              EEA  N  T GYFNSAQALADYAEV++ +K    AQ+SP+++ GGSYGGMLASWFRLKY
Sbjct  145   REEAFKNANTLGYFNSAQALADYAEVIIDIKKTLHAQNSPVVLIGGSYGGMLASWFRLKY  204

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+A+GALASSAPILYFD+IT  N Y+ +V++DFKEVSE CY+TI  SWS IDK+AS+PN
Sbjct  205   PHLAIGALASSAPILYFDDITSPNAYFDVVSRDFKEVSETCYETILNSWSEIDKVASQPN  264

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GLSILS++F  C+ L    EL + L+S Y +AAQY+ PP YPVT +C GID A  G +IL
Sbjct  265   GLSILSQRFNTCRPLNHSFELSEDLESMYTSAAQYNHPPDYPVTVICSGIDKASFGNNIL  324

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPT-SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             D+I++GVV  +GN TC   ++ NP   SET VGWRWQTCSEM MP   G+ DTMF P+PF
Sbjct  325   DKIYSGVVAYKGNGTC---KVNNPKNISETDVGWRWQTCSEMVMPFAIGN-DTMFQPSPF  380

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
              +++F   C   YGV PRPHWITTYYGGHDIK VL KFGSNIIFSNGL+DPYSSAGVL D
Sbjct  381   DLKRFVERCKKKYGVSPRPHWITTYYGGHDIKRVLQKFGSNIIFSNGLKDPYSSAGVLHD  440

Query  1436  ISDTVLAVYTRN------GSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             +S +++AV T N      GSHCLDI  + ++DP WL EQR KEV+IIQ WI +YY++L A
Sbjct  441   LSKSLVAVPTINDINSIAGSHCLDILPSKESDPKWLIEQRNKEVKIIQEWIAQYYIDLGA  500

Query  1598  L  1600
             L
Sbjct  501   L  501



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/438 (64%), Positives = 346/438 (79%), Gaps = 2/438 (0%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T YY QTLDHF+YGP+S+ TFKQRY ++SKYWGGA S++PI A+LGAE PID D  YI
Sbjct  64    FETLYYPQTLDHFSYGPESFTTFKQRYAINSKYWGGANSSAPILAFLGAEGPIDYDVGYI  123

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GFL +NAPR KAL VYIEHRYYGKS+PFG++++AM N + RGYFN+ QA+ADYA VLL++
Sbjct  124   GFLNENAPRLKALQVYIEHRYYGKSVPFGSVKKAMKNASIRGYFNTDQAIADYAVVLLHV  183

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K K  A +SPIIV GGSYGGMLA+WFRLKYPHVA+GALASSAPILYFD+ITPE+GYYS+V
Sbjct  184   KKKLSAHNSPIIVVGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDDITPESGYYSVV  243

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             TKDFK+ SE+CY+TIRKSW+ ID++AS+P+GLSILS+KFK C  LK+  +LKDYLD+ YC
Sbjct  244   TKDFKDTSESCYETIRKSWAEIDRVASEPSGLSILSRKFKTCGKLKTSADLKDYLDTVYC  303

Query  989   TAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETI  1168
              AAQY+ P   P++ +C  IDGAP   D L ++ AGV    GNR+CY+    N  + + +
Sbjct  304   GAAQYNGPSTRPLSHLCNAIDGAPNNTDTLGKLFAGVSAYRGNRSCYNIS-GNNLSDQLL  362

Query  1169  VGWRWQTCSEMAMPIGRG-DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1345
              GW WQ+CSEM MPI  G D D+MF    F ++ ++ DC   YGV PRPHW+TTYYGGHD
Sbjct  363   DGWYWQSCSEMVMPIAHGSDEDSMFPKDHFDLESYTNDCKRLYGVVPRPHWVTTYYGGHD  422

Query  1346  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1525
             IKLV H+F SNIIFSNGLRDPYS  GVLE+I+++V+AV T NGSHCLD+  +  +DP WL
Sbjct  423   IKLVFHEFASNIIFSNGLRDPYSRGGVLENITESVVAVTTDNGSHCLDLLSSRPSDPQWL  482

Query  1526  TEQRKKEVEIIQSWITKY  1579
               QRK E+EII+ WI KY
Sbjct  483   VMQRKNEIEIIEGWIAKY  500



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 354/477 (74%), Gaps = 6/477 (1%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             K PRL  +     ++      +P  K   + +  +YY QTLDHFNY P+SY TF+Q+Y++
Sbjct  31    KTPRLRVMRRMKDRKVGDMAGTPSPK---ADYNVYYYNQTLDHFNYRPESYTTFQQKYVI  87

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             +S YWGGA S++PIF +LG ES IDDD +  GFL++NAP+F AL+V+IEHRYYGKS+PFG
Sbjct  88    NSNYWGGANSSAPIFVYLGDESAIDDDIRTTGFLSENAPKFNALIVFIEHRYYGKSVPFG  147

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + +EA  + +T GYF+S+QALADYAE++L +K    A+ SP+IV GGSYGGMLA+WFRLK
Sbjct  148   SRDEAFRDASTLGYFSSSQALADYAEIILAIKKNLSAERSPVIVVGGSYGGMLAAWFRLK  207

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF++ SE+CY TIR+SWS ID+++S+P
Sbjct  208   YPHIALGALASSAPILYFDDITPQDGYYSVVTKDFRDASESCYNTIRQSWSEIDRVSSEP  267

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLSILSK+F  C  + S  +LKDYL+  YC AAQY  P    V ++C  IDG     DI
Sbjct  268   NGLSILSKQFMTCNPITSASQLKDYLEYMYCEAAQYAFPSDDSVLKICNAIDGTSNNTDI  327

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPT---SETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
             + ++ AGVV   GN +CYD    N P+    ET  GW WQTCSEM MP+GRG  DTMF  
Sbjct  328   IGKVVAGVVSYNGNSSCYDLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSNDTMFEA  387

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1426
             APF ++ F + C   Y V PRPHWITT +GGHDIKL+L +FGSNIIFSNGLRDPYSSAGV
Sbjct  388   APFDLEAFIQGCKSAYSVSPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRDPYSSAGV  447

Query  1427  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             L  ISD++LA+YT  G HCLDI  +S  DP+WL  QR++E+EII  WI +YY +L A
Sbjct  448   LTSISDSLLAIYTNEGCHCLDIVQSSPDDPNWLVMQRRREIEIISDWIKQYYADLAA  504



>ref|XP_010031429.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50725.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
 gb|KCW50726.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=496

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/454 (63%), Positives = 353/454 (78%), Gaps = 9/454 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF++ QTLDHFNY P+SY TF+QRY++ S++WGGA S++PIF +LGAESPID  
Sbjct  48    IADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWGGANSSAPIFVYLGAESPIDGS  107

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
             P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA++    RGYF+SAQALADYA 
Sbjct  108   PTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEALHETNIRGYFSSAQALADYAA  167

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ +GALASSAPILYFD+ITP++ 
Sbjct  168   IIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLTVGALASSAPILYFDDITPQDA  227

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S LS+ FK CK L+S  ELK+YL
Sbjct  228   YYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSNLSEMFKTCKPLESGDELKNYL  287

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNP  1150
              S Y  AAQYD PP+YPVT +C GIDGA    + IL +I AGVV  +GN  CY     NP
Sbjct  288   MSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKIFAGVVAYKGNSACY----VNP  343

Query  1151  PT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             PT  S+T +GW WQ CSEM MPIG  + ++MF   PF++  F  +C+D YGV PRPHWIT
Sbjct  344   PTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNLSSFIDECNDQYGVTPRPHWIT  402

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1504
             TYYGGHDI+L+L +FGSNIIFSNGLRDPYSSAGVL++ISD+++AVYT  GSHCLDI    
Sbjct  403   TYYGGHDIELILLRFGSNIIFSNGLRDPYSSAGVLKNISDSIIAVYTEKGSHCLDILAEK  462

Query  1505  KTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             +TDPDWL  QRK EVEII+ WI KYY +L A K+
Sbjct  463   QTDPDWLVMQRKVEVEIIKGWIAKYYSDLLAFKQ  496



>ref|XP_010651746.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Vitis 
vinifera]
Length=465

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/448 (65%), Positives = 352/448 (79%), Gaps = 11/448 (2%)
 Frame = +2

Query  128   STTCGGLSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHF  307
             STTC  +S T P  L    RL      +L R+  +  +  ++ +S  F+TFYY QTLDHF
Sbjct  24    STTC--VSATQPHLL----RL-----GVLGRTFLREPATFSESVSEEFQTFYYNQTLDHF  72

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
             NY P+SY TF+QRY+V+ KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKAL
Sbjct  73    NYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKAL  132

Query  488   LVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIV  667
             LVYIEHRYYGKSIP+G+ EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV
Sbjct  133   LVYIEHRYYGKSIPYGSREEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIV  192

Query  668   FGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQ  847
              G SYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+
Sbjct  193   VGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYK  252

Query  848   TIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPV  1027
             TI +SWS ID++AS+PNGLSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPV
Sbjct  253   TISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPV  312

Query  1028  TEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             T VCGGIDGAP+G+DIL RI AGVV   GN +CY          ETI GW WQTCSE+ +
Sbjct  313   TVVCGGIDGAPEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVI  372

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             PIGRG  DTMF  APF++  FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIF
Sbjct  373   PIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIF  432

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRN  1471
             SNGLRDPYS  GVL++IS++VLA+ T N
Sbjct  433   SNGLRDPYSIGGVLKNISNSVLAILTVN  460



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/489 (61%), Positives = 363/489 (74%), Gaps = 12/489 (2%)
 Frame = +2

Query  146   LSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQT--KPLSSHFRTFYYRQTLDHFNYGP  319
              S   P   +KIP+L    ++I        + PQT  K  S    TFYY QTLDHF+Y P
Sbjct  16    FSSCLPTTQYKIPKLGAFPKNI------HRTEPQTSSKSSSKDLVTFYYTQTLDHFSYKP  69

Query  320   QSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYI  499
             +SY TF+QRY++  +YWGGA +++PIF + GAE  +DDD   IGFL+DNAP FKALL+YI
Sbjct  70    ESYTTFRQRYVIDFRYWGGANTSAPIFVFFGAEEDLDDDLDAIGFLSDNAPHFKALLIYI  129

Query  500   EHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGS  679
             EHRYYGKSIPFG+ +EA+ N  T GY NSAQA+AD A V+++LK KY A+ SP+IV GGS
Sbjct  130   EHRYYGKSIPFGSRKEALKNAETLGYLNSAQAIADCAAVIMHLKKKYSAKDSPVIVIGGS  189

Query  680   YGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRK  859
             YGGML SWFRLKYPH+ALGALASSAPILYFD+I P+ GYYS+VTKDFKE SE+CY TIRK
Sbjct  190   YGGMLTSWFRLKYPHIALGALASSAPILYFDDIAPQEGYYSIVTKDFKETSESCYNTIRK  249

Query  860   SWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVC  1039
             SW  I KIASKPNGL+ILSKKFK C  L    EL+D+LDS YC AAQYD PP++PV+ VC
Sbjct  250   SWGEIKKIASKPNGLAILSKKFKTCYPLNRTFELEDFLDSIYCEAAQYDYPPEFPVSTVC  309

Query  1040  GGIDGAPKG-ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1216
             GGI+ A      ILDRI AGVV   GN +CYD   +N    +    WRWQTCSE+ MPIG
Sbjct  310   GGINKASAARTGILDRIFAGVVAYMGNISCYDMNAFN--YQDKTEEWRWQTCSELVMPIG  367

Query  1217  RGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNG  1396
               + ++MF PAPF+++ + +DC   +GV P+P WITTYYGGHD+KL+LH+FGSNIIFSNG
Sbjct  368   H-ESNSMFPPAPFNLKNYIKDCKSLFGVLPQPRWITTYYGGHDLKLILHRFGSNIIFSNG  426

Query  1397  LRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITK  1576
             LRDPYS  GVL +ISD+++AV   NGSHCLDI  AS +DP WL  QRK EV+II+ WI+K
Sbjct  427   LRDPYSGGGVLNNISDSIVAVSAVNGSHCLDIQRASPSDPHWLVTQRKIEVKIIEGWISK  486

Query  1577  YYVELEALK  1603
             YY +L   K
Sbjct  487   YYTDLLEFK  495



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/477 (60%), Positives = 356/477 (75%), Gaps = 9/477 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             +IPRL+P+ E  L      HS     P S  F+TFY+ QTLDHFNY P+SY TF QRYI+
Sbjct  24    RIPRLSPIGEKFLH-----HSKALELPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYII  78

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             + KYWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG
Sbjct  79    NFKYWGGANSSAPILAYLGPEAPIDSAMNVIGFMTDNAVKFNALLVYIEHRYYGKSIPFG  138

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + +EA+ N +T GYFNSAQALADYA +L+++K ++ A++SP+IV GGSYGGMLA+WFRLK
Sbjct  139   SRKEALRNASTLGYFNSAQALADYAAILIHVKKEFSAKYSPVIVIGGSYGGMLATWFRLK  198

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPILYF++ITPENGYY +VTKDF+EVS+ CY++IR+SWS I+ +AS+ 
Sbjct  199   YPHVALGALASSAPILYFNDITPENGYYVIVTKDFREVSQTCYESIRESWSEIETVASQS  258

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLS+L K FK C  L+S  +L++YL   Y +AAQY+ P +YPV  +C  ID        
Sbjct  259   NGLSVLDKVFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTYSNG-T  317

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L +I AGV    G  +CY  +  N  T+ET VGW+WQ CSEM MPI  G+ DTMF    F
Sbjct  318   LGKIAAGVFAYRGELSCYINEPIN--TTETTVGWQWQRCSEMVMPISTGN-DTMFPSETF  374

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
               + FS  C+  YGV PRPHW+TTYYGGHDI L+LH+F SNIIFSNGL+DPYS  GVL +
Sbjct  375   DHESFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHN  434

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ISD++LAVYT NGSHCLDI  A++ DP+WL  QRK EV II+ WI +YY +L   K+
Sbjct  435   ISDSLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEWIDEYYADLANYKK  491



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/445 (64%), Positives = 342/445 (77%), Gaps = 3/445 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  ++TF Y Q LDHFNY P SY TF+QRY+++ KYW GA +++PIF   G E  ID D 
Sbjct  52    SKDYKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANTSAPIFVLFGGEESIDYDR  111

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
                GFL +NAP FKALLVYIEHRYYGKS+PFGT EEAM N +T GY NSAQA+ADYA VL
Sbjct  112   DINGFLPENAPHFKALLVYIEHRYYGKSVPFGTKEEAMKNASTLGYCNSAQAIADYAAVL  171

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGY  796
             L++K KY A+  P+IV GGSYGGMLASWFRLKYPH+ALGALASS+PILYFD +  P+ GY
Sbjct  172   LHIKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIALGALASSSPILYFDGVVDPQVGY  231

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             Y++VTKDFKE SE+CY+TIRKSW  ID++ S+PNGLSILSKKF+ C  L S  ELKDYLD
Sbjct  232   YTIVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLSILSKKFRTCNPLNSTSELKDYLD  291

Query  977   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1156
             S Y  AAQYD+PPKYPV+ VCG IDGA +G D LD+I A VV   GN +CYD + +  PT
Sbjct  292   SLYTDAAQYDEPPKYPVSRVCGAIDGA-EGTDTLDKIFAAVVTYMGNTSCYDMKEFGSPT  350

Query  1157  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1336
             S T   + WQ C+E+  PIG G  DTMF  APF +  FS+ C+  +GV P+PHW+TTYYG
Sbjct  351   S-TFDMFTWQVCTELVFPIGHGHNDTMFPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYG  409

Query  1337  GHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDP  1516
             G DIKL+LH F SNIIFSNGLRDPYSS GVL++ISD+V+A+ T NGSHCLDI  A ++DP
Sbjct  410   GQDIKLILHNFASNIIFSNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDP  469

Query  1517  DWLTEQRKKEVEIIQSWITKYYVEL  1591
              WL  QRK EVEII+ W+ KY+ +L
Sbjct  470   LWLIMQRKAEVEIIEGWLAKYHADL  494



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/479 (60%), Positives = 356/479 (74%), Gaps = 12/479 (3%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSS  361
             PR+ PL      R S   +S     +  + +TFYY QTLDHFNY P S+  F+QRY+++S
Sbjct  44    PRVRPL-----GRISRNSASFAASSIYHNLQTFYYNQTLDHFNYRPDSFDMFQQRYVINS  98

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  541
             KYWGGA SN+PIF + G E+P++ D   IG L +NA RFKAL VYIEHRYYGKSIPFG+ 
Sbjct  99    KYWGGAISNAPIFVYFGEEAPLEYDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSR  158

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
              EA  N +T GYFNSAQALADYAE+++++K K+ AQ SP+IV G SYGGMLASWFRLKYP
Sbjct  159   NEAFKNASTLGYFNSAQALADYAEIIIHVKEKFHAQRSPVIVVGASYGGMLASWFRLKYP  218

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             H+ALGALASSAPILYF +ITP + Y S+VTKDF+E S++C+ TI+KSW+VIDKIASKP+G
Sbjct  219   HIALGALASSAPILYFTDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASKPDG  278

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1081
             LSILSKKFK CK L +  ELKDYL   Y  AAQYD PP YPVT +C  ID    G DIL 
Sbjct  279   LSILSKKFKTCKPLNNSSELKDYLAGIYMAAAQYDAPPSYPVTVICRSIDEPSFGNDILG  338

Query  1082  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             RI AG+V   G   CY     N PT  +ET VGW WQTC++M +P G  + D+MF P PF
Sbjct  339   RIFAGMVAYRGELPCY----VNKPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPF  393

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
              +  +  DC D YGVPPRPHW+TTY+GGHDIKL+L +FGSNIIFSNGLRDPYSS GVL++
Sbjct  394   DLNVYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQN  453

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1612
             IS++V+A+ T  GSHCLD+   +K+DP WL  QRK+EV II+ WI  Y+ +L+A ++ K
Sbjct  454   ISESVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDLDACEKGK  512



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/445 (64%), Positives = 342/445 (77%), Gaps = 3/445 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             S  ++TF Y Q LDHFNY P SY TF+QRY+++ KYW GA +++PIF   G E  ID D 
Sbjct  6     SKDYKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANTSAPIFVLFGGEESIDYDR  65

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
                GFL +NAP FKALLVYIEHRYYGKS+PFG+ EEAM N +T GY NSAQA+ADYA VL
Sbjct  66    DINGFLPENAPHFKALLVYIEHRYYGKSVPFGSKEEAMKNASTLGYCNSAQAIADYAAVL  125

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGY  796
             L++K KY A+  P+IV GGSYGGMLASWFRLKYPH+ALGALASS+PILYFD +  P+ GY
Sbjct  126   LHIKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIALGALASSSPILYFDGVVDPQVGY  185

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             Y++VTKDFKE SE+CY+TIRKSW  ID++ S+PNGLSILSKKF+ C  L S  ELKDYLD
Sbjct  186   YTIVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLSILSKKFRTCNPLNSTSELKDYLD  245

Query  977   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1156
             S Y  AAQYD+PPKYPV+ VCG IDGA +G D LD+I A VV   GN +CYD + +  PT
Sbjct  246   SLYTDAAQYDEPPKYPVSRVCGAIDGA-EGTDTLDKIFAAVVTYMGNTSCYDMKEFGSPT  304

Query  1157  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1336
             S T   + WQ C+E+  PIG G  DTMF  APF +  FS+ C+  +GV P+PHW+TTYYG
Sbjct  305   S-TFDMFTWQVCTELVFPIGHGHNDTMFPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYG  363

Query  1337  GHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDP  1516
             G DIKL+LH F SNIIFSNGLRDPYSS GVL++ISD+V+A+ T NGSHCLDI  A ++DP
Sbjct  364   GQDIKLILHNFASNIIFSNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDP  423

Query  1517  DWLTEQRKKEVEIIQSWITKYYVEL  1591
              WL  QRK EVEII+ W+ KY+ +L
Sbjct  424   LWLIMQRKAEVEIIEGWLAKYHADL  448



>ref|XP_008458662.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=495

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/477 (60%), Positives = 357/477 (75%), Gaps = 9/477 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             +IPRL+P+ E  L      HS     P S  F+TFY+ QTLDHFNY P+SY TF QRYI+
Sbjct  28    RIPRLSPIGEKFLY-----HSKALELPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYII  82

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             + KYWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG
Sbjct  83    NFKYWGGANSSAPILAYLGPEAPIDSAMNAIGFMTDNAVKFNALLVYIEHRYYGKSIPFG  142

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + +EA+ N +T GYFNSAQA+ADYA +L+++KN++ A++SP+IV GGSYGGMLA+WFRLK
Sbjct  143   SRKEALRNASTLGYFNSAQAIADYAAILIHVKNEFNAKYSPVIVIGGSYGGMLATWFRLK  202

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPILYF++ITP+NGYY  VTKDF+EVS+ CY+TIR+SWS I+ +AS+P
Sbjct  203   YPHVALGALASSAPILYFNDITPQNGYYVTVTKDFREVSQTCYETIRESWSEIETVASQP  262

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLS+L K+FK C  L+S  +L++YL   Y +AAQY+ P  YPVT +C  ID        
Sbjct  263   NGLSVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSSYPVTRICDAIDRTYSNG-T  321

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L +I AGV    GN +CY  +  N  T+ET VGW+WQ CSEM MPI   + DTMF P  F
Sbjct  322   LGKIAAGVFAYRGNLSCYINEPIN--TTETTVGWQWQRCSEMVMPISTSN-DTMFPPRTF  378

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
               + FS  C+  YGV PRPHW+TTYYGG D+ L+LH+F SNIIFSNGL+DPYS  GVL +
Sbjct  379   DHESFSIYCNQLYGVTPRPHWVTTYYGGDDVHLILHRFASNIIFSNGLKDPYSIGGVLHN  438

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ISD++ AVYT NGSHCLDI  +++ DP+WL  QRK EV II+ WI KYY +L   K+
Sbjct  439   ISDSLPAVYTANGSHCLDILSSNRMDPEWLVTQRKTEVRIIKEWIDKYYADLANYKK  495



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/477 (60%), Positives = 357/477 (75%), Gaps = 9/477 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             +IPRL+P+ E  L      HS     P S  F+TFY+ QTLDHFNY P+SY TF QRYI+
Sbjct  24    RIPRLSPIGEKFLH-----HSKALELPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYII  78

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             + KYWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG
Sbjct  79    NFKYWGGAYSSAPILAYLGPEAPIDSAMNVIGFMTDNAVKFNALLVYIEHRYYGKSIPFG  138

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A++SP+IV GGSYGGMLA+WFRLK
Sbjct  139   SRKEALRNASTLGYFNSAQAIADYAAILIHVKKEFSAKYSPVIVIGGSYGGMLATWFRLK  198

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPILYF++ITPENGYY +VTKDF+EVS+ CY++IR+SWS I+ +AS+ 
Sbjct  199   YPHVALGALASSAPILYFNDITPENGYYVIVTKDFREVSQTCYESIRESWSEIETVASQS  258

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             NGLS+L K+FK C  L+S  +L++YL   Y +AAQY+ P +YPV  +C  ID        
Sbjct  259   NGLSVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTYSNG-T  317

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             L +I AGV    G  +CY  +  N  T+ET VGW+WQ CSEM MPI  G+ DTMF    F
Sbjct  318   LGKIAAGVFAYRGELSCYINEPIN--TTETTVGWQWQRCSEMVMPISTGN-DTMFPSETF  374

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
               + FS  C+  YGV PRPHW+TTYYGGHDI L+LH+F SNIIFSNGL+DPYS  GVL +
Sbjct  375   DHESFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHN  434

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ISD++LAVYT NGSHCLDI  A++ DP+WL  QRK EV II+ WI +YY +L   K+
Sbjct  435   ISDSLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEWIDEYYADLANYKK  491



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 364/486 (75%), Gaps = 6/486 (1%)
 Frame = +2

Query  146   LSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQS  325
             ++ TP   L KIPRLTPLY+    +++  +          +  TFYY+Q LDHFNY P+S
Sbjct  21    INLTPTHSL-KIPRLTPLYK---WKTTLHNLEKLVSIEKENVETFYYKQVLDHFNYRPES  76

Query  326   YATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEH  505
             Y  F+QRY ++ KYWGGA S++PIFA+LGAE  ID  P  IGF+TDNA  FKALLVYIEH
Sbjct  77    YHKFEQRYFMNFKYWGGANSSAPIFAYLGAEDSIDTYPTGIGFMTDNAATFKALLVYIEH  136

Query  506   RYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYG  685
             RYYGKS+PFG+ ++A  N +T GYFNSAQA+ADYA VL+++K    A +SPIIV GGSYG
Sbjct  137   RYYGKSVPFGSRKKAFRNASTLGYFNSAQAIADYAAVLIHIKKTLHAHNSPIIVLGGSYG  196

Query  686   GMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSW  865
             GMLASWFRLKYPH+ +GALASSAPILYFDNITP N Y  LV+++FKEVSE CY+TI KSW
Sbjct  197   GMLASWFRLKYPHLTIGALASSAPILYFDNITPHNAYMDLVSREFKEVSETCYETILKSW  256

Query  866   SVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGG  1045
             S I++I+S+ +GLSILS++F  C+ LK   +L +YL+S Y  A QY+ P    V+E+C G
Sbjct  257   SEIERISSQSDGLSILSERFNTCRPLKQYSDLSEYLESMYTAAVQYNGPTSSRVSEICRG  316

Query  1046  IDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1225
             IDGA  G DIL +I++G+V  EGN TC      +  + E   GW WQ CSEM MPIG G+
Sbjct  317   IDGASFGNDILSKIYSGLVAYEGNGTCKINYAPSNISDEVYEGWSWQRCSEMVMPIGTGN  376

Query  1226  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1405
              DTMF P PF+++++  +C   YGV PRPHW+TTYYGGH+IKLVL KFGSNIIFSNGL+D
Sbjct  377   -DTMFQPDPFNLKRYVEECKKQYGVSPRPHWVTTYYGGHNIKLVLQKFGSNIIFSNGLKD  435

Query  1406  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1585
             PYS+ GVL ++SD+++AVYT NGSHCLDI    ++DP WL +QRKKEVEII+ WI +YY 
Sbjct  436   PYSTGGVLSNLSDSLIAVYTTNGSHCLDILQTRQSDPKWLIQQRKKEVEIIKRWIEQYYS  495

Query  1586  ELEALK  1603
             +L ALK
Sbjct  496   DL-ALK  500



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/481 (59%), Positives = 356/481 (74%), Gaps = 12/481 (2%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSS  361
             PR+ PL      R S   +S     +  + +TFYY QTLDHFNY P S+  F+QRY+++S
Sbjct  40    PRVKPL-----GRISRNSASFAASSIYHNLQTFYYNQTLDHFNYRPDSFDMFQQRYVINS  94

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  541
             KYWGGA SN+PIF + G E+P+++D   IG L +NA RFKAL VYIEHRYYGKSIPFG+ 
Sbjct  95    KYWGGANSNAPIFVYFGEEAPLENDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSR  154

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
              EA  N +T GYFNSAQALADYAE+++++  K+  Q SP+IV G SYGGMLASWFRLKYP
Sbjct  155   NEAFKNASTLGYFNSAQALADYAEIIIHVNEKFHVQRSPVIVVGASYGGMLASWFRLKYP  214

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             H+ALGALASSAPILYF +ITP + Y S+VTKDF+E S++C+ TI+KSW+VIDKIAS+P+G
Sbjct  215   HIALGALASSAPILYFTDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASEPDG  274

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1081
             LSILSKKF+ CK L +  EL DYL   Y  AAQYD PP YPVT VC  ID    G DIL 
Sbjct  275   LSILSKKFETCKPLNNSSELTDYLAGIYMAAAQYDAPPSYPVTMVCKSIDEPSFGNDILG  334

Query  1082  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             RI AG+V  +G   CY     N PT  +ET VGW WQTC++M +P G  + D+MF P PF
Sbjct  335   RIFAGMVAYQGELPCY----VNEPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPF  389

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
              +  +  DC D YGVPPRPHW+TTY+GGHDIKL+L +FGSNIIFSNGLRDPYSS GVL++
Sbjct  390   DLNAYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQN  449

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*KT  1615
             ISD+V+A+ T  GSHCLD+   +K+DP WL  QRK+EV II+ WI  Y+ +L+A ++ K 
Sbjct  450   ISDSVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDLDACEKGKH  509

Query  1616  K  1618
             +
Sbjct  510   R  510



>ref|XP_002313555.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|EEE87510.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=495

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/476 (62%), Positives = 361/476 (76%), Gaps = 10/476 (2%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +     F TF+Y QTLDHFNY P+SY TF QRY
Sbjct  25    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDFETFFYNQTLDHFNYRPESYDTFLQRY  81

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA +++PI  +LGAE+PID D   +GFL D A  F +LLVY+EHRYYGKSIP
Sbjct  82    LINSKYWGGANASAPILVYLGAEAPIDGDLDAVGFLVDTAVEFNSLLVYVEHRYYGKSIP  141

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  142   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  201

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIR+SW  ID++AS
Sbjct  202   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRESWEEIDEVAS  261

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  262   KPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGCGFGD  321

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET VGWRWQTCSEM MPIG G+ D+MF 
Sbjct  322   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSVGWRWQTCSEMVMPIGYGN-DSMFP  376

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  377   PDPFDLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGG  436

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  437   VLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  492



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/478 (61%), Positives = 359/478 (75%), Gaps = 6/478 (1%)
 Frame = +2

Query  167   PLHKIPRLTPLYES---ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             P  KIPRL  L  S   +L+ SSS  +   +  LS +F+TF+Y QTLDHFNY P+SY TF
Sbjct  25    PSKKIPRLGVLRGSSLSVLEGSSSLRTV--SVNLSENFQTFFYPQTLDHFNYRPESYTTF  82

Query  338   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  517
             + RY+V+  YWGGA+S + IF +LG ES +D D   IGFL +N  RF ALLVYIEHRYYG
Sbjct  83    QHRYMVNFNYWGGARSAAXIFVYLGEESDLDKDINSIGFLVENGARFGALLVYIEHRYYG  142

Query  518   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  697
             KS PFG+M++++ N   RGYFNS QALAD+AEV++ LK    A  SP+IV GGS GG+LA
Sbjct  143   KSNPFGSMQKSLQNAGQRGYFNSGQALADFAEVIINLKKNLSADSSPVIVVGGSDGGLLA  202

Query  698   SWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             +WFRLKYPHVALGALASSAPILYFD+ITP++GYYSLVTKDF++ SE+CY TI+ SW+ ID
Sbjct  203   AWFRLKYPHVALGALASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEID  262

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA  1057
             K A++ NGL  LSKKF+ CK L+S  +LKDYL++ Y  AAQYD+PP YPVT VC GIDG 
Sbjct  263   KAAAEANGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTIVCNGIDGG  322

Query  1058  PKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +G DIL RI +G+V   GN++CYD    + P SET  GW WQ CSE+ +PIGRG  DTM
Sbjct  323   LQGTDILGRIFSGIVASRGNKSCYDMGQSSFP-SETEEGWNWQVCSELVIPIGRGSNDTM  381

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  APF  +++   C   YGV PRPHWIT+YYGGH+IKL+L +FGSNIIFSNGLRDPYSS
Sbjct  382   FPAAPFDFKEYDDSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSS  441

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              GVLEDIS +++AV+T  GSHCLDI  + + DP+WL  QR  E+EI+  W+ KYY +L
Sbjct  442   GGVLEDISHSIIAVHTPRGSHCLDILPSREDDPNWLVLQRNVEIEILHGWLLKYYEDL  499



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/450 (61%), Positives = 341/450 (76%), Gaps = 3/450 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             +S  + FY+ QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG ES +D D 
Sbjct  51    ASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDL  110

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQALADYA++L
Sbjct  111   SAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYAKIL  170

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             L++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY
Sbjct  171   LHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYY  230

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
              +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L     +KD+LD+
Sbjct  231   YIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLDT  290

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
              Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTCYDP ++  P
Sbjct  291   IYAESVQYNRGPSYSVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQP  350

Query  1154  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYY  1333
             T+  I+ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPPR HWITTY+
Sbjct  351   TNN-IIAWRWQSCSEIVMPVGFDKQDTMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYF  409

Query  1334  GGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTD  1513
             G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDTV+A+ T NGSHC DI   SK D
Sbjct  410   GIQDVKLILRKFGSNIIFSNGLSDPYSVGGILEDISDTVVAITTNNGSHCQDISLKSKED  469

Query  1514  PDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             P+WL  QR+KE++II SWI+ Y  +L  L 
Sbjct  470   PEWLVMQREKEIKIIDSWISTYQKDLRDLN  499



>emb|CAN63232.1| hypothetical protein VITISV_004830 [Vitis vinifera]
Length=468

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/448 (65%), Positives = 349/448 (78%), Gaps = 11/448 (2%)
 Frame = +2

Query  128   STTCGGLSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHF  307
             STTC  +S T P  L    RL      +L R+  +  +  ++ +S  F+TFYY QTLDHF
Sbjct  24    STTC--VSATQPHLL----RL-----GVLGRTFLREPATFSESVSEEFQTFYYNQTLDHF  72

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
             NY P+SY TF+QRY+V+ KYWGGA +++PIFA+LG E+ +D D   IGFLTDNA +FKAL
Sbjct  73    NYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGXEADLDYDLSGIGFLTDNAHQFKAL  132

Query  488   LVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIV  667
             LVYIEHRYYGKSIP G+ EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV
Sbjct  133   LVYIEHRYYGKSIPXGSREEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIV  192

Query  668   FGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQ  847
              G SYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+
Sbjct  193   VGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYK  252

Query  848   TIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPV  1027
             TI +SWS ID++AS+PNGLSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPV
Sbjct  253   TISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPV  312

Query  1028  TEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             T VCGGIDGAP+G+DIL RI AGVV   GN +CY          ETI GW WQTCSE+ +
Sbjct  313   TVVCGGIDGAPEGSDILSRIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVI  372

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             PIGR   DTMF  APF++  FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIF
Sbjct  373   PIGRXVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIF  432

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRN  1471
             SNGLRDPYS  GVL++IS++VLA+ T N
Sbjct  433   SNGLRDPYSIGGVLKNISNSVLAILTVN  460



>ref|XP_010036093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=509

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 363/480 (76%), Gaps = 13/480 (3%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTK---PLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             PRL+   E++LQ        PQ +    +++ F TFY+ QTLDHFNY P+SY TF+QRY+
Sbjct  27    PRLSLHRENVLQ-------DPQRRVPVSVTNDFTTFYFNQTLDHFNYQPKSYTTFRQRYL  79

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++S+YWGGA S++PIF +LGAE+PI++D   IGFLT+NA +FKA LVYIEHRYYG+SIPF
Sbjct  80    INSRYWGGANSSAPIFIYLGAEAPIENDLNGIGFLTENAAQFKAFLVYIEHRYYGRSIPF  139

Query  533   G-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             G ++EEA+N+   RGYF+S+QALADYA ++ ++K K  A+  P+IV GGSYGGMLASWFR
Sbjct  140   GMSLEEALNDPIARGYFSSSQALADYAAIIRHVKEKLKARDCPVIVVGGSYGGMLASWFR  199

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+A GALASSAPILYFD ITP++ Y+S+VTKDFKE S+ CYQTIR SW+ ID++ S
Sbjct  200   LKYPHLAFGALASSAPILYFDGITPQDAYFSVVTKDFKEASKTCYQTIRDSWAEIDRVIS  259

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA-PKG  1066
             KP+GLS LSK FK C+ LKS  ELK+YL   Y  AAQYD PP+YPV  VC GIDGA   G
Sbjct  260   KPSGLSRLSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGANASG  319

Query  1067  ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
               IL +I AGVV L+ N TCY         ++T +G+ WQ CSEM M IG  + + MF  
Sbjct  320   KGILKKIFAGVVALDRNSTCYIVPPNGTTPTQTELGYSWQRCSEMVMGIGITN-NAMFQA  378

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1426
              PF++  F   C+  YGV PRPHWITTYYGGHDI+ VLH+FGSNIIFSNGLRDPYSS G+
Sbjct  379   YPFNLTDFINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRDPYSSGGI  438

Query  1427  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             L++ISDT+ AVYT+ GSHCLDI  + + DP+WL  QRK+EVEII+ WITKY+  L A K+
Sbjct  439   LKNISDTIDAVYTQKGSHCLDILASEQADPNWLVRQRKREVEIIKGWITKYHAHLLAFKQ  498



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/452 (61%), Positives = 347/452 (77%), Gaps = 8/452 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF+Y QTLDHFNYGP+SY  F QRY+V+SKYWGGA S +PIFA+ GAE+PID D
Sbjct  51    VAEDFVTFFYNQTLDHFNYGPESYTAFNQRYVVNSKYWGGADSGAPIFAFFGAEAPIDGD  110

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
                +GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+++A+ +   RGYF+SAQALADYAE
Sbjct  111   IANVGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLKKALGDPNIRGYFSSAQALADYAE  170

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +LL+LK K  A+HSPIIV GGSYGGMLASWFRLKYPHVALGALASSAPILYFD+I P++ 
Sbjct  171   ILLHLKQKLKAEHSPIIVLGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDIIPQDA  230

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+V K F E S +C++TIR+SW  IDK+AS+P GL+ LS  FK C  L+S  ELK YL
Sbjct  231   YYSVVAKSFLESSSSCHETIRRSWEEIDKVASEPRGLTKLSNTFKTCSPLQSSSELKKYL  290

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
                Y    QY+ P   P+  +C  ++G P    +L +I AG+V + GN TCY   +  PP
Sbjct  291   RFLYAQVVQYNDPSTQPLKLMCDAVNGVPPRKGLLQKIFAGLVAINGNLTCY---VNAPP  347

Query  1154  T---SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             +   ++T++GW WQTC+EM +P+G   R+TMF P PF++  FS  C   +GVPPRPHW+T
Sbjct  348   SGTFAQTLLGWSWQTCTEMVIPMGI-TRNTMFPPKPFNLNSFSNACKSVFGVPPRPHWVT  406

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1504
             TY+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++IS TV+A+YT  GSH LDI GA 
Sbjct  407   TYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLDILGAD  466

Query  1505  KTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             K+DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  467   KSDPDWLVEQRKTEVKIMKKWLAKYYADLRAF  498



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/452 (61%), Positives = 347/452 (77%), Gaps = 8/452 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF+Y QTLDHFNYGP+SY  F QRY+V+SKYWGGA S +PIFA+ GAE+PID D
Sbjct  57    VAEDFVTFFYNQTLDHFNYGPESYTAFNQRYVVNSKYWGGADSGAPIFAFFGAEAPIDGD  116

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
                +GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+++A+ +   RGYF+SAQALADYAE
Sbjct  117   IANVGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLKKALGDPNIRGYFSSAQALADYAE  176

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +LL+LK K  A+HSPIIV GGSYGGMLASWFRLKYPHVALGALASSAPILYFD+I P++ 
Sbjct  177   ILLHLKQKLKAEHSPIIVLGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDIIPQDA  236

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+V K F E S +C++TIR+SW  IDK+AS+P GL+ LS  FK C  L+S  ELK YL
Sbjct  237   YYSVVAKSFLESSSSCHETIRRSWEEIDKVASEPRGLTKLSNTFKTCSPLQSSSELKKYL  296

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
                Y    QY+ P   P+  +C  ++G P    +L +I AG+V + GN TCY   +  PP
Sbjct  297   RFLYAQVVQYNDPSTQPLKLMCDAVNGVPPRKGLLQKIFAGLVAINGNLTCY---VNAPP  353

Query  1154  T---SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             +   ++T++GW WQTC+EM +P+G   R+TMF P PF++  FS  C   +GVPPRPHW+T
Sbjct  354   SGTFAQTLLGWSWQTCTEMVIPMGI-TRNTMFPPKPFNLNSFSNACKSVFGVPPRPHWVT  412

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1504
             TY+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++IS TV+A+YT  GSH LDI GA 
Sbjct  413   TYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLDILGAD  472

Query  1505  KTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             K+DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  473   KSDPDWLVEQRKTEVKIMKKWLAKYYADLRAF  504



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/414 (66%), Positives = 330/414 (80%), Gaps = 1/414 (0%)
 Frame = +2

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  541
             KYW G  +++PIF + GAE  IDDD   IGFL DNA  FKALL+YIEHRYYGKSIPFG+ 
Sbjct  4     KYWSGPNTSAPIFVFFGAEENIDDDVSGIGFLPDNASHFKALLLYIEHRYYGKSIPFGSS  63

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
             +EA+ N ++ GYFNSAQALADYA V++++K KY A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  64    KEALRNASSLGYFNSAQALADYASVIMHVKKKYSAKSSPVIVIGGSYGGMLASWFRLKYP  123

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             HVALGALASSAPILYFD I P NGYYS+VTKDFKE SE+CY+TI KSW+ I+K ASKPNG
Sbjct  124   HVALGALASSAPILYFDEIAPRNGYYSVVTKDFKEASESCYKTISKSWAEIEKAASKPNG  183

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1081
             LSILSKKF  C  LK   ELKDYLDS Y  AAQY+ PP YPV+ VC GID AP+G DIL 
Sbjct  184   LSILSKKFNTCSPLKRTFELKDYLDSIYAEAAQYNDPPNYPVSIVCDGIDRAPEGTDILG  243

Query  1082  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1261
             RI AGVV   G+++CYD   +N PT +T + WRWQTCSE+ MPIG  DR+TMF PAPF++
Sbjct  244   RIFAGVVAYMGHKSCYDMNEFNDPTDQTSLAWRWQTCSELVMPIGH-DRNTMFPPAPFNL  302

Query  1262  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1441
             + + ++C   +G+ P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYS+ GVLE+IS
Sbjct  303   KSYIKECKSLFGILPQPHWVTTYYGGQDLKLILHRFASNIIFSNGLRDPYSTGGVLENIS  362

Query  1442  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             D+++A+ T NGSHCLDI     +DP+WL  QRK EVEIIQ WI+KYY +L  LK
Sbjct  363   DSIVAISTVNGSHCLDIQKEKPSDPNWLVMQRKTEVEIIQGWISKYYTDLLELK  416



>ref|XP_010031433.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=496

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/489 (59%), Positives = 367/489 (75%), Gaps = 21/489 (4%)
 Frame = +2

Query  152   ETPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYA  331
             +TP   LH+   L            SKH+   +  +++ + TF++ QTLDHFNY P+SY 
Sbjct  25    DTPTLSLHREHNL----------RDSKHAV--SASIANDYETFFFNQTLDHFNYRPESYT  72

Query  332   TFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  511
              FKQRY+++S YWGGA S++PIF +LGAESPID +P  IGFLTDNA +FKALLVYIEHRY
Sbjct  73    AFKQRYLINSNYWGGANSSAPIFVYLGAESPIDGEPTAIGFLTDNAAQFKALLVYIEHRY  132

Query  512   YGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGG  688
             YG+SIP G T++ A+ +   RGYF+SAQALADYA +++++K K  A  SP+IV G SYGG
Sbjct  133   YGESIPLGMTLKGALEDANIRGYFSSAQALADYAAIIMHVKQKLKASFSPVIVVGASYGG  192

Query  689   MLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWS  868
             MLASWFRLKYPHVALGALASSAPILYFD ITP++ Y+ ++TKDFKE SE CYQTIR SWS
Sbjct  193   MLASWFRLKYPHVALGALASSAPILYFDGITPQDAYHWVITKDFKEASETCYQTIRDSWS  252

Query  869   VIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI  1048
              ID++A +P+GLS L+K FK CK L+S  ELK YL S Y +AAQYD PP YPVT +C GI
Sbjct  253   EIDRVAHEPDGLSNLNKLFKTCKPLESVDELKGYLKSLYWSAAQYDDPPIYPVTMICNGI  312

Query  1049  DGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGR  1219
             DGA    + IL +I AGVV  +GN TCY     NP T  S+T +GW WQ CSEM MPIG 
Sbjct  313   DGANTIENGILGKIFAGVVAYDGNSTCY----VNPSTDVSQTSLGWSWQKCSEMVMPIGI  368

Query  1220  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1399
              + ++MF P PF +  F  +C+  YGV P+ HW++TYYGG+DI+L+L +FGSNIIFSNGL
Sbjct  369   TN-NSMFQPHPFILSDFIDECNSSYGVLPQLHWVSTYYGGYDIELILRRFGSNIIFSNGL  427

Query  1400  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1579
             RDP+SSAGVL++IS++++AVYT  GSHCLD+Y   +TDP+WL  QRK EV+II++WI +Y
Sbjct  428   RDPWSSAGVLKNISNSIIAVYTEKGSHCLDLYSEMQTDPNWLVMQRKTEVKIIKAWIAEY  487

Query  1580  YVELEALKR  1606
             Y +L A K+
Sbjct  488   YADLLAFKQ  496



>ref|XP_010031432.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50733.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=504

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/451 (62%), Positives = 343/451 (76%), Gaps = 8/451 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF+Y QTLDHFNY P+SY  F QRY+V+S+YWGGA S +PIFA+LGAE+PID D
Sbjct  57    VAEDFVTFFYNQTLDHFNYRPESYTAFNQRYVVNSEYWGGADSGAPIFAFLGAEAPIDGD  116

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
                 GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+E A+ +  TRGYF+SAQALADYAE
Sbjct  117   IANAGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLERALGDADTRGYFSSAQALADYAE  176

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +L++LK K  A+HSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD+I P++ 
Sbjct  177   ILIHLKQKLKAEHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDIIPQDA  236

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+V K F E S +C+QTIR+SW  +D++AS+P GL+ LS  FK C  L+S  ELK YL
Sbjct  237   YYSVVAKSFLESSSSCHQTIRQSWEELDRVASEPRGLTKLSNAFKTCSPLQSSSELKKYL  296

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
                Y    QY+ P   P+  +C  I+GAP    +L +I AG+V + GN TCY     NP 
Sbjct  297   KLLYVQVVQYNDPSAQPLKLMCDAINGAPPRKGLLQKIFAGLVAINGNLTCY----VNPS  352

Query  1154  TS--ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITT  1327
              S  +T  GW WQTC+EMA PIG   R+TMF P PF++  FS  C   +GVP RP W+TT
Sbjct  353   GSDAQTPSGWFWQTCTEMAFPIGI-TRNTMFPPEPFNLNSFSNACKSEFGVPARPRWVTT  411

Query  1328  YYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK  1507
             Y+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++IS TV+A+YT  GSHCLDI GA K
Sbjct  412   YFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHCLDILGADK  471

Query  1508  TDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  472   SDPDWLVEQRKTEVKIMKKWLAKYYADLHAF  502



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 323/387 (83%), Gaps = 3/387 (1%)
 Frame = +2

Query  446   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  625
             +GFLTDNA RFKALLVYIEHRY GKSIPFG+ EEA+ N + RGYFNSAQA+ADYAEVL+Y
Sbjct  22    LGFLTDNAHRFKALLVYIEHRYCGKSIPFGSREEALKNASIRGYFNSAQAIADYAEVLIY  81

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             +K K LA++SP+IV GGSYGGMLASWFRLKYPHVALG LASSAPILYF++ITP+NGYYS+
Sbjct  82    IKKKLLAENSPVIVVGGSYGGMLASWFRLKYPHVALGVLASSAPILYFEDITPQNGYYSI  141

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             VTKDF+E SE+CY+TIR+SWS ID++AS+PNG+SILSKKF+ C  L +  ELKDYLD+ Y
Sbjct  142   VTKDFREASESCYKTIRESWSEIDRVASEPNGISILSKKFRTCDRLNNSDELKDYLDTIY  201

Query  986   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1165
             CTAAQY+ PP YPVT  C GIDGAP+G+DIL RI AGVV   GN +CY    +NP  +ET
Sbjct  202   CTAAQYNDPPMYPVTMACSGIDGAPEGSDILSRIFAGVVAYGGNSSCYTTS-HNP--TET  258

Query  1166  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1345
               GW WQTCSEM MPIGRGD DTMF PAPF++  F ++C   YGV PRPHW+TTYYGGH+
Sbjct  259   SEGWAWQTCSEMVMPIGRGDNDTMFPPAPFNLTTFIQECTSIYGVSPRPHWVTTYYGGHN  318

Query  1346  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1525
             I+L+L +F SNIIFSNGLRDPYSS GVL++ISD+VLA+ T NGSHCLDI  A+ TDP+WL
Sbjct  319   IELILRRFASNIIFSNGLRDPYSSGGVLKNISDSVLAILTVNGSHCLDILPATSTDPEWL  378

Query  1526  TEQRKKEVEIIQSWITKYYVELEALKR  1606
               QRK EVE+I+SWI +YY +L A+ +
Sbjct  379   VMQRKAEVEVIESWIAQYYADLHAITK  405



>ref|XP_010493394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010493396.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/450 (60%), Positives = 340/450 (76%), Gaps = 4/450 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             +S  + FY+ QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG ES +D D 
Sbjct  51    ASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDL  110

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQALADYA +L
Sbjct  111   SAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYATIL  170

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             L++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY
Sbjct  171   LHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYY  230

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
              +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L     +KD+L++
Sbjct  231   YIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLNT  290

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
              Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTCYDP ++  P
Sbjct  291   IYAESVQYNRGPSYWVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQP  350

Query  1154  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYY  1333
             T+  ++ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPPR HWITTY+
Sbjct  351   TNN-VIAWRWQSCSEIVMPVGYDKQDTMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYF  409

Query  1334  GGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTD  1513
             G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDTV+A+ T NGSHC DI   SK D
Sbjct  410   GIQDVKLILRKFGSNIIFSNGLSDPYSVGGILEDISDTVVAI-TTNGSHCQDITLKSKED  468

Query  1514  PDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             P+WL  QR+KE++II SWI+ Y  +L  L 
Sbjct  469   PEWLVRQREKEIKIIDSWISTYQKDLRDLN  498



>ref|XP_006485332.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=511

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/485 (60%), Positives = 360/485 (74%), Gaps = 8/485 (2%)
 Frame = +2

Query  161   PPPLHKIPRLTPLYE-SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             P  L  IP+L  L   +I Q  S   +S + K   S  +T YY QTLDHFNY P+SY TF
Sbjct  26    PTLLKYIPKLGVLRGINIFQNPSENLTSSEPK---SDLKTLYYDQTLDHFNYNPESYLTF  82

Query  338   KQRYIVSSKYWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  511
              QRY+++ K+WGG    +  PI A+LG ES +DDD + I +L+DNA RFKAL VYIEHR+
Sbjct  83    PQRYVLNFKHWGGGGGAAAAPILAYLGEESSLDDDLRGIEWLSDNAHRFKALQVYIEHRF  142

Query  512   YGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             YGKS+PF + E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGM
Sbjct  143   YGKSVPFVSSEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGM  202

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFRLKYPH+ALG +ASSAPILYFD ITP + YYS VTKDF+E SE+CY TI++SW+ 
Sbjct  203   LAAWFRLKYPHIALGEVASSAPILYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAA  262

Query  872   IDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGID  1051
             IDK  +K NGL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GID
Sbjct  263   IDKTGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGID  322

Query  1052  GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1231
             GA +G D + RI +G+V   G ++CY+  I    + ET+ GW W+TCSE+ MPIG G   
Sbjct  323   GASQGTDTVARIFSGIVASWGKKSCYN--IGEFFSDETLNGWGWKTCSEIVMPIGIGKNK  380

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
             +MF   PF+++++   C   YGV PR HWITTYYGG DI++VL +FGSNIIFS+GL DPY
Sbjct  381   SMFPAEPFNLKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHDPY  440

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S+AGVLEDISD++LAV T+NGSHCLDI  A K DPDWLT QR+ EV I+ +WI KYY +L
Sbjct  441   STAGVLEDISDSILAVPTKNGSHCLDILPAKKDDPDWLTMQRQVEVNIVHAWILKYYADL  500

Query  1592  EALKR  1606
               + +
Sbjct  501   LQISK  505



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 340/443 (77%), Gaps = 2/443 (0%)
 Frame = +2

Query  263   SHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  442
             + ++ +Y+ QTLDHFNY P+SY TF+QRY++++KYWGGA +++PIF +LG E+ +D    
Sbjct  25    ADYKVYYHNQTLDHFNYRPESYTTFRQRYVMNAKYWGGANTSAPIFVYLGDEAALDFQIG  84

Query  443   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  622
               GFL+DNAP+FKALLVYIEHRYYGKSIPF + EEA +N +T GYF+S+QA+ADYAE++L
Sbjct  85    SAGFLSDNAPKFKALLVYIEHRYYGKSIPFSSREEAFSNASTLGYFSSSQAIADYAEIIL  144

Query  623   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  802
             ++K    A+ SP+IV GGSYGGMLA+WFRLKYPH+ALGALASSAPILYFD+ITP++GYYS
Sbjct  145   HIKKNLSAEKSPVIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFDDITPQDGYYS  204

Query  803   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  982
             +V+KDF+E SENCY T+++SWS ID++AS+PNGLSILSK+F  C  + S  +LKDYLDS 
Sbjct  205   VVSKDFREKSENCYNTLKQSWSEIDRVASQPNGLSILSKQFMTCSPITSASQLKDYLDSN  264

Query  983   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1162
             YC AAQY  P    V+ +C  IDG     DIL +I  G+V   GN TCYD   +N P SE
Sbjct  265   YCEAAQYASPSGDGVSRICNAIDGTSNHTDILGKIFKGLVSFNGNWTCYDVNAFNNP-SE  323

Query  1163  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
             T  GW WQTCSEM MPI  G+ DTMF    F +  F +DC + YGV PRPHWIT  +GG 
Sbjct  324   TDEGWSWQTCSEMVMPIAHGN-DTMFQAESFDLDAFVQDCKNAYGVSPRPHWITAEFGGD  382

Query  1343  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1522
             DIKL+L +FGSNIIFSNGL+DPYSS GVL+ IS ++ A+YT  GSHCLDI  +   DP W
Sbjct  383   DIKLILERFGSNIIFSNGLKDPYSSGGVLKSISKSLPAIYTTEGSHCLDILPSLPNDPKW  442

Query  1523  LTEQRKKEVEIIQSWITKYYVEL  1591
             L +QR++EVEII +W  +YY +L
Sbjct  443   LIKQRRREVEIISNWFRQYYTDL  465



>ref|XP_010034183.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 364/479 (76%), Gaps = 16/479 (3%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             H+IP+L+   ++ +Q    +  + +   LS  F+TF+Y QTLDHF+Y P+SYATFKQRY+
Sbjct  34    HRIPKLSVRRQTFIQ---DRKQAVRASILSEDFQTFFYNQTLDHFDYRPESYATFKQRYV  90

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++  +WGGA +++PIFA+LGAE+ IDD    +GFL DNA +F+AL VYIEHR+YG+SIP+
Sbjct  91    INFNHWGGANASAPIFAYLGAEAAIDDHG--VGFLIDNAAQFRALSVYIEHRFYGESIPY  148

Query  533   G-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             G T+++A+++   RGYF+SAQALADYAE+L+YLK+K  A+ SPIIV GGSYGGMLASWFR
Sbjct  149   GLTLDKALSDPNVRGYFSSAQALADYAEILVYLKHKLNAKDSPIIVIGGSYGGMLASWFR  208

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPHVALGALASSAPILYF ++TP+  +YS+V KDF E S +C++TIR SW  ID++AS
Sbjct  209   LKYPHVALGALASSAPILYFLDVTPQGAFYSVVAKDFLETSFSCHETIRLSWEEIDRVAS  268

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             +P+GL+ LS  FK C+ L+S  +LKD+L   Y  AAQY+ P   PV E+C  IDGA    
Sbjct  269   EPHGLTKLSNTFKTCRPLQSSSQLKDHLIYAYEGAAQYNDP---PVKEICNAIDGASPRN  325

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DIL +I AG+V  +GN  CY     NP  S+T +GW WQTCSEM MPIG  + +TMF P 
Sbjct  326   DILGKIFAGLVASDGNLPCY----VNP--SQTDLGWSWQTCSEMVMPIGITE-NTMFQPE  378

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF +  ++ DC   YG+ PRPHWITTYYGGHDIKLVLH+F SNIIFSNGL+DPYSS GVL
Sbjct  379   PFDLNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNIIFSNGLQDPYSSGGVL  438

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             ++ISDTV+AVYT  GSHCLDI  A+K DPDWL +QRK E+EIIQ WI  Y+ +L  L +
Sbjct  439   KNISDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQKWIATYHADLRTLGK  497



>ref|XP_006408695.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
 gb|ESQ50148.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
Length=502

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/458 (59%), Positives = 336/458 (73%), Gaps = 3/458 (1%)
 Frame = +2

Query  233   HSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  412
             H +   K   S    FY+ Q LDHF + P+SY TF+QRY++ S++W GA+ N+PI A+LG
Sbjct  42    HDALTQKVDKSDLEIFYFNQDLDHFTFTPKSYMTFQQRYVIDSQHWAGAKVNAPILAFLG  101

Query  413   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  592
              ES +D D   IGFL DN PR KALLVYIEHRYYGKS+PFG+ EEA+ N +T GY NSAQ
Sbjct  102   EESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKSMPFGSAEEALKNASTLGYLNSAQ  161

Query  593   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  772
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAAILLHIKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  773   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  952
             +  P+ GYY +VTK  KE SE CY TI KSW  ID++A+KPNGL ILS+KFK C  L   
Sbjct  222   DTRPKFGYYYIVTKVIKETSEKCYNTICKSWKEIDRVAAKPNGLLILSQKFKTCGPLNGS  281

Query  953   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTC  1126
              ++KD+L + Y  A QY++ P Y VT VC  ID  P     D+L+R+ AG V L GNRTC
Sbjct  282   SDIKDFLGTIYAEAVQYNRGPSYWVTSVCHAIDANPPTHKNDLLNRVFAGAVALIGNRTC  341

Query  1127  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1306
             YD  +++ PT+ +I  WRWQ+CSE+ MPIG   +DTMF  APF+M  F   C  YYGVPP
Sbjct  342   YDTNMFSQPTNNSI-AWRWQSCSEIVMPIGYDKQDTMFQLAPFNMTSFIEGCKSYYGVPP  400

Query  1307  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1486
             RPHWI TY+G  DIKL+L +FGSNIIFSNGL DPYS  GVLEDISD+++A+ T+NGSHC 
Sbjct  401   RPHWIMTYFGTQDIKLILKRFGSNIIFSNGLSDPYSVGGVLEDISDSIVAIKTKNGSHCQ  460

Query  1487  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             DI    K DP+WL  QR+KE +II+SWI+ Y  +L  L
Sbjct  461   DISLKRKGDPEWLVMQREKEFKIIESWISMYQKDLRDL  498



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/476 (60%), Positives = 356/476 (75%), Gaps = 8/476 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSS-HFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             K+PRL      ++ R++   +   TK  S+  F+ FYY QTLDHFNY P+SY TF+Q+Y+
Sbjct  30    KVPRL-----GVVGRTTRVRNLGTTKTSSTWDFKKFYYTQTLDHFNYRPESYRTFQQKYV  84

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             VS KYWGGA +++PIFA+LG E+P+ D     G + DNAPRF AL+++IEHR+YG+SIPF
Sbjct  85    VSFKYWGGANASAPIFAYLGYEAPLYDQSPATGLILDNAPRFHALVIHIEHRFYGESIPF  144

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              + +EA+ N +T GYFNSAQALADYAE++L LK    A+ SP+I  GGSYGGMLA+WFRL
Sbjct  145   ESRDEALRNSSTLGYFNSAQALADYAEIILDLKKNLSAETSPVIAVGGSYGGMLAAWFRL  204

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHV +GALASSAPILYFD+ITPENGYYS+V+K F+E SE+CY+TI++SWS ID++AS+
Sbjct  205   KYPHVTVGALASSAPILYFDDITPENGYYSIVSKGFRESSESCYKTIKQSWSEIDELASQ  264

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              NGLS+LS+KF+ C  L    ELK YL+  Y  AAQY+ PP+YPV  +C  IDGA +G D
Sbjct  265   SNGLSLLSQKFQTCSALNKSSELKGYLEYVYTDAAQYNAPPEYPVDRICSAIDGASEGTD  324

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL RI AGVV    N +CYD   YN PT ET VGW WQTCSEM  PI  G   T  FPA 
Sbjct  325   ILSRIFAGVVASRVNSSCYDTNEYNYPT-ETFVGWDWQTCSEMVFPIDHGRDPTSMFPAS  383

Query  1253  -FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
              F ++ +  DC+  YGVPPRPHWITT +GGHDIKLVL +F SNIIFSNGLRDPYS  GVL
Sbjct  384   TFVLRDYIEDCNRSYGVPPRPHWITTEFGGHDIKLVLKRFASNIIFSNGLRDPYSIGGVL  443

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             ++ISD+V+A+ T NGSHCLDI   S  DP WL+ QR+ E+EII+ WI KYY +L A
Sbjct  444   QNISDSVVALATVNGSHCLDILSESPNDPKWLSMQRQSEIEIIEGWIEKYYADLAA  499



>gb|KCW50732.1| hypothetical protein EUGRSUZ_J00405 [Eucalyptus grandis]
Length=476

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/452 (62%), Positives = 350/452 (77%), Gaps = 13/452 (3%)
 Frame = +2

Query  254   PLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDD  433
             P  S F+TF+Y QTLDHF+Y P+SYATFKQRY+++  +WGGA +++PIFA+LGAE+ IDD
Sbjct  37    PKLSDFQTFFYNQTLDHFDYRPESYATFKQRYVINFNHWGGANASAPIFAYLGAEAAIDD  96

Query  434   DPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYA  610
                 +GFL DNA +F+AL VYIEHR+YG+SIP+G T+++A+++   RGYF+SAQALADYA
Sbjct  97    HG--VGFLIDNAAQFRALSVYIEHRFYGESIPYGLTLDKALSDPNVRGYFSSAQALADYA  154

Query  611   EVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPEN  790
             E+L+YLK+K  A+ SPIIV GGSYGGMLASWFRLKYPHVALGALASSAPILYF ++TP+ 
Sbjct  155   EILVYLKHKLNAKDSPIIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFLDVTPQG  214

Query  791   GYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDY  970
              +YS+V KDF E S +C++TIR SW  ID++AS+P+GL+ LS  FK C+ L+S  +LKD+
Sbjct  215   AFYSVVAKDFLETSFSCHETIRLSWEEIDRVASEPHGLTKLSNTFKTCRPLQSSSQLKDH  274

Query  971   LDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNP  1150
             L   Y  AAQY+ P   PV E+C  IDGA    DIL +I AG+V  +GN  CY     NP
Sbjct  275   LIYAYEGAAQYNDP---PVKEICNAIDGASPRNDILGKIFAGLVASDGNLPCY----VNP  327

Query  1151  PTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTY  1330
               S+T +GW WQTCSEM MPIG  + +TMF P PF +  ++ DC   YG+ PRPHWITTY
Sbjct  328   --SQTDLGWSWQTCSEMVMPIGITE-NTMFQPEPFDLNSYNNDCKRSYGITPRPHWITTY  384

Query  1331  YGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKT  1510
             YGGHDIKLVLH+F SNIIFSNGL+DPYSS GVL++ISDTV+AVYT  GSHCLDI  A+K 
Sbjct  385   YGGHDIKLVLHRFASNIIFSNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKA  444

Query  1511  DPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             DPDWL +QRK E+EIIQ WI  Y+ +L  L +
Sbjct  445   DPDWLVKQRKIEIEIIQKWIATYHADLRTLGK  476



>ref|XP_011004990.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/476 (62%), Positives = 359/476 (75%), Gaps = 10/476 (2%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +       TF+Y QTLDHFNY P+SY TF QRY
Sbjct  61    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDLETFFYNQTLDHFNYRPESYDTFLQRY  117

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIP
Sbjct  118   LINSKYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIP  177

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  178   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  237

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++AS
Sbjct  238   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVAS  297

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  298   KPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGD  357

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET  GWRWQTCSEM +PIG G+ D+MF 
Sbjct  358   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFP  412

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  413   PDPFDLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGG  472

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  473   VLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  528



>ref|XP_011005221.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/476 (61%), Positives = 359/476 (75%), Gaps = 10/476 (2%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +       TF+Y QTLDHFNY P+SY TF QRY
Sbjct  61    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDLETFFYNQTLDHFNYRPESYDTFLQRY  117

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIP
Sbjct  118   LINSKYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIP  177

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  178   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  237

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++AS
Sbjct  238   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVAS  297

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    EL+++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  298   KPDGLSILSKKFKTCNPLTDASELRNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGD  357

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET  GWRWQTCSEM +PIG G+ D+MF 
Sbjct  358   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFP  412

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  413   PDPFDLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGG  472

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  473   VLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  528



>ref|XP_004295648.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 346/474 (73%), Gaps = 22/474 (5%)
 Frame = +2

Query  239   SPQTKPLS----SHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAW  406
             S Q++ LS    S + TFYY QTLDHFN+ P S++TF+Q+Y+++SKYWGG+  ++PIFA+
Sbjct  4     SLQSEALSAFDPSEYETFYYNQTLDHFNFRPDSFSTFQQKYVINSKYWGGSNISAPIFAY  63

Query  407   LGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNS  586
             LGAE  +D    Y GFL +NA +F+ALL+YI+HRYYG+SIPFG+  EA  N +T GYFNS
Sbjct  64    LGAEVSLDSVISYTGFLPENANQFQALLIYIQHRYYGESIPFGSRTEAFQNASTLGYFNS  123

Query  587   AQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILY  766
             AQALADYAE+L+++K +  A+HSP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILY
Sbjct  124   AQALADYAEILVHVKTQLNAEHSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILY  183

Query  767   FDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGL  943
             FD+I  PENGY S+VTKDF+E SE CYQTI++SWS ID IAS P+GLS LSK F+ C  L
Sbjct  184   FDDIIPPENGYLSIVTKDFREASETCYQTIKQSWSEIDTIASMPDGLSNLSKIFRTCSPL  243

Query  944   KSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIHAGVVGLEGNR  1120
             ++   LK  L   Y  AAQ+D P   PV  +C GIDGA     D L +I AG+V +EGNR
Sbjct  244   RTAHHLKYSLQLMYTRAAQFDDPSTNPVNVICSGIDGAASLTNDTLAKIFAGLVAIEGNR  303

Query  1121  TCY------------DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1264
             +CY             P   N  TSE   GW WQ CSEM MP+     +TMF P  F +Q
Sbjct  304   SCYLSIAPSSSSTNALPSNANDETSE---GWSWQACSEMVMPVFAVGNNTMFQPYSFDVQ  360

Query  1265  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1444
              +  +C   YGVP RP+WITTYYGGHDIKL L++F SNIIFSNGLRDPYSS  VL++ISD
Sbjct  361   SYINNCKAQYGVPSRPNWITTYYGGHDIKLTLYRFASNIIFSNGLRDPYSSGRVLQNISD  420

Query  1445  TVLAVYTRNGSHCLDIYGAS-KTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             +++AVYT+NGSHCLD+  ++  TDPDWL  QRK EVEII+ W+T YY  L+  K
Sbjct  421   SLVAVYTKNGSHCLDLVPSNPSTDPDWLINQRKIEVEIIKGWMTTYYAALQTFK  474



>gb|KCW84338.1| hypothetical protein EUGRSUZ_B01187, partial [Eucalyptus grandis]
Length=478

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/460 (60%), Positives = 348/460 (76%), Gaps = 13/460 (3%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTK---PLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             PRL+   E++LQ        PQ +    +++ F TFY+ QTLDHFNY P+SY TF+QRY+
Sbjct  27    PRLSLHRENVLQ-------DPQRRVPVSVTNDFTTFYFNQTLDHFNYQPKSYTTFRQRYL  79

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++S+YWGGA S++PIF +LGAE+PI++D   IGFLT+NA +FKA LVYIEHRYYG+SIPF
Sbjct  80    INSRYWGGANSSAPIFIYLGAEAPIENDLNGIGFLTENAAQFKAFLVYIEHRYYGRSIPF  139

Query  533   G-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             G ++EEA+N+   RGYF+S+QALADYA ++ ++K K  A+  P+IV GGSYGGMLASWFR
Sbjct  140   GMSLEEALNDPIARGYFSSSQALADYAAIIRHVKEKLKARDCPVIVVGGSYGGMLASWFR  199

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+A GALASSAPILYFD ITP++ Y+S+VTKDFKE S+ CYQTIR SW+ ID++ S
Sbjct  200   LKYPHLAFGALASSAPILYFDGITPQDAYFSVVTKDFKEASKTCYQTIRDSWAEIDRVIS  259

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA-PKG  1066
             KP+GLS LSK FK C+ LKS  ELK+YL   Y  AAQYD PP+YPV  VC GIDGA   G
Sbjct  260   KPSGLSRLSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGANASG  319

Query  1067  ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
               IL +I AGVV L+ N TCY         ++T +G+ WQ CSEM M IG  + + MF  
Sbjct  320   KGILKKIFAGVVALDRNSTCYIVPPNGTTPTQTELGYSWQRCSEMVMGIGITN-NAMFQA  378

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1426
              PF++  F   C+  YGV PRPHWITTYYGGHDI+ VLH+FGSNIIFSNGLRDPYSS G+
Sbjct  379   YPFNLTDFINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRDPYSSGGI  438

Query  1427  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKE  1546
             L++ISDT+ AVYT+ GSHCLDI  + + DP+WL  QRK+E
Sbjct  439   LKNISDTIDAVYTQKGSHCLDILASEQADPNWLVRQRKRE  478



>ref|XP_009126572.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=502

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/477 (57%), Positives = 342/477 (72%), Gaps = 7/477 (1%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             KIPRL  +   +L+   ++  SP  K      + FY+ Q LDHF + P+SY TF+QRY +
Sbjct  27    KIPRLG-ISPKMLK---NEPDSPTQKLNDPDLKMFYFNQNLDHFTFTPKSYMTFQQRYAI  82

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
              SK+W GA+ N+PI A+LG ES +D D   IGFL DN PR KALLVYIEHRYYGK++PFG
Sbjct  83    DSKHWAGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKTMPFG  142

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLK
Sbjct  143   SAEEALKNASTLGYLNAAQALADYASILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLK  202

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPH+ALGALASSAP+LYF++  P+ GYY +VTK  K  SE CY  IRKSW  ID++A+KP
Sbjct  203   YPHIALGALASSAPLLYFEDTRPKFGYYYIVTKVIKGTSERCYNMIRKSWKEIDRVAAKP  262

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-  1072
             NGL ILSK+FK C  L +  ++KD+L + Y  A QY++ P Y VT VC  ID  P  +  
Sbjct  263   NGLLILSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNNPPNSKK  322

Query  1073  -ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
              +LDRI AG V L GN++CYD  ++  PT+     WRWQTCSE+ MP+G   +DTMF   
Sbjct  323   GLLDRIFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQTCSEIVMPVGYDKQDTMFPTT  381

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF+M  +   C   YGV PRPHWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  GVL
Sbjct  382   PFNMTSYIERCKADYGVTPRPHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVGGVL  441

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             EDISD+V+A+ + NGSHC DI    K DP+WL  QR KE++II+SWI+ Y  +L+AL
Sbjct  442   EDISDSVVAIKSNNGSHCQDIVMKMKGDPEWLVMQRDKEIKIIESWISTYQKDLKAL  498



>ref|XP_009591854.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Nicotiana 
tomentosiformis]
Length=412

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 320/390 (82%), Gaps = 7/390 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             HKIPRLTPL ++IL+  ++  +S  T P    F T++Y QTLDHFNYGP+SY+TFKQRYI
Sbjct  30    HKIPRLTPLLKNILKDFNTLSNSSTTLP--KEFETYFYTQTLDHFNYGPKSYSTFKQRYI  87

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++SKYWGG+ S+SPIFA+LGAES ID+DP  IGFLTD APRFKALLVY+EHRYYG+SIPF
Sbjct  88    INSKYWGGSNSSSPIFAYLGAESYIDNDPLSIGFLTDFAPRFKALLVYLEHRYYGQSIPF  147

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
               +EEA+ +E  RGYFNSAQA+ADYAE+LL++K ++ A +SPIIV GGSYGGMLASWFRL
Sbjct  148   EKIEEALKDEDRRGYFNSAQAIADYAELLLHVKEQFSAPNSPIIVIGGSYGGMLASWFRL  207

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKE SE+CYQTIR SWS+IDKIAS 
Sbjct  208   KYPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEASESCYQTIRDSWSIIDKIAST  267

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
              +GL+ LS+KFK C  L +  +LK YLDSTY  AAQYD PP+YPVT +CGGIDGA  G+D
Sbjct  268   KDGLAYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTVICGGIDGATNGSD  327

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             +LDRI AG+V  EGN++C     YN    +T +GW WQTCSEM MPIGRG+ DTMF+ AP
Sbjct  328   VLDRIFAGIVAYEGNKSC-----YNILPGQTDLGWDWQTCSEMVMPIGRGENDTMFYSAP  382

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
             FS+ +F  DC   YGV PRPHW+TTYYGGH
Sbjct  383   FSLDEFIEDCKSDYGVSPRPHWVTTYYGGH  412



>ref|XP_010535638.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=507

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 338/445 (76%), Gaps = 5/445 (1%)
 Frame = +2

Query  278   FYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFL  457
             F + Q LDHF Y P+SY  F+QRY V ++YWGGA++NSPI A+LG E+ +D D + IGFL
Sbjct  62    FIFDQDLDHFTYTPESYTKFRQRYAVDTRYWGGAEANSPILAYLGEETSMDTDLRAIGFL  121

Query  458   TDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNK  637
              +N P FKALLVY+EHRYYG+S+PFG+ +EA+ N T  GYFN+AQALADYA +LL++K+K
Sbjct  122   RENGPHFKALLVYMEHRYYGESMPFGSAKEALKNATAMGYFNTAQALADYAAILLHVKDK  181

Query  638   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  817
             Y A+HSPIIV GGSYGGMLA+WFRLKYPH+A+GALASSAP+LYF++  P++GYY +VTK 
Sbjct  182   YAAKHSPIIVVGGSYGGMLAAWFRLKYPHIAIGALASSAPVLYFEDTVPKHGYYYIVTKI  241

Query  818   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  997
              K+ S  C++ IRKSW  ID++AS+PNGLS LS+KFK C  L    +LKD+LDS Y  A 
Sbjct  242   IKKTSVRCHKRIRKSWDEIDRVASQPNGLSFLSEKFKTCAPLNGSFDLKDFLDSVYAEAV  301

Query  998   QYDQPPKYPVTEVCGGIDG-APKG--ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETI  1168
             QY++ P YPVT +C  ID  +P+G   D+L RI AGVV   GNR+CYD  +++ PT+  +
Sbjct  302   QYNRHPNYPVTSICKAIDSESPRGKKKDLLGRIFAGVVAYIGNRSCYDTTMFSQPTNNNL  361

Query  1169  VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDI  1348
               WRWQ+CSE+ MPIG   +DT++   P+++  +  +C   YGV PRPHWI TYYGG D 
Sbjct  362   -AWRWQSCSELVMPIGHDKQDTLYQTMPYNISNYISECKSMYGVSPRPHWINTYYGGQDF  420

Query  1349  KLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLT  1528
             KL+L +FGSNIIFSNGL DPYS  GVLEDISDT++A+ T NGSHCLD+   +K DP WL 
Sbjct  421   KLILRRFGSNIIFSNGLSDPYSVGGVLEDISDTIVAIKT-NGSHCLDLIFKTKDDPKWLV  479

Query  1529  EQRKKEVEIIQSWITKYYVELEALK  1603
              QR+KEV+II SWI+ Y  +L+ LK
Sbjct  480   MQRQKEVKIIDSWISNYQKDLKDLK  504



>ref|XP_006436581.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
 gb|ESR49821.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
Length=506

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/485 (59%), Positives = 355/485 (73%), Gaps = 13/485 (3%)
 Frame = +2

Query  161   PPPLHKIPRLTPLYE-SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             P  L  IP+L  L   +I Q  S   +S + K   S  +T YY QTLDHFNY P+SY TF
Sbjct  26    PTLLKYIPKLGVLRGINIFQNPSENLTSSEPK---SDLKTLYYDQTLDHFNYNPESYLTF  82

Query  338   KQRYIVSSKYWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  511
              QRY+++ K+WGG    +  PI A+LG ES +DDD + I +L+DNA RFKAL VYIEHR+
Sbjct  83    PQRYVLNFKHWGGGGGAAAAPILAYLGEESSLDDDLRGIEWLSDNAHRFKALQVYIEHRF  142

Query  512   YGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             YGKS+PF + E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGM
Sbjct  143   YGKSVPFVSSEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGM  202

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFRLKYPH+ALG +ASSAPILYFD ITP + YYS VTKDF+E SE+CY TI++SW+ 
Sbjct  203   LAAWFRLKYPHIALGEVASSAPILYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAA  262

Query  872   IDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGID  1051
             IDK  +K NGL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GID
Sbjct  263   IDKTGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGID  322

Query  1052  GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1231
             GA +G D + RI +G+V   G ++CY+  I    + ET+ GW W+TCSE+ MPIG G   
Sbjct  323   GASQGTDTVARIFSGIVASWGKKSCYN--IGEFFSDETLNGWGWKTCSEIVMPIGIGKNK  380

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
             +MF   PF+++++   C   YGV PR HWITTYYGG DI++VL +FGSNIIFS+GL DPY
Sbjct  381   SMFPAEPFNLKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHDPY  440

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S+AGVLEDISD++LAV T+N     DI  A K DPDWLT QR+ EV I+ +WI KYY +L
Sbjct  441   STAGVLEDISDSILAVPTKN-----DILPAKKDDPDWLTMQRQVEVNIVHAWILKYYADL  495

Query  1592  EALKR  1606
               + +
Sbjct  496   LQISK  500



>gb|KFK27606.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=499

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 340/458 (74%), Gaps = 3/458 (1%)
 Frame = +2

Query  236   SSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGA  415
             + P  K   S    FY+ Q LDHF Y  +SY TF+QRY + SK+W G+++N+PI A+LG 
Sbjct  40    NEPTQKVNESDLEMFYFNQNLDHFTYTAKSYTTFQQRYAIDSKHWAGSKANAPILAFLGE  99

Query  416   ESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQA  595
             E+ +D D   IGFL DNA RFK+LLVYIEHRYYG ++PFG+  EA+ N +T GY N+AQA
Sbjct  100   ETSLDSDLSTIGFLRDNALRFKSLLVYIEHRYYGMTMPFGSANEALKNASTLGYLNAAQA  159

Query  596   LADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDN  775
             LADYA +LL++K  Y A+HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++
Sbjct  160   LADYAAILLHVKQNYSAKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFED  219

Query  776   ITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPG  955
               P++GYY +VTK FKE SE CYQTIRKSW  I+++A+KPNGL  L KKFK C  L    
Sbjct  220   TLPKHGYYYIVTKVFKETSERCYQTIRKSWKEIERVAAKPNGLLTLGKKFKTCAPLNGSF  279

Query  956   ELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCY  1129
              +KD+LDS Y  A QY++ P Y VT VC GI+  P  +  D+LDRI AGVV L GNR+CY
Sbjct  280   NIKDFLDSIYAEAVQYNRGPSYWVTNVCNGINANPSNRKIDLLDRIFAGVVALVGNRSCY  339

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D  ++  PT+  +  WRWQ+C+E+ MP+G   +DTMF  APF+M  F   C+ YYGVPPR
Sbjct  340   DTNMFAQPTNNNL-AWRWQSCTEIVMPVGYDKQDTMFPTAPFNMTSFIAGCESYYGVPPR  398

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHW+TTY+G  D+KL+L +FGSNIIFSNGL+DPYS  GVLEDIS +V+A+ T NGSHC D
Sbjct  399   PHWVTTYFGIQDVKLILRRFGSNIIFSNGLKDPYSVGGVLEDISGSVVAIKTENGSHCQD  458

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             I   SK DP+WL  QR+KE++II+SWIT Y  +L  L 
Sbjct  459   IVLKSKEDPEWLVMQREKEIDIIESWITSYKRDLRDLN  496



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 342/481 (71%), Gaps = 52/481 (11%)
 Frame = +2

Query  170   LHKIPRLTPL--YESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             L+KIP+L+P   +E+ L    +    P    LS  + TF+Y QTLDHFNY P+SY+TF+Q
Sbjct  32    LNKIPKLSPTGHHETFLHDPET----PTADSLSEDYETFFYNQTLDHFNYRPESYSTFRQ  87

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+V+SKYWGG  SN+PIFA+LGAE+P+D D   IGFLTDNA  FKAL +YIEHRYYGKS
Sbjct  88    RYVVNSKYWGG--SNAPIFAYLGAEAPLDGDLSVIGFLTDNALEFKALQIYIEHRYYGKS  145

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IP+G+ EEA+NN +T GYFNSAQA+ADYAE+LL++K K+ A+ SP+IV GGSYGGMLASW
Sbjct  146   IPYGSREEALNNASTLGYFNSAQAIADYAEILLHVKQKFHAEKSPVIVIGGSYGGMLASW  205

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAPILYFDNIT ++GYYS+VTKDF + S                 
Sbjct  206   FRLKYPHIALGALASSAPILYFDNITSQDGYYSIVTKDFIKSS-----------------  248

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  1063
                                     ELKD+L+STY TAAQY+ PP+YPV  +CG IDGA  
Sbjct  249   ------------------------ELKDHLESTYATAAQYNHPPRYPVNVICGAIDGANN  284

Query  1064  GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
                IL +I AG+     NRTCY  Q  N   SET VGW WQTCSEM +PIG  + +TMF 
Sbjct  285   DDGILGKIFAGLASYRTNRTCYVNQPRN--LSETDVGWNWQTCSEMVIPIGISN-NTMFP  341

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
              +PF +Q F  +C   Y VPPRPHW+TTYYGG DIKL+L +F SNIIFSNGLRDPYSS G
Sbjct  342   ASPFELQDFINECKAAYDVPPRPHWVTTYYGGKDIKLILRRFASNIIFSNGLRDPYSSGG  401

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             VLE+IS +V+AV T  GSHCLDI  A +TDPDWL +QRK EV II+ WI +YY +LE L+
Sbjct  402   VLENISKSVVAVTTTKGSHCLDILQAKETDPDWLVKQRKVEVNIIKRWIAQYYFDLEVLR  461

Query  1604  R  1606
             +
Sbjct  462   K  462



>ref|XP_011005420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005421.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005422.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=496

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/474 (62%), Positives = 363/474 (77%), Gaps = 5/474 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY TF QRY
Sbjct  25    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYEQTLDHFNYRPESYDTFLQRY  82

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE+PID D   IGFL DNA +F +LLVYIEHRYYGKSIP
Sbjct  83    LINSKYWGGANVSAPILVYLGAEAPIDGDLAAIGFLVDNAVQFNSLLVYIEHRYYGKSIP  142

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K      +SP+IV GGSYGGMLASWFR
Sbjct  143   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLTTLYSPVIVIGGSYGGMLASWFR  202

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  203   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  262

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    +LKD+LD+ Y +AAQY++PP YP+ EVC GIDG   G 
Sbjct  263   KPDGLSMLSKKFKTCNPLTDASKLKDHLDTMYASAAQYNRPPTYPINEVCKGIDGGGFGD  322

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DIL RI  G+V   GN +CY     +P  SET VGWRWQTCSEMA+PIG G+ ++MF P 
Sbjct  323   DILSRIFGGLVAYNGNLSCYVNARTDP--SETAVGWRWQTCSEMAIPIGVGN-NSMFPPD  379

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  380   PFDLEDYIEHCKSMYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVL  439

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             E+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  440   ENISDTVVAVKTANGSHCLDILFAEETDPEWLVTQRKIEIKIIKEWINKYYADL  493



>ref|NP_851059.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 dbj|BAB10607.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AED93088.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=502

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/481 (57%), Positives = 349/481 (73%), Gaps = 10/481 (2%)
 Frame = +2

Query  188   LTPLYESILQRSSSKHSSPQTKPL-------SSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             L PL  S + R      + + +P         S+ + +Y+ QTLDHF + P+SY TF+QR
Sbjct  20    LIPLAHSKIARLGISSKTLKNEPDGSTQKVDESNLKMYYFNQTLDHFTFTPESYMTFQQR  79

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y + S +WGGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++
Sbjct  80    YAIDSTHWGGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETM  139

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WF
Sbjct  140   PFGSAEEALKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWF  199

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+ALGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A
Sbjct  200   RLKYPHIALGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWIEIDRVA  259

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--  1060
              KPNGLSILSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  
Sbjct  260   GKPNGLSILSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPN  319

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
             +  ++LDRI AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF
Sbjct  320   RRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMF  378

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
               APF+M  +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  
Sbjct  379   PTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVG  438

Query  1421  GVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             GVLEDISDT++A+ T+NGSHCLDI   SK DP+WL  QR+KE+++I SWI+ Y  +L  L
Sbjct  439   GVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTYQNDLRDL  498

Query  1601  K  1603
              
Sbjct  499   N  499



>ref|XP_006369367.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65936.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=517

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 363/474 (77%), Gaps = 5/474 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY  F QRY
Sbjct  46    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYNQTLDHFNYRPESYDKFPQRY  103

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIP
Sbjct  104   LINSKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIP  163

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  164   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFR  223

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  224   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  283

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G 
Sbjct  284   KPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGD  343

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D L RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P 
Sbjct  344   DTLSRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPD  400

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  401   PFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVL  460

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             E+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYYV+L
Sbjct  461   ENISDTVVAVKTVNGSHCLDILFAKETDPEWLVTQRKIEIKIIKEWINKYYVDL  514



>ref|XP_010527988.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Tarenaya hassleriana]
Length=493

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 337/473 (71%), Gaps = 10/473 (2%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSS  361
             PR+ P        S      P     +S    F++ Q LDHF Y P+SY TF+QRY +  
Sbjct  26    PRVYP------DASRQNQLKPDNYGSASDVEFFFFDQNLDHFTYTPESYTTFRQRYAIDF  79

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  541
              YWGGA++NSPI A+LGAESP+D D   +GFL DN   FKALLVYIEHRYYG+S+PFG+ 
Sbjct  80    SYWGGAKTNSPILAYLGAESPMDSDLSVVGFLRDNGLHFKALLVYIEHRYYGESMPFGSA  139

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
             +EA+ N TT GYFN+AQALADYAE+L+++K+KY  +HSPIIV GGSYGGMLA+WFRLKYP
Sbjct  140   KEALKNATTMGYFNTAQALADYAEILMHIKDKYATKHSPIIVIGGSYGGMLATWFRLKYP  199

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             HVA+GALASSAP+LYF++  P+ GY+ +VT+  K+ S+ CY+TIRKSW  ID++A  PNG
Sbjct  200   HVAIGALASSAPLLYFEDTVPKYGYFYVVTQVIKKTSQTCYETIRKSWDDIDRVAWHPNG  259

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG-APKGA-DI  1075
             LSILS+KFK C  L    +LKDYL+S Y    QY+  P Y V   C  ID  +PK   D+
Sbjct  260   LSILSEKFKTCAPLNRSSDLKDYLESMYSLVVQYNGLPYYSVDATCKAIDSESPKDTEDL  319

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             LDRI AGVV   GN+ CYD  I +PPT+  +  W WQ CSE+ MPIG   +DT+F   PF
Sbjct  320   LDRIFAGVVAQFGNQVCYDISIGSPPTNSEL-AWMWQICSELVMPIGLDKQDTLFQTNPF  378

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             +M  ++  C+  YG+ PRPHWI+ YYGG D KL L +FGSNIIFSNGL DPYS  GVLED
Sbjct  379   NMSDYTSKCESMYGISPRPHWISAYYGGEDFKLSLRRFGSNIIFSNGLSDPYSVGGVLED  438

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             ISDT+LAV T NGSHC+D+   +K DP WL  QR+KEVEII SWI+ Y  +L+
Sbjct  439   ISDTILAVKT-NGSHCMDLVFETKEDPKWLVLQRQKEVEIIDSWISIYQNDLK  490



>ref|XP_006388621.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
 gb|ERP47535.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
Length=496

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 362/474 (76%), Gaps = 5/474 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY  F QRY
Sbjct  25    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYNQTLDHFNYRPESYDKFPQRY  82

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIP
Sbjct  83    LINSKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIP  142

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  143   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFR  202

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  203   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  262

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G 
Sbjct  263   KPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGD  322

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D L RI  G+V   GN +CY     +P  SET VGW+WQTCSEMA+PIG G+ ++MF P 
Sbjct  323   DTLSRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQTCSEMAIPIGVGN-NSMFPPD  379

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF ++ +  +C   YGVP RPHWITTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  380   PFDLEDYIENCKSLYGVPTRPHWITTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVL  439

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             E+ISDTV+AV T NGSHCLDI  A + DP WL  QRK E++II+ WI KYY +L
Sbjct  440   ENISDTVVAVKTVNGSHCLDILFAEENDPAWLVTQRKIEIKIIKEWINKYYADL  493



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 344/482 (71%), Gaps = 9/482 (2%)
 Frame = +2

Query  164   PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             P   KI RL  +  ++L+ +  +   P  K   S  + FY+ QTLDHF + P+SY TF+Q
Sbjct  23    PAHSKIARLG-ISPNLLKNAPDR---PTQKIAESDLKLFYFNQTLDHFTFTPESYLTFQQ  78

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY + SK+W GA++N+PI A+LG ES ++ D    GFL DNAP FKAL VYIEH YYGK+
Sbjct  79    RYAIDSKHWAGAKANAPILAFLGLESSLETDFSAFGFLRDNAPHFKALCVYIEHTYYGKT  138

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+++EAM N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+W
Sbjct  139   IPFGSVKEAMKNASTLGYLNTAQALADYAAILLHVKEKYSTKHSPIIVVGGSYGGMLAAW  198

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAP+LYF++  P+ GYY ++TK FKE ++ CY TIRKSW  IDK+
Sbjct  199   FRLKYPHIALGALASSAPLLYFEDTRPKFGYYYIITKVFKETNKRCYNTIRKSWKQIDKV  258

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP-  1060
             A+KPNGL IL KKFK C  L    +LKD+LD+ Y  A QY++   + VT VC  I+  P 
Sbjct  259   AAKPNGLLILGKKFKTCAPLNKSFDLKDFLDTIYAEAVQYNE--GFLVTNVCSAINANPP  316

Query  1061  -KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +  DILDRI AGVV L GN++CYD   Y+   +   + WRWQ CSE+ +P+G   +D M
Sbjct  317   NRKIDILDRIFAGVVALTGNQSCYDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDAM  375

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  +PF+M  F   C+  YGV PRPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS 
Sbjct  376   FPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSV  435

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLED+SD+V+A+ T NGSHC DI   SK DP+WL  QR+KE++II  W+ KY  +L  
Sbjct  436   GGVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREKEIKIIDYWLLKYQKDLRD  495

Query  1598  LK  1603
             L 
Sbjct  496   LN  497



>gb|AAM61502.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
Length=502

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/481 (57%), Positives = 348/481 (72%), Gaps = 10/481 (2%)
 Frame = +2

Query  188   LTPLYESILQRSSSKHSSPQTKPL-------SSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             L PL  S + R      + + +P         S  + +Y+ QTLDHF + P+SY TF+QR
Sbjct  20    LIPLAHSKIARLGISSKTLKNEPDGSTQKVDESDLKMYYFNQTLDHFTFTPESYMTFQQR  79

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y + S +WGGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++
Sbjct  80    YAIDSTHWGGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETM  139

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WF
Sbjct  140   PFGSAEEALKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWF  199

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+ALGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A
Sbjct  200   RLKYPHIALGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWKEIDRVA  259

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--  1060
              KPNGLSILSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  
Sbjct  260   GKPNGLSILSKQFKTCDPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPN  319

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
             +  ++LDRI AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF
Sbjct  320   RRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMF  378

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
               APF+M  +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  
Sbjct  379   PTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVG  438

Query  1421  GVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             GVLEDISDT++A+ T+NGSHCLDI   SK DP+WL  QR+KE+++I SWI+ Y  +L  L
Sbjct  439   GVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTYQNDLRDL  498

Query  1601  K  1603
              
Sbjct  499   N  499



>ref|XP_006287572.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
 gb|EOA20470.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
Length=502

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/451 (60%), Positives = 338/451 (75%), Gaps = 5/451 (1%)
 Frame = +2

Query  263   SHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  442
             S  + FY+ QTLDHF + P+SY TF+QRY ++S +WGGA++N+PI A+LG E+ +D D  
Sbjct  50    SGLQMFYFNQTLDHFTFRPESYMTFQQRYAINSTHWGGAKANAPILAFLGEETSLDSDLS  109

Query  443   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  622
              IGFL DN PR KALLVYIEHRYYGK++PFG+ EE + N +T GY N+AQALADYA +LL
Sbjct  110   GIGFLRDNGPRLKALLVYIEHRYYGKTMPFGSAEETLKNASTLGYLNAAQALADYAAILL  169

Query  623   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  802
             ++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY 
Sbjct  170   HVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTLPKFGYYY  229

Query  803   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  982
             +VTK FKE SE CY TIRKSW  ID++A+KPNGL ILSKKFK C  L    ++KD+LDS 
Sbjct  230   IVTKVFKETSERCYNTIRKSWKEIDRVAAKPNGLLILSKKFKTCAPLNGSFKIKDFLDSV  289

Query  983   YCTAAQYDQPPKYPVTEVCGGIDGAP----KGADILDRIHAGVVGLEGNRTCYDPQIYNP  1150
             Y  + QY++ P Y VT+VC  I+          D+LD+I AGVV L GNRTCYD  ++  
Sbjct  290   YAESVQYNRGPSYWVTKVCNAINTNTYPPNSKHDLLDQIFAGVVALIGNRTCYDTNMFAQ  349

Query  1151  PTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTY  1330
             PT+  I  WRWQ+CSE+ MP+G   +DTMF   PF+M  +   C+ YYGVPPR HWITTY
Sbjct  350   PTNNNI-AWRWQSCSEIVMPVGYDKQDTMFPTTPFNMTSYISGCESYYGVPPRQHWITTY  408

Query  1331  YGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKT  1510
             +G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDT++A+ T+NGSHC DI   SK 
Sbjct  409   FGIQDVKLILQKFGSNIIFSNGLSDPYSVGGILEDISDTIVAITTKNGSHCQDIGLKSKD  468

Query  1511  DPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             DP+WL  QR+KE++I+ SWI+ Y  +L  L 
Sbjct  469   DPEWLVMQREKEIKILDSWISTYQKDLRDLN  499



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/482 (56%), Positives = 345/482 (72%), Gaps = 9/482 (2%)
 Frame = +2

Query  164   PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             P   KI RL  +  ++L+ +  +   P  K   S  + FY+ QTLDHF + P+SY TF+Q
Sbjct  23    PAHSKIARLG-ISPNLLKNAPDR---PTQKIAESDLKFFYFNQTLDHFTFTPESYLTFQQ  78

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY + SK+W GA++N+PI A+LG ES ++ D    GFL DNAP FKAL VYIEHRYYGK+
Sbjct  79    RYAIDSKHWAGAKANAPILAFLGLESSLETDMSAFGFLRDNAPHFKALCVYIEHRYYGKT  138

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+++EAM N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+W
Sbjct  139   IPFGSVKEAMKNASTLGYLNTAQALADYAAILLHIKEKYSTKHSPIIVVGGSYGGMLAAW  198

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAP+LYF++  P+ GYY ++TK FKE +  CY TIRKSW  IDK+
Sbjct  199   FRLKYPHIALGALASSAPLLYFEDTRPKFGYYYIITKVFKETNMRCYNTIRKSWKEIDKV  258

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP-  1060
             A+KPNGL IL KKFK C  L    +LKD+LD+ Y  A QY++     V+ VC  I+  P 
Sbjct  259   AAKPNGLLILGKKFKTCAPLNRSFDLKDFLDTIYAEAVQYNE--GILVSNVCNAINANPP  316

Query  1061  -KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +  DILDRI AGVV L GN++CYD   Y+   +   + WRWQ CSE+ +P+G   +DTM
Sbjct  317   NRKIDILDRIFAGVVALTGNQSCYDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDTM  375

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  +PF+M  F   C+  YGV PRPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS 
Sbjct  376   FPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSV  435

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLED+SD+V+A+ T NGSHC DI   SK DP+WL  QR++E++II SW++ Y  ++  
Sbjct  436   GGVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSWLSTYQKDIRD  495

Query  1598  LK  1603
             L 
Sbjct  496   LN  497



>ref|XP_006369363.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
 gb|ERP65932.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
Length=576

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/479 (60%), Positives = 341/479 (71%), Gaps = 14/479 (3%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +S +       F T +Y QTLDHFNY P+SY TF QRY
Sbjct  93    LNTIPRLSPIGPRVWRDQPDKTTSGEFD--GEGFETCFYSQTLDHFNYRPESYDTFLQRY  150

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
              ++SKYW GA  N+ I  +LGAE+ ID      GFL DNA +FK+LLV IEHRYYG+SIP
Sbjct  151   AINSKYWAGA--NASILVYLGAEASIDPYLDAGGFLVDNAVQFKSLLVVIEHRYYGQSIP  208

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
              G+  +       RGYFNSAQALADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  209   PGSWGK-------RGYFNSAQALADYAAIIIHIKKTLRAQYSPVIVIGGSYGGMLASWFR  261

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++ YYS+VTK F+E SE CYQTI+ SWS ID++AS
Sbjct  262   LKYPHIALGALASSAPILYFDDITPQDAYYSVVTKAFREASETCYQTIKTSWSEIDELAS  321

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KPNGLS+LS K K C  L     LKDYL   Y  AAQY+ PP YPV EVC GID    G 
Sbjct  322   KPNGLSMLSDKLKTCN-LTDASTLKDYLRIMYANAAQYNSPPTYPVNEVCKGIDDDASGD  380

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DIL RI  GVV   GNRTCY         SE  + W WQTCSEM M +G G+ ++MF P 
Sbjct  381   DILSRIFRGVVAYYGNRTCYFNNNAYAYQSEATLDWSWQTCSEMVMSLGVGN-NSMFEPD  439

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF  + +   C   YGV PRPHW+TTYYGGHDIKL+L +FGSNIIFSNGLRDPYSS GVL
Sbjct  440   PFDWKDYIDRCKSLYGVRPRPHWVTTYYGGHDIKLILQRFGSNIIFSNGLRDPYSSGGVL  499

Query  1430  EDISDTVLAVYTRNGSHCLDIYGAS-KTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
              +ISD+++AV T NGSHCLDI  A+  TDPDWL  QRKKEVEII+ WIT+YY +L   K
Sbjct  500   NNISDSIVAVTTVNGSHCLDIQRANPSTDPDWLVMQRKKEVEIIEGWITQYYEDLYEFK  558



>ref|XP_010031431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/481 (58%), Positives = 343/481 (71%), Gaps = 15/481 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP LT   E  L+   S  S+     ++  F TF++ QTLDHF+Y PQSYATFKQRY + 
Sbjct  26    IPTLTLQLEDFLRDPESAVSAS----ITDDFETFFFDQTLDHFSYTPQSYATFKQRYFID  81

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-  535
             S+YWGGA S++PIF +LGAES +D  P  IGFL DNA +FKALLVYIEHRYYG+SIP G 
Sbjct  82    SRYWGGANSSAPIFVYLGAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGM  141

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N   RGYF+SAQALADY  V++++K +  A  SP+IV GGSYGGMLASW RLK
Sbjct  142   SFEEALENADIRGYFSSAQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLK  201

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAP+LYF++ITP++ YYS+V KDFKE SE C+Q I  SWS ID++A + 
Sbjct  202   YPHVALGALASSAPVLYFEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKEL  261

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-D  1072
             +GLS LSK F  C+ L+S   LK +L   Y  AAQ+D PP YPV  +C GIDGA     D
Sbjct  262   DGLSNLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGANTTEND  321

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL +I AGVV    N TCY     NP    T  GW WQ CSEM MP+G  + ++MF  AP
Sbjct  322   ILGKISAGVVAYYWNSTCY----VNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPRAP  376

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +  F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL+
Sbjct  377   FVLDDFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLK  436

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +IS++++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A 
Sbjct  437   NISESIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADLRAS  496

Query  1601  K  1603
             K
Sbjct  497   K  497



>gb|KFK27605.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=509

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 340/468 (73%), Gaps = 13/468 (3%)
 Frame = +2

Query  236   SSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGA  415
             + P  K   S    FY+ Q LDHF Y  +SY TF+QRY + SK+W G+++N+PI A+LG 
Sbjct  40    NEPTQKVNESDLEMFYFNQNLDHFTYTAKSYTTFQQRYAIDSKHWAGSKANAPILAFLGE  99

Query  416   ESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQA  595
             E+ +D D   IGFL DNA RFK+LLVYIEHRYYG ++PFG+  EA+ N +T GY N+AQA
Sbjct  100   ETSLDSDLSTIGFLRDNALRFKSLLVYIEHRYYGMTMPFGSANEALKNASTLGYLNAAQA  159

Query  596   LADYAEVLLYLKNKYLAQHSPIIVFGGSYGG----------MLASWFRLKYPHVALGALA  745
             LADYA +LL++K  Y A+HSPIIV GGSYGG          +LA+WFRLKYPH+ALGALA
Sbjct  160   LADYAAILLHVKQNYSAKHSPIIVIGGSYGGKECTLSHNLPLLAAWFRLKYPHIALGALA  219

Query  746   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  925
             SSAP+LYF++  P++GYY +VTK FKE SE CYQTIRKSW  I+++A+KPNGL  L KKF
Sbjct  220   SSAPLLYFEDTLPKHGYYYIVTKVFKETSERCYQTIRKSWKEIERVAAKPNGLLTLGKKF  279

Query  926   KLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGV  1099
             K C  L     +KD+LDS Y  A QY++ P Y VT VC GI+  P  +  D+LDRI AGV
Sbjct  280   KTCAPLNGSFNIKDFLDSIYAEAVQYNRGPSYWVTNVCNGINANPSNRKIDLLDRIFAGV  339

Query  1100  VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRD  1279
             V L GNR+CYD  ++  PT+  +  WRWQ+C+E+ MP+G   +DTMF  APF+M  F   
Sbjct  340   VALVGNRSCYDTNMFAQPTNNNL-AWRWQSCTEIVMPVGYDKQDTMFPTAPFNMTSFIAG  398

Query  1280  CDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAV  1459
             C+ YYGVPPRPHW+TTY+G  D+KL+L +FGSNIIFSNGL+DPYS  GVLEDIS +V+A+
Sbjct  399   CESYYGVPPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLKDPYSVGGVLEDISGSVVAI  458

Query  1460  YTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
              T NGSHC DI   SK DP+WL  QR+KE++II+SWIT Y  +L  L 
Sbjct  459   KTENGSHCQDIVLKSKEDPEWLVMQREKEIDIIESWITSYKRDLRDLN  506



>ref|XP_006424402.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
 gb|ESR37642.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
Length=429

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/415 (64%), Positives = 319/415 (77%), Gaps = 3/415 (1%)
 Frame = +2

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++ KYW GA +++P F   G E  ID D    GFL +NAP FKALLVYIEHRYYGKS+P
Sbjct  2     LINFKYWDGANTSAPNFVLFGGEESIDYDRDINGFLPENAPHFKALLVYIEHRYYGKSVP  61

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FGT EEAM N +T GY NSAQA+ADYA VLL++K KY A+  P+IV GGSYGGMLASWFR
Sbjct  62    FGTKEEAMKNASTLGYCNSAQAIADYAAVLLHIKQKYSAEKCPVIVIGGSYGGMLASWFR  121

Query  710   LKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             LKYPH+ALGALASS+PILYFD +  P+ GYY++VTKDFKE SE+CY+TIRKSW  ID++ 
Sbjct  122   LKYPHIALGALASSSPILYFDGVVDPQVGYYTIVTKDFKETSESCYETIRKSWGEIDEVG  181

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             S+PNGLSILSKKF+ C  L S  ELKDYLDS Y  AAQYD+PPKYPV+ VCG IDGA +G
Sbjct  182   SRPNGLSILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA-EG  240

Query  1067  ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
              D LD+I A VV   GN +CYD + +  PTS T   + WQ C+E+  PIG G  DTMF  
Sbjct  241   TDTLDKIFAAVVTYMGNTSCYDMEEFGSPTS-TYDMFTWQVCTELVFPIGHGHNDTMFPL  299

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1426
             APF +  FS+ C+  +GV P+PHW+TTYYGG DIKL+LH F SNIIFSNGLRDPYSS GV
Sbjct  300   APFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRDPYSSGGV  359

Query  1427  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             L++ISD+V+A+ T NGSHCLDI  A ++DP WL  QRK EVEII+ W+ KY+ +L
Sbjct  360   LKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGWLAKYHADL  414



>gb|KCW50722.1| hypothetical protein EUGRSUZ_J00400 [Eucalyptus grandis]
Length=535

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/481 (58%), Positives = 343/481 (71%), Gaps = 15/481 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP LT   E  L+   S  S+     ++  F TF++ QTLDHF+Y PQSYATFKQRY + 
Sbjct  64    IPTLTLQLEDFLRDPESAVSAS----ITDDFETFFFDQTLDHFSYTPQSYATFKQRYFID  119

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-  535
             S+YWGGA S++PIF +LGAES +D  P  IGFL DNA +FKALLVYIEHRYYG+SIP G 
Sbjct  120   SRYWGGANSSAPIFVYLGAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGM  179

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N   RGYF+SAQALADY  V++++K +  A  SP+IV GGSYGGMLASW RLK
Sbjct  180   SFEEALENADIRGYFSSAQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLK  239

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAP+LYF++ITP++ YYS+V KDFKE SE C+Q I  SWS ID++A + 
Sbjct  240   YPHVALGALASSAPVLYFEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKEL  299

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-D  1072
             +GLS LSK F  C+ L+S   LK +L   Y  AAQ+D PP YPV  +C GIDGA     D
Sbjct  300   DGLSNLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGANTTEND  359

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL +I AGVV    N TCY     NP    T  GW WQ CSEM MP+G  + ++MF  AP
Sbjct  360   ILGKISAGVVAYYWNSTCY----VNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPRAP  414

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +  F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL+
Sbjct  415   FVLDDFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLK  474

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +IS++++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A 
Sbjct  475   NISESIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADLRAS  534

Query  1601  K  1603
             K
Sbjct  535   K  535



>ref|XP_006485136.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=498

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/483 (55%), Positives = 357/483 (74%), Gaps = 23/483 (5%)
 Frame = +2

Query  182   PRLTPLYES-ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             PRL  +  S IL++  S H           F+TF+Y QT+DHF+YGP+SY TF +RY+++
Sbjct  31    PRLGRIRRSRILEQKDSNHG----------FKTFFYNQTIDHFSYGPESYQTFPERYVIN  80

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             SK+WGG   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+
Sbjct  81    SKFWGGG--NSPILAFLGAEAPIDDNIQLSGFTYENAHQFKALIVILEHRYYGKSVPFGS  138

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              + A+ N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKY
Sbjct  139   RKAALKNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKY  198

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PHV +G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+
Sbjct  199   PHVVIGSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPD  258

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADI  1075
             GL+ILSKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DI
Sbjct  259   GLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAPNCGDDI  318

Query  1076  LDRIHAGVVGLE------GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
             L +I AGVV  +       N  CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M
Sbjct  319   LCKIAAGVVEADSLEYDGNNSRCYINE--DKTGDESDEGWEWQSCSEMVVPMGK-DKNSM  375

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             + P P+++ ++ ++C + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S 
Sbjct  376   YQPEPWNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSR  435

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLE+ISD+++A+ T+ GSHCLD+ GA K+DPDWL +QRK EV+I+Q WIT+YY + +A
Sbjct  436   GGVLENISDSIIALSTKYGSHCLDLDGAKKSDPDWLVQQRKTEVKIMQGWITQYYDDFKA  495

Query  1598  LKR  1606
             + +
Sbjct  496   INK  498



>emb|CDY09173.1| BnaA02g05990D [Brassica napus]
Length=517

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/492 (55%), Positives = 342/492 (70%), Gaps = 22/492 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             KIPRL  +   +L+   ++  SP  K      + FY+ Q LDHF + P+SY TF+QRY +
Sbjct  27    KIPRLG-ISPKMLK---NEPDSPTQKLNDPDLKMFYFNQNLDHFTFTPKSYMTFQQRYAI  82

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
              SK+W GA+ N+PI A+LG ES +D D   IGFL DN PR KALLVYIEHRYYGK++PFG
Sbjct  83    DSKHWAGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKTMPFG  142

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLK
Sbjct  143   SAEEALKNASTLGYLNAAQALADYASILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLK  202

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPH+ALGALASSAP+LYF++  P+ GYY +VTK  K  SE CY  IRKSW  ID++A+KP
Sbjct  203   YPHIALGALASSAPLLYFEDTRPKFGYYYIVTKVIKGTSERCYNMIRKSWKEIDRVAAKP  262

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-  1072
             NGL ILSK+FK C  L +  ++KD+L + Y  A QY++ P Y VT VC  ID  P  +  
Sbjct  263   NGLLILSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNNPPNSKK  322

Query  1073  -ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ--------------TCSEMAM  1207
              +LDRI AG V L GN++CYD  ++  PT+     WRWQ              TCSE+ M
Sbjct  323   GLLDRIFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQARKFTLKTMLKPDRTCSEIVM  381

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             P+G   +DTMF   PF+M  +   C   YGV PRPHWITTY+G  D+KL+L KFGSNIIF
Sbjct  382   PVGYDKQDTMFPTTPFNMTSYIERCKADYGVTPRPHWITTYFGIQDVKLILRKFGSNIIF  441

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRN-GSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1564
             SNGL DPYS  GVLEDISD+V+A+ + N GSHC DI    K DP+WL  QR KE++II+S
Sbjct  442   SNGLSDPYSVGGVLEDISDSVVAIKSNNAGSHCQDIVMKMKGDPEWLVMQRDKEIKIIES  501

Query  1565  WITKYYVELEAL  1600
             WI+ Y  +L+AL
Sbjct  502   WISTYQKDLKAL  513



>ref|XP_002874097.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50356.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=501

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/449 (60%), Positives = 335/449 (75%), Gaps = 4/449 (1%)
 Frame = +2

Query  263   SHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  442
             S  + +Y+ QTLDHF + P+SY TF+QRY ++S +WGGA++N+PI A+LG ES +D D  
Sbjct  52    SDLKMYYFNQTLDHFTFTPKSYMTFQQRYAINSSHWGGAKANAPILAFLGEESSLDSDLS  111

Query  443   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  622
              IGFL DN P  KALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQALADYA +LL
Sbjct  112   GIGFLRDNGPHLKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYAAILL  171

Query  623   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  802
             ++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY 
Sbjct  172   HVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKIGYYY  231

Query  803   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  982
             +VTK FKE SE CY  IRKSW  ID++A KPNGLSILSK FK C  L     +KD+LD+ 
Sbjct  232   IVTKVFKETSERCYTRIRKSWKEIDRVAVKPNGLSILSKTFKTCAPLNGSFNIKDFLDTI  291

Query  983   YCTAAQYDQPPKYPVTEVCGGIDG-APKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPT  1156
             Y  A QY++ P Y V  VC  I+   P   D +LDRI AGVV L GNRTCYD  +++ PT
Sbjct  292   YAEAVQYNRGPTYWVANVCNAINANTPNRKDTLLDRIFAGVVALIGNRTCYDTNMFSQPT  351

Query  1157  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1336
             +  I  WRWQ+CSE+ +P+G   +DTMF  APF+M  +   C+ YYGVPPRPHWITTY+G
Sbjct  352   NNHI-AWRWQSCSEIVIPVGYDKQDTMFPTAPFNMTSYIDGCESYYGVPPRPHWITTYFG  410

Query  1337  GHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDP  1516
               D+KL+L +FGSNIIFSNGL DPYS  GVLEDISDTV+A+ T NGSHC DI   +K DP
Sbjct  411   IQDVKLILRRFGSNIIFSNGLSDPYSVGGVLEDISDTVVAI-TTNGSHCQDISLKNKEDP  469

Query  1517  DWLTEQRKKEVEIIQSWITKYYVELEALK  1603
              WL  QR+KE+++I SWI+ Y  +L  L 
Sbjct  470   QWLVMQREKEIKVIDSWISTYQNDLRDLN  498



>ref|XP_006424406.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
 gb|ESR37646.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
Length=501

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/483 (56%), Positives = 357/483 (74%), Gaps = 23/483 (5%)
 Frame = +2

Query  182   PRLTPLYES-ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             PRL  +  S IL++  S H           F TF+Y QT+DHF+YGP+SY TF QRY+++
Sbjct  34    PRLGRIRRSRILEQKDSNHG----------FETFFYNQTIDHFSYGPESYQTFPQRYVIN  83

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             SK+WGG   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+
Sbjct  84    SKFWGGG--NSPILAFLGAEAPIDDNIQPSGFTYENAHQFKALIVILEHRYYGKSVPFGS  141

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              + A+ N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKY
Sbjct  142   RKAALKNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKY  201

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PHV +G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+
Sbjct  202   PHVVIGSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPD  261

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADI  1075
             GL+ILSKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DI
Sbjct  262   GLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDSPSNIPVKRICNAIENAPNCGDDI  321

Query  1076  LDRIHAGVVG---LE---GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
             L +I AGVV    LE    N  CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M
Sbjct  322   LCKIAAGVVEAYLLEYDGNNSRCYINE--DRTGDESDEGWEWQSCSEMVVPMGK-DKNSM  378

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             + P P+++ ++ +DC + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S 
Sbjct  379   YQPEPWNLTKYIKDCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSR  438

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLE+ISD+++A+ T++GSHCLD+  A K+DPDWL +QRK EV+I+Q WIT+YY + +A
Sbjct  439   GGVLENISDSIIALSTKHGSHCLDLDEAKKSDPDWLVQQRKTEVKIMQGWITQYYDDFKA  498

Query  1598  LKR  1606
             + +
Sbjct  499   INK  501



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/481 (57%), Positives = 342/481 (71%), Gaps = 15/481 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP LT   E   Q      S+  T      F TF++ QTLDHF+Y PQSYATFKQRY ++
Sbjct  26    IPALTLEREDFHQDPERAVSASTTD----DFETFFFDQTLDHFSYRPQSYATFKQRYFIN  81

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-  535
             S YWGGA+S++PIF +LGAES +D  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G 
Sbjct  82    SSYWGGAKSSAPIFVYLGAESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGM  141

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N   RGYF+SAQALADY  +++++K +  A  SP+IV GGSYGGMLASW RLK
Sbjct  142   SFEEALENADIRGYFSSAQALADYVAIIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLK  201

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAP+LYF+++TP++ YYS+V KDFKE SE C+Q I  SWS ID++A + 
Sbjct  202   YPHVALGALASSAPVLYFEDMTPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKEL  261

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-  1072
             +GLS LS+ F  C+ L+S   LK +L   Y TAAQ D PP YPVT +C GIDGA    + 
Sbjct  262   DGLSNLSQIFNTCRPLESGATLKSFLKDMYTTAAQQDNPPTYPVTRICEGIDGANTTENG  321

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL +I AGVV    N  C      N P + +  GW WQ CSEM MP+G   R++MF PAP
Sbjct  322   ILGKISAGVVAYYWNSNC----CLNTPLTVSPDGWSWQKCSEMVMPLGI-TRNSMFPPAP  376

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F +  F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL+
Sbjct  377   FLLDDFMEHCRCEYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLK  436

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +IS++++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A 
Sbjct  437   NISESIIAVITDQGSHCVDIYPESHDTQCPDPDWLVKQRKTEVEIIKGWIDQYYADLRAS  496

Query  1601  K  1603
             K
Sbjct  497   K  497



>gb|KDO55292.1| hypothetical protein CISIN_1g036751mg [Citrus sinensis]
Length=492

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 346/480 (72%), Gaps = 29/480 (6%)
 Frame = +2

Query  161   PPPLHKIPRLTPLYE-SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             P  L  IP+L  L   +I Q  S   +S + K   S  +T YY QTLDHFNY P+SY TF
Sbjct  26    PTLLKYIPKLGVLRGINIFQNPSENLTSSEPK---SDLKTLYYDQTLDHFNYNPESYLTF  82

Query  338   KQRYIVSSKYWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  511
              QRY+++ K+WGG    +  PI A+LG ES +DDD + IG+L+DNA RFKAL VYIEHR+
Sbjct  83    PQRYVLNFKHWGGGGGAAAAPILAYLGEESSLDDDLRGIGWLSDNAHRFKALQVYIEHRF  142

Query  512   YGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             YGKS+PF + E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGM
Sbjct  143   YGKSVPFVSSEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGM  202

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFRLKYPH+ALGA+ASSAP+LYFD ITP + YYS VTKDF+E SE+CY TI++SW+ 
Sbjct  203   LAAWFRLKYPHIALGAVASSAPVLYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAA  262

Query  872   IDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGID  1051
             IDK  +K NGL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GID
Sbjct  263   IDKAGAKRNGLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGID  322

Query  1052  GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1231
             GA +G D + RI +G+V   G ++CY+  I    + ET+ GW WQTCSE+ MPIG G   
Sbjct  323   GASQGTDTVARIFSGIVASRGKKSCYN--IGEFFSDETLNGWGWQTCSEIVMPIGIGKNK  380

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
             TMF   PF+++++   C++ YGV PRPHWITTYYGG DI++VL  FGSNIIFSNGLRDPY
Sbjct  381   TMFPADPFNLKEYMDSCENSYGVVPRPHWITTYYGGLDIRVVLKSFGSNIIFSNGLRDPY  440

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S+AGVLEDISD+++A+                     + + R+ EV I+ +WI KYY +L
Sbjct  441   STAGVLEDISDSIIAL---------------------VQKMRQIEVNIVHAWILKYYADL  479



>ref|XP_008458664.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Cucumis 
melo]
Length=436

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/417 (64%), Positives = 321/417 (77%), Gaps = 8/417 (2%)
 Frame = +2

Query  173   HKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYI  352
             ++IPRL+P+  + L  + +  SS     +S  F+TFYY Q+LDHFNY P+SY  F  RYI
Sbjct  28    YRIPRLSPIGRTFLHNAEAISSS-----ISDDFKTFYYNQSLDHFNYRPESYTCFPHRYI  82

Query  353   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
             ++ KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEHRYYGKS+PF
Sbjct  83    INFKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAVRFDALLVYIEHRYYGKSMPF  142

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N +T GYF+SAQA+ADYA VLL+LK KY A+ SP+IV GGSYGGMLA+WFRL
Sbjct  143   GSREEALKNASTLGYFSSAQAIADYAAVLLHLKQKYHAKDSPVIVLGGSYGGMLAAWFRL  202

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SWS I+ IASK
Sbjct  203   KYPHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSWSKIETIASK  262

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             PNGLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGGIDGA  G+ 
Sbjct  263   PNGLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGASPGSG  322

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             I+ ++ AGV   +GN  CY+    N   +ET VGWRWQ CSEM MP+   + DTMF P  
Sbjct  323   IISKVAAGVFAYKGNLPCYNIGPRN--DTETDVGWRWQRCSEMVMPMSTSN-DTMFPPIT  379

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             F ++ F   C   YGV PRPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRDPYSS G
Sbjct  380   FDLRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGG  436



>ref|XP_006287573.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
 gb|EOA20471.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
Length=502

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/482 (55%), Positives = 338/482 (70%), Gaps = 9/482 (2%)
 Frame = +2

Query  167   PLH-KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             P+H KI RL     S +   ++    P  K   S  + FY+ QTLDHF + P+SY TF+Q
Sbjct  23    PVHSKIARLGV---SPILLKNAPGDGPTQKNAESDLKFFYFNQTLDHFTFTPESYMTFQQ  79

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY V +K+W GA+ N+PI  +LG ES ++ D    GFL DNAP FKAL VYIEHRYYGK+
Sbjct  80    RYAVDAKHWAGAKVNAPILVFLGMESSLETDMSAYGFLRDNAPHFKALNVYIEHRYYGKT  139

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+++EAM N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+W
Sbjct  140   IPFGSLKEAMKNSSTLGYLNTAQALADYAAILLHVKEKYSTKHSPIIVVGGSYGGMLAAW  199

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+A GALASSAP+LYF++  P+ GYY ++TK +KE +E CY TIR+SW  ID++
Sbjct  200   FRLKYPHIAHGALASSAPLLYFEDTLPKFGYYYIITKVYKETNEKCYNTIRESWEEIDRV  259

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP-  1060
             A+KPNGL ILSKKFK C  L    +LKD+LD+ Y  + QYD+     VT+VC  I+  P 
Sbjct  260   AAKPNGLLILSKKFKTCTPLNKSFDLKDFLDTIYVESVQYDEGSW--VTDVCDAINAGPP  317

Query  1061  -KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +  DILDRI AGVV   GN++CYD   Y+   +   + + WQ CSE+ +PIG   +DTM
Sbjct  318   NRKIDILDRIFAGVVASHGNQSCYDTN-YSVLVASDAMAYSWQCCSEIVIPIGHDKQDTM  376

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  +PF+M  +   C   YGV PRPHWITTY+G  DIKL+L +FGSNIIFSNGL DPYS 
Sbjct  377   FQTSPFNMTSYIEGCKSQYGVIPRPHWITTYFGIQDIKLILRRFGSNIIFSNGLSDPYSV  436

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
              GVLEDISD+V+A+ T  GSHC DI    K DP+WL  QR+KE++II SW+  Y  +L  
Sbjct  437   GGVLEDISDSVVAITTEKGSHCRDINSKKKDDPEWLVMQREKEIKIIDSWLLTYQKDLRD  496

Query  1598  LK  1603
             L 
Sbjct  497   LN  498



>gb|KCW50493.1| hypothetical protein EUGRSUZ_J00219 [Eucalyptus grandis]
Length=503

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/478 (57%), Positives = 348/478 (73%), Gaps = 11/478 (2%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP+L+  + + +Q  +    + QT   S  FRTF+Y QTLDHFNY P+SY TFKQRYI++
Sbjct  30    IPKLSVFHPTFIQDPTW---AVQTSISSKDFRTFFYNQTLDHFNYRPESYTTFKQRYIIN  86

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIE-HRYYGKSIPFG  535
             SKYWGGA +++PIFA+LG E PID      GF+TDNA  FKALLVYI  HR+YG+SIP+G
Sbjct  87    SKYWGGANASAPIFAFLGDEEPIDSGTTGAGFMTDNAAEFKALLVYIVLHRFYGESIPYG  146

Query  536   -TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
              T+++A+ +  TRGYF+SAQALADYAE+LLYLK K  A+HSPIIV GGSYGGMLA+W RL
Sbjct  147   WTLDKALKDANTRGYFSSAQALADYAEILLYLKQKLNAKHSPIIVSGGSYGGMLAAWLRL  206

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPIL F +I P++ +YS V KDF E S +C+QTIR+SW  ID++AS+
Sbjct  207   KYPHVALGALASSAPILAFPDIMPQDTFYSGVAKDFLEASFSCHQTIRRSWEEIDRVASE  266

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             P+GL+ LSK FK C+ L+S  +LK+YL S Y  AAQY+ P + PV  +C  I+GA    D
Sbjct  267   PHGLAKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGASPRND  326

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
              L +I AG+   + N TCY   I  PPT  S+T +GW WQTC+E+A  +     +TMF P
Sbjct  327   TLRKIFAGLAASDRNSTCY---INPPPTPPSQTELGWHWQTCTEIAA-LWSITNNTMFQP  382

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1426
             AP  + +F   C   + + PR HW++TYYGG DI+LVLH+F SNIIFSNGL+DP+S  G+
Sbjct  383   APSGLDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQDPFSYGGI  442

Query  1427  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             L+ IS++V+AVYT  GSHCLDI  A+K DP WL  QRK EVEII+ WI  Y+ +L A 
Sbjct  443   LKSISNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKWIATYHADLRAF  500



>ref|XP_003596267.1| Lysosomal Pro-X carboxypeptidase [Medicago truncatula]
 gb|AES66518.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=479

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/473 (58%), Positives = 340/473 (72%), Gaps = 22/473 (5%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             +PRL+P  ES     ++++ + +T  L+   + ++Y QTLDHFNY   SY TFKQRYI++
Sbjct  27    LPRLSPFSES----KTTEYQNTKTFNLNEDMQPYFYEQTLDHFNYLSDSYKTFKQRYIIN  82

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
               YWGGA S++PIFA+LG E   DD    +GF+TDNA  FKALLVYIEHRYYGKS+P   
Sbjct  83    FNYWGGANSSAPIFAYLGGE---DDIVNTLGFMTDNATSFKALLVYIEHRYYGKSVP---  136

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
                  +   + GY NSAQALADYAEVLLYLK+   AQ SP+IV GGSY GMLA+WFRLKY
Sbjct  137   -----SFNASYGYLNSAQALADYAEVLLYLKDSLHAQKSPVIVVGGSYAGMLAAWFRLKY  191

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+A+GALASSAP+LYFDNITP +GY  ++T+DF+E S+ CY+TIR SW  ID++ASKPN
Sbjct  192   PHIAIGALASSAPLLYFDNITPASGYNDVITRDFQETSKTCYETIRNSWFEIDEVASKPN  251

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GL+ LSKKF  C  L+ PGELKDYL + Y  AAQY+ P   P T +C  ID A  G DIL
Sbjct  252   GLNFLSKKFNTCYPLEQPGELKDYLGNMYQKAAQYNDP---PTTTICEAIDRASYGDDIL  308

Query  1079  DRIHAGVVGLEGNRTC-YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
              RI+ G+V   GN+ C  +P  Y    ++    WRWQTC+E+ MPIG GD  ++F P PF
Sbjct  309   SRIYGGMVASYGNKKCNVNPDKYT--GAKPFDRWRWQTCTEIVMPIGIGD-SSLFQPKPF  365

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             +   F+ +C   +GV PRPHWIT+YYGG DI+LVL +FGSNIIFSNGLRDPYSS GVL +
Sbjct  366   NFTSFAENCKKDFGVQPRPHWITSYYGGQDIQLVLKRFGSNIIFSNGLRDPYSSGGVLNN  425

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             ISD+++A+ T NG HC DI  A ++DP WL  QR  EVEIIQSWI KYY E+ 
Sbjct  426   ISDSLVALPTVNGYHCQDIVPAIESDPAWLVHQRNTEVEIIQSWIKKYYDEVN  478



>ref|XP_006378926.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|ERP56723.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=456

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 332/440 (75%), Gaps = 10/440 (2%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +     F TF+Y QTLDHFNY P+SY TF QRY
Sbjct  25    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDFETFFYNQTLDHFNYRPESYDTFLQRY  81

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA +++PI  +LGAE+PID D   +GFL D A  F +LLVY+EHRYYGKSIP
Sbjct  82    LINSKYWGGANASAPILVYLGAEAPIDGDLDAVGFLVDTAVEFNSLLVYVEHRYYGKSIP  141

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  142   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  201

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIR+SW  ID++AS
Sbjct  202   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRESWEEIDEVAS  261

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  262   KPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGCGFGD  321

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET VGWRWQTCSEM MPIG G+ D+MF 
Sbjct  322   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSVGWRWQTCSEMVMPIGYGN-DSMFP  376

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PF ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  377   PDPFDLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGG  436

Query  1424  VLEDISDTVLAVYTRNGSHC  1483
             VLE+ISDTV+AV T NG H 
Sbjct  437   VLENISDTVVAVKTVNGKHA  456



>ref|XP_010034149.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=670

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/477 (57%), Positives = 350/477 (73%), Gaps = 10/477 (2%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP+L+  + + +Q  +    + QT   S  F+TF+Y QTLDHFNY P+SY TFKQRYI++
Sbjct  198   IPKLSVFHPTFIQDPTW---AVQTSISSKDFQTFFYNQTLDHFNYRPESYTTFKQRYIIN  254

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-  535
             SKYWGGA +++PIFA+LG E PI+     +GF+TDNA  FKALLVYIEHR+YG+SIP+G 
Sbjct  255   SKYWGGANASAPIFAFLGDELPINSATTNVGFMTDNAAEFKALLVYIEHRFYGESIPYGW  314

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             T+++A+ +  TRGYF+SAQALADYAE+LLYLK K  A+HSPIIV GGSYGGMLA+W RLK
Sbjct  315   TLDKALKDANTRGYFSSAQALADYAEILLYLKQKLNAKHSPIIVSGGSYGGMLAAWLRLK  374

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAPIL F +I P++ +YS V KDF E S +C+QTIR+SW  ID++AS+P
Sbjct  375   YPHVALGALASSAPILAFPDIMPQDTFYSGVAKDFLEASFSCHQTIRRSWEEIDRVASEP  434

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
             +GL+ LSK FK C+ L+S  +LK+YL S Y  AAQY+ P + PV  +C  I+GA    D 
Sbjct  435   HGLAKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGASPRNDT  494

Query  1076  LDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             L +I AG+   + N TCY   I  PPT  S+T +GW WQTC+E+A  +     +TMF PA
Sbjct  495   LRKIFAGLAASDRNSTCY---INPPPTPPSQTELGWHWQTCTEIAA-LWSITNNTMFQPA  550

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             P  + +F   C   + + PR HW++TYYGG DI+LVLH+F SNIIFSNGL+DP+S  G+L
Sbjct  551   PSGLDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQDPFSYGGIL  610

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             + IS++V+AVYT  GSHCLDI  A+K DP WL  QRK EVEII+ WI  Y+ +L A 
Sbjct  611   KSISNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKWIATYHADLRAF  667


 Score =   187 bits (474),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  500  EHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGG  676
            +HR+YG+SIP+G T+++A+ +  TRGYF+SAQALADY E+LLYLK K  A+HSPIIV GG
Sbjct  51   KHRFYGESIPYGWTLDKALKDANTRGYFSSAQALADYVEILLYLKQKLNAKHSPIIVSGG  110

Query  677  SYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIR  856
            SYGGMLA+W RLKYPHVALGALASSAPIL F +I P + +YS V KDF E S +C+QTIR
Sbjct  111  SYGGMLAAWLRLKYPHVALGALASSAPILAFPDIMPRDTFYSGVAKDFLEASFSCHQTIR  170

Query  857  KSWSVIDKIASKPNGLSILSKKF  925
            +SW  ID++AS+P+  +   K  
Sbjct  171  RSWEEIDRVASEPHVCAATKKNL  193



>emb|CDP14439.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/413 (64%), Positives = 316/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  377   AQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMN  556
             A+SNS I A+LGAE+P+ +D + IGFLTDNAP FKALLVYIEHR+YGKSIP G+ME+AM 
Sbjct  80    ARSNSSILAYLGAEAPLAEDLESIGFLTDNAPWFKALLVYIEHRFYGKSIPLGSMEKAMK  139

Query  557   NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALG  736
             N+T RGYFN AQALA+YAE+LL++K+K+ AQ SP+IV GGSYGGML SWFRLKYPH+AL 
Sbjct  140   NKTMRGYFNLAQALANYAEILLHVKDKFSAQSSPVIVVGGSYGGMLTSWFRLKYPHIALV  199

Query  737   ALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILS  916
             ALASS PILYF++ITP++GYYS+VTKDFK  SE+C Q IRKSW  IDK+ASKPNGLSILS
Sbjct  200   ALASSDPILYFNHITPQHGYYSIVTKDFKVKSEHCCQIIRKSWFEIDKVASKPNGLSILS  259

Query  917   KKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAG  1096
             K+FK C  L S  ELKDYL+  Y  AAQY+ P  YPVTE+C GID  PKG D+L RI  G
Sbjct  260   KRFKTCSPLNSSSELKDYLNYVYTLAAQYNSPSNYPVTEICNGIDKVPKGTDLLGRIFVG  319

Query  1097  VVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR---GDRDTMFFPAPFSMQQ  1267
             VV  +G+ +CYDP  Y  P SE  +GW WQTCSE+ MPIG+      DTMF P+PF +  
Sbjct  320   VVSYKGDNSCYDPLEYAYP-SEACIGWTWQTCSEIVMPIGKSHLSSNDTMFPPSPFILLD  378

Query  1268  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1447
             F   C+  YGV PRPHWIT  YG HDIKLV  +FGSNIIFSNGLRDPYSSAG+L D +  
Sbjct  379   FIEYCESSYGVSPRPHWITN-YGCHDIKLVFQRFGSNIIFSNGLRDPYSSAGILLDSACY  437

Query  1448  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
              L   T+  SHCLDI  A K+D  +L  QRK EVEII+ WI +YY +L A+++
Sbjct  438   FLPSITKLRSHCLDILPAGKSDLSYLVAQRKIEVEIIEGWIKQYYADLYAIRK  490



>ref|XP_007150133.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
 gb|ESW22127.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
Length=440

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 323/420 (77%), Gaps = 13/420 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKH--SSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             +IPRL+P    I +  +S H  ++   K  + + +TFYY Q LDHFNY P+SY TF QRY
Sbjct  30    EIPRLSP----IPRWDTSLHHPATSDAKTYADNIQTFYYEQVLDHFNYRPESYKTFLQRY  85

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++ KYWGGA S+SPIFA+LGAE PID+ P+ I FLTDNA  F ALLVYIEHRYYGKS+P
Sbjct  86    LINFKYWGGANSSSPIFAYLGAEEPIDNSPEGIAFLTDNAASFNALLVYIEHRYYGKSVP  145

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQALADYA VL+++K    A +SP+IV GGSYGGMLASWFR
Sbjct  146   FGSREEALQNASTIGYFNSAQALADYASVLIHIKKTLHAPNSPVIVIGGSYGGMLASWFR  205

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ +GALASSAPILYFD+ITP++GY+ +V++ F+EVSE CYQTI KSWS ID+ AS
Sbjct  206   LKYPHITIGALASSAPILYFDDITPQDGYFYVVSRSFREVSETCYQTILKSWSEIDRTAS  265

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             +P+G ++LS++F  C+ L    ELK+YL+S Y +AAQY+ P + PV+ +CGGID    G+
Sbjct  266   QPSGKTLLSQRFNTCRPLNESLELKEYLESMYASAAQYNDPARNPVSVICGGIDRGSFGS  325

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L +I+AGVV L GN TC      N PT  SET +GWRWQTCSEM +PIG G+ ++MF 
Sbjct  326   DVLSKIYAGVVALRGNTTCK----VNAPTIVSETTLGWRWQTCSEMVIPIGIGN-NSMFQ  380

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P PFS + F+  C   YGV PRPHW+TTYYGGH+IKL+L KFGSNIIF NGLRDPYSS G
Sbjct  381   PQPFSFKSFANGCKKLYGVSPRPHWVTTYYGGHNIKLILQKFGSNIIFYNGLRDPYSSGG  440



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/445 (57%), Positives = 319/445 (72%), Gaps = 4/445 (1%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             L   F T++Y QTLDHFNY P+SY TF+QRYI++S+YWGGA S+SPIF + G E+ I   
Sbjct  44    LLPEFVTYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAV  103

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  616
               + GF+ + A RF  LL+YIEHRYYG S+PFG+ +EA +N +T GYF S QALADYAE+
Sbjct  104   AAFAGFIVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAEL  163

Query  617   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  796
             +  LK    A++ P+I  GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP N Y
Sbjct  164   ITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPGNAY  223

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             + +VTKDF+E SE+CY TIR SWS IDK+A++PNGL+ LS+ F  C+ L S  ELK YL 
Sbjct  224   HVIVTKDFRETSESCYSTIRDSWSEIDKVAAEPNGLANLSQIFMTCEPLNSSQELKYYLA  283

Query  977   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1156
               Y  +AQ D PP YPV +VC  IDGAP+G DI+ R+ AG+    G   C+    + P  
Sbjct  284   LCYVVSAQNDNPPAYPVKKVCDAIDGAPEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSN  342

Query  1157  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1336
                   W WQTC+EM MPIG G  DTMF   PF +   ++ C D +GV PRPHWITT +G
Sbjct  343   RSE---WTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWITTEFG  399

Query  1337  GHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDP  1516
             GHDIK V+  F SNIIFSNGLRDPYS+ GVL+DISD+V+A+YT  G+HCLD+   + TDP
Sbjct  400   GHDIKSVVGNFASNIIFSNGLRDPYSAGGVLQDISDSVVAIYTDKGAHCLDLSTPTATDP  459

Query  1517  DWLTEQRKKEVEIIQSWITKYYVEL  1591
             DWL  Q++KEV+II  W+ +Y   L
Sbjct  460   DWLVSQQEKEVKIIGLWLAEYNARL  484



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 340/476 (71%), Gaps = 12/476 (3%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSS  361
             PR    + + ++R ++   S    P    F   YY QTLDHFNY P+SY TF+QRYI++ 
Sbjct  25    PRKLAKFSTNVKRFAASGDSFGLPP---EFEIHYYTQTLDHFNYKPESYDTFQQRYILNY  81

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKY-IGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             KYWGGA ++SPIF + G E    DD  Y +  +TD A RFK LL+YIEHRYYG+S+PFG+
Sbjct  82    KYWGGANNSSPIFVYTGEE----DDVTYDVDAITDLAARFKGLLLYIEHRYYGESMPFGS  137

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              ++A  N +T GYF+S QALADYA+V+  +K    A++ P I  G SYGGMLASWFRLKY
Sbjct  138   EDQAFQNSSTLGYFSSEQALADYAQVVTDVKKNLSAENCPAIAVGASYGGMLASWFRLKY  197

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+ +GALASS+PILYFD+ITP+NGY+ +VTKDFKE SE+CY TI +SW  ID++A++PN
Sbjct  198   PHIVIGALASSSPILYFDDITPQNGYHVVVTKDFKETSESCYNTIIQSWPEIDRVAAEPN  257

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GL  LS KF  C+ L S  ELKD L  +Y +AAQYD PP YPV  +C  IDGAP+G DIL
Sbjct  258   GLLTLSNKFNTCRTLNSSKELKDRLAISYISAAQYDNPPYYPVQNICHAIDGAPEGTDIL  317

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1258
              R+ AG+    G + C +  I++   S    GW WQTC+E+ MPIG GD +TMF   PF 
Sbjct  318   GRVAAGLHRYPG-QGCVN--IFSFELSNK-SGWDWQTCTEIVMPIGYGDNETMFQAEPFD  373

Query  1259  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1438
             ++ ++RDC + +GV PRPHW+TT +GGHDIK VL  F SNIIFSNGLRDP+SS GVLEDI
Sbjct  374   LKNYTRDCVNCFGVVPRPHWVTTEFGGHDIKTVLGNFASNIIFSNGLRDPWSSGGVLEDI  433

Query  1439  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             SD+V+A++T  G+HC D++ +S  DP WL EQR+KEV+II  WI +YY +L   +R
Sbjct  434   SDSVVAIHTEYGAHCADLFPSSPDDPVWLVEQREKEVKIIAVWIAEYYAKLSTKER  489



>ref|XP_002874100.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50359.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/441 (59%), Positives = 328/441 (74%), Gaps = 9/441 (2%)
 Frame = +2

Query  278   FYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFL  457
             F++ QTLDHF Y P SY  F+QRY V+SKYW G ++N+PI A+LGAES +D +   +GFL
Sbjct  57    FFFEQTLDHFTYTPGSYKKFRQRYAVNSKYWEGGKTNAPILAYLGAESSLDSELSVLGFL  116

Query  458   TDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNK  637
              DNAP FKAL+VYIEHR+YG+++PFG+ EE + N  T GY N+AQALADYA +LL++K  
Sbjct  117   KDNAPHFKALMVYIEHRFYGETMPFGSAEETLKNAKTLGYLNAAQALADYAAILLHIKET  176

Query  638   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  817
             Y A+HSP+IV GGSYGGMLA+WF+LKYPH+ALGALASSAP+LYF++  P++GY+ +VTK 
Sbjct  177   YSAKHSPVIVIGGSYGGMLAAWFKLKYPHIALGALASSAPLLYFEDTLPKHGYFYIVTKV  236

Query  818   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  997
             FKE S+ C+  IRKSW  ID+IA+KPNGLSILSKKFKLC  L    ELK YL + Y   A
Sbjct  237   FKETSQKCHNKIRKSWDEIDRIAAKPNGLSILSKKFKLCNPLNDTIELKSYLSNIYAGTA  296

Query  998   QYDQPPKYPVTEVCGGIDGAPKG--ADILDRIHAGVVGLEGNRTCYD-PQIYNPPTSETI  1168
             QY+  P Y V  +C  I+ +P    +D+LD+I AGVV   GN +CY   QI N   +   
Sbjct  297   QYNNNP-YSVASLCEAINTSPPNTKSDLLDQIFAGVVASGGNISCYGMDQITNDARA---  352

Query  1169  VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDI  1348
               W WQ+CSEM MPIG    DTMF P PF+M  F+++C+  YGV PRPHW+T Y+G  D+
Sbjct  353   --WTWQSCSEMVMPIGYEKEDTMFQPKPFNMSSFTKNCESQYGVSPRPHWVTAYFGSQDV  410

Query  1349  KLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLT  1528
             KL+  +FG+NIIFSNGL DPYS  GVLEDISDTV+A+ TR+GSHC DI   SK DP+WL 
Sbjct  411   KLIFRRFGNNIIFSNGLLDPYSVGGVLEDISDTVIAITTRDGSHCQDIVLKSKEDPEWLV  470

Query  1529  EQRKKEVEIIQSWITKYYVEL  1591
             EQR+KEV+II SWI+ Y  +L
Sbjct  471   EQREKEVKIIDSWISTYQKDL  491



>ref|XP_010034145.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=502

 Score =   532 bits (1371),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/458 (56%), Positives = 332/458 (72%), Gaps = 9/458 (2%)
 Frame = +2

Query  245   QTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESP  424
             Q    S  F+TF+Y QTLDHFNY  +SY TFKQRY+++SKYWGGA +++PIF + G E+P
Sbjct  49    QASVSSKDFQTFFYNQTLDHFNYRLESYTTFKQRYVINSKYWGGANASAPIFVFFGDEAP  108

Query  425   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALA  601
              D     +GF+T+NA  FKALLVYIEHR+YG+SIP+G T+++A+ +  TRGYF S QALA
Sbjct  109   FDTAMTEVGFMTENAAEFKALLVYIEHRFYGESIPYGWTLDKALKDANTRGYFTSVQALA  168

Query  602   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  781
             DYAE+L+YLK    A+HSP IV GGSYGGMLA+WFRLKYPHVALGALASSAPIL   +IT
Sbjct  169   DYAEILVYLKQILNAKHSPTIVIGGSYGGMLAAWFRLKYPHVALGALASSAPILASPDIT  228

Query  782   PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGEL  961
             P +  YS V K F E S +C+QTIRKSW  ID++AS+P+GL+ LS+ FK C+ L+S  +L
Sbjct  229   PRDTIYSAVAKVFLETSFSCHQTIRKSWEEIDRVASEPHGLAKLSRTFKTCRPLESSSQL  288

Query  962   KDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQI  1141
             K+YL   Y  AAQY+ P   PV  +C  I+GA    DIL +I AG+   + N TCY    
Sbjct  289   KEYLKLVYAEAAQYNDPLSRPVEVICNAINGASPRNDILGKIFAGLASADRNSTCY----  344

Query  1142  YNPPTS---ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              NPP +   +T +GW WQTCSE+ + +G    +TMF PAP  + +F   C   +G+ PR 
Sbjct  345   VNPPPTPLPQTYLGWHWQTCSEI-LFVGSITNNTMFQPAPSGLDKFVNSCKREFGIAPRQ  403

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HW++T+YGG DIKLVLH+F SNIIFSNGL+DP S  G+L++IS++V+A++T  GSHCLDI
Sbjct  404   HWVSTHYGGQDIKLVLHRFASNIIFSNGLQDPLSYGGILKNISNSVVAIHTAKGSHCLDI  463

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             + A+K DP WL +QRK EVEII+ WI  Y+ +L A  +
Sbjct  464   WPATKKDPIWLVKQRKTEVEIIRKWIATYHADLRAFGK  501



>ref|XP_009356965.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=445

 Score =   530 bits (1364),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 257/422 (61%), Positives = 315/422 (75%), Gaps = 11/422 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLS-----SHFRTFYYRQTLDHFNYGPQSYATFK  340
              IPRL+P   + +Q +      P  KPLS     + F+T YY QTLDHFN+ P S+ TF+
Sbjct  29    NIPRLSPNAGAFVQGNYFARDHP--KPLSAFDPVTEFQTIYYNQTLDHFNFRPDSFNTFQ  86

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY+++ K+WGG+  ++PIFA+LG E  ID D   IGFL++NA +F+AL ++IEHRYYG+
Sbjct  87    QRYLINFKHWGGSNISAPIFAYLGEEEAIDADLSIIGFLSENADKFQALQIFIEHRYYGQ  146

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PFG+ EE   N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV G SYGGMLAS
Sbjct  147   SVPFGSREEGFKNASTIGYFNSAQAMADYAEILIHVKKQLRAEHSPVIVIGASYGGMLAS  206

Query  701   WFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             WFRLKYPHVALGALASSAPILYF++I  PE GYYS+VTKDF+E SE CYQTI+KSWS ID
Sbjct  207   WFRLKYPHVALGALASSAPILYFEDIIPPEKGYYSIVTKDFQEASETCYQTIKKSWSEID  266

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA  1057
              IASKP GLS LS KF+ C  L    ELKDYLDS YC AAQY+ PP YPVT VCGGIDG 
Sbjct  267   DIASKPEGLSFLSNKFRTCSPLTKSSELKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGV  326

Query  1058  PKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
               G D L +I AGVV   GNR+CY  +  N   SET VGW WQTCS++ +P+G  + ++M
Sbjct  327   SSGNDTLSKIFAGVVAYYGNRSCYVNEPRN--LSETDVGWSWQTCSDLVIPMGVSN-ESM  383

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F P  F +Q++   C   YGVPPRPHW TTY+GGHDIKL L++F SNIIFSNGLRDPYSS
Sbjct  384   FPPYQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRDPYSS  443

Query  1418  AG  1423
              G
Sbjct  444   GG  445



>ref|XP_002874098.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50357.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=427

 Score =   528 bits (1361),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 317/427 (74%), Gaps = 6/427 (1%)
 Frame = +2

Query  332   TFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  511
             TF+QRY + +K+W GA++N+PI A+LG E+ ++ D    GFL+DNAP FKAL VYIEHRY
Sbjct  2     TFQQRYAIDAKHWAGAKANAPILAFLGLEASLETDLAAFGFLSDNAPHFKALKVYIEHRY  61

Query  512   YGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             YGK+IPFG+ +EAM N +T GY NSAQALADYA +LL++K KY A HSPIIV GGSYGGM
Sbjct  62    YGKTIPFGSAKEAMKNASTLGYLNSAQALADYAAILLHIKEKYSATHSPIIVVGGSYGGM  121

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY ++TK FKE ++ CY TIRKSW  
Sbjct  122   LAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYYYIITKVFKETNKRCYNTIRKSWEE  181

Query  872   IDKIASKPNGLSILSKKFKLCKG-LKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI  1048
             ID++ASKPNGL ILSKKFK C   L    +LKD+LD+ Y    QY+      VT VC  I
Sbjct  182   IDRVASKPNGLLILSKKFKTCASPLSRSFDLKDFLDTVYAETVQYND--GVWVTNVCNAI  239

Query  1049  DGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1222
             +  P  +  DILDRI AGVV L G+++CY+   Y+   +   + WRWQ CSE+ +P+G  
Sbjct  240   NANPPNRKIDILDRIFAGVVALTGSQSCYNTN-YSVQVTNNDMAWRWQCCSEIVVPVGHD  298

Query  1223  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1402
              +DTM+  +PF+M  +  DC+  YGV PRPHWITTY+G  ++KL+L +FGSNIIFSNGL 
Sbjct  299   KQDTMYQTSPFNMTSYIEDCESSYGVSPRPHWITTYFGIQNVKLILQRFGSNIIFSNGLS  358

Query  1403  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             DPYS  GVLEDISDTV+A+ T+NGSHC DI   SK DP+WL  QR+KE+++I SWI+ Y 
Sbjct  359   DPYSVGGVLEDISDTVVAITTKNGSHCQDINLKSKGDPEWLVMQREKEIKVINSWISTYQ  418

Query  1583  VELEALK  1603
              +L  L 
Sbjct  419   NDLRDLN  425



>ref|XP_006369368.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65937.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=486

 Score =   530 bits (1365),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 270/439 (62%), Positives = 334/439 (76%), Gaps = 5/439 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY  F QRY
Sbjct  46    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYNQTLDHFNYRPESYDKFPQRY  103

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIP
Sbjct  104   LINSKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIP  163

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  164   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFR  223

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  224   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  283

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G 
Sbjct  284   KPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGD  343

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D L RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P 
Sbjct  344   DTLSRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPD  400

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  401   PFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVL  460

Query  1430  EDISDTVLAVYTRNGSHCL  1486
             E+ISDTV+AV T NG H L
Sbjct  461   ENISDTVVAVKTVNGKHAL  479



>ref|XP_006424409.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
 gb|ESR37649.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
Length=521

 Score =   531 bits (1367),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 256/464 (55%), Positives = 336/464 (72%), Gaps = 23/464 (5%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F TF+Y QT+DHFNY P+S+ TF+QRY++ SK+WGG Q+  PI A++GAE PIDDD K I
Sbjct  56    FETFFYNQTIDHFNYRPESFTTFRQRYLIYSKHWGGGQA--PILAFMGAEEPIDDDLKAI  113

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GFLT+N+ R KAL+V++EHRYYG+S+PFG+  EA+NN   RGYFNSAQALADYAE+LL++
Sbjct  114   GFLTENSERLKALVVFMEHRYYGQSVPFGSRSEALNNTNNRGYFNSAQALADYAEILLHI  173

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K  + A +SP+IV GGSYGG LA+WFRLKYPH+ALGALASSAP+LY+++ITP N YYS+V
Sbjct  174   KKTHDATYSPVIVVGGSYGGELATWFRLKYPHIALGALASSAPVLYYEDITPHNAYYSIV  233

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             TK++++ SE CYQTI KSW+ I ++   P+G SILS++FK C  L++  EL+D L   Y 
Sbjct  234   TKNYRDTSETCYQTILKSWAEIQRVGELPDGASILSRQFKTCTPLRNENELRDALAGMYA  293

Query  989   TAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1165
             + +QY +PP+ P+ + C  +D A   G D L +I A V   +G+R CY  +  N   +ET
Sbjct  294   STSQYGRPPENPIEKFCSAVDRATACGNDSLCKIAAAVFAQKGDRPCYINKPKN--RTET  351

Query  1166  IVGWRWQTCSEMAMPIGRGDRDTMFFPAP-FSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
               GW WQ+CSEM +P+   D  TM  P   F++ +    C   YGVPPRP+WITTYYGGH
Sbjct  352   DEGWPWQSCSEMVVPMSI-DEKTMLRPVNLFNLTEVIDQCQQEYGVPPRPNWITTYYGGH  410

Query  1343  ---------------DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGS  1477
                            DIKL L +   NIIFSNGLRDPYS+ GVL++ISD ++A+ T NGS
Sbjct  411   LIINFGLLHFCEKLQDIKLTLQRSTGNIIFSNGLRDPYSAGGVLKNISDNIIALPTVNGS  470

Query  1478  HCLDIYGASKT-DPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             HCLDI  ++KT DPDWL +QRK EVEII+ WI KYY +L+A+ +
Sbjct  471   HCLDIVKSNKTSDPDWLVQQRKTEVEIIKGWIAKYYADLKAINK  514



>ref|XP_006485335.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=471

 Score =   528 bits (1360),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 259/443 (58%), Positives = 320/443 (72%), Gaps = 6/443 (1%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQS-NSPIFAWLGAESPIDDDPKY  445
               T+YY Q LDH NY PQSY TF  RY+++ K+WGG  +  +PI A+LG ES +DDD   
Sbjct  8     LETYYYDQILDHSNYNPQSYLTFPHRYVLNFKHWGGGGAMAAPILAYLGEESSLDDDHGG  67

Query  446   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  625
             IG+LTDNA RFKAL VYIEHR+YGKS+PF   ++A+ N T RGYFNSAQALADYAE+LL+
Sbjct  68    IGWLTDNAHRFKALEVYIEHRFYGKSVPFVPSKDALKNATLRGYFNSAQALADYAEILLH  127

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             +K    A+ SP IV G SYGGML +WFRLKYP +ALGA+ASSAPILYFDNITP N +Y L
Sbjct  128   IKKNLSAEMSPTIVVGASYGGMLVAWFRLKYPDIALGAVASSAPILYFDNITPSNAFYDL  187

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             V+KDF+E SE+CY+TI++SW    K   K NGL+ LSKKFK CK LK   ELKDYL+S Y
Sbjct  188   VSKDFREASESCYKTIKQSWLKSIKPLLKKNGLTFLSKKFKTCKPLKDVSELKDYLESMY  247

Query  986   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE-  1162
              +AAQYD P +YPV + C GIDGA +G D L RI +G+V L G  +CYD  + + P    
Sbjct  248   TSAAQYDDPQEYPVNKACNGIDGASEGTDTLGRIFSGIVALRGESSCYDVLMNSSPMKHW  307

Query  1163  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
             T  G      SEM  PI  G  DT F   PF+  +    C+  YGV PRPHWITTY  GH
Sbjct  308   TPAG----AGSEMVSPIKIGKNDTTFQANPFNPTESMDSCNKSYGVVPRPHWITTYCSGH  363

Query  1343  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1522
             DI++VL++FGSNIIFSNGLR+PYSSAGVLEDIS++++ V TRNGS+CLDI   ++ DP W
Sbjct  364   DIRMVLNRFGSNIIFSNGLRNPYSSAGVLEDISNSIIVVTTRNGSYCLDIQPETEDDPKW  423

Query  1523  LTEQRKKEVEIIQSWITKYYVEL  1591
             +  QRK EV+++  WI KY+ +L
Sbjct  424   VVVQRKIEVDVVHDWILKYFADL  446



>gb|KDO44737.1| hypothetical protein CISIN_1g038117mg [Citrus sinensis]
Length=500

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 345/485 (71%), Gaps = 25/485 (5%)
 Frame = +2

Query  182   PRLTPLYES-ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             PRL  +  S IL++  S H           F TF+Y QT+DHF+YGP+SY TF QRY+++
Sbjct  31    PRLGRIRRSRILEQKDSNHG----------FETFFYNQTIDHFSYGPESYQTFPQRYVIN  80

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             SK+WGG   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+
Sbjct  81    SKFWGGG--NSPILAFLGAEAPIDDNIQLSGFTYENAHQFKALIVILEHRYYGKSVPFGS  138

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
              + A+ N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKY
Sbjct  139   RKAALKNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKY  198

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PHV +G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+
Sbjct  199   PHVVIGSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPD  258

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADI  1075
             GL+ILSKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DI
Sbjct  259   GLAILSKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAPNCGDDI  318

Query  1076  LDRIHAGVVGLE------GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
             L +I AGVV  +       N  CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M
Sbjct  319   LCKIAAGVVEADSLEYDGNNSRCYINE--DRTGDESDEGWEWQSCSEMVVPMGK-DKNSM  375

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             + P P+++ ++ ++C + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S 
Sbjct  376   YQPEPWNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSR  435

Query  1418  AGVLE--DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              G ++     D   +     GSHCLD+  A K+DPDWL +QRK EV+I+Q WIT+YY + 
Sbjct  436   GGWVKTYHFFDLSFSQDLNLGSHCLDLDEAKKSDPDWLVQQRKTEVKIMQGWITQYYDDF  495

Query  1592  EALKR  1606
             +A+ +
Sbjct  496   KAINK  500



>emb|CBI17113.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   529 bits (1363),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 324/461 (70%), Gaps = 9/461 (2%)
 Frame = +2

Query  212   LQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNS  391
             L   S    S     LSS F T+YY QTLDHFNY P+SY  F+QRY+++S YWGGA S+S
Sbjct  31    LGMVSKSMKSALNAELSSDFVTYYYNQTLDHFNYRPESYTNFQQRYLINSAYWGGANSSS  90

Query  392   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVY---IEHRYYGKSIPFGTMEEAMNNE  562
             PIF + G E  I     + GF+ D A RFK LL+Y   ++HRYYG S+PF + + A NN 
Sbjct  91    PIFVYTGDEGSITGAAAFAGFMVDLASRFKGLLLYYLILQHRYYGDSVPFRSKDIAFNNT  150

Query  563   TTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGAL  742
             +T GYF+S QALADYAE++  LK    A++ P+I  GGSYGGMLASWFRLKYPHV +GAL
Sbjct  151   STLGYFSSTQALADYAELITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHVVIGAL  210

Query  743   ASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  922
             ASSAPILYFD+ITP NGY S+VTKDF+E SE CY TI++SWS ID++A +PNGL+ LS+ 
Sbjct  211   ASSAPILYFDDITPHNGYDSIVTKDFRETSETCYTTIKQSWSEIDEVAGQPNGLANLSQI  270

Query  923   FKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVV  1102
             F+ C+ L S  +LK YL+ TY  +AQYD PP + V+++C  IDGAP+G  IL R+  GV 
Sbjct  271   FRTCEPLNSSQQLKLYLEYTYEASAQYDNPPAHYVSDICNAIDGAPEGTSILGRVAEGVN  330

Query  1103  GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDC  1282
                G   C+    + P     + GW WQTC+EM MP GRG+ DTMF  +PF +  +++ C
Sbjct  331   ASAG-PPCHRIYDFQP---SNMSGWLWQTCTEMVMPFGRGENDTMFQASPFDLNNYTKTC  386

Query  1283  DDYYG--VPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLA  1456
              D +G  V PRPHWITT +GGH+IK VL  F SNIIFSNGLRDPYS  GVL+DIS++V+A
Sbjct  387   QDIFGASVTPRPHWITTEFGGHNIKSVLGNFASNIIFSNGLRDPYSIGGVLQDISESVVA  446

Query  1457  VYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1579
             VYT  G+HCLD+     +DPDWL  QR KE++I+  W+ +Y
Sbjct  447   VYTLKGAHCLDLGTPMPSDPDWLVAQRDKEIKIVALWLAEY  487


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  824  EVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  958
            + SE+CY+TI++SW  I+K+AS+PNGL ILSKKF  CKG +   E
Sbjct  530  QASESCYKTIQESWPEINKVASEPNGLLILSKKFGTCKGEQKTQE  574



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 326/461 (71%), Gaps = 10/461 (2%)
 Frame = +2

Query  212   LQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNS  391
             ++R ++   S Q  P    +   YY QTLDHFNY PQSYATF+QRYI++ KYWGGA ++S
Sbjct  37    VKRFAASEFSYQLPP---EYEIHYYTQTLDHFNYNPQSYATFQQRYILNFKYWGGANTSS  93

Query  392   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  571
             PIF + G E  +  D   I  L   A RFKALL+YIEHRYYG+S+PFG+ ++A  N +T 
Sbjct  94    PIFVYTGEEVDVTYDVDTILHL---AARFKALLLYIEHRYYGESMPFGSEDQAFQNSSTL  150

Query  572   GYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASS  751
             GY +S QALADYA+V+  +K K  A++ P I  G SYGGMLA+WFRLKYPH+ +G+LASS
Sbjct  151   GYLSSEQALADYAQVVTDVKKKLSAENCPAIAVGASYGGMLAAWFRLKYPHIVIGSLASS  210

Query  752   APILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  931
             +PILYFD+ITP+NGY+ +VTKD+++ SE+CY TI++SWS ID++A++PNGL  LS  F  
Sbjct  211   SPILYFDDITPQNGYHVVVTKDYRDTSESCYNTIKQSWSEIDRVAAQPNGLLTLSNMFNT  270

Query  932   CKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVG-L  1108
             C  L S  EL++YL+  Y +AAQYD PP  PV   C GIDGAP G DIL RI AG+   +
Sbjct  271   CSPLNSSTELREYLEILYVSAAQYDNPPYNPVQNTCRGIDGAPPGTDILGRIVAGLKSRI  330

Query  1109  EGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDD  1288
                 +CYD   ++         W WQTC+EM  PIG G  +TMF P+PF +  ++  C  
Sbjct  331   PSWSSCYDVPTWDLSNKS---AWDWQTCTEMVFPIGYGYNETMFQPSPFDINNYTEACVQ  387

Query  1289  YYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTR  1468
              +G+ PRP W TT +GGHDIK VL  F SNIIF+NGLRDP+S+ GVLEDISDTV+AVYT 
Sbjct  388   VFGIKPRPQWATTEFGGHDIKTVLGNFASNIIFANGLRDPWSAGGVLEDISDTVVAVYTE  447

Query  1469  NGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              G+HCLD+Y  +  DPDWL EQR KE++II +WI +YY +L
Sbjct  448   YGAHCLDLYPPTPNDPDWLVEQRDKEIKIIAAWIAEYYAKL  488



>ref|XP_006369365.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 ref|XP_006369366.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65934.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65935.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
Length=474

 Score =   523 bits (1346),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 267/434 (62%), Positives = 331/434 (76%), Gaps = 5/434 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY  F QRY
Sbjct  46    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYNQTLDHFNYRPESYDKFPQRY  103

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIP
Sbjct  104   LINSKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIP  163

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  164   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFR  223

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  224   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  283

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G 
Sbjct  284   KPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGD  343

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D L RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P 
Sbjct  344   DTLSRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPD  400

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
             PF ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  401   PFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVL  460

Query  1430  EDISDTVLAVYTRN  1471
             E+ISDTV+AV T N
Sbjct  461   ENISDTVVAVKTVN  474



>ref|XP_006424411.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
 gb|ESR37651.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
Length=418

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 257/396 (65%), Positives = 303/396 (77%), Gaps = 17/396 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
              IPRL+P   +ILQ      ++     +S  F+TFYY QTLDHFNY P+SY+TF+QRY++
Sbjct  29    NIPRLSPTRGTILQNPEILSAT-----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYVI  83

Query  356   SSKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             + KYWGG        PIF +LGAE P+D D   IGFLTDNA RF ALLVYIEHRYYGKSI
Sbjct  84    NFKYWGGGAGADANAPIFVYLGAEGPLDGDISIIGFLTDNAARFNALLVYIEHRYYGKSI  143

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GYFNSAQA+ DYAE+LLY+K K+ A+HSP+IV GGSYGGMLA+WF
Sbjct  144   PFGSREEALKNASTLGYFNSAQAVTDYAEILLYIKEKFNARHSPVIVIGGSYGGMLATWF  203

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPHVALGALASSAPILYFD+ITP NGYYS+VT+DF+E SE CY+TI KSW+ I+K+A
Sbjct  204   RLKYPHVALGALASSAPILYFDDITPRNGYYSIVTRDFREASETCYETIMKSWAEIEKVA  263

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             SKP+GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G
Sbjct  264   SKPDGLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALG  323

Query  1067  A--DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDT  1234
                DIL +I AGVV  EGN +CY     NPPT  SET VGWRWQTCSEM +PIG  D  T
Sbjct  324   TDNDILSKIFAGVVAHEGNMSCY----VNPPTIESETTVGWRWQTCSEMVIPIGT-DNTT  378

Query  1235  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
             MF PAPF++  F   C+  YGV PRPHW+T YYGG+
Sbjct  379   MFQPAPFNLSSFIDGCESLYGVSPRPHWVTAYYGGY  414



>gb|KCW50727.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=458

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 250/393 (64%), Positives = 306/393 (78%), Gaps = 9/393 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF++ QTLDHFNY P+SY TF+QRY++ S++WGGA S++PIF +LGAESPID  
Sbjct  48    IADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWGGANSSAPIFVYLGAESPIDGS  107

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
             P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA++    RGYF+SAQALADYA 
Sbjct  108   PTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEALHETNIRGYFSSAQALADYAA  167

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ +GALASSAPILYFD+ITP++ 
Sbjct  168   IIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLTVGALASSAPILYFDDITPQDA  227

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S LS+ FK CK L+S  ELK+YL
Sbjct  228   YYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSNLSEMFKTCKPLESGDELKNYL  287

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNP  1150
              S Y  AAQYD PP+YPVT +C GIDGA    + IL +I AGVV  +GN  CY     NP
Sbjct  288   MSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKIFAGVVAYKGNSACY----VNP  343

Query  1151  PT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             PT  S+T +GW WQ CSEM MPIG  + ++MF   PF++  F  +C+D YGV PRPHWIT
Sbjct  344   PTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNLSSFIDECNDQYGVTPRPHWIT  402

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             TYYGGHDI+L+L +FGSNIIFSNGLRDPYSSAG
Sbjct  403   TYYGGHDIELILLRFGSNIIFSNGLRDPYSSAG  435



>emb|CAN64373.1| hypothetical protein VITISV_018663 [Vitis vinifera]
Length=702

 Score =   526 bits (1356),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 246/394 (62%), Positives = 305/394 (77%), Gaps = 12/394 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHF----RTFYYRQTLDHFNYGPQSYATFKQR  346
             +PRL PL   IL+       +P+   +S  F    +TF+Y QTLDHFNY P+SY TF+QR
Sbjct  35    VPRLGPLSRGILR-------NPEPAAVSESFYKDLKTFFYAQTLDHFNYRPESYKTFRQR  87

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++ K+WGGA++ +PIFA+LGAE+P+D D   IGF+ DNA RF ALL+YIEHRYYGKSI
Sbjct  88    YVMNFKHWGGAKAGAPIFAYLGAEAPLDGDLVNIGFVNDNAARFNALLIYIEHRYYGKSI  147

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ + A+ N +T GYFNSAQA+ADYA VL+++K +  AQ+SP+IV GGSYGGMLASWF
Sbjct  148   PFGSTKVALKNASTLGYFNSAQAIADYAAVLMHVKKRLHAQNSPVIVIGGSYGGMLASWF  207

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+ALGALASSAPILYFD I PE GYYS+VTKDF+E SE+CY+TIR+SWS ID+IA
Sbjct  208   RLKYPHIALGALASSAPILYFDEIAPEIGYYSIVTKDFREASESCYRTIRRSWSEIDRIA  267

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  1066
             SKPNGLSILSK+FK C  L+S  ELKDYLDS Y  AAQY++PP YPVT VC GI+GA K 
Sbjct  268   SKPNGLSILSKRFKTCAHLESSFELKDYLDSIYAEAAQYNEPPTYPVTVVCKGINGASKR  327

Query  1067  ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1246
              D L RI  G+V + G R+CYD + +N PT ET +GWRWQ CSEM +PIG    DTMF P
Sbjct  328   TDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-ETYLGWRWQKCSEMVLPIGHATNDTMFQP  386

Query  1247  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDI  1348
              PF++ +F ++C+  Y V PRPHW+TTYYGG  +
Sbjct  387   EPFNLNRFIKECNSLYSVSPRPHWVTTYYGGRTL  420



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   518 bits (1335),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 330/480 (69%), Gaps = 8/480 (2%)
 Frame = +2

Query  167   PLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             P   +P++  + + I  +      +     +    +  YY QTLDHFNY PQSY  FKQ+
Sbjct  23    PTFAMPKMGRILQKIQHKHDVYSFTTTKTSIDKDLKILYYPQTLDHFNYQPQSYMIFKQK  82

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y++ SKYWGGA+ NSPI  +LG E P+ DD      L D A + KAL+V IEHRYYG+S 
Sbjct  83    YMIYSKYWGGAKVNSPILVYLGDEGPMYDDQIDALILPDYAAKLKALIVIIEHRYYGESK  142

Query  527   PFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             PFG +MEE + N + RGYFNSAQA+ADYAEV+L++K    A +SP+IV GGSYGGMLASW
Sbjct  143   PFGMSMEEIVKNASIRGYFNSAQAIADYAEVILHVKETMNAHYSPLIVVGGSYGGMLASW  202

Query  704   FRLKYPHVALGALASSAPILYFDN-ITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             FRLKYPH+ALGALASSAP+LYFD+ I+P +GY  +VTKDFKE SE+CY+TI+ SWS IDK
Sbjct  203   FRLKYPHIALGALASSAPVLYFDDMISPNHGYNYVVTKDFKEASESCYRTIKNSWSEIDK  262

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  1060
             I S  +GL+ LSKKF  C  L     LK++L S Y + AQY      P T +C  ID   
Sbjct  263   IGSSGDGLAYLSKKFNTCVHLADTSALKNFLQSLYDSTAQYGNLETNPST-ICKAIDEGM  321

Query  1061  KGADILDRIHAGVVGL--EGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDT  1234
             K  DI+ RI+AGV+      +  C D   +     E+IVG+ WQTCSEM MPIG   + +
Sbjct  322   KTTDIVSRIYAGVLDYFNSTHHDCVDTNYFQ--IGESIVGYDWQTCSEMVMPIGTS-KWS  378

Query  1235  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1414
             MF P PF+++ F +DC + Y V PRPHWIT+YYGGHD+KL+  +FGSNIIFSNGL+DPYS
Sbjct  379   MFPPQPFNLRDFIQDCKNKYNVMPRPHWITSYYGGHDMKLIFGRFGSNIIFSNGLQDPYS  438

Query  1415  SAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             SAGVL ++SD+++AVY   GSHC+DI  A K DP+WL   R  E+EII  WI KYY +L+
Sbjct  439   SAGVLYNLSDSIIAVYATQGSHCVDIQHAKKDDPEWLINMRNTEIEIISGWIRKYYDDLK  498



>ref|XP_010493397.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X3 [Camelina 
sativa]
Length=439

 Score =   516 bits (1328),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 236/390 (61%), Positives = 296/390 (76%), Gaps = 3/390 (1%)
 Frame = +2

Query  260   SSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  439
             +S  + FY+ QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG ES +D D 
Sbjct  51    ASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDL  110

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQALADYA +L
Sbjct  111   SAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYATIL  170

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             L++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY
Sbjct  171   LHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYY  230

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
              +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L     +KD+L++
Sbjct  231   YIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGSSNIKDFLNT  290

Query  980   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
              Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTCYDP ++  P
Sbjct  291   IYAESVQYNRGPSYWVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTCYDPNMFAQP  350

Query  1154  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYY  1333
             T+  ++ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPPR HWITTY+
Sbjct  351   TNN-VIAWRWQSCSEIVMPVGYDKQDTMFPTAPFNMTSYIEGCESNYGVPPRQHWITTYF  409

Query  1334  GGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             G  D+KL+L KFGSNIIFSNGL DPYS  G
Sbjct  410   GIQDVKLILRKFGSNIIFSNGLSDPYSVGG  439



>gb|KCW50433.1| hypothetical protein EUGRSUZ_J00172, partial [Eucalyptus grandis]
Length=516

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/459 (55%), Positives = 329/459 (72%), Gaps = 10/459 (2%)
 Frame = +2

Query  245   QTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESP  424
             Q    S  F+TF+Y QTLDHFNY  +SY TFKQRY+++SKYWGGA +++PIF + G E+P
Sbjct  62    QASVSSKDFQTFFYNQTLDHFNYRLESYTTFKQRYVINSKYWGGANASAPIFVFFGDEAP  121

Query  425   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALA  601
              D     +GF+T+NA  FKALLVYIEHR+YG+SIP+G T+++A+ +  TRGYF S QALA
Sbjct  122   FDTAMTEVGFMTENAAEFKALLVYIEHRFYGESIPYGWTLDKALKDANTRGYFTSVQALA  181

Query  602   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  781
             DYAE+L+YLK    A+HSP IV GGSYGGMLA+WFRLKYPHVALGALASSAPIL   +IT
Sbjct  182   DYAEILVYLKQILNAKHSPTIVIGGSYGGMLAAWFRLKYPHVALGALASSAPILASPDIT  241

Query  782   PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGEL  961
             P +  YS V K F E S +C+QTIRKSW  ID++AS+P+GL+ LS+ FK C+ L+S  +L
Sbjct  242   PRDTIYSAVAKVFLETSFSCHQTIRKSWEEIDRVASEPHGLAKLSRTFKTCRPLESSSQL  301

Query  962   KDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQI  1141
             K+YL   Y  AAQY+ P   PV  +C  I+GA    DIL +I AG+   + N TCY    
Sbjct  302   KEYLKLVYAEAAQYNDPLSRPVEVICNAINGASPRNDILGKIFAGLASADRNSTCY----  357

Query  1142  YNPPTS---ETIVG-WRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
              NPP +   +T +G    QTCSE+   +G    +TMF PAP  + +F   C   +G+ PR
Sbjct  358   VNPPPTPLPQTYLGCLGLQTCSEILF-VGSITNNTMFQPAPSGLDKFVNSCKREFGIAPR  416

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
              HW++T+YGG DIKLVLH+F SNIIFSNGL+DP S  G+L++IS++V+A++T  GSHCLD
Sbjct  417   QHWVSTHYGGQDIKLVLHRFASNIIFSNGLQDPLSYGGILKNISNSVVAIHTAKGSHCLD  476

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
             I+ A+K DP WL +QRK EVEII+ WI  Y+ +L A  +
Sbjct  477   IWPATKKDPIWLVKQRKTEVEIIRKWIATYHADLRAFGK  515



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/455 (53%), Positives = 319/455 (70%), Gaps = 3/455 (1%)
 Frame = +2

Query  230   KHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWL  409
             + S      +S  F    Y Q+LDHFN+ P+SYATF+QRYI++ KYWGGA ++SPIF +L
Sbjct  39    ESSMASVNAISPEFEVHNYTQSLDHFNFKPESYATFQQRYILNYKYWGGANTSSPIFVYL  98

Query  410   GAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSA  589
             GAE  ID        + D A RFK LL+YIEHRYYG S+PFG+ +EA  N +T GY +S 
Sbjct  99    GAE--IDVTQNLDLSIVDLAARFKGLLLYIEHRYYGVSMPFGSEDEAFQNSSTFGYLSSE  156

Query  590   QALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYF  769
             QALADYA+V++ +K    A++ P I  GGSYGGMLASWFRLKYPH+ +G+LASSAPILYF
Sbjct  157   QALADYAQVIVDVKKDLSAENCPAIAIGGSYGGMLASWFRLKYPHIVIGSLASSAPILYF  216

Query  770   DNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKS  949
             D+ITP+NGY+ +V+KDF++ SE+CY TI++SW+ ID++AS+ NGL  LS  F  C  L S
Sbjct  217   DDITPQNGYHVIVSKDFRDTSESCYNTIQQSWAEIDRVASETNGLLNLSNIFTTCSPLNS  276

Query  950   PGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCY  1129
               +LK Y +  Y  AAQ D PP YPV ++C  IDGAP G DIL R+ AGV       +C+
Sbjct  277   SKDLKVYTEIAYMWAAQLDNPPSYPVNKICSAIDGAPSGTDILGRVAAGVNASVFGNSCH  336

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
                  +  + ++   W WQTC+EM  P+G G+ +TMF   P  +  ++++C D +G+ PR
Sbjct  337   SAS-GSGLSRKSASAWEWQTCTEMVFPMGYGENETMFQSDPLDINNYTKECVDVFGIKPR  395

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHWITT +GGHDIK VL  F SNIIFSNGLRDP+S+ GVLEDISD+V+A+YT  GSHCLD
Sbjct  396   PHWITTEFGGHDIKTVLGNFASNIIFSNGLRDPWSAGGVLEDISDSVVALYTEQGSHCLD  455

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             +Y  + +DPDWL   R KE +II  W+ +YY +L 
Sbjct  456   LYPPTSSDPDWLLALRDKENKIIAYWLAEYYAKLN  490



>emb|CDY09174.1| BnaA02g06000D [Brassica napus]
Length=502

 Score =   512 bits (1319),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 339/486 (70%), Gaps = 15/486 (3%)
 Frame = +2

Query  188   LTPLYESILQRSSSKHS-SPQTKPL--------SSHFRTFYYRQTLDHFNYGPQSYATFK  340
             L+P + S+     ++   SP T+P         +S  + FYY Q LDHF++ P+SY TF+
Sbjct  16    LSPYFVSLTHSKVARLGISPTTRPTETVLEKTETSDLKFFYYDQILDHFSFTPESYQTFQ  75

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY V SK+W GA +++PI A+LG E+ ++ D   +GF  DN PR KAL VYIEHRYYG 
Sbjct  76    QRYAVDSKHWAGANASAPILAFLGEEAWLEVDLHDVGFFQDNGPRLKALCVYIEHRYYGM  135

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PFG+ +EA+ N TT GY N+AQALADYA +L+++K KY A+HSPIIV G SYGGMLA+
Sbjct  136   SMPFGSAKEALKNATTLGYLNAAQALADYAAILVHVKEKYSAKHSPIIVVGASYGGMLAA  195

Query  701   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             WFRLKYPH+ALGALASSAP+LYF++  P+ GYY ++T  FKE SE CY+TIRKSW  ID+
Sbjct  196   WFRLKYPHIALGALASSAPLLYFEDTRPKYGYYHVITNVFKETSERCYKTIRKSWREIDR  255

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  1060
             +A+K NGL ILSKKF+ C  L    ++KD+LDS Y  + Q+++ P   V  +C  ID  P
Sbjct  256   VAAKSNGLLILSKKFRTCAPLSRSFDIKDFLDSIYAESVQFNRNPGDWVATLCNAIDNPP  315

Query  1061  KGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCS----EMAMPIGRGD  1225
                + +LDRI AG+V   GN++CYD  ++  P+++ ++ W WQ C+    E+ MPIG   
Sbjct  316   NRKNYVLDRIFAGIVAYIGNQSCYDTGLFIQPSND-VIAWSWQACTLHFGEIMMPIGHDK  374

Query  1226  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1405
              DTMF  APF+M     +C   YGV PRPHW+TTY+G  D+KL+L +FGSNIIFSNGL D
Sbjct  375   HDTMFQTAPFNMTSAIDNCKSSYGVSPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLAD  434

Query  1406  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1585
             PYS  GVLED+SD+++A+ T  G+H  D+    K DP+WL  QR+KE++II+SWI+ Y  
Sbjct  435   PYSVGGVLEDVSDSIVAIKTLKGTHSQDLSTRRKDDPEWLVMQREKEIKIIESWISTYQK  494

Query  1586  ELEALK  1603
             +L  L 
Sbjct  495   DLRGLN  500



>ref|XP_004293172.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=522

 Score =   513 bits (1320),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 256/488 (52%), Positives = 336/488 (69%), Gaps = 16/488 (3%)
 Frame = +2

Query  164   PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             PPL KIPRL     SILQR  +  +   +  +   FRT++Y QTLDHF+Y P SY TF Q
Sbjct  34    PPLRKIPRL-----SILQRPITFRNHSNSVAVRHRFRTYFYAQTLDHFSYEPASYTTFLQ  88

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+VSS +W GA + +PIF +LG E  +++    IGFLTDNA +F AL+VY+EHRYYGKS
Sbjct  89    RYMVSSMHWRGALAAAPIFVYLGGEESLEESIGSIGFLTDNAQKFGALMVYLEHRYYGKS  148

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IP     + + N T+ GY NS QALADYA+++L+LK    A+ SP+IV GGSYGGMLA+W
Sbjct  149   IPSRDNMQDIYNTTSLGYLNSGQALADYADIILHLKRNLSAEASPVIVIGGSYGGMLAAW  208

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK-  880
             FRLKYPH+A+GALASSAP+LYFD+ITP +G++S+V+ +F+E SE+CY TI+KSWS ID+ 
Sbjct  209   FRLKYPHIAMGALASSAPLLYFDDITPSDGFHSVVSDNFREASESCYNTIKKSWSEIDRM  268

Query  881   IASKPNGLSILSKKFKLCKGLKSPG--ELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI-D  1051
             +  + NGL +L++KF+ C+ L+     ELK YL++ Y TA+QYD PP YPV+++C  I +
Sbjct  269   VLDQDNGLDMLTEKFRTCEPLEDGDELELKTYLENLYITASQYDDPPTYPVSQICNSIEE  328

Query  1052  GAPKGADILDRIHAGVVGL----EGNRTCYDPQIYNPPTSETIVG--WRWQTCSEMAMPI  1213
              A +G D +DRI + V  L    E +  C +      P+ +T+ G  W WQ C+E+ MPI
Sbjct  329   AAARGDDTIDRIASAVNNLTRPGENSGRCLELSSELRPSDDTVNGLNWLWQACTELLMPI  388

Query  1214  GRGDRDTMFFPAPFSMQQFSRDCDDYY-GVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1390
             GR   +TMF   PF +  +SR C   Y G   RP+WITTYYGGH I++ L KF SNIIFS
Sbjct  389   GRETNETMFQAEPFDVDSYSRMCRQLYQGSRLRPNWITTYYGGHHIRMTLEKFASNIIFS  448

Query  1391  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWI  1570
             NG RDP+S+AGVL +IS +V+AV T  GSHCLDI  A   DP WL  QR  E+ II  WI
Sbjct  449   NGRRDPFSAAGVLTNISPSVVAVTTSQGSHCLDILPARINDPRWLVLQRNIELGIIAGWI  508

Query  1571  TKYYVELE  1594
               YY +L 
Sbjct  509   RNYYNDLR  516



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   508 bits (1309),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 323/450 (72%), Gaps = 17/450 (4%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESP----  424
             L S +   YY QTLDHFNY P+SYATF+QRYI++ KYWGGA ++SPIF + GAE      
Sbjct  49    LPSDYEIHYYTQTLDHFNYKPESYATFQQRYILNFKYWGGANTSSPIFLYTGAEENLIYH  108

Query  425   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALAD  604
             +D        + + A RF+ LL+YIEHRYYG+S+PFG+ E+A+ N +T GY +S QALAD
Sbjct  109   VDRS------IVELAARFRGLLLYIEHRYYGESMPFGSEEQALQNSSTLGYLSSEQALAD  162

Query  605   YAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP  784
             YA+V+  +K    A++ P I  G SYGGMLA+WFRLKYPH+ +G+LASS+PILYFD+ITP
Sbjct  163   YAQVITDVKKNLSAENCPAIAVGASYGGMLAAWFRLKYPHIVIGSLASSSPILYFDDITP  222

Query  785   ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELK  964
             +NGY+ L  +    + E+C+ TI++SWS ID++A++PNGL  LS  F  C+ L S  E K
Sbjct  223   QNGYHVLSRRI---LDESCHNTIKQSWSEIDRVAAQPNGLLTLSNMFNTCRPLVSSAEFK  279

Query  965   DYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVG-LEGNRTCYDPQI  1141
             +YL+  Y TAAQYD PP  PV   C GIDGAP G DIL RI  G+ G + G  +C+D  I
Sbjct  280   EYLELLYITAAQYDNPPDNPVQSTCRGIDGAPPGTDILGRIVEGLNGRIPGWSSCHD--I  337

Query  1142  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1321
             +    S     W WQTC+EM  PIG GD +TMF P+PF +  + ++C   +G+ PRPHW+
Sbjct  338   FTLELSNN-GSWDWQTCTEMVFPIGYGDNETMFQPSPFDINNYKKECLQVFGIKPRPHWV  396

Query  1322  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1501
             TT +GGHDIK VL  F SNIIF+NGLRDP+S+ GVLEDISD+++AVYT +G+HCLD+Y +
Sbjct  397   TTEFGGHDIKTVLGNFASNIIFANGLRDPWSAGGVLEDISDSIVAVYTEHGAHCLDLYPS  456

Query  1502  SKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  DP+WL EQR+KE++II +W+ +YY +L
Sbjct  457   TPDDPNWLVEQREKEIKIIAAWLAEYYAKL  486



>ref|XP_006286678.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
 gb|EOA19576.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
Length=424

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 244/424 (58%), Positives = 304/424 (72%), Gaps = 6/424 (1%)
 Frame = +2

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+QRY V+SKYW G +SN+PI A+LGAES +D D   IGF+ DNAP FKAL+VYIEHR+Y
Sbjct  3     FRQRYAVNSKYWEGGKSNAPILAYLGAESSMDGDLGNIGFIEDNAPHFKALIVYIEHRFY  62

Query  515   GKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGML  694
             GK++PFG+ EE +    T GY N+AQALADYA +LL++K  Y A HSP+IV GGSYGGML
Sbjct  63    GKTMPFGSAEETLKTAKTLGYLNTAQALADYALILLHIKESYSAHHSPVIVIGGSYGGML  122

Query  695   ASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVI  874
             A+WF+LKYPH+ALGALASSAP+LYF+   P++GY+ +VTK FK+ S+ C+  IR+SW  I
Sbjct  123   AAWFKLKYPHIALGALASSAPLLYFEETLPKHGYFYIVTKVFKQTSKKCHDQIRRSWDEI  182

Query  875   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPP-KYPVTEVCGGID  1051
             D IA+KP GLSILSKK KLC  LK   ELK +L   Y   AQY+       VT VC  I+
Sbjct  183   DIIAAKPAGLSILSKKIKLCNPLKDTYELKSFLSYVYAGTAQYNNNVYSATVTSVCEAIN  242

Query  1052  GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1231
               P   D+LD+I AGVV   GN +CY    +N  T+     W WQ CSE+ MPIG  + D
Sbjct  243   TTPP-RDLLDQIFAGVVAYAGNISCYG---FNQLTNSD-RAWGWQVCSEIVMPIGYNEED  297

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
             +MF   P++M  +S DC   YGV PRPHWIT++YG  D+KL+  +FG+NIIFSNGL DPY
Sbjct  298   SMFQTRPYNMTSYSEDCQSNYGVIPRPHWITSHYGTQDVKLIFRRFGNNIIFSNGLLDPY  357

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S   VLE+ISDTV+A+ T NGSHC+DI    K DPDWL EQR+KEV+II SWI  Y  +L
Sbjct  358   SVGSVLENISDTVVAITTNNGSHCMDITLKRKDDPDWLVEQREKEVQIIGSWIRTYQKDL  417

Query  1592  EALK  1603
             + LK
Sbjct  418   KELK  421



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score =   505 bits (1300),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 248/448 (55%), Positives = 315/448 (70%), Gaps = 13/448 (3%)
 Frame = +2

Query  248   TKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPI  427
             T+ L   F T YY QTLDHFNY P+SY TF+QRYI++SKYWGG  ++SPIF + GAE  I
Sbjct  35    TEELPPEFVTLYYTQTLDHFNYKPESYETFQQRYILNSKYWGGPNTSSPIFVYAGAECNI  94

Query  428   D-DDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALAD  604
                 P   GF+   A RF ALL+YIEHR+YG+S PFG    ++ N TT GY +SAQALAD
Sbjct  95    TLVIPPGGGFMAHLASRFNALLLYIEHRFYGESNPFG--PSSLQNATTLGYLSSAQALAD  152

Query  605   YAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP  784
             YA+++L +K    A+ SP+IV GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP
Sbjct  153   YAQLILDVKKNLSAESSPVIVVGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITP  212

Query  785   ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELK  964
             ++G++ + +KDFK+ SE+CY TI++SWS IDK+A++ NGL  L   F LC  L S G LK
Sbjct  213   QDGFFVVASKDFKDTSESCYNTIKQSWSEIDKVAAQQNGLETLRSIFSLCDRLHSVGMLK  272

Query  965   DYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIY  1144
               L   Y  +AQYD PP + V +VCG I+GAP+G D L RI AG+     N + +    +
Sbjct  273   FILRRVYLYSAQYDNPPYFYVEKVCGAINGAPEGTDTLGRIAAGL-----NASIF--SCH  325

Query  1145  NPPTSETIVG---WRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPH  1315
             + PT ++IV    W WQ C+E+ MPIG  + +TMF   PF M +    C   +G+ PRPH
Sbjct  326   SNPTWKSIVDEDLWLWQVCTELVMPIGLDNNNTMFEALPFDMNRHVNMCQSIFGISPRPH  385

Query  1316  WITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIY  1495
             WITT YGGHDIK VL  F SNIIFSNGLRDP+S  GVLEDISD+V+A+ T  G+HCLD+Y
Sbjct  386   WITTEYGGHDIKSVLGNFASNIIFSNGLRDPFSVGGVLEDISDSVVAIKTEKGAHCLDLY  445

Query  1496  GASKTDPDWLTEQRKKEVEIIQSWITKY  1579
              A+  D DWL  QR++E+ II  WI +Y
Sbjct  446   TATPNDSDWLVAQREEEINIIAHWIDEY  473



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   500 bits (1287),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 259/488 (53%), Positives = 335/488 (69%), Gaps = 23/488 (5%)
 Frame = +2

Query  167   PLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             PL+ +PRL  + ++ + R  +  SS     +SS F+T++Y QTLDHFNY P+SY TF+QR
Sbjct  31    PLN-MPRLGVIPDTEVWRLRAAQSS-----ISSDFKTYFYTQTLDHFNYRPESYTTFQQR  84

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++ KYWGGA+S +PI  +LGAE  +D+   + GFLTD+AP+F AL+VYIEHRYYG+S+
Sbjct  85    YVINFKYWGGAKSGAPILVYLGAEQSLDN-INFDGFLTDHAPQFNALIVYIEHRYYGESV  143

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG ++    N +T GYF+S+QAL DYAE++L +K    A   P+IV GGSYGGMLASWF
Sbjct  144   PFGKVQ----NASTLGYFSSSQALEDYAEIILDIKKNLSANGCPVIVIGGSYGGMLASWF  199

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+ALGALASSAPILYFD+ITP++G+ S+ ++ FK+ S++CY TI +SW+ IDK+A
Sbjct  200   RLKYPHIALGALASSAPILYFDDITPDDGFLSVASRVFKKTSKSCYNTILQSWAEIDKVA  259

Query  887   S---KPNGLSILSKKFKLCK-GLKSPGELKDYLD-STYCTAAQYDQPPKYPVTEVCGGID  1051
             S   +  GLSIL  +FK C     +  ELK YL  S Y  AAQYD P +  V  +C  ID
Sbjct  260   SSQPQGQGLSILHNRFKTCGVSFTNLSELKGYLTYSIYARAAQYDYP-RRSVDLICKAID  318

Query  1052  GAPKGA--DILDRIHAGVVGLEGNRTCYD--PQIYNPPTSE--TIVGWRWQTCSEMAMPI  1213
             G PK    DI+ +I AGV   +GN +     P    P   +      W WQTC+EM MPI
Sbjct  319   GTPKAGTTDIVGKIIAGVSAYKGNVSSKSNVPSALAPGNVQLNENTAWNWQTCTEMVMPI  378

Query  1214  GRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSN  1393
             G G   T+F   PF +      C  +YGV PRPHWITTY+GGHDIK VL +FGSNIIFSN
Sbjct  379   GGGINATLFPVPPFDLNSRIETCKSFYGVSPRPHWITTYFGGHDIKRVLKRFGSNIIFSN  438

Query  1394  GLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWIT  1573
             GLRDPYS AGVL  +S +++A+ T+ GSHCLD+  AS  DP WLT QR +EV II  WIT
Sbjct  439   GLRDPYSVAGVLRSLSHSLVALITKQGSHCLDLLPASPDDPHWLTAQRSREVRIIARWIT  498

Query  1574  KYYVELEA  1597
             +Y  +  A
Sbjct  499   QYKADRAA  506



>gb|KFK36399.1| hypothetical protein AALP_AA4G119300 [Arabis alpina]
Length=1109

 Score =   517 bits (1331),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 322/441 (73%), Gaps = 10/441 (2%)
 Frame = +2

Query  239   SPQTKPLS-------SHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPI  397
             SP T+P         S  +TFYY Q LDHF Y P+SY TF+QRY + SK+W GA++N+PI
Sbjct  34    SPTTRPTKKVDAFADSDIKTFYYDQNLDHFTYTPESYKTFQQRYAIDSKHWAGAKANAPI  93

Query  398   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  577
              A+LG ES +++D   +GF  DN PR KA+LVYIEHRYYGKS+PFG+ +EA+ NE+T GY
Sbjct  94    LAFLGEESWLENDLFRVGFFQDNGPRLKAILVYIEHRYYGKSMPFGSAKEALKNESTLGY  153

Query  578   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  757
              N+AQALADYA +LL++K KY A+HSPIIV G SYGGMLA+WFRLKYPH+ALGALASSAP
Sbjct  154   LNAAQALADYAAILLHVKEKYSAKHSPIIVVGASYGGMLAAWFRLKYPHIALGALASSAP  213

Query  758   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  937
             +LYF +  P+ GYY ++TK FKE SE CY TIR SW  ID+IA+K NGL ILSKKFK C 
Sbjct  214   LLYFQDTRPKFGYYYIITKIFKETSERCYNTIRTSWEEIDRIAAKSNGLLILSKKFKTCA  273

Query  938   GLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLE  1111
              L    ++KD+LDS Y  A Q+++     VT +C  I+  P  +  D+LDR+ AGVV   
Sbjct  274   PLSRTFDIKDFLDSIYAEAVQFNRNTGDWVTTICNAINDNPANRKHDVLDRVLAGVVAYI  333

Query  1112  GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDY  1291
             GN++CYD  ++  P++++I  WRWQ CSE+ MPIG   +DTMF  APF+M  F  DC   
Sbjct  334   GNQSCYDTDLFVRPSNDSI-AWRWQGCSEIVMPIGYDKQDTMFPTAPFNMTSFIDDCKSN  392

Query  1292  YGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRN  1471
             YGV PRPHWITTY+G  D+KL+L +FGSNIIFSNGL DPYS  GVLED+SD+V+A+ T N
Sbjct  393   YGVTPRPHWITTYFGIQDVKLILKRFGSNIIFSNGLADPYSVGGVLEDVSDSVVAIKTVN  452

Query  1472  GSHCLDIYGASKTDPDWLTEQ  1534
             G+HC D+      DP+WL ++
Sbjct  453   GTHCQDLSLRRNEDPEWLLQR  473



>ref|XP_010421084.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=437

 Score =   491 bits (1264),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 301/422 (71%), Gaps = 9/422 (2%)
 Frame = +2

Query  164   PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             P   KI RL  +  ++L+ +  +   P  K   S  + FY+ QTLDHF + P+SY TF+Q
Sbjct  23    PAHSKIARLG-ISPNLLKNAPDR---PTQKIAESDLKLFYFNQTLDHFTFTPESYLTFQQ  78

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY + SK+W GA++N+PI A+LG ES ++ D    GFL DNAP FKAL VYIEH YYGK+
Sbjct  79    RYAIDSKHWAGAKANAPILAFLGLESSLETDFSAFGFLRDNAPHFKALCVYIEHTYYGKT  138

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+++EAM N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+W
Sbjct  139   IPFGSVKEAMKNASTLGYLNTAQALADYAAILLHVKEKYSTKHSPIIVVGGSYGGMLAAW  198

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+ALGALASSAP+LYF++  P+ GYY ++TK FKE ++ CY TIRKSW  IDK+
Sbjct  199   FRLKYPHIALGALASSAPLLYFEDTRPKFGYYYIITKVFKETNKRCYNTIRKSWKQIDKV  258

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP-  1060
             A+KPNGL IL KKFK C  L    +LKD+LD+ Y  A QY++   + VT VC  I+  P 
Sbjct  259   AAKPNGLLILGKKFKTCAPLNKSFDLKDFLDTIYAEAVQYNE--GFLVTNVCSAINANPP  316

Query  1061  -KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
              +  DILDRI AGVV L GN++CYD   Y+   +   + WRWQ CSE+ +P+G   +D M
Sbjct  317   NRKIDILDRIFAGVVALTGNQSCYDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDAM  375

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F  +PF+M  F   C+  YGV PRPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS 
Sbjct  376   FPTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSV  435

Query  1418  AG  1423
              G
Sbjct  436   GG  437



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score =   486 bits (1252),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/389 (59%), Positives = 288/389 (74%), Gaps = 2/389 (1%)
 Frame = +2

Query  425   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALAD  604
             +D+D    G LTDNA RF AL+V+IEHR+YG+S+PF + EEA+ N T RGYF+SAQALAD
Sbjct  1     MDNDIDVAGILTDNADRFGALVVFIEHRFYGESVPFVSREEALRNATLRGYFSSAQALAD  60

Query  605   YAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP  784
             YAE++LY+K +  A  SP+IVFGGSYGGMLA+WFRLKYPH+ALGALASSAPILYFD + P
Sbjct  61    YAEIILYIKKELSADKSPVIVFGGSYGGMLATWFRLKYPHIALGALASSAPILYFDGLIP  120

Query  785   ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELK  964
             ++ Y+++ +KDF E SE+CY TI +SW+ ID+ A+  NGLS+LSKKFK CK L++  ELK
Sbjct  121   QDSYFAVASKDFWETSESCYNTIVQSWAEIDRFAAMENGLSLLSKKFKTCKNLENVYELK  180

Query  965   DYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIY  1144
             + L +TY  +AQYD+P  + V+ VC  I  AP+G DILD+I  G V   G + CYDP   
Sbjct  181   EILVTTYAASAQYDKPSNH-VSRVCEAITSAPQGTDILDKIFLGFVAFAGKKDCYDPNTL  239

Query  1145  NPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
                + ET  GW WQ CS++ +P+G     TMF   PF M+ F+  C + YGV PRPHW+T
Sbjct  240   F-WSQETTEGWNWQVCSDLVIPMGIDSNRTMFQHDPFVMEIFTESCKESYGVLPRPHWVT  298

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1504
             TYYGG  IK VL +FGSNIIFSNGLRDPYSS GVLEDISD+++A+ TR GSHC+DI  A+
Sbjct  299   TYYGGQHIKEVLRRFGSNIIFSNGLRDPYSSGGVLEDISDSIVALTTREGSHCMDILYAT  358

Query  1505  KTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             K DP+WL  QR   +EII  WI  YY +L
Sbjct  359   KDDPEWLVLQRNTALEIISGWILTYYQDL  387



>ref|NP_197677.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|AED93089.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=439

 Score =   486 bits (1250),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 238/421 (57%), Positives = 303/421 (72%), Gaps = 10/421 (2%)
 Frame = +2

Query  188   LTPLYESILQRSSSKHSSPQTKPL-------SSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             L PL  S + R      + + +P         S+ + +Y+ QTLDHF + P+SY TF+QR
Sbjct  20    LIPLAHSKIARLGISSKTLKNEPDGSTQKVDESNLKMYYFNQTLDHFTFTPESYMTFQQR  79

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y + S +WGGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++
Sbjct  80    YAIDSTHWGGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETM  139

Query  527   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             PFG+ EEA+ N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WF
Sbjct  140   PFGSAEEALKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWF  199

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+ALGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A
Sbjct  200   RLKYPHIALGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWIEIDRVA  259

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--  1060
              KPNGLSILSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  
Sbjct  260   GKPNGLSILSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPN  319

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
             +  ++LDRI AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF
Sbjct  320   RRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMF  378

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
               APF+M  +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  
Sbjct  379   PTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVG  438

Query  1421  G  1423
             G
Sbjct  439   G  439



>ref|XP_008458666.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Cucumis 
melo]
Length=365

 Score =   483 bits (1242),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 284/368 (77%), Gaps = 4/368 (1%)
 Frame = +2

Query  503   HRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSY  682
             HRYYGKSIPF + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSY
Sbjct  2     HRYYGKSIPFRSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSY  61

Query  683   GGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKS  862
             GGMLASWFRLKYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KS
Sbjct  62    GGMLASWFRLKYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKS  121

Query  863   WSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCG  1042
             WS I  +AS+PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C 
Sbjct  122   WSEIKTVASQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICD  181

Query  1043  GIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1222
              IDG       L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPI   
Sbjct  182   AIDGTYSVNGTLSKIAAGVFAFRGSISCYINEPRN--ETETDVGWRWQSCSEMVMPI--S  237

Query  1223  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1402
               D MF P PF +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+
Sbjct  238   SDDDMFPPYPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLK  297

Query  1403  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             DPYS AGVL  ISD++LAV+T NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY
Sbjct  298   DPYSIAGVLHSISDSLLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGWISEYY  357

Query  1583  VELEALKR  1606
              +L+  K+
Sbjct  358   ADLKKYKQ  365



>ref|XP_011004991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   486 bits (1252),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 323/476 (68%), Gaps = 61/476 (13%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +       TF+Y QTLDHFNY P+SY TF QRY
Sbjct  61    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDLETFFYNQTLDHFNYRPESYDTFLQRY  117

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIP
Sbjct  118   LINSKYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIP  177

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  178   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  237

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++AS
Sbjct  238   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVAS  297

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  298   KPDGLSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGD  357

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET  GWRWQ+                  
Sbjct  358   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQS------------------  395

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
                                               I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  396   ----------------------------------IRLILQRFASNIIFSNGLRDPYSSGG  421

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  422   VLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  477



>ref|XP_011005222.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   484 bits (1247),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 262/476 (55%), Positives = 323/476 (68%), Gaps = 61/476 (13%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             LH IPRL+P+   +      +      +       TF+Y QTLDHFNY P+SY TF QRY
Sbjct  61    LHTIPRLSPIGPRVWLDHPDQILGESVR---EDLETFFYNQTLDHFNYRPESYDTFLQRY  117

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIP
Sbjct  118   LINSKYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIP  177

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFR
Sbjct  178   FGSREEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFR  237

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++AS
Sbjct  238   LKYPHIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVAS  297

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLSILSKKFK C  L    EL+++LDS Y  AAQY++PP YPV +VCGGIDG   G 
Sbjct  298   KPDGLSILSKKFKTCNPLTDASELRNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGD  357

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
             D+L R+  G+V  +GNR+CY     N PT  SET  GWRWQ+                  
Sbjct  358   DLLGRVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQS------------------  395

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
                                               I+L+L +F SNIIFSNGLRDPYSS G
Sbjct  396   ----------------------------------IRLILQRFASNIIFSNGLRDPYSSGG  421

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             VLE+ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  422   VLENISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  477



>ref|XP_010254367.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Nelumbo 
nucifera]
Length=476

 Score =   481 bits (1239),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 320/468 (68%), Gaps = 11/468 (2%)
 Frame = +2

Query  212   LQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNS  391
             + + S +  +P + P S  F T++Y Q LDHFNY  +S ATF+Q+Y+++SK+WGGA S++
Sbjct  9     ITKQSHRRLTPFSFP-SRDFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSA  67

Query  392   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  571
             PIF +LGA +P+DD  + IGF+TDNAP+F ALLVYIEHR+YG+S PFG+ EEA  N+ T 
Sbjct  68    PIFVYLGANAPLDDQIRRIGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTL  127

Query  572   GYFNSAQALADYAEVLLYLKNKYLAQHS-PIIVFGGSYGGMLASWFRLKYPHVALGALAS  748
              Y N +Q L DYAEV+L +K    A +S P+IV GGSYGG+LA+ FRL+YP++ALGALAS
Sbjct  128   DYLNLSQTLEDYAEVILDIKKNLSANNSTPVIVIGGSYGGVLATLFRLRYPYIALGALAS  187

Query  749   SAPILYFDNITP--ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  922
             SAPILY D + P  ++GY+S+V+KDF+E SE+CY TI++SWS IDKIAS+ +GLS+LS++
Sbjct  188   SAPILYLDGLKPQLQDGYFSIVSKDFREASESCYNTIQQSWSEIDKIASQEDGLSVLSRR  247

Query  923   FKLCKGLKSPGELKDYLDSTYCTAAQYDQPP-KYPVTEVCGGIDGAPKGADILDRIHAGV  1099
             F  C  L++   LKD L   Y  AAQYD P     V  +C  ID A  G D+LD++ A +
Sbjct  248   FNTCTPLENSSWLKDALKLVYAAAAQYDAPQINQAVNLICTAIDRATNGTDVLDKVIAAM  307

Query  1100  VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRD  1279
                        P  Y     +    W WQ C+E+ +P G    DTMF   PF++  +   
Sbjct  308   FAFFSKYP--GPHEYCDEMHQW--AWNWQICTEILIPTGISGTDTMFQAEPFNLTSYKET  363

Query  1280  CDDYYGVP--PRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVL  1453
             C   Y +   P P WIT+ +GG D+KLVL +FGSNIIFSNGLRDP+S+ GVLE +SD+++
Sbjct  364   CKGLYDLRLMPEPFWITSQFGGQDVKLVLGRFGSNIIFSNGLRDPFSAGGVLESLSDSLV  423

Query  1454  AVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             A+ T  GSHCLDIY A   DPDWL  QR+ E++II  WI +Y+++  A
Sbjct  424   ALPTAKGSHCLDIYAALPNDPDWLIVQRRSELKIISQWIAQYHMDRAA  471



>ref|XP_004172321.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal Pro-X carboxypeptidase-like 
[Cucumis sativus]
Length=440

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 293/401 (73%), Gaps = 8/401 (2%)
 Frame = +2

Query  233   HSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  412
              S+PQ    S    TF Y+Q LDHFNY PQSY TF QRYI+  KYW G    +PIFA+LG
Sbjct  44    QSTPQQ---SDGLATFXYKQPLDHFNYQPQSYVTFDQRYIIDFKYWEGINPKTPIFAYLG  100

Query  413   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  592
             AES ID+D  Y+GF    A ++KA+ VY+EHR+YGKSIPFG++E+AM N + RGYFNSAQ
Sbjct  101   AESDIDNDVPYVGFPLRFASQYKAMSVYLEHRFYGKSIPFGSLEKAMKNGSIRGYFNSAQ  160

Query  593   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  772
             ALADYAE+LL++K  +    SPIIV G SYGGMLASWFRLKYPH+ALGALASSAPILYFD
Sbjct  161   ALADYAELLLHIKKMFAYDTSPIIVMGASYGGMLASWFRLKYPHIALGALASSAPILYFD  220

Query  773   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN-GLSILSKKFKLCKGLKS  949
             NITP++GYYS+V+K FKE S+ C+ TIR+SW  ID+IA K   GLSILSK+FK C  LK+
Sbjct  221   NITPQDGYYSIVSKSFKETSKTCHDTIRRSWGEIDRIAGKTQGGLSILSKQFKTCGKLKT  280

Query  950   PGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGID-GAPKGADILDRIHAGVVGLEGNRTC  1126
               E+K+ +DS +  AAQY+ P + PV  +C  ID  A K ++++ ++ AGV+   G R C
Sbjct  281   SSEIKNLMDSVFTMAAQYNDPYENPVRGICVAIDEEAKKKSNVIKQVVAGVIAYLGERPC  340

Query  1127  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD--TMFFPAPFSMQQFSRDCDDYYGV  1300
             YD   +  P ++ +  + WQ CSEM MPIG   RD  +MF P+PF    F   C D YGV
Sbjct  341   YDVYEFGYP-NDPLNQYGWQVCSEMVMPIGSSGRDKNSMFPPSPFQFNDFKTMCKDLYGV  399

Query  1301  PPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
              PRPHWITT+YGG DIKLVLH+FGSNIIFSNGL+DPYSS G
Sbjct  400   TPRPHWITTFYGGQDIKLVLHRFGSNIIFSNGLKDPYSSGG  440



>ref|XP_010254366.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   477 bits (1227),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 320/470 (68%), Gaps = 13/470 (3%)
 Frame = +2

Query  212   LQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNS  391
             + + S +  +P + P S  F T++Y Q LDHFNY  +S ATF+Q+Y+++SK+WGGA S++
Sbjct  9     ITKQSHRRLTPFSFP-SRDFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSA  67

Query  392   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  571
             PIF +LGA +P+DD  + IGF+TDNAP+F ALLVYIEHR+YG+S PFG+ EEA  N+ T 
Sbjct  68    PIFVYLGANAPLDDQIRRIGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTL  127

Query  572   GYFNSAQALADYAEVLLYLKNKYLAQHS-PIIVFGGSYGGMLASWFRLKYPHVALGALAS  748
              Y N +Q L DYAEV+L +K    A +S P+IV GGSYGG+LA+ FRL+YP++ALGALAS
Sbjct  128   DYLNLSQTLEDYAEVILDIKKNLSANNSTPVIVIGGSYGGVLATLFRLRYPYIALGALAS  187

Query  749   SAPILYFDNITP--ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  922
             SAPILY D + P  ++GY+S+V+KDF+E SE+CY TI++SWS IDKIAS+ +GLS+LS++
Sbjct  188   SAPILYLDGLKPQLQDGYFSIVSKDFREASESCYNTIQQSWSEIDKIASQEDGLSVLSRR  247

Query  923   FKLCKGLKSPGELKDYLDSTYCTAAQYDQPP-KYPVTEVCGGIDGAPKGADILDRIHAGV  1099
             F  C  L++   LKD L   Y  AAQYD P     V  +C  ID A  G D+LD++ A +
Sbjct  248   FNTCTPLENSSWLKDALKLVYAAAAQYDAPQINQAVNLICTAIDRATNGTDVLDKVIAAM  307

Query  1100  VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRD  1279
                        P  Y     +    W WQ C+E+ +P G    DTMF   PF++  +   
Sbjct  308   FAFFSKYP--GPHEYCDEMHQW--AWNWQICTEILIPTGISGTDTMFQAEPFNLTSYKET  363

Query  1280  CDDYYGVP--PRPHWITTYYGG--HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1447
             C   Y +   P P WIT+ +GG   D+KLVL +FGSNIIFSNGLRDP+S+ GVLE +SD+
Sbjct  364   CKGLYDLRLMPEPFWITSQFGGQQQDVKLVLGRFGSNIIFSNGLRDPFSAGGVLESLSDS  423

Query  1448  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             ++A+ T  GSHCLDIY A   DPDWL  QR+ E++II  WI +Y+++  A
Sbjct  424   LVALPTAKGSHCLDIYAALPNDPDWLIVQRRSELKIISQWIAQYHMDRAA  473



>ref|XP_006494702.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   471 bits (1213),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/342 (68%), Positives = 271/342 (79%), Gaps = 12/342 (4%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P+ E+ILQ      S+     +S  F+TFYY QTLDHFNY P+SY+TF+QRYI++
Sbjct  31    IPRLSPIRETILQNFEILSSAT----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  359   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A HSP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATHSPVIVIGGSYGGMLAAWFRL  206

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGIDGA  G D
Sbjct  267   PDGLAILSNKFRTCRPLGDSYELKGYLRLMYAYAAQYNHPPDYPVSMVCGGIDGAAFGND  326

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTC  1192
             IL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ  
Sbjct  327   ILSKIFAGVVAYEGNMSCY----VNPPTNETETTVGWRWQVI  364



>ref|XP_006494706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   469 bits (1208),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 271/342 (79%), Gaps = 12/342 (4%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPRL+P+ E+ILQ      S+     +S  F+TFYY QTLDHFNY P+SY+TF+QRYI++
Sbjct  31    IPRLSPIRETILQNFEILSSAT----ISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  359   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  532
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  533   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A +SP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATNSPVIVIGGSYGGMLAAWFRL  206

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1072
             P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGIDGA  G D
Sbjct  267   PDGLAILSNKFRTCRPLGDSYELKGYLRLMYAYAAQYNHPPDYPVSMVCGGIDGAAFGND  326

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTC  1192
             IL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ  
Sbjct  327   ILSKIFAGVVAYEGNMSCY----VNPPTNETETTVGWRWQVI  364



>gb|KCW50728.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=409

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/366 (62%), Positives = 280/366 (77%), Gaps = 9/366 (2%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF++ QTLDHFNY P+SY TF+QRY++ S++WGGA S++PIF +LGAESPID  
Sbjct  48    IADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWGGANSSAPIFVYLGAESPIDGS  107

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
             P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA++    RGYF+SAQALADYA 
Sbjct  108   PTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEALHETNIRGYFSSAQALADYAA  167

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ +GALASSAPILYFD+ITP++ 
Sbjct  168   IIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLTVGALASSAPILYFDDITPQDA  227

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S LS+ FK CK L+S  ELK+YL
Sbjct  228   YYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSNLSEMFKTCKPLESGDELKNYL  287

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNP  1150
              S Y  AAQYD PP+YPVT +C GIDGA    + IL +I AGVV  +GN  CY     NP
Sbjct  288   MSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKIFAGVVAYKGNSACY----VNP  343

Query  1151  PT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             PT  S+T +GW WQ CSEM MPIG  + ++MF   PF++  F  +C+D YGV PRPHWIT
Sbjct  344   PTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNLSSFIDECNDQYGVTPRPHWIT  402

Query  1325  TYYGGH  1342
             TYYGGH
Sbjct  403   TYYGGH  408



>emb|CBI17114.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   469 bits (1207),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 277/389 (71%), Gaps = 4/389 (1%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             L   F T++Y QTLDHFNY P+SY TF+QRYI++S+YWGGA S+SPIF + G E+ I   
Sbjct  44    LLPEFVTYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAV  103

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  616
               + GF+ + A RF  LL+YIEHRYYG S+PFG+ +EA +N +T GYF S QALADYAE+
Sbjct  104   AAFAGFIVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAEL  163

Query  617   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  796
             +  LK    A++ P+I  GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP N Y
Sbjct  164   ITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPGNAY  223

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             + +VTKDF+E SE+CY TIR SWS IDK+A++PNGL+ LS+ F  C+ L S  ELK YL 
Sbjct  224   HVIVTKDFRETSESCYSTIRDSWSEIDKVAAEPNGLANLSQIFMTCEPLNSSQELKYYLA  283

Query  977   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1156
               Y  +AQ D PP YPV +VC  IDGAP+G DI+ R+ AG+    G   C+    + P  
Sbjct  284   LCYVVSAQNDNPPAYPVKKVCDAIDGAPEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSN  342

Query  1157  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1336
                   W WQTC+EM MPIG G  DTMF   PF +   ++ C D +GV PRPHWITT +G
Sbjct  343   RSE---WTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWITTEFG  399

Query  1337  GHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             GHDIK V+  F SNIIFSNGLRDPYS+ G
Sbjct  400   GHDIKSVVGNFASNIIFSNGLRDPYSAGG  428



>emb|CDP07009.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/407 (58%), Positives = 290/407 (71%), Gaps = 40/407 (10%)
 Frame = +2

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             + YWGGA S+SPIFA LGAESP+D D   +GF  D+AP F AL+VY+EHR+YG+S+PFG+
Sbjct  13    NTYWGGANSSSPIFAHLGAESPLDHDFLRVGFPVDHAPFFNALVVYVEHRHYGESVPFGS  72

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
             MEEA+ NETTRG+FNSAQA+ADYAEVLLY+K ++    SP+IV+GGSYGGMLA+WFRLKY
Sbjct  73    MEEALKNETTRGFFNSAQAIADYAEVLLYVKERF---SSPVIVYGGSYGGMLAAWFRLKY  129

Query  719   PHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             PH+A+GALASSAP+LYFDNIT P++GYY +VTKDF   S +CY+TI+ SW V+D IAS+P
Sbjct  130   PHIAIGALASSAPVLYFDNITRPQDGYYWIVTKDFPATSGSCYRTIKDSWDVVDNIASQP  189

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1075
              GLSILS++FK C  L S  ELK++L S   ++AQY+ PP YP+T +C  ID A    DI
Sbjct  190   GGLSILSQRFKTCSHLNSGVELKNFLVSMCASSAQYNHPPDYPLTVLCEAIDRAGSRTDI  249

Query  1076  LDRIHAGVVGLEG-NRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
               +I AGV    G N +CYD   ++ PT ET  GW WQ CSEM MPIGR     MF PAP
Sbjct  250   FGQIFAGVESAFGKNSSCYDVNYFHRPT-ETNEGWGWQVCSEMVMPIGRTVEAHMFQPAP  308

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG---  1423
             F++ +F++ C   YGVPPRPHWITTYYGGHDIKL L KF SNIIFSNG +DPYSS G   
Sbjct  309   FNLTEFTQYCKLVYGVPPRPHWITTYYGGHDIKLTLQKFASNIIFSNGRKDPYSSGGYVI  368

Query  1424  -------------------------------VLEDISDTVLAVYTRN  1471
                                            VLED+SD++LA+ TR+
Sbjct  369   YTIKEIIVFCLSFEVMPILDHLVMVFWLIYRVLEDLSDSLLAISTRS  415



>ref|XP_006436579.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
 gb|ESR49819.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
Length=421

 Score =   462 bits (1188),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 237/427 (56%), Positives = 286/427 (67%), Gaps = 26/427 (6%)
 Frame = +2

Query  167   PLHKIPRLTPLYESILQRSSS-------KHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQS  325
             P   IPRL   + + L  +S+         SS  + P      T+YY Q LDH NY PQS
Sbjct  13    PFTFIPRLATRFTARLIPASTPTCVAFDSVSSANSTPWKGDLETYYYDQILDHSNYNPQS  72

Query  326   YATFKQRYIVSSKYWGGAQS-NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIE  502
             Y TF  RY+++ K+WGG  +  +PI A+LG ES +DDD   IG+LTDNA RFKAL VYIE
Sbjct  73    YLTFPHRYVLNFKHWGGGGAMAAPILAYLGEESSLDDDHGGIGWLTDNAHRFKALEVYIE  132

Query  503   HRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSY  682
             HR+YGKS+PF   ++A+ N T RGYFNSAQALADYAE+LL++K    A+ SP IV G SY
Sbjct  133   HRFYGKSVPFVPSKDALKNATLRGYFNSAQALADYAEILLHIKKNLSAEMSPTIVVGASY  192

Query  683   GGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKS  862
             GGML +WFRLKYP +ALGA+ASSAPILYFDNITP N +Y LV+KDF+E SE+CY+TI++S
Sbjct  193   GGMLVAWFRLKYPDIALGAVASSAPILYFDNITPSNAFYDLVSKDFREASESCYKTIKQS  252

Query  863   WSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCG  1042
             W    K   K NGL+ LSKKFK CK LK   ELKDYL+S Y +AAQYD P +YPV + C 
Sbjct  253   WLKSIKPLLKKNGLTFLSKKFKTCKPLKDVSELKDYLESMYTSAAQYDDPQEYPVNKACN  312

Query  1043  GIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1222
             GIDGA +G D L RI +G+V L G  +CYD                  TCSEM  PI  G
Sbjct  313   GIDGASEGTDTLGRIFSGIVALRGESSCYD------------------TCSEMVSPIKIG  354

Query  1223  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1402
               DT F   PF+  +    C+  YGV PRPHWITTY  GHDI++VL +FGSNIIFSNGLR
Sbjct  355   KNDTTFQANPFNPTESMDSCNKSYGVVPRPHWITTYCSGHDIRVVLKRFGSNIIFSNGLR  414

Query  1403  DPYSSAG  1423
              PY S G
Sbjct  415   YPYGSEG  421



>ref|XP_006424410.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
 gb|ESR37650.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
Length=436

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/416 (53%), Positives = 292/416 (70%), Gaps = 7/416 (2%)
 Frame = +2

Query  182   PRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSS  361
             P  +  ++++ +R +SK +S     L   F T+YY QTLDHFNY P+SYATF+Q+YI + 
Sbjct  26    PGSSTRFDTMRRRMTSKSNSH----LPPEFVTYYYTQTLDHFNYKPESYATFQQKYIKNF  81

Query  362   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  541
             KYWGGA ++SPI  ++G E+P+       GF+ D A RFKA+L+YIEHRYYG S+PFG+ 
Sbjct  82    KYWGGASTSSPIIVYIGEEAPLTFGVHGKGFIVDLASRFKAMLLYIEHRYYGDSMPFGSF  141

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
             +EA  +  T G+ +S QALAD A+++  +K    A++ P+I  GGSYGGMLASW RLKYP
Sbjct  142   DEAFRDANTLGFLSSTQALADCAQLITDVKRNLSAENCPVIAIGGSYGGMLASWLRLKYP  201

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             H+A GALASSAPILYFD++TP+NGY+ +VT DF++VSE+CY TI++SWS ID++A + NG
Sbjct  202   HIATGALASSAPILYFDDLTPQNGYHVVVTNDFRDVSESCYNTIKQSWSEIDRVAGQTNG  261

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1081
             L+ LS  F+ C  L S  ELKD+L   Y  +AQ D PP  PV++VCG IDGAPKG DIL 
Sbjct  262   LTTLSNIFQTCSPLNSSKELKDHLGMIYVISAQNDNPPYNPVSKVCGAIDGAPKGTDILG  321

Query  1082  RIHAGVVG--LEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             ++ AG+    L G        I +  T +   GW WQTC+EM MPIG G+ DTMF  +PF
Sbjct  322   KVAAGLNASLLRGGPEAQCNHIID-FTPKNTSGWTWQTCTEMVMPIGHGENDTMFQGSPF  380

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
              +  +++ C   +GV P+PHWITT +GGHDIK VL  F SNIIFSNGLRDPYS  G
Sbjct  381   DLNNYTKSCQALFGVTPKPHWITTEFGGHDIKSVLGNFSSNIIFSNGLRDPYSVGG  436



>gb|KCW50734.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=454

 Score =   460 bits (1183),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 284/400 (71%), Gaps = 12/400 (3%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             ++  F TF+Y QTLDHFNY P+SY  F QRY+V+S+YWGGA S +PIFA+LGAE+PID D
Sbjct  57    VAEDFVTFFYNQTLDHFNYRPESYTAFNQRYVVNSEYWGGADSGAPIFAFLGAEAPIDGD  116

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  613
                 GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+E A+ +  TRGYF+SAQALADYAE
Sbjct  117   IANAGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLERALGDADTRGYFSSAQALADYAE  176

Query  614   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  793
             +L++LK K  A+HSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD+I P++ 
Sbjct  177   ILIHLKQKLKAEHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDIIPQDA  236

Query  794   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  973
             YYS+V K F E S +C+QTIR+SW  +D++AS+P GL+ LS  FK C  L+S  ELK YL
Sbjct  237   YYSVVAKSFLESSSSCHQTIRQSWEELDRVASEPRGLTKLSNAFKTCSPLQSSSELKKYL  296

Query  974   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1153
                Y    QY+ P   P+  +C  I+GAP    +L +I AG+V + GN TCY     NP 
Sbjct  297   KLLYVQVVQYNDPSAQPLKLMCDAINGAPPRKGLLQKIFAGLVAINGNLTCY----VNPS  352

Query  1154  TS--ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITT  1327
              S  +T  GW WQTC+EMA PIG   R+TMF P PF++  FS  C   +GVP RP W+TT
Sbjct  353   GSDAQTPSGWFWQTCTEMAFPIGI-TRNTMFPPEPFNLNSFSNACKSEFGVPARPRWVTT  411

Query  1328  YYGGH----DIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
             Y+GGH      ++ L  F S+++  N    P   A  L +
Sbjct  412   YFGGHVGHSANQINLAVFFSSLLLINFCAKPEEMASDLSN  451



>ref|XP_006369369.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65938.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=435

 Score =   456 bits (1173),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 295/395 (75%), Gaps = 5/395 (1%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRY  349
             L+ IPRL+P+   + +    K +  +       F TF+Y QTLDHFNY P+SY  F QRY
Sbjct  46    LNTIPRLSPIGPRVWRDQPDKTTLGEFD--GEDFETFFYNQTLDHFNYRPESYDKFPQRY  103

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIP
Sbjct  104   LINSKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIP  163

Query  530   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  709
             FG+ EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFR
Sbjct  164   FGSREEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFR  223

Query  710   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  889
             LKYPH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++AS
Sbjct  224   LKYPHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELAS  283

Query  890   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1069
             KP+GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G 
Sbjct  284   KPDGLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGD  343

Query  1070  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             D L RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P 
Sbjct  344   DTLSRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPD  400

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKL  1354
             PF ++ +   C   YGVP RPHW+TTYYGGH   L
Sbjct  401   PFDLKDYIEHCKSLYGVPTRPHWVTTYYGGHVCSL  435



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   452 bits (1164),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 218/447 (49%), Positives = 299/447 (67%), Gaps = 10/447 (2%)
 Frame = +2

Query  251   KPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPID  430
             +PLS  + T  Y QTLDHF + P  Y TF QRY+V+  YWGG Q+NSPIF  LG E  I 
Sbjct  72    RPLSLDYTTNQYMQTLDHFTFRPDGYRTFPQRYLVNKTYWGGPQNNSPIFVCLGNEEDII  131

Query  431   DDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYA  610
                 Y G +T++A  F+AL+V+IEHRYYG S+PFG+ +E+  N +T GY++++QALADYA
Sbjct  132   TQLPYFGIMTEHAADFRALIVFIEHRYYGTSMPFGSQDESYANASTLGYYSASQALADYA  191

Query  611   EVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPEN  790
              V+  LK    A   P++VFGGSYGGMLA+W RLKYPH+ +GALASS+PILYF+++TP +
Sbjct  192   IVITDLKKNLSADDCPVVVFGGSYGGMLAAWLRLKYPHITIGALASSSPILYFEDMTPHD  251

Query  791   GYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDY  970
              Y  +VTKDF++ S+ CY+ I++SW+ ++K+AS+P GL  L+K F  C+ L S  +L  +
Sbjct  252   AYDRVVTKDFRDASDICYRRIKESWAEMEKVASQPGGLQKLAKLFNTCQSLSSWTDLFYW  311

Query  971   LDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNP  1150
             +      +AQY+      V  +C  I+   +G DIL R+ AG         C +      
Sbjct  312   IYPALQVSAQYNFA---EVKAICRVINSQARGTDILTRLAAGAEYANEGLGCLN------  362

Query  1151  PTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTY  1330
               S T+ GW WQTCSEM +P+      TMF  APF ++ +   C   YGV PRP+WITT 
Sbjct  363   -LSTTLSGWDWQTCSEMVIPLAPNANTTMFPSAPFDLKSYFSGCFKTYGVLPRPYWITTE  421

Query  1331  YGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKT  1510
             +GGH+IK VL +FGSNIIFSNGLRDPYSS GVL++ISD+++A+  + G HC DI  ++  
Sbjct  422   FGGHNIKRVLKRFGSNIIFSNGLRDPYSSGGVLKNISDSIVAITAKEGVHCEDIRSSTND  481

Query  1511  DPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             DP+WL EQR+KE+ II+ WI  Y + +
Sbjct  482   DPNWLKEQRQKEINIIRKWIIDYKMSM  508



>ref|XP_006408697.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
 gb|ESQ50150.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
Length=418

 Score =   446 bits (1146),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 211/380 (56%), Positives = 266/380 (70%), Gaps = 13/380 (3%)
 Frame = +2

Query  227   SKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAW  406
             + H +   K   S    FY+ Q LDHF + P+SY TF+QRY +  K+W GA++N+PI A+
Sbjct  40    NAHDALTQKVDKSDHEIFYFNQDLDHFTFTPKSYMTFQQRYAIDFKHWAGAKANAPILAF  99

Query  407   LGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNS  586
             LG E+ +D D   +GFL DN PR KALLVYIEHRYYGKS+PFG+ EEA+ N +T GY NS
Sbjct  100   LGEEASLDHDLAVVGFLGDNGPRLKALLVYIEHRYYGKSMPFGSAEEALKNASTLGYLNS  159

Query  587   AQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILY  766
             AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LY
Sbjct  160   AQALADYAAILLHIKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLY  219

Query  767   FDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLK  946
             F++  P+ GYY +VTK  KE SE CY TIRKSW  ID++A+KPNGL ILS+KFK C  L 
Sbjct  220   FEDTRPKFGYYYIVTKVIKETSERCYNTIRKSWKEIDRVAAKPNGLLILSQKFKTCSPLN  279

Query  947   SPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNR  1120
                ++KD+L + Y  A QY++     VT +C  I+  P  +  D+LDRI AGVV L+ N+
Sbjct  280   ESSDIKDFLGTIYAEAVQYNRD---WVTNMCNAINADPPNRKNDLLDRIFAGVVALKRNQ  336

Query  1121  TCYDPQIYNPPTSETI--------VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSR  1276
             TCY   +   PT   I        + W WQ+C+E+ MPIG   +DTMF PAP++M  F  
Sbjct  337   TCYGTNMLLQPTKNNIAWNEKNNHIAWSWQSCTEIVMPIGYDKQDTMFQPAPYNMSSFIE  396

Query  1277  DCDDYYGVPPRPHWITTYYG  1336
              C  YYGVPPRPHWI TY+G
Sbjct  397   GCQSYYGVPPRPHWIMTYFG  416



>emb|CDX71016.1| BnaC03g11000D [Brassica napus]
Length=407

 Score =   444 bits (1141),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 285/436 (65%), Gaps = 42/436 (10%)
 Frame = +2

Query  125   SSTTCGGLSE-TPPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLD  301
             SST     SE TP     KIPR           ++S+          S  + FYY Q LD
Sbjct  11    SSTISIARSEVTPLRVFAKIPR-----------NASEERQQVDDSTDSDLKIFYYDQNLD  59

Query  302   HFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT-DNAPRF  478
             HF + P+SY TF+QRY + SK+W                          GF+  DN PR 
Sbjct  60    HFTFTPKSYMTFQQRYAIQSKHWAD------------------------GFICHDNGPRL  95

Query  479   KALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSP  658
             KALLVYIEHRYYG S+PFG+ +EA+ N +T GY NSAQALADYA +LL++K KY A HSP
Sbjct  96    KALLVYIEHRYYGTSMPFGSGKEALKNASTLGYLNSAQALADYAAILLHVKEKYSADHSP  155

Query  659   IIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSEN  838
             IIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF +  P++GYY +VTK FKE +E+
Sbjct  156   IIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFQDTLPKHGYYYIVTKVFKETNES  215

Query  839   CYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPK  1018
             CY TIRKSW  ID++A KPNGL ILSKKF++C  L +  ELK++LD+ Y +AAQY+   +
Sbjct  216   CYNTIRKSWEEIDRVAVKPNGLLILSKKFRICNTLNNTFELKNFLDTIYASAAQYNS-NQ  274

Query  1019  YPVTEVCGGI-DGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCS  1195
             YPV  +C  I +G     D+L +I AGVV   GNR+CY   +   PT ++I  W+WQTCS
Sbjct  275   YPVASLCEAINNGVNSENDLLGQIFAGVVYDRGNRSCYPLSV--QPTEDSI-AWKWQTCS  331

Query  1196  EMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGS  1375
             E+ +PIG  ++DTMF   PF M      C   YGVPPRPHW+T YYG  D+KL+L +FGS
Sbjct  332   EIVLPIGHDEQDTMFQTEPFRMDIKIDRCKLQYGVPPRPHWVTAYYGIQDVKLILRRFGS  391

Query  1376  NIIFSNGLRDPYSSAG  1423
             NIIFSNGL DPYS  G
Sbjct  392   NIIFSNGLLDPYSVGG  407



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   441 bits (1135),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/477 (48%), Positives = 298/477 (62%), Gaps = 72/477 (15%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPR++P+ E      ++ H+ P     +   +TFY++Q LDHFNY P+SY TF+QRY+++
Sbjct  30    IPRMSPIPE----WETTLHNHPAIN--TEEVKTFYFKQVLDHFNYRPESYTTFQQRYLIN  83

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
              KYWGGA S++PIFA+ GAESPID+ P  +GFLTDNA  F ALLV               
Sbjct  84    FKYWGGANSSAPIFAYFGAESPIDNSPNGVGFLTDNAASFNALLV---------------  128

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
                                   Y E LL+                   G  + +W  + +
Sbjct  129   ----------------------YIECLLH-----------------GLGSNIPTWRLVPW  149

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH        S  ++   +          +    +E SE CY+T+ KSWS I +IAS+PN
Sbjct  150   PHQL-----QSYTLIKLHHKMVTTLLSQGIIDGLQEASETCYETVLKSWSEIRRIASQPN  204

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1078
             GL  LS++F  C  L    EL DYL STY  AAQY+QPP+YPV+ +CGGIDG   G+DIL
Sbjct  205   GLVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGESLGSDIL  264

Query  1079  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
              +I+AG+V L GN TC      N PT  SET VGWRWQTCSEM +PIG G+ DTMF P P
Sbjct  265   SKIYAGIVALRGNSTCK----VNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFEPIP  319

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1432
             F++ +++  C + YGV PRPHW+TTYYGGH+IKLVL + GSNIIFSNGLRDPYS  GVL+
Sbjct  320   FNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLD  379

Query  1433  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             +ISD+++AV+T NGSHCLD+  A+++DP WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  380   NISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDALK  436



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 320/493 (65%), Gaps = 19/493 (4%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSH-----FRTFYYRQTLDHFNYGPQSYAT  334
             L  +P LT  +  IL R  S   S + K  S       +RT ++ Q LDHFN+ PQS  T
Sbjct  14    LFSVPSLTFAFAPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHT  73

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+QRY+++  +WGGA++N+PIF + G E  I+   +  GF+ +NAP F+ALLV+IEHR+Y
Sbjct  74    FQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFY  133

Query  515   GKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             GKSIPFG  +  A  N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGM
Sbjct  134   GKSIPFGGNKTVAYANTSTLGYLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGM  193

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFR+KYPHVA+GALASSAPIL+F  +   + + S++T+DF+  SENCY+ I+ SW +
Sbjct  194   LAAWFRMKYPHVAIGALASSAPILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDL  253

Query  872   IDKIASKPNGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP-------PKYPV  1027
             ID  A+KP G+ +L K F++CK     P  L+ +L + +   A  D P       P YPV
Sbjct  254   IDDTANKPGGMELLRKTFRICKSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFLLPAYPV  313

Query  1028  TEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSE  1198
              ++C  ID +  G + L +++A         G  TC+D    + P    + GW+WQ C+E
Sbjct  314   KKMCEAIDSSVTGNNRLAKLYAAANVYYNYTGKATCFDLDDNSDP--HDLGGWQWQACTE  371

Query  1199  MAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSN  1378
             M MP+G  +++++F    +S +  +  CD +Y V PRPHWITT +GGH I+ VL +  SN
Sbjct  372   MIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASN  431

Query  1379  IIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEII  1558
             IIF NGLRDP+S+ GVL+ IS T++A+  + G+H +D+  +SK DP WL + RK+EV II
Sbjct  432   IIFFNGLRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNII  491

Query  1559  QSWITKYYVELEA  1597
              SWI++Y+ +L++
Sbjct  492   ASWISQYHQDLQS  504



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   442 bits (1138),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 222/495 (45%), Positives = 320/495 (65%), Gaps = 21/495 (4%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSH-----FRTFYYRQTLDHFNYGPQSYAT  334
             L  +P LT  +  IL R  S   S + K  S       +RT ++ Q LDHFN+ PQS  T
Sbjct  14    LFSVPSLTFAFAPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHT  73

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+QRY+++  +WGGA++N+PIF + G E  I+   +  GF+ +NAP F+ALLV+IEHR+Y
Sbjct  74    FQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFY  133

Query  515   GKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             GKSIPFG  +  A  N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGM
Sbjct  134   GKSIPFGGNKTVAYANTSTLGYLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGM  193

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFR+KYPHVA+GALASSAPIL+F  +   + + S++T+DF+  SENCY+ I+ SW +
Sbjct  194   LAAWFRMKYPHVAIGALASSAPILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDL  253

Query  872   IDKIASKPNGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---------PKY  1021
             ID  A+KP G+ +L K F++CK     P  L+ +L + +   A  D P         P Y
Sbjct  254   IDDTANKPGGMELLRKTFRICKSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAY  313

Query  1022  PVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTC  1192
             PV ++C  ID +  G + L +++A         G  TC+D    + P    + GW+WQ C
Sbjct  314   PVKKMCEAIDSSVTGNNRLAKLYAAANVYYNYTGKATCFDLDDNSDP--HDLGGWQWQAC  371

Query  1193  SEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFG  1372
             +EM MP+G  +++++F    +S +  +  CD +Y V PRPHWITT +GGH I+ VL +  
Sbjct  372   TEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSA  431

Query  1373  SNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVE  1552
             SNIIF NGLRDP+S+ GVL+ IS T++A+  + G+H +D+  +SK DP WL + RK+EV 
Sbjct  432   SNIIFFNGLRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVN  491

Query  1553  IIQSWITKYYVELEA  1597
             II SWI++Y+ +L++
Sbjct  492   IIASWISQYHQDLQS  506



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 300/454 (66%), Gaps = 15/454 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             + T Y+ QTLDHFN+ PQSY TF+QRY+++ KYWGGAQ+N+PIF + G E  I+   +  
Sbjct  52    YETKYFTQTLDHFNFQPQSYQTFQQRYLINDKYWGGAQNNAPIFVYTGNEGDIEWFAQNT  111

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ + AP+FKALLV+IEHR+YG SIPFG  +E A +N +T GY +S QALADYA +++ 
Sbjct  112   GFMYETAPKFKALLVFIEHRFYGSSIPFGGDKEVAYSNASTLGYLSSTQALADYATLIID  171

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A+ SP+I FGGSYGGMLA+WFRLKYPHV +GALASS+PIL F+++T   G+ S+
Sbjct  172   LKKNLTAEDSPVIAFGGSYGGMLAAWFRLKYPHVVVGALASSSPILNFEDLTSPYGFNSI  231

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T DF+  SENCY+ I+ SW  I+  A +  GL +L   FKLCK   +  +L+ ++++  
Sbjct  232   ITNDFRSESENCYKVIKGSWKEIEDTAKQQGGLEVLRNSFKLCKKAFTADDLESWIETAL  291

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P YPV ++C  ID    G D   R++  V       GN TC+
Sbjct  292   IYTAMTDYPTPSNFLQPLPAYPVKQMCKAIDNPTVGNDTFARLYGAVNIYYNNTGNATCF  351

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D +  + P    +  W WQ C+EM +P      D++F  + +     + +C   +G+ PR
Sbjct  352   DIEDDSDP--HGLSEWTWQACTEMILPTDGNKNDSIFPASEWDYANRATNCQFAFGINPR  409

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHWITT YGG+DI+ VL +FGSNIIF NGLRDP+S  GVLE IS +++A+  + G+H +D
Sbjct  410   PHWITTEYGGYDIRRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIIAIVAKEGAHHVD  469

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  ++K DP+WL + RK+EV II+ W+++YY +L
Sbjct  470   LRFSTKEDPEWLRDVRKREVGIIRKWLSQYYNDL  503



>gb|KCW50724.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=408

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 271/390 (69%), Gaps = 11/390 (3%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IP LT   E   Q      S+  T      F TF++ QTLDHF+Y PQSYATFKQRY ++
Sbjct  26    IPALTLEREDFHQDPERAVSASTTD----DFETFFFDQTLDHFSYRPQSYATFKQRYFIN  81

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-  535
             S YWGGA+S++PIF +LGAES +D  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G 
Sbjct  82    SSYWGGAKSSAPIFVYLGAESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGM  141

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
             + EEA+ N   RGYF+SAQALADY  +++++K +  A  SP+IV GGSYGGMLASW RLK
Sbjct  142   SFEEALENADIRGYFSSAQALADYVAIIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLK  201

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVALGALASSAP+LYF+++TP++ YYS+V KDFKE SE C+Q I  SWS ID++A + 
Sbjct  202   YPHVALGALASSAPVLYFEDMTPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKEL  261

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-  1072
             +GLS LS+ F  C+ L+S   LK +L   Y TAAQ D PP YPVT +C GIDGA    + 
Sbjct  262   DGLSNLSQIFNTCRPLESGATLKSFLKDMYTTAAQQDNPPTYPVTRICEGIDGANTTENG  321

Query  1073  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1252
             IL +I AGVV    N  C      N P + +  GW WQ CSEM MP+G   R++MF PAP
Sbjct  322   ILGKISAGVVAYYWNSNC----CLNTPLTVSPDGWSWQKCSEMVMPLGI-TRNSMFPPAP  376

Query  1253  FSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1342
             F +  F   C   YGV PRPHW+TT+YGGH
Sbjct  377   FLLDDFMEHCRCEYGVVPRPHWVTTHYGGH  406



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   440 bits (1131),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 222/495 (45%), Positives = 317/495 (64%), Gaps = 21/495 (4%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSH-----FRTFYYRQTLDHFNYGPQSYAT  334
             L   P LT  +  IL R  S   S + K  S       +RT ++ Q LDHFN+ PQS  T
Sbjct  15    LFSAPSLTFAFVPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHT  74

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+QRY+++  +WGGA++N+PIF + G E  I+   +  GF+ +NAP F+ALLV+IEHR+Y
Sbjct  75    FQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFY  134

Query  515   GKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             GKSIPFG  +  A  N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGM
Sbjct  135   GKSIPFGGNKTVAYANTSTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGM  194

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFR+KYPHVA+GALASSAPIL+F  +   + + +++T+DF+  SENCY+ I+ SW +
Sbjct  195   LAAWFRMKYPHVAIGALASSAPILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDL  254

Query  872   IDKIASKPNGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---------PKY  1021
             ID  A+KP G+ +L K F++CK     PG L+ +L + +   A  D P         P Y
Sbjct  255   IDDTANKPGGMELLRKTFRICKSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAY  314

Query  1022  PVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTC  1192
             PV ++C  ID +  G + L ++HA         G   C+D    + P    + GW+WQ C
Sbjct  315   PVKKMCEAIDSSVTGNNRLAKLHAAASVYYNYTGKARCFDLDDNSDP--HDLGGWQWQAC  372

Query  1193  SEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFG  1372
             +EM MP+G  +++++F    +S +  +  CD +Y V PRPHWITT +GGH I+ VL +  
Sbjct  373   TEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSA  432

Query  1373  SNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVE  1552
             SNIIF NGLRDP+S  GVL+ IS T++A+  + G+H +D+  +SK DP WL + RK EV 
Sbjct  433   SNIIFFNGLRDPWSGGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVN  492

Query  1553  IIQSWITKYYVELEA  1597
             II SWI++Y+ +L++
Sbjct  493   IIASWISQYHQDLQS  507



>gb|KCW50731.1| hypothetical protein EUGRSUZ_J004041, partial [Eucalyptus grandis]
Length=346

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 260/351 (74%), Gaps = 9/351 (3%)
 Frame = +2

Query  503   HRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGS  679
             HRYYG+SIP G ++EEA+ +   RGYF+SAQALAD+A +++++K    A+ SP+IV G S
Sbjct  1     HRYYGESIPHGMSLEEALKDANIRGYFSSAQALADFAAIIMHVKQDLKARDSPVIVVGAS  60

Query  680   YGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRK  859
             YGGMLASWFRLKYPHV LGALASSAPILYFD+I  ++ Y S+VTKDFKE SE CYQ I  
Sbjct  61    YGGMLASWFRLKYPHVTLGALASSAPILYFDDIISQDAYSSVVTKDFKEASETCYQAIGD  120

Query  860   SWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVC  1039
             SWS I++IA  PNG S LSK FK CK L+S  ELKDYL S Y  AAQYD PP YP + +C
Sbjct  121   SWSEINRIAQNPNGTSKLSKMFKTCKPLESGDELKDYLISMYEGAAQYDLPPTYPASVIC  180

Query  1040  GGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMP  1210
               IDGA    + IL ++ AGV+    N  CY     NPPT  S++ +GW WQ CSEM MP
Sbjct  181   NAIDGANTTENGILGKVFAGVIAYNTNSACY----VNPPTAISQSSLGWGWQRCSEMVMP  236

Query  1211  IGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1390
              G  + ++MF P PF +  F+ +C+  YGV PRPHWITTYYG HDI+L+L +FGSNIIFS
Sbjct  237   KGVTN-NSMFQPDPFILSSFTDECNHQYGVVPRPHWITTYYGAHDIELILCRFGSNIIFS  295

Query  1391  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKK  1543
             NGLRDP+SSAGVL++ISD+++AVYT  G+HCLD+Y   ++DPDWL  QRK 
Sbjct  296   NGLRDPFSSAGVLKNISDSIVAVYTEKGAHCLDVYAEDQSDPDWLVMQRKN  346



>ref|XP_010651835.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=376

 Score =   434 bits (1116),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 265/365 (73%), Gaps = 6/365 (2%)
 Frame = +2

Query  491   VYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVF  670
             + ++HRYYG S+PF + + A NN +T GYF+S QALADYAE++  LK    A++ P+I  
Sbjct  9     LILQHRYYGDSVPFRSKDIAFNNTSTLGYFSSTQALADYAELITNLKKNLSAENCPVIAI  68

Query  671   GGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQT  850
             GGSYGGMLASWFRLKYPHV +GALASSAPILYFD+ITP NGY S+VTKDF+E SE CY T
Sbjct  69    GGSYGGMLASWFRLKYPHVVIGALASSAPILYFDDITPHNGYDSIVTKDFRETSETCYTT  128

Query  851   IRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVT  1030
             I++SWS ID++A +PNGL+ LS+ F+ C+ L S  +LK YL+ TY  +AQYD PP + V+
Sbjct  129   IKQSWSEIDEVAGQPNGLANLSQIFRTCEPLNSSQQLKLYLEYTYEASAQYDNPPAHYVS  188

Query  1031  EVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMP  1210
             ++C  IDGAP+G  IL R+  GV    G   C+    + P     + GW WQTC+EM MP
Sbjct  189   DICNAIDGAPEGTSILGRVAEGVNASAG-PPCHRIYDFQP---SNMSGWLWQTCTEMVMP  244

Query  1211  IGRGDRDTMFFPAPFSMQQFSRDCDDYYG--VPPRPHWITTYYGGHDIKLVLHKFGSNII  1384
              GRG+ DTMF  +PF +  +++ C D +G  V PRPHWITT +GGH+IK VL  F SNII
Sbjct  245   FGRGENDTMFQASPFDLNNYTKTCQDIFGASVTPRPHWITTEFGGHNIKSVLGNFASNII  304

Query  1385  FSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1564
             FSNGLRDPYS  GVL+DIS++V+AVYT  G+HCLD+     +DPDWL  QR KE++I+  
Sbjct  305   FSNGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTPMPSDPDWLVAQRDKEIKIVAL  364

Query  1565  WITKY  1579
             W+ +Y
Sbjct  365   WLAEY  369



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/495 (45%), Positives = 317/495 (64%), Gaps = 21/495 (4%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTKPLSSH-----FRTFYYRQTLDHFNYGPQSYAT  334
             L   P LT  +  IL R  S   S + K  S       +RT ++ Q LDHFN+ PQS  T
Sbjct  15    LFSAPSLTFAFVPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHT  74

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+QRY+++  +WGGA++N+PIF + G E  I+   +  GF+ +NAP F+ALLV+IEHR+Y
Sbjct  75    FQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFY  134

Query  515   GKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             GKSIPFG  +  A  N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGM
Sbjct  135   GKSIPFGGNKTVAYANTSTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGM  194

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFR+KYPHVA+GALASSAPIL+F  +   + + +++T+DF+  SENCY+ I+ SW +
Sbjct  195   LAAWFRMKYPHVAIGALASSAPILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDL  254

Query  872   IDKIASKPNGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---------PKY  1021
             ID  A+KP G+ +L K F++CK     PG L+ +L + +   A  D P         P Y
Sbjct  255   IDDTANKPGGMELLRKTFRICKSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAY  314

Query  1022  PVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTC  1192
             PV ++C  ID +  G + L ++HA         G   C+D    + P    + GW+WQ C
Sbjct  315   PVKKMCEAIDSSVTGNNRLAKLHAAASVYYNYTGKARCFDLDDNSDP--HDLGGWQWQAC  372

Query  1193  SEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFG  1372
             +EM MP+G  +++++F    +S +  +  CD +Y V PRPHWITT +GGH ++ VL +  
Sbjct  373   TEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAVERVLKRSA  432

Query  1373  SNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVE  1552
             SNIIF NGLRDP+S  GVL+ IS T++A+  + G+H +D+  +SK DP WL + RK EV 
Sbjct  433   SNIIFFNGLRDPWSGGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVN  492

Query  1553  IIQSWITKYYVELEA  1597
             II SWI++Y+ +L++
Sbjct  493   IIASWISQYHQDLQS  507



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   439 bits (1128),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 299/454 (66%), Gaps = 16/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T Y+ Q LDHFNY PQSY TF+QRY+++  +WGG+++N+PIF + G E  I+   +  
Sbjct  53    YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ D AP+FKALLV+IEHRYYGKSIP+G  +E A  N +T GY +S QALADYA +++ 
Sbjct  113   GFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FDNI     + ++
Sbjct  173   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNI  232

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+ VSENCY+ I+ SW  I++ A KP GL  L K F++CK  K+   ++ +L + +
Sbjct  233   ITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLA-IESWLSTAF  291

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1129
                A  D P         P +PV E+C  ID    G D+  +++          G   C+
Sbjct  292   VYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCF  351

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D    + P    +  W WQ C+EM M  G  ++D++F  +       +R C + YGV PR
Sbjct  352   DLNGDSDP--HGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPR  409

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P+WITT +GGH I LVL +F SNIIF NGLRDP+S  GVL++IS TVLA+  + G+H +D
Sbjct  410   PNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVD  469

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  ++K DP WL + R++EVEI+  WI++Y+ +L
Sbjct  470   LRFSTKEDPQWLKDVRRREVEIVGKWISQYFQDL  503



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 299/454 (66%), Gaps = 16/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T Y+ Q LDHFNY PQSY TF+QRY+++  +WGG+++N+PIF + G E  I+   +  
Sbjct  53    YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ D AP+FKALLV+IEHRYYGKS+P+G  +E A  N +T GY +S QALADYA +++ 
Sbjct  113   GFMYDVAPKFKALLVFIEHRYYGKSMPYGGNKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FDNI     + ++
Sbjct  173   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNI  232

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+ VSENCY+ I+ SW  I++ A KP GL  L K F++CK  K+   ++ +L + +
Sbjct  233   ITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLA-IESWLSTAF  291

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P +PV E+C  ID    G D+  +++          G   C+
Sbjct  292   VYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCF  351

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D    + P    +  W WQ C+EM M  G  ++D++F  +       +R C + YGV PR
Sbjct  352   DLNGDSDP--HGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPR  409

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P+WITT +GGH I LVL +F SNIIF NGLRDP+S  GVL++IS TVLA+  + G+H +D
Sbjct  410   PNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVD  469

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  ++K DP WL + R++EVEII  WI++Y+ +L
Sbjct  470   LRFSTKEDPQWLKDVRRREVEIIGKWISQYFQDL  503



>gb|KHN29944.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=348

 Score =   431 bits (1108),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 253/328 (77%), Gaps = 7/328 (2%)
 Frame = +2

Query  209   ILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSN  388
             I +  +S H  P     +   +TFY++Q LDHFNY P+SY TF+QRY+V+ KYWGGA S+
Sbjct  4     IPEWETSLHDHPVATD-AEEVKTFYFKQVLDHFNYRPESYTTFQQRYLVNFKYWGGANSS  62

Query  389   SPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETT  568
             +PIFA+ GAESPID+ P  IGFLTDNA  F ALLVYIEHRYYGKS+PFG+ EEA+ N +T
Sbjct  63    APIFAYFGAESPIDNSPNGIGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNAST  122

Query  569   RGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALAS  748
              GYFNSAQALADYA +L ++K    AQ+SP+IV GGSYGGMLASWFRLKYPH+ +GALAS
Sbjct  123   IGYFNSAQALADYAAILEHIKKTLHAQNSPVIVIGGSYGGMLASWFRLKYPHLTVGALAS  182

Query  749   SAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFK  928
             +APILYFD ITP+NGYYS+VT+D+++ SE CY+TI KSWS I ++AS+PNGL  LS +F 
Sbjct  183   AAPILYFDKITPQNGYYSVVTRDYRDASETCYETILKSWSEIHRVASQPNGLVTLSHRFN  242

Query  929   LCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGL  1108
              C  +    EL DYL STY  AAQY+QPP+YPV+E+CGGIDGA  G+DIL +I+AGVV L
Sbjct  243   TCHTVNQSYELIDYLRSTYVYAAQYNQPPRYPVSEICGGIDGASLGSDILSKIYAGVVAL  302

Query  1109  EGNRTCYDPQIYNPPT--SETIVGWRWQ  1186
              GN TC      N PT  SET VGWRWQ
Sbjct  303   WGNNTCK----VNGPTNVSETSVGWRWQ  326



>ref|XP_008344905.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=381

 Score =   432 bits (1110),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 261/351 (74%), Gaps = 9/351 (3%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSS----HFRTFYYRQTLDHFNYGPQSYATFKQ  343
             KIPRL+P   + +    +  ++ Q K LS+     F TFYY QTLDHFN+   S+ TF+Q
Sbjct  29    KIPRLSPTGGTFVH--GNYFANDQPKALSALDQNDFETFYYTQTLDHFNFRXDSFTTFQQ  86

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+++SKYWGG+  ++PI A+LGAE  ID D   IGFL++NA +F+AL ++IEHRYYGKS
Sbjct  87    RYLINSKYWGGSNVSAPILAYLGAEESIDTDLAIIGFLSENANQFQALQIFIEHRYYGKS  146

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+ SP+IV GGSYGGMLASW
Sbjct  147   IPFGSREEAFKNASTIGYFNSAQAIADYAEILIHVKKQLHAEDSPVIVIGGSYGGMLASW  206

Query  704   FRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             FRLKYPHVA+GALASSAPILYFDNI  PE GYY +VTKDF+E SE CYQTI+KSWSVID+
Sbjct  207   FRLKYPHVAVGALASSAPILYFDNIIPPEKGYYFIVTKDFQEASETCYQTIKKSWSVIDE  266

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  1060
             IASK  GLSILSKKF  C  L +  ELKDYL S Y  AAQYD PP+YPVT VCGGIDGA 
Sbjct  267   IASKDGGLSILSKKFHTCSLLNNSSELKDYLKSVYAXAAQYDSPPRYPVTVVCGGIDGAS  326

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPI  1213
              G D L +I  G+V   GNR+CY  Q  N   SET +GW WQ  S + + I
Sbjct  327   SGNDTLSKIFXGLVAYRGNRSCYVNQPGN--LSETDIGWGWQVISYIXLVI  375



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   436 bits (1121),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 307/482 (64%), Gaps = 19/482 (4%)
 Frame = +2

Query  185   RLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSK  364
             ++TP + S + R      S QT+   +     Y+ Q LDHFNY PQSY TF+QRY+++ K
Sbjct  27    KITPRFPSSIVRPEQLSVSSQTELYEAK----YFTQLLDHFNYQPQSYRTFQQRYLINDK  82

Query  365   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TM  541
             YWGGA   +PIF + G E  I+   +  GF+ D AP F+ALLV+IEHR+YGKSIPFG   
Sbjct  83    YWGGADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDT  142

Query  542   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  721
               A +N +T GY +S QALADYA +++ LK    A +SP++VFGGSYGGMLA+WFRLKYP
Sbjct  143   NVAYSNASTLGYLSSTQALADYATLIIDLKKNLSATNSPVVVFGGSYGGMLAAWFRLKYP  202

Query  722   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  901
             HVA+GALASSAPIL F+NIT    + +++T+DF+  SENCY+ I+ SW  I++ A K  G
Sbjct  203   HVAIGALASSAPILNFENITSPYTFNNIITQDFRSESENCYKVIKGSWEQIEETAMKNGG  262

Query  902   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDG  1054
             L +L K F++CK   S G ++++L + Y   A  D P         P YPV ++C  ID 
Sbjct  263   LEVLRKSFRICKNYISGGAIENWLSTAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDD  322

Query  1055  APKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1225
               +G D   +++          G   C+D    + P    +  W WQ C+EM MP+   +
Sbjct  323   PAQGNDTFAKLYGAANVYYNYTGTAACFDLADDSDP--HGLGEWTWQACTEMIMPVNANN  380

Query  1226  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1405
              +++F  + ++    +  C   + + PRP+WITT +GGHDIK VL +FGSNIIF NGLRD
Sbjct  381   EESIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRD  440

Query  1406  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1585
             P+S  GVLE IS +++A+  ++G+H +D+  A+  DP+WL + RK+EV+II  W ++YY 
Sbjct  441   PWSGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYH  500

Query  1586  EL  1591
             +L
Sbjct  501   DL  502



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 222/487 (46%), Positives = 303/487 (62%), Gaps = 32/487 (7%)
 Frame = +2

Query  206   SILQRSSSKHSSPQTKPLSS------HFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKY  367
             SI+ + +++    Q   LS       +++  ++ Q LDHFNY PQSY TF+QRY+++ +Y
Sbjct  11    SIIIQPAAEQQHDQQLSLSDKESNQIYYKEKFFTQILDHFNYNPQSYHTFQQRYLINDEY  70

Query  368   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TME  544
             WGG  +NSPIF + G E  ID   +  GF+ + APRF ALLV+IEHRYYGKS+PFG   E
Sbjct  71    WGGPTTNSPIFVYTGNEGRIDWFAQNTGFMFETAPRFNALLVFIEHRYYGKSVPFGGNKE  130

Query  545   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  724
              A  N +T GY +SAQALADYA V+L LKN   A  SP++VFGGSYGGMLA+W RLKYPH
Sbjct  131   TAYANSSTLGYLSSAQALADYAAVILDLKNNLTAADSPVVVFGGSYGGMLAAWLRLKYPH  190

Query  725   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  904
             VA+GALASSAPIL FDNIT    + +++T+DF+  SENCY+ I++SW  I++ A+KP GL
Sbjct  191   VAIGALASSAPILNFDNITSSFTFNNIITQDFRSESENCYKVIKRSWQEIEETAAKPGGL  250

Query  905   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGA  1057
              IL K FK+CK   S   L+ +L + Y   A  D P         P YPV ++C  ID  
Sbjct  251   EILRKSFKICKNYMSTDYLEGWLGTAYTYTAMTDYPTPTNFLNPMPAYPVKQMCKAIDDP  310

Query  1058  PKGADILDRIHAGV---VGLEGNRTCY------DPQIYNPPTSETIVGWRWQTCSEMAMP  1210
               G +  ++++A         GN  C+      DP    P       GW WQ C+EM + 
Sbjct  311   KSGNNTFEKLYAAASIYYNYTGNAKCFNLIDRSDPHGIRP-------GWNWQACTEMILL  363

Query  1211  IGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1390
                   D++F  + +S     + C   Y + PRP WI T +G   I  VL +FGSNIIF 
Sbjct  364   TDGNTEDSIFPASNYSYNDRLQYCKSNYDIDPRPTWIPTEFGARHIHRVLKRFGSNIIFF  423

Query  1391  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWI  1570
             NGLRDP+S  GVL+DIS +V+A+  + G+H +D+  +++ DP+WL E RK+EV II +W+
Sbjct  424   NGLRDPWSGGGVLKDISKSVVAIVAKEGAHHVDLRFSTREDPEWLREVRKREVHIISNWL  483

Query  1571  TKYYVEL  1591
             ++YY  L
Sbjct  484   SQYYHTL  490



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/488 (45%), Positives = 308/488 (63%), Gaps = 30/488 (6%)
 Frame = +2

Query  173   HKIPRL--TPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQR  346
             H IP+L  + +   + QRS S  +          +RT ++ Q LDHFNY PQSY TF+QR
Sbjct  26    HVIPKLPSSAVSPELQQRSISAQNGL--------YRTKFFTQILDHFNYNPQSYQTFQQR  77

Query  347   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  526
             Y+++  YWGGA+  +PIF ++G E  I    +  GF+ + AP F A+LV+IEHRYYGKSI
Sbjct  78    YLINDTYWGGAKKKAPIFVYMGNEGDIQWFAQNTGFMFEIAPYFNAILVFIEHRYYGKSI  137

Query  527   PFGTMEEAMN-NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             PFG  +E  N   +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+W
Sbjct  138   PFGGNDEVANKTSSTLGYMSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAW  197

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FR+KYPHVA+GALASSAPIL F ++     + ++VT+D+K  SENCY+ I+ SW  ID  
Sbjct  198   FRMKYPHVAIGALASSAPILQFLDLVSPYTFTNIVTQDYKSESENCYKVIKGSWKEIDDT  257

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEV  1036
             A+ P G+  L K F+LC    S G+LK++L +     A  D P         P YPV ++
Sbjct  258   ANTPGGIEQLQKSFRLCNNNISAGDLKNWLQTALMYTAMTDYPTPSNFVTPLPAYPVKKM  317

Query  1037  CGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             C  ID    G +   +++A         G+  C+D        S    GW WQ+C+EM M
Sbjct  318   CEAIDSKSSGNETFTKLYAAANIFYNYSGSVICFD-------ISNDSGGWDWQSCTEMIM  370

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             P+G  + +++F    + +++    C   Y + PRPHWITT +GGHDI  VL ++GSNIIF
Sbjct  371   PLGGNNEESIFPAHKWELEETLSYCKQTYHIDPRPHWITTEFGGHDIGRVLKRYGSNIIF  430

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSW  1567
              NGLRDP+S  GVL++IS T++A+  + G+H +D+  ++K DP+WL + RK+EV+II SW
Sbjct  431   FNGLRDPWSGGGVLKNISKTLIAIVAKEGAHHVDLRFSTKEDPEWLKDVRKQEVKIITSW  490

Query  1568  ITKYYVEL  1591
             I++YY +L
Sbjct  491   ISQYYQDL  498



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 302/469 (64%), Gaps = 33/469 (7%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             + T YY Q LDHF + PQSY TF+QRY++S K+WGGA+ N+PIF + G E  I+   +  
Sbjct  49    YETKYYTQILDHFTFTPQSYQTFQQRYLISYKHWGGAKKNAPIFVYTGNEGDIEWFTQNT  108

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ +NAP FKALLV+IEHR+YGKSIPFG  ++ A  N +T GY +S QALADYA +++ 
Sbjct  109   GFMFENAPHFKALLVFIEHRFYGKSIPFGGNKDVAYANSSTLGYLSSTQALADYATLIID  168

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPILYFDNIT E  ++S 
Sbjct  169   LKKNLSAVDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDNITSEYSFHST  228

Query  806   VTKDFKEV------------------SENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  931
             V  DF+                    SENCY+ I+ SW +I+  A +  GL  L K F++
Sbjct  229   VGNDFRAFVHMHVSLFDTGKCWRRSESENCYKVIKGSWQLIEDTAEQSGGLDTLRKSFRI  288

Query  932   CKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1084
             CK   S G L  +L + +   A  D P         P YPV ++C  ID    G + L++
Sbjct  289   CKNYISAGALVSWLSTAFIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDRKAGNNTLEK  348

Query  1085  IHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1255
             +++         G  TC++    + P    +  W WQ C+EM +PIG  + D +F P+ +
Sbjct  349   LYSAANVYYNSTGRATCFNLNDDSDP--HGLDEWSWQACTEMILPIGGNNADGIFPPSEW  406

Query  1256  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1435
                  ++ C+D +GV PRP+WITT +GGH+I+ VL +FGSNIIF NGLRDP+S  GVL+D
Sbjct  407   DYAGRAQSCEDAFGVQPRPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRDPWSGGGVLKD  466

Query  1436  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             IS +++A+  + G+H +D+  ++  DP+WL   R++EV+II++W+++YY
Sbjct  467   ISKSLVAIVAKEGAHHVDLRFSTPEDPEWLKHARRREVKIIENWLSQYY  515



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 300/453 (66%), Gaps = 20/453 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T Y+ Q LDHF++ P+SY  F Q+Y+++S++W   +   PIF + G E  ID      
Sbjct  46    FETLYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF++D AP+F ALLV+IEHR+YG+S PFG  +++  +  T GY NS QALADYA ++  L
Sbjct  103   GFMSDIAPKFGALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL+FDNI P   +Y  +
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAI  220

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS---  979
             ++DFK+ S NC++ I++SW  ++ +++  +GL  LSKKF+ CKGL S    +D+L S   
Sbjct  221   SQDFKDASVNCFEVIKRSWQELEAVSNMKHGLPELSKKFRTCKGLHSQYAARDWLMSAFI  280

Query  980   -----TYCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1132
                   Y TAA +  P P YPV ++C  IDG P+G+  LDR  A         G+  C+ 
Sbjct  281   YTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCF-  339

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              ++  P     + GW WQ C+EM MP+   ++ +MF P     + F   C   YGV PRP
Sbjct  340   -ELEQPTDDHGLDGWGWQACTEMVMPMSCSNQ-SMFPPYDNDYEAFKEQCMSRYGVKPRP  397

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  398   HWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADL  457

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
               ASK DP+WL EQR++EV II+ WI++Y+  L
Sbjct  458   RAASKGDPEWLKEQRRQEVAIIEKWISEYHRAL  490



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 300/471 (64%), Gaps = 21/471 (4%)
 Frame = +2

Query  206   SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQS  385
             S L R  S   S Q +     + T Y+ Q LDHF++     +TF+QRY+++ KYW GA+ 
Sbjct  38    STLNREKSFLQSSQYE-----YETKYFTQRLDHFSFKNHKNSTFQQRYLINDKYWLGAER  92

Query  386   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNET  565
               PIF + G E  ID      GF+ D AP+F ALLV+ EHRYYG+S+P+G+   A  +  
Sbjct  93    MGPIFYYCGNEGYIDWFAVNTGFMWDIAPQFGALLVFPEHRYYGESMPYGSQSMAYKDGD  152

Query  566   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  745
             +  Y  + QALAD+A +++ LK    A+  P+++FGGSYGGMLA+W RLKYPH+A+GALA
Sbjct  153   SLSYLTAEQALADFATLIVDLKKNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALA  212

Query  746   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  925
             SSAPIL F++I P + +Y+LV+ DFK  SENC++ I++SW  ++    +  GL  LSKKF
Sbjct  213   SSAPILQFEDIVPSDTFYNLVSNDFKRESENCFKVIQQSWKALETYGERDEGLQNLSKKF  272

Query  926   KLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADIL  1078
             ++C+ L S  E++D+L+S Y   A  D P         P YP+ EVC  ID    G D+L
Sbjct  273   RMCRDLNSTDEIEDWLNSAYSNLAMVDYPYPASFLMPLPAYPIKEVCKVIDSFSNGTDVL  332

Query  1079  DRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DRI AGV       G   C+D  + + P  E   GW WQ C+EM MP+      ++F   
Sbjct  333   DRIFAGVSVYYNYTGEEKCFD--VNDDPHGEN--GWNWQACTEMVMPMSSNPESSIFPQF  388

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
              F ++ ++++C + +GV PRPHWITT +GG DIK VL  +GSNIIFSNGL DP+S  GVL
Sbjct  389   TFDIESYTKNCLNMFGVEPRPHWITTEFGGQDIKRVLKNYGSNIIFSNGLLDPWSGGGVL  448

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             ++IS++++A+ T  G+H LD+  A++ DP WL EQR  E++II  W+ +YY
Sbjct  449   QNISNSIVALVTELGAHHLDLRAATENDPLWLVEQRNAEMKIINKWMNEYY  499



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   434 bits (1117),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 296/451 (66%), Gaps = 15/451 (3%)
 Frame = +2

Query  281   YYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT  460
             ++ Q LDH+ + PQSY TF+QRY+++ KYWGGA+ N+PIF + G E  I+   +  GF+ 
Sbjct  53    FFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFAQNTGFIF  112

Query  461   DNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNK  637
             D AP FK L+V+IEHR+YGKS+PFG  +E A +N +T GY  S QALADYA +++ LK  
Sbjct  113   DIAPHFKPLVVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATLIIDLKKN  172

Query  638   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  817
               A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASS+PIL F+NIT    + +++T+D
Sbjct  173   LSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSPILNFENITSPYSFNNIITQD  232

Query  818   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  997
             F+  SENCY+ I++SW  I+  AS+P GL IL + F++C+   S   L+ +L +     A
Sbjct  233   FRGESENCYKVIKRSWQEIENTASQPGGLEILRRSFRICRNSISASSLQSWLYTALVYTA  292

Query  998   QYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQI  1141
               D P         P YPV E+C  ID    G +   +++          G  TC++   
Sbjct  293   MTDYPTPSNFLSPMPAYPVKEMCKAIDDPKTGNNTFAKLYGAASVYYNYSGTATCFNLDD  352

Query  1142  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1321
              + P    + GW WQ C+EM +P    ++D++F  + ++    +  C  Y+GV PRP+WI
Sbjct  353   DSDP--HGLGGWSWQACTEMILPTSGNNKDSIFTASEWNYDDRATFCKAYFGVEPRPNWI  410

Query  1322  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1501
             TT +GGHDIK VL +FGSNIIF NGLRDP+S  GVLE+IS +++A+  + G+H +D+  A
Sbjct  411   TTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENISSSIVAIVAKQGAHHVDLRFA  470

Query  1502  SKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             +  DP WL + RK+EV II  W++KYY +L+
Sbjct  471   TSEDPKWLQDVRKREVSIIAKWLSKYYDDLD  501



>ref|XP_010493392.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=353

 Score =   428 bits (1101),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 256/353 (73%), Gaps = 5/353 (1%)
 Frame = +2

Query  551   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  730
             M N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  1     MKNASTLGYLNTAQALADYAAILLHIKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIA  60

Query  731   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  910
             LGALASSAP+LYF++  P+ GYY ++TK FKE +  CY TIRKSW  IDK+A+KPNGL I
Sbjct  61    LGALASSAPLLYFEDTRPKFGYYYIITKVFKETNMRCYNTIRKSWKEIDKVAAKPNGLLI  120

Query  911   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDR  1084
             L KKFK C  L    +LKD+LD+ Y  A QY++     V+ VC  I+  P  +  DILDR
Sbjct  121   LGKKFKTCAPLNRSFDLKDFLDTIYAEAVQYNE--GILVSNVCNAINANPPNRKIDILDR  178

Query  1085  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1264
             I AGVV L GN++CYD   Y+   +   + WRWQ CSE+ +P+G   +DTMF  +PF+M 
Sbjct  179   IFAGVVALTGNQSCYDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDTMFPTSPFNMT  237

Query  1265  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1444
              F   C+  YGV PRPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS  GVLED+SD
Sbjct  238   SFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVGGVLEDLSD  297

Query  1445  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1603
             +V+A+ T NGSHC DI   SK DP+WL  QR++E++II SW++ Y  ++  L 
Sbjct  298   SVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSWLSTYQKDIRDLN  350



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/450 (46%), Positives = 294/450 (65%), Gaps = 15/450 (3%)
 Frame = +2

Query  281   YYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT  460
             Y+ Q LDHFNY PQSY TF+QRY+++ KYWGGA   +PIF + G E  I+   +  GF+ 
Sbjct  33    YFTQLLDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNTGFMF  92

Query  461   DNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNK  637
             D AP F+ALLV+IEHR+YGKSIPFG     A +N +T GY +S QALADYA +++ LK  
Sbjct  93    DTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIIDLKKN  152

Query  638   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  817
               A +SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL F+NIT    + +++T+D
Sbjct  153   LSATNSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFENITSPYTFNNIITQD  212

Query  818   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  997
             F+  SENCY+ I+ SW  I++ A K  GL +L K F++CK   S G ++++L + Y   A
Sbjct  213   FRSESENCYKVIKGSWEQIEETAMKNGGLEVLRKSFRICKNYISGGAIENWLSTAYVYTA  272

Query  998   QYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQI  1141
               D P         P YPV ++C  ID   +G D   +++          G   C+D   
Sbjct  273   MTDYPTPSNFLSPMPAYPVKQMCKAIDDPAQGNDTFAKLYGAANVYYNYTGTAACFDLAD  332

Query  1142  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1321
              + P    +  W WQ C+EM MP+   + +++F  + ++    +  C   + + PRP+WI
Sbjct  333   DSDP--HGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEPRPNWI  390

Query  1322  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1501
             TT +GGHDIK VL +FGSNIIF NGLRDP+S  GVLE IS +++A+  ++G+H +D+  A
Sbjct  391   TTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIVAIVAKDGAHHVDLRFA  450

Query  1502  SKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  DP+WL + RK+EV+II  W ++YY +L
Sbjct  451   TSEDPEWLQDVRKREVKIITKWFSEYYHDL  480



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 300/457 (66%), Gaps = 15/457 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             +RT Y+ Q LDHFN+ P+SY TF+QRY+++  +WGGA++N+PIF + G E  I+   + +
Sbjct  49    YRTKYFTQILDHFNFYPKSYQTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFAQNL  108

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GFL + AP FK+L+V+IEHR+YGKSIP+G  +  A +N +T G+ +S QALADYA +++ 
Sbjct  109   GFLYETAPHFKSLVVFIEHRFYGKSIPYGGKKSVAYSNASTLGHLSSTQALADYASLIID  168

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASS+PIL F+NIT    + ++
Sbjct  169   LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSSPILNFENITSSYSFRNI  228

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             VT+DFK VSENCY+ I+ SW  I+  A++P GL +L K FKLCK       L+D+L + Y
Sbjct  229   VTQDFKSVSENCYKVIKGSWEQIENTANQPGGLELLRKSFKLCKNGADLDYLEDWLSTAY  288

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P +PV ++C  ID    G D   +++          G  TC+
Sbjct  289   AYTAMTDYPTPSNFLCPLPAFPVKKMCEAIDDPTTGNDTFAKLYGAANVYYNYSGTVTCF  348

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             +    + P    + GW WQ C+EM MP G  + D++F  + +  +  +  C   +G+ PR
Sbjct  349   ELDDNSDP--HDLGGWYWQACTEMIMPTGGNNEDSIFPASDWDYKDQASVCKSRFGIEPR  406

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P WITT +GGH I+ VL ++GSNIIF NGLRDP+S  GVL++IS +++A+  + G+H +D
Sbjct  407   PLWITTEFGGHAIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVD  466

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +   S  DP+WL + RK+E++II  WI++YY +L  L
Sbjct  467   LMFKSSEDPEWLQDVRKQEIKIIAKWISQYYHDLAQL  503



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   432 bits (1111),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 308/490 (63%), Gaps = 29/490 (6%)
 Frame = +2

Query  164   PPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQ  343
             PP+   PR T    S+ Q  + K   P        F+T ++ Q LDHF Y P+SY  F Q
Sbjct  30    PPIF-FPRATHQSSSLKQDDTLKEKIP--------FKTQFFPQILDHFTYNPKSYIIFYQ  80

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             +Y+++S++W      +PIF + G E  I+      GFL D AP+F+ALLV+IEHRYYG+S
Sbjct  81    KYLINSQFW---HHGAPIFVYTGNEGNIEWFAANTGFLLDIAPKFRALLVFIEHRYYGES  137

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             +PFG  +++ N+  T GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+W
Sbjct  138   LPFG--KDSYNSAETVGYLNSQQALADYAVLIRSLKQNLSSEASPVVVFGGSYGGMLAAW  195

Query  704   FRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  883
             FRLKYPH+A+GALASSAPIL+FD+I P+  +Y  V++DFK VS NCYQ I+ SW+ +   
Sbjct  196   FRLKYPHIAIGALASSAPILHFDDIIPQTSFYDAVSQDFKSVSLNCYQVIKGSWAELAAF  255

Query  884   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEV  1036
             +S+  GL+ LSK FK CKGL S    +++L + +   A  + P         P YPV E+
Sbjct  256   SSQGQGLAELSKNFKSCKGLHSVDAAQNWLWAAFVYTAMVNYPTEANFMMHLPAYPVKEM  315

Query  1037  CGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAM  1207
             C  ID  P G   L +  A             C+D  I +   +  + GW WQ C+EM M
Sbjct  316   CKIIDALPPGETKLSKAFAAASLYYNYSQTEKCFD--IEHGSDAHGLHGWDWQACTEMVM  373

Query  1208  PIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIF  1387
             P+     ++MF P  ++   F+  C   YGV PRPHWI T +GG  I+ +L +FGSNIIF
Sbjct  374   PMS-CSSESMFTPYSYNYSAFAEQCMKNYGVTPRPHWIATEFGGKQIEKILKRFGSNIIF  432

Query  1388  SNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSW  1567
             SNG++DP+S  GVL++IS +++A+ T  G+H +D   A+K DP+WL EQRK+EV+IIQSW
Sbjct  433   SNGMQDPWSRGGVLKNISASIVALVTEEGAHHVDFRFATKDDPNWLVEQRKQEVDIIQSW  492

Query  1568  ITKYYVELEA  1597
             I +YY +L +
Sbjct  493   IDEYYADLRS  502



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 214/458 (47%), Positives = 298/458 (65%), Gaps = 17/458 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             +RT Y+ Q LDHFN+ P+SY TF+QRY+++  +WGGA+SN+PIF + G E  ID   +  
Sbjct  59    YRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIDWFAQNT  118

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GFL + AP FKAL+V+IEHR+YGKSIP+G  +E A  N TT GY +S QALADYA +++ 
Sbjct  119   GFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYGNATTLGYLSSTQALADYASLIID  178

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F+NIT    + ++
Sbjct  179   LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSFSNI  238

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             VT+DF+  SENCY+ I+ SW  I+  A +P GL +L   FK+CK   S  +L+ +L + +
Sbjct  239   VTQDFRSESENCYKVIKGSWEQIESTADEPGGLELLRNSFKICKNYISADDLEGWLRTAF  298

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P +PV ++C  ID    G D   +++          G  TC+
Sbjct  299   TYTAMTDYPTPSNFLSPMPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGKATCF  358

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP-FSMQQFSRDCDDYYGVPP  1306
             D    +      + GW WQ C+EM MP+G G+ +   FPA  +  +  +  C   +G+ P
Sbjct  359   DLDDDS--DPHDLGGWSWQACTEMIMPMG-GNTEVSIFPASEWKYKYRAASCMRNFGIEP  415

Query  1307  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1486
             RP WITT +GGHDIK VL ++GSNIIF NGLRDP+S  GVL++IS +++A+  + G+H +
Sbjct  416   RPLWITTEFGGHDIKRVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHV  475

Query  1487  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             D+   +  DP+WL E RK+E+ II +WI++YY +L  L
Sbjct  476   DLRFKNSEDPEWLKEVRKQEINIIGNWISQYYHDLAQL  513



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   432 bits (1112),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 222/492 (45%), Positives = 312/492 (63%), Gaps = 23/492 (5%)
 Frame = +2

Query  170   LHKIPRLTPLYESILQRSSSKHSSPQTK-PLSSH----FRTFYYRQTLDHFNYGPQSYAT  334
             LH +P  +   +S  +R  S   SP+ K  LS+     + T Y+ Q LDHFNY P+SY T
Sbjct  22    LHSLPVYSA--KSSHRRFPSLLISPEEKISLSARQNQLYTTKYFTQVLDHFNY-PKSYET  78

Query  335   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  514
             F+ RY+++  YWGGA+SNSPIF + G E  I+   +  GFL + AP FKAL+++IEHR+Y
Sbjct  79    FQHRYLINDTYWGGAKSNSPIFVYTGNEGNIEWFAENTGFLYETAPHFKALIIFIEHRFY  138

Query  515   GKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  691
             GKS+PFG  ++ A +N TT GY +S QALADYA +++ LK    A  SP++V GGS+G M
Sbjct  139   GKSLPFGGKKDVAYSNATTLGYLSSTQALADYASLIIDLKKNLTATDSPVVVLGGSHGEM  198

Query  692   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  871
             LA+WFRLKYPHV +GALASS+PIL F+NIT    + +++TKDF   SE+CY+ I+ SW  
Sbjct  199   LAAWFRLKYPHVTIGALASSSPILNFNNITSPESFNNIITKDFMSESESCYKVIKGSWQQ  258

Query  872   IDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYP  1024
             I   A +  GL +L K FKLCK + S  +L+++L+S +   A  D P         P YP
Sbjct  259   IKDTAKQHGGLELLQKSFKLCKNIISVDDLQNWLESAFIYTAMTDYPTPSNFMTPVPAYP  318

Query  1025  VTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCS  1195
             V ++C  ID    G D   +++  V       G  TC+DP   + P    + GW WQ C+
Sbjct  319   VKQMCKAIDNPATGNDTFAKLYGAVTVYYNYSGTTTCFDPDDNSDP--HDLGGWDWQACT  376

Query  1196  EMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGS  1375
             EM M     D++++F P+    +     C + YGV PRP+WITT +GGHDIK VL ++GS
Sbjct  377   EMIMQTNGNDKESIFPPSESQYKDQVSYCKEAYGVEPRPNWITTEFGGHDIKRVLRRYGS  436

Query  1376  NIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEI  1555
             NIIF NGLRDP+S  GVL +IS  ++A+  + G+H +D+   +  DP+WL + RK+EV+I
Sbjct  437   NIIFFNGLRDPWSGGGVLSNISKRIVAIVAKEGAHHVDLRFKTNEDPEWLKDVRKQEVKI  496

Query  1556  IQSWITKYYVEL  1591
             I  WI++YY +L
Sbjct  497   IAKWISEYYHDL  508



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 294/451 (65%), Gaps = 15/451 (3%)
 Frame = +2

Query  281   YYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT  460
             ++ Q LDH+ + PQSY TF+QRY+++ KYWGGA+ N+PIF + G E  I+   +  GF+ 
Sbjct  53    FFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFAQNTGFIF  112

Query  461   DNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNK  637
             D AP FK LLV+IEHR+YGKS+PFG  +E A +N +T GY  S QALADYA +++ LK  
Sbjct  113   DIAPHFKPLLVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATLIIDLKKN  172

Query  638   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  817
               A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASS+PIL F+NIT    + +++T+D
Sbjct  173   LSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSPILNFENITSPYSFNNIITQD  232

Query  818   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  997
             F+  SENCY+ I++SW  I+  AS+P GL IL   F++C+   S   L+ +L +     A
Sbjct  233   FRGESENCYKVIKRSWQEIEDTASQPGGLEILRSSFRICRNSMSASSLQSWLYTALVYTA  292

Query  998   QYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQI  1141
               D P         P YPV E+C  ID    G     +++          GN TC++   
Sbjct  293   MTDYPTPSNFLNPMPAYPVKEMCKAIDDPKTGNKTFAKLYGAASVYYNYSGNATCFNHDD  352

Query  1142  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1321
              + P    + GW WQ C+EM +P    ++D++F  + ++    +  C  Y+GV PRP+WI
Sbjct  353   DSDP--HGLGGWSWQACTEMILPTSGNNKDSIFPASEWNYDDRASFCKAYFGVEPRPNWI  410

Query  1322  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1501
             T  +GGHDIK VL +FGSNIIF NGLRDP+S  GVLE+IS +++A+  + G+H +D+  A
Sbjct  411   TAEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENISSSIVAIIAKQGAHHVDLRFA  470

Query  1502  SKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             +  DP WL + RK+EV II  W+++YY +L+
Sbjct  471   TSEDPKWLQDVRKREVSIIAKWLSEYYDDLD  501



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 208/453 (46%), Positives = 298/453 (66%), Gaps = 20/453 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T Y+ Q LDHF++ P SY  F Q+Y+++S +W   +   PIF + G E  ID      
Sbjct  47    FETRYFPQNLDHFSFTPDSYKVFHQKYLINSHFW---RKGGPIFVYTGNEGDIDWFATNT  103

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF++D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY NS QALAD+A ++  L
Sbjct  104   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADFAILIRSL  161

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL+FDNI P   +Y  V
Sbjct  162   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAV  221

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             ++DFK+ S NC++ I++SW  +D +++  NGL  LSKKF+ CKGL S    +D+L   + 
Sbjct  222   SQDFKDASINCFKVIKRSWEELDALSTMKNGLQELSKKFRTCKGLHSIYSARDWLSGAFV  281

Query  989   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1132
               A  + P         P YPV ++C  IDG P+G+  LDR  A         G++ C++
Sbjct  282   YTAMVNYPTAANFMASLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSKKCFE  341

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              +         + GW++Q C+EM MP+   ++ +M  P     + F   C   YGV PRP
Sbjct  342   ME--QQSDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYENDYEAFKEQCMSRYGVKPRP  398

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  399   HWITTEFGGKSIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADL  458

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
               A+K DP+WL EQR++EV II++WI++YY +L
Sbjct  459   RAATKGDPEWLKEQRRQEVAIIENWISEYYRDL  491



>ref|XP_004306148.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=795

 Score =   441 bits (1133),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 303/454 (67%), Gaps = 17/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             +RT Y+ Q LDHFNY P+SY TF+QRY+++  +WGGA+SN+PIF + G E  I+   +  
Sbjct  340   YRTKYFTQILDHFNYYPKSYDTFQQRYLINDTFWGGAKSNAPIFVYTGNEGIIEWFAQNT  399

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GFL + AP FKAL+++IEHR+YGKSIPFG  ++ A +N TT GY +S QALADYA +++ 
Sbjct  400   GFLYETAPHFKALIIFIEHRFYGKSIPFGGKKDVAYSNATTLGYLSSTQALADYASLIID  459

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASS+PIL F+NIT    + ++
Sbjct  460   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSSPILNFENITSPYSFNNI  519

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             VTKDF+  SE+CY+ I+ SW  I++ A++P G+ +L K F++CK   +  +L+ +L++ Y
Sbjct  520   VTKDFR--SESCYKVIKGSWQQIEETANQPGGIELLRKSFRICKNHFTGYDLEGWLETAY  577

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1129
                A  D P         P YPV ++C  ID    G D   ++           G  TC+
Sbjct  578   IYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPATGNDTFAKLFGAATVYYNYTGTATCF  637

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             DP   + P    + GW+WQ C+EM MP    + ++MF P+ +  Q     C+  YGV PR
Sbjct  638   DPNDNSDP--HDLGGWQWQACTEMIMPTSGNNEESMFPPSEWRYQGRVSYCEGAYGVEPR  695

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P+WITT +GGHDIK VL ++GSNIIF NGLRDP+S  GVL +IS++++A+  + G+H +D
Sbjct  696   PNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISESIVAIVAKEGAHHVD  755

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +   +  DP+WL + RK+E+ II  WI++YY +L
Sbjct  756   LRFKTSEDPEWLKDVRKQEIGIIAKWISEYYHDL  789



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/476 (45%), Positives = 306/476 (64%), Gaps = 25/476 (5%)
 Frame = +2

Query  206   SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQS  385
             S+ Q+  +  S P+       F T Y+ Q LDHF++ P+SY  F Q+Y+++S++W   + 
Sbjct  31    SLRQKKKASKSKPELP-----FETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RK  82

Query  386   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNET  565
               PIF + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S P    +++  +  
Sbjct  83    GGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPI--RKKSHKSAE  140

Query  566   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  745
             T GY NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALA
Sbjct  141   TLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALA  200

Query  746   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  925
             SSAPIL+FDNI P   +Y  V++DFK+ S NC++ I++SW  +D +++K NGL  LSKKF
Sbjct  201   SSAPILHFDNIVPLTSFYDAVSQDFKDASMNCFKVIKRSWEELDAVSTKKNGLQELSKKF  260

Query  926   KLCKGLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADIL  1078
             + CKGL+S     ++L   +         TAA +  P P YPV E+C  IDG P+G+  L
Sbjct  261   RTCKGLQSRYSASNWLSGAFVYTAMVNYPTAANFMAPLPGYPVEEMCKIIDGFPRGSSNL  320

Query  1079  DRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DR  A         G+  C++ +         + GW++Q C+EM MP+   ++ +M  P 
Sbjct  321   DRAFAAASLYYNYSGSEKCFEME--QQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPY  377

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
                 + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL
Sbjct  378   DNDYEAFEEQCKSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVL  437

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             ++IS +++A+ T+ G+H  D+  A+K DP+WL EQR +EV II+ WI++YY +L  
Sbjct  438   KNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYYRDLRG  493



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 312/491 (64%), Gaps = 32/491 (7%)
 Frame = +2

Query  158   PPPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATF  337
             PP   H +  L         R SSK  S         F T Y+ Q LDHF++ P+SY  F
Sbjct  21    PPGGFHHLSSLRQ------NRKSSKSKSELP------FETRYFPQNLDHFSFRPESYKVF  68

Query  338   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  517
              Q+Y+++S++W   +   PIF + G E  ID      GF++D AP+F+ALLV+IEHR+YG
Sbjct  69    HQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYG  125

Query  518   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  697
             +S PFG  +++  +  T GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA
Sbjct  126   ESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLA  183

Query  698   SWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVID  877
             +WFRLKYPH+A+GALASSAPIL+FDNI P   +Y  +++DFK+ S NC++ I++SW  ++
Sbjct  184   AWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELE  243

Query  878   KIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS--------TYCTAAQYDQP-PKYPVT  1030
              +++  +GL  LSKKF+ CKGL S    +D+L           Y TAA +  P P YPV 
Sbjct  244   AVSNMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFVYTAMVNYATAANFMAPLPGYPVE  303

Query  1031  EVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEM  1201
             ++C  IDG P+G+  LDR  A         G+  C+  ++  P     + GW +Q C+EM
Sbjct  304   QMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCF--ELEQPTDDHGLDGWGYQACTEM  361

Query  1202  AMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNI  1381
              MP+   ++ +MF P     + F   C   YGV PRPHWITT +GG  I+ VL +FGSNI
Sbjct  362   VMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIESVLKRFGSNI  420

Query  1382  IFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQ  1561
             IFSNG++DP+S  GVL++IS +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+
Sbjct  421   IFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIE  480

Query  1562  SWITKYYVELE  1594
              WI++YY +++
Sbjct  481   KWISEYYRDMK  491



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   429 bits (1104),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/458 (46%), Positives = 303/458 (66%), Gaps = 19/458 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYG-PQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  445
             + T Y+ Q LDHFNY  PQ   TF+QRY+++ KYWGG+++N+PIF + G E  I+   + 
Sbjct  40    YETNYFTQILDHFNYNNPQ---TFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQN  96

Query  446   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLL  622
              GF+ + AP F ALLV+IEHR+YGKSIP+G  +  A +N+TT GY +S QALADYA +++
Sbjct  97    TGFMFEIAPHFNALLVFIEHRFYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLII  156

Query  623   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  802
              LKN   A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F NIT    + +
Sbjct  157   DLKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFGNITSPYSFNN  216

Query  803   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  982
             ++T+DFK  SENCY+ I+ SW  I+ +A    GL  L K F++CK   S G L+++L + 
Sbjct  217   IITQDFKGESENCYKVIKGSWKQIEDMAKTKGGLEKLRKSFRICKNYISQGALENWLYTA  276

Query  983   YCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTC  1126
             +   A  D P         P YPV ++C  ID    G D  ++I+          GN TC
Sbjct  277   FVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPKSGKDTFEKIYGAANIYYNYTGNATC  336

Query  1127  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1306
             ++   ++ P    + GW WQ C+EM MP    +++++F P+ +   + ++ C   +GV P
Sbjct  337   FNLNDHSDP--HGLAGWTWQACTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSNFGVEP  394

Query  1307  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1486
             RP+W+TT +GG++I+ VL +FGSNIIF NGLRDP+S AGVL+DIS +++A+  + G+H +
Sbjct  395   RPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHHV  454

Query  1487  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             D+  +SK DP WL + R++EV II +W+++YY  L  +
Sbjct  455   DLRWSSKEDPKWLKQVREREVNIISNWLSQYYQSLNEI  492



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   430 bits (1105),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 290/451 (64%), Gaps = 15/451 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             + T Y+ Q LDHFNY P SY TF+QRY+ + K WGGA++N+PIF + G E  I+   +  
Sbjct  52    YETKYFTQILDHFNYNPDSYQTFQQRYLFNDKNWGGAKTNAPIFVYTGNEGDIEWFTQNT  111

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ + AP FKALLV+IEHR+YGKSIP+G  +E A +N +T GY +S QALADYA +++ 
Sbjct  112   GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKEIAYSNTSTLGYLSSTQALADYATLIID  171

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F NIT    + ++
Sbjct  172   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFQNITSPYSFNNI  231

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+  SENCY+ I+ SW  I+ +A    GL  L K F++CK   SP  L ++L + +
Sbjct  232   ITQDFRGESENCYKVIKGSWKKIEDMAKTTGGLKKLRKSFRICKNYISPDSLVNWLSTAF  291

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P YPV E+C  ID    G D  ++++          G  TC 
Sbjct  292   TYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANIYYNYTGKATCL  351

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             +    + P    + GW WQ C+EM MP    +++++F P+ +   +  R C     V PR
Sbjct  352   NLNDNSDP--HGLGGWTWQACTEMVMPTNGNNKESIFPPSEWDYNERVRFCKLILDVKPR  409

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P WITT +GGHDI+ VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D
Sbjct  410   PDWITTEFGGHDIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHVD  469

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1582
             +  +SK DP+WL E R +E+ II  WI++YY
Sbjct  470   LRWSSKEDPEWLREVRAREINIISKWISQYY  500



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 301/454 (66%), Gaps = 20/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T Y+ Q LDHF++ P+SY  F+Q+Y+++ ++W   +   PIF + G E  ID      
Sbjct  46    FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF++D AP+F+ALLV+IEHR+YG+S PFG  +++     T GY +S QALADYA ++  L
Sbjct  103   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  160

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL+FDNI P   +Y  +
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLASFYDAI  220

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS---  979
             ++DFK+ S NC++ I++SW  +D +++  +GL  LSKKF+ CKGL S    +D+L     
Sbjct  221   SQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCKGLHSIYSARDWLMEAFV  280

Query  980   -----TYCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
                   Y TAA +  P P YPV ++C  IDG P+G+  LDR  A         G+  C+ 
Sbjct  281   YTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCF-  339

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              ++  P     + GW +Q C+EM MP+   ++ +MF P     + F   C   YGV PRP
Sbjct  340   -ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRP  397

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  398   HWITTEFGGKKIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADL  457

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
               A+K DP+WL EQR++EV II+ WI++YY +L+
Sbjct  458   RAATKGDPEWLKEQRRQEVAIIEKWISEYYRDLK  491



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 305/459 (66%), Gaps = 19/459 (4%)
 Frame = +2

Query  266   HFRTFYYRQTLDHFNYG-PQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  442
             ++ T Y+ Q LDHFN+  PQ   TF+QRY+++ KYWGG+++N+PIF + G E  I+   +
Sbjct  40    NYDTKYFTQILDHFNFNNPQ---TFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQ  96

Query  443   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVL  619
               GF+ + AP F ALLV+IEHRYYGKSIP+G  +  A +N+TT GY +S QALADYA ++
Sbjct  97    NTGFMFEIAPHFNALLVFIEHRYYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLI  156

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
             + LKN   A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F NIT    + 
Sbjct  157   IDLKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFGNITSPYSFN  216

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
             +++T+DFK  S+NCY+ I+ SW  I+ +A    GL  L K F++CK   S G L+++L +
Sbjct  217   NIITQDFKGESDNCYKVIKGSWKQIEDMAKTKGGLEKLRKSFRICKNYISQGALENWLYT  276

Query  980   TYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRT  1123
              +   A  D P         P YPV ++C  ID    G D  ++I+          GN T
Sbjct  277   AFVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPKGGKDTFEKIYEAANIYYNYTGNAT  336

Query  1124  CYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVP  1303
             C+D   ++ P    + GW WQ+C+EM MP    +++++F P+ +   + ++ C   +GV 
Sbjct  337   CFDLNDHSDP--HGLAGWTWQSCTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSIFGVE  394

Query  1304  PRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHC  1483
             PRP+W+TT +GG++I+ VL +FGSNIIF NGLRDP+S AGVL+DIS +++A+  + G+H 
Sbjct  395   PRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHH  454

Query  1484  LDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +D+  +SK DP WL + R++EV II +W+++YY  L  +
Sbjct  455   VDLRWSSKEDPKWLQQVREREVNIISNWLSQYYQSLNEI  493



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 296/454 (65%), Gaps = 20/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T Y+ Q LDHF++ P+SY  F Q+Y+++  +W   +   PIF + G E  ID      
Sbjct  48    FETRYFPQNLDHFSFKPESYKVFHQKYLINGSFW---RKGGPIFVYTGNEGDIDWFASNT  104

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF++D AP+FKALLV+IEHR+YG+S P G  +++     T GY NS QALADYA ++  L
Sbjct  105   GFMSDIAPKFKALLVFIEHRFYGESTPLG--KKSPKTAETLGYLNSQQALADYAILIRSL  162

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL+FDNI P   +Y  +
Sbjct  163   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSFYDAI  222

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS---  979
             ++DFK+ S NC + I++SW  ++ +++   GL  LSKKF+ CKGL+S    +D+L S   
Sbjct  223   SQDFKDASVNCVKVIKRSWEELEAVSTMKTGLPELSKKFRTCKGLQSIYSARDWLMSAFV  282

Query  980   -----TYCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
                   Y TAA +  P P YPV ++C  +DG P+G+  LDR  A         G++ C++
Sbjct  283   YTAMVNYATAANFMAPLPAYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSKKCFE  342

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              +   P     + GW WQ C+EM MP+   ++ +MF P     + F   C   YGV PRP
Sbjct  343   ME--QPTDDHGLDGWGWQACTEMVMPMSISNQ-SMFPPYDNDYEAFQDQCMGRYGVKPRP  399

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  400   HWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADL  459

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
               A+K DP+WL EQR +EV II+ WIT+YY +L 
Sbjct  460   RAATKDDPEWLKEQRMQEVTIIEQWITQYYKDLR  493



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/500 (44%), Positives = 315/500 (63%), Gaps = 32/500 (6%)
 Frame = +2

Query  134   TCGGLSETPPPPLHKIPRLTP--LYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHF  307
             TC   S T   P + +P   P   Y+S+++++ +    P+ K     F+  Y+ QTLDHF
Sbjct  14    TC---SATLITPANSLPTFFPGATYQSLIKQAKT----PKPK---LPFKVHYFPQTLDHF  63

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
              + P+S   F Q+Y+++S YW      +PIF + G E  I+      GF+ D AP+FKAL
Sbjct  64    TFQPKSSKIFYQKYLINSHYW---HKGAPIFVYTGNEGDIEWFAANTGFMLDIAPKFKAL  120

Query  488   LVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIV  667
             LV+IEHR+YG+S PFG  +E+  +  T GY NS QALAD+A ++  LK    ++ SP++V
Sbjct  121   LVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALADFAVLIRNLKQNLSSEASPVVV  178

Query  668   FGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQ  847
             FGGSYGGMLA+WFRLKYPH+A+GALASSAPIL FD I P + +Y  V++DFK+VS NCY+
Sbjct  179   FGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIIPWSSFYDAVSQDFKDVSWNCYE  238

Query  848   TIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP-----  1012
              I+ SW  ++ ++++   L+ LSK F+ CK L S    +D+L + +   A  + P     
Sbjct  239   VIKGSWEELEAMSTQKEALAELSKAFRTCKSLHSTASARDWLWTAFVYTAMVNYPTEANF  298

Query  1013  ----PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIV  1171
                 P YPV E+C  ID  P GA  L R  A             C++  I +   +  + 
Sbjct  299   LKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYSRAENCFE--IEHEVDTHGLH  356

Query  1172  GWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIK  1351
             GW WQTC+EM MP+    +++MF P+ F  ++F+  C   Y V PRPHWITT +GG  I+
Sbjct  357   GWDWQTCTEMVMPM-TCSKESMFPPSGFDYEEFAEQCQMKYEVLPRPHWITTEFGGERIQ  415

Query  1352  LVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTE  1531
              VL KFGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H +D   A+K DPDWL E
Sbjct  416   KVLKKFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSATKDDPDWLVE  475

Query  1532  QRKKEVEIIQSWITKYYVEL  1591
             QR++EVEIIQ W+ +YY +L
Sbjct  476   QRRQEVEIIQKWLNEYYADL  495



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/474 (45%), Positives = 305/474 (64%), Gaps = 24/474 (5%)
 Frame = +2

Query  206   SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQS  385
             S L++      S Q  P    F T Y+ Q LDHF + P+SY  F Q+Y+++S++W   + 
Sbjct  29    SSLRQQKKASKSKQELP----FETRYFPQNLDHFGFTPESYTVFHQKYLINSRFW---RK  81

Query  386   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNET  565
               PIF + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++  +  
Sbjct  82    GGPIFVYTGNEGDIDWFASNTGFMSDIAPKFQALLVFIEHRFYGESTPFG--KKSHKSAE  139

Query  566   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  745
             T GY +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALA
Sbjct  140   TLGYLSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALA  199

Query  746   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  925
             SSAPIL+FDNI P   +Y  +++DFK+ S NC+  I++SW  ++ +++  NGL  LSKKF
Sbjct  200   SSAPILHFDNIVPLTSFYDAISQDFKDASINCFTVIKRSWEELEAVSTMKNGLQELSKKF  259

Query  926   KLCKGLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADIL  1078
             + CKGL+S    +D+L   +         TAA +  P P YPV ++C  IDG P+G+  L
Sbjct  260   RTCKGLQSKYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNL  319

Query  1079  DRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DR  A         G+  C++ +         + GW++Q C+EM MP+   ++ +M  P 
Sbjct  320   DRAFAAASLYYNYSGSEKCFEME--QQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPY  376

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
                 + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL
Sbjct  377   DNDYEAFQEQCMSTYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVL  436

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             ++IS +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +L
Sbjct  437   KNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVSIIEKWISEYYRDL  490



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/484 (44%), Positives = 303/484 (63%), Gaps = 18/484 (4%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             +PR +    +  Q +  K +S  T P +  ++  ++ QTLDHFN+ P+SY TF+QRY+++
Sbjct  25    LPRFSSSINT--QPADQKKTSLSTTP-NKLYKEKFFTQTLDHFNFNPKSYQTFQQRYLIN  81

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
               YW G ++N+PIF + G E  I+   +  GF+ DNAP+F ALLV++EHR+YGKSIPFG 
Sbjct  82    DTYWAGPKNNAPIFMYTGNEGEIEWFAQNTGFMFDNAPKFNALLVFVEHRFYGKSIPFGG  141

Query  539   MEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
              +E A +N +T GY  S Q+LADYA ++  LKN   A  SP++VFGGSYGGMLA+WFRLK
Sbjct  142   NKEVAYSNASTLGYLTSTQSLADYATLITDLKNNLSATDSPVVVFGGSYGGMLAAWFRLK  201

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHV +GALASSAPIL F NIT    + +++T DF+  SENCY+ I+ SW  I+  A++ 
Sbjct  202   YPHVTIGALASSAPILGFVNITSPYSFNNIITHDFRSESENCYKVIKGSWQQIEDTANQH  261

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  1048
              GL  L K FK+CK   S G L+++L + +  +A  D P         P +PV ++C  I
Sbjct  262   GGLEKLRKSFKICKNYISAGSLENWLSTAWVYSAMTDYPTPSNFLNPLPAFPVKQMCKAI  321

Query  1049  DGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR  1219
             D    G D   + HA         G  TC+D    + P    + GW WQ C+EM +P G 
Sbjct  322   DDPTAGNDTFAKFHAAASVYYNYSGTATCFDLDDDSDP--HGLGGWDWQACTEMILPTGG  379

Query  1220  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1399
                +++F  + +        C   + + PRP+WITT +GGH+IK+ L +F SNIIF NGL
Sbjct  380   STAESIFPASEWDYNDRVTYCKLRFDIDPRPNWITTEFGGHNIKMALKRFASNIIFFNGL  439

Query  1400  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1579
             RDP+S  GVLEDIS +++A+    G+H +D+  A+  DP WL E R+KEV+II  W++ Y
Sbjct  440   RDPWSGGGVLEDISKSLVALVEEKGAHHVDLRFATSEDPKWLQEVRQKEVKIIAKWLSDY  499

Query  1580  YVEL  1591
             Y +L
Sbjct  500   YQDL  503



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/469 (45%), Positives = 302/469 (64%), Gaps = 28/469 (6%)
 Frame = +2

Query  221   SSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIF  400
             S SKH  P        F T Y+ Q LDHF++ P SY  F Q+Y++++++W   +   PIF
Sbjct  38    SKSKHELP--------FETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIF  86

Query  401   AWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYF  580
              + G E  ID      GF+ D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY 
Sbjct  87    VYTGNEGDIDWFASNTGFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYL  144

Query  581   NSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPI  760
             NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPI
Sbjct  145   NSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPI  204

Query  761   LYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKG  940
             L+FDNI P   +Y  +++DFK+ S NC++ I++SW  ++ +++  NGL  LSKKF+ CKG
Sbjct  205   LHFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELEAVSTMKNGLQELSKKFRTCKG  264

Query  941   LKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHA  1093
             L S    +D+L   +         TAA +  P P YPV ++C  IDG P+G+  LDR  A
Sbjct  265   LHSQYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFA  324

Query  1094  GVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1264
                      G+  C++ +         + GW++Q C+EM MP+   ++ +M  P     +
Sbjct  325   AASLYYNYSGSEKCFEME--QQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDSE  381

Query  1265  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1444
              F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS 
Sbjct  382   AFQEQCMTRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISS  441

Query  1445  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +L
Sbjct  442   SIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDL  490



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   428 bits (1100),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 294/457 (64%), Gaps = 15/457 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             +RT Y+ Q LDHFN+ P+SY TF+QRY+++  +WGGA+SN+PIF + G E  I+   +  
Sbjct  59    YRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIEWFAQNT  118

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GFL + AP FKAL+V+IEHR+YGKSIP+G  +E A +N TT GY +S QALADYA +++ 
Sbjct  119   GFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYSNATTLGYLSSTQALADYASLIID  178

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F+NIT    + ++
Sbjct  179   LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSFTNI  238

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+  SENCY+ I+ SW  I+  A +P GL +L   FK+CK   S   L+ +L + +
Sbjct  239   ITQDFRSESENCYKVIKGSWEQIESTADQPGGLELLRNSFKICKNYISADYLEGWLRTAF  298

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P +PV ++C  ID    G D   +++          G  TC+
Sbjct  299   TYTAMTDYPTPSNFLSPLPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGTATCF  358

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D    +      + GW WQ C+EM MP      +++F  + +     +  C   +G+ PR
Sbjct  359   DLDDDS--DPHDLGGWSWQACTEMIMPTSGNTEESIFPASEWKYXYRAASCKRSFGIEPR  416

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P WITT +GGHDI+ VL ++GSNIIF NGLRDP+S  GVL++IS +++A+  + G+H +D
Sbjct  417   PLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVD  476

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +   +  DPDWL E RK+E+ II +WI++YY +L  L
Sbjct  477   LRFKNSEDPDWLKEVRKQEINIIGNWISQYYHDLAQL  513



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   427 bits (1099),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 300/454 (66%), Gaps = 20/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F T Y+ Q LDHF++ P+SY  F+Q+Y+++ ++W   +   PIF + G E  ID      
Sbjct  78    FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  134

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF++D AP+F+ALLV+IEHR+YG+S PFG  +++     T GY +S QALADYA ++  L
Sbjct  135   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  192

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL+FDNI P   +Y  +
Sbjct  193   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLASFYDAI  252

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS---  979
             ++DFK+ S NC++ I++SW  +D +++  +GL  LSKKF+ CKGL S    +D+L     
Sbjct  253   SQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFV  312

Query  980   -----TYCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
                   Y T A +  P P YPV ++C  IDG P+G+  LDR  A         G+  C+ 
Sbjct  313   YTAMVNYATTANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCF-  371

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              ++  P     + GW +Q C+EM MP+   ++ +MF P     + F   C   YGV PRP
Sbjct  372   -ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRP  429

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  430   HWITTEFGGKRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADL  489

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
               A+K DP+WL EQR++EV I++ WI++YY +L+
Sbjct  490   RAATKGDPEWLKEQRRQEVAIVEKWISEYYRDLK  523



>ref|XP_006388622.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
 gb|ERP47536.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
Length=357

 Score =   421 bits (1082),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 259/350 (74%), Gaps = 11/350 (3%)
 Frame = +2

Query  146   LSETPPPPLHKIPRLTPLYESILQRSSSKHSSPQT--KPLSSHFRTFYYRQTLDHFNYGP  319
              S   P   +KIP+L    ++I        + PQT  K  S     FYY QTLDHFNY P
Sbjct  16    FSSCLPTTQYKIPKLGAFQKNI------HRTEPQTSSKSSSKDLVMFYYTQTLDHFNYKP  69

Query  320   QSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYI  499
             +SY TF+QRY++  +YWGGA +++PIF + GAE  +DDD   IGFL+DNAP FKALL+YI
Sbjct  70    ESYTTFRQRYVIDFRYWGGANTSAPIFVFFGAEEDLDDDLDAIGFLSDNAPHFKALLIYI  129

Query  500   EHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGS  679
             EHRYYG+SIPFG+ +EA+ N  T GY NSAQA+ADYA V+++LK KY A++SP+IV GGS
Sbjct  130   EHRYYGRSIPFGSRKEALKNAETLGYLNSAQAMADYAAVIMHLKKKYSAKNSPVIVIGGS  189

Query  680   YGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRK  859
             YGGML SWFRLKYPH+ALGALASSAPILYFD+I+P+ GYYS+VTKDFKE SE+CY TIRK
Sbjct  190   YGGMLTSWFRLKYPHIALGALASSAPILYFDDISPQEGYYSIVTKDFKETSESCYNTIRK  249

Query  860   SWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVC  1039
             SW  I+KIASKPNGLSILSKKFK C  L    EL+D+LDS Y  AAQYD PP++PV+ VC
Sbjct  250   SWGEIEKIASKPNGLSILSKKFKTCFPLNRTFELEDFLDSIYFEAAQYDYPPEFPVSIVC  309

Query  1040  GGIDGAPKG-ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ  1186
             GGI+ A     DILDRI A VV   GNR+C+D   +N P  + I  WRWQ
Sbjct  310   GGINKASAARTDILDRILAVVVAYMGNRSCHDMNAFNYP--DAIYEWRWQ  357



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   426 bits (1096),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 298/468 (64%), Gaps = 15/468 (3%)
 Frame = +2

Query  227   SKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAW  406
             S+ +S  +   +  ++  ++ Q LDHFN+ P+SY TF++RY+++  +WGG + N+PIF +
Sbjct  29    SQKTSLSSSTSNGLYKEKFFTQVLDHFNFNPESYHTFQERYLINDTFWGGPKKNAPIFLY  88

Query  407   LGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFN  583
              G E  I+   +  GF+ D AP F ALLV+IEHR+YGKSIPFG  ++ A +N +T GY  
Sbjct  89    TGNEGDIEWFAQNTGFMFDIAPHFNALLVFIEHRFYGKSIPFGGDKKVAYSNASTLGYLT  148

Query  584   SAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPIL  763
             S QALADYA ++  LKN   A  SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL
Sbjct  149   STQALADYATLMTDLKNNLSATESPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPIL  208

Query  764   YFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGL  943
              F NIT    + S++T DF+  SENCY+ I+ SW  I+  AS+P GL  L K FK+CK  
Sbjct  209   GFVNITSPYSFNSIITNDFRNESENCYKVIKGSWQKIEDTASQPGGLEKLRKAFKICKNY  268

Query  944   KSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAG  1096
              S G L+ +L + +   A  D P         P +PV ++C  ID    G D   +++  
Sbjct  269   ISAGSLESWLYTAWTYTAMTDYPTSSNFLNPLPPHPVKQMCKAIDDPTTGNDTFAKLYGA  328

Query  1097  VV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1267
                     G  TC+D  + N      + GW WQ C+EM +P G  ++++MF  + +S+  
Sbjct  329   ASVYYNHSGTATCFD--LDNNSDPHGLGGWSWQACTEMILPTGGNNKESMFPASSWSLND  386

Query  1268  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1447
              +  C   + + PRP+W+   +GGH+IK VL +FGSNIIF NGLRDP+S  GVLEDIS +
Sbjct  387   RATYCQYAFHIQPRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRDPWSGGGVLEDISKS  446

Query  1448  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             ++A+  + G+H +D+  AS  DP WL   RK+E++II  W+++YY++L
Sbjct  447   IIAIVAKKGAHHVDLRYASSEDPKWLQHVRKREIKIIAKWLSEYYLDL  494



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   427 bits (1097),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 209/455 (46%), Positives = 292/455 (64%), Gaps = 17/455 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             + T Y+ Q LDHF + P+SY TF+QRY+++S +WGG Q N+PIF + G E  I+   +  
Sbjct  60    YETRYFTQVLDHFGFRPESYQTFQQRYLINSTFWGGPQRNAPIFVYTGNEGDIEWFTQNT  119

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ + APRF ALLV+IEHR+YGKSIPFG  +E A +N +T GY +S QALADYA ++  
Sbjct  120   GFMFETAPRFNALLVFIEHRFYGKSIPFGGNKEVAYSNSSTLGYLSSTQALADYATLITD  179

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK  + A+ SP++VFGGSYGGMLA+WFRLKYPH+A+GAL+SS+PIL FDNIT    +  +
Sbjct  180   LKKNWTAEDSPVVVFGGSYGGMLAAWFRLKYPHIAIGALSSSSPILNFDNITSPYSFNDI  239

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+  SENCYQ I++SW  I+ +A +  GL IL K F LCK     G L+ +L +  
Sbjct  240   ITRDFRSESENCYQVIKQSWQKIEDMAEQHGGLKILGKSFGLCKNSMDAGYLQGWLQTAL  299

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P YPV ++C  ID   KG D   +++          G  +C+
Sbjct  300   IYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPSKGDDDFAKLYGAANIYYNYSGGVSCF  359

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA-PFSMQQFSRDCDDYYGVPP  1306
             D  + +      +  W WQ C+EM +P G G+R+T  FPA  ++       C   +GV P
Sbjct  360   D--LLDDSDPHGLGEWAWQACTEMILPTG-GNRETSIFPAHEYNYNDRVATCTSLFGVVP  416

Query  1307  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1486
             RP WI   +GGHDI+  L +FGSNIIF NGLRDP+S  GVL+ IS +++A+    G+H +
Sbjct  417   RPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSGGGVLKSISKSIVAIVAEKGAHHV  476

Query  1487  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             D+  ++  DP+WL + RKKE++II  WI++YY +L
Sbjct  477   DLRYSTNEDPEWLQDVRKKEIKIISGWISQYYRDL  511



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   426 bits (1095),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 210/476 (44%), Positives = 304/476 (64%), Gaps = 25/476 (5%)
 Frame = +2

Query  206   SILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQS  385
             S+ Q+  +  S P+       F T Y+ Q LDHF++ P+SY  F Q+Y+++++ W   + 
Sbjct  31    SLRQKKKASKSKPELP-----FETRYFPQNLDHFSFTPESYKVFHQKYLINNRSW---RK  82

Query  386   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNET  565
               PIF + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S P G  +++  +  
Sbjct  83    GGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAE  140

Query  566   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  745
             T GY NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALA
Sbjct  141   TLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALA  200

Query  746   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  925
             SSAPIL+FDNI P   +Y  V++DFK+ S NC++ I++SW  +D +++K NGL  LSKKF
Sbjct  201   SSAPILHFDNIVPLTSFYDAVSQDFKDASINCFKVIKRSWEELDAVSTKKNGLQELSKKF  260

Query  926   KLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADIL  1078
             + CKGL+S     ++L   +   A  + P         P YPV ++C  IDG P+G+  L
Sbjct  261   RTCKGLQSIYSASNWLSGAFVYTAMVNYPTPANFMAPLPGYPVEQMCKIIDGFPRGSSNL  320

Query  1079  DRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
             DR  A         G+  C++  +        + GW++Q C+EM MP+   ++ +M  P 
Sbjct  321   DRAFAAASLYYNYSGSEKCFE--MEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPY  377

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
                 + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL
Sbjct  378   DNDYEAFKEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVL  437

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1597
             ++IS +++A+ T+ G+H  D+  A+K DP+WL EQR +EV II+ WI++YY +L  
Sbjct  438   KNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYYRDLRG  493



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   426 bits (1095),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 298/454 (66%), Gaps = 20/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T Y+ Q LDHF + P  Y  F Q+Y++SS+YW      +PIF + G E  I+      
Sbjct  50    YKTRYFPQLLDHFTFQPNGYKIFYQKYLISSQYW---HKEAPIFVYTGNEGDIEWFAANT  106

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GFL D AP+F+ALLV+IEHR+YG+S+PFG  +++  +  T GY NS QALAD+A ++  L
Sbjct  107   GFLLDIAPKFRALLVFIEHRFYGESMPFG--KDSYKSAETLGYLNSQQALADFAVLIRSL  164

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL FD+ITP + +Y  V
Sbjct  165   KQNLSSEASPVVVFGGSYGGMLATWFRLKYPHIAIGALASSAPILQFDDITPWSSFYDAV  224

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             ++DF+E S NCY+ I+ SW+ ++ ++S+  GL  LS+ F+ CK L S   + D+L S Y 
Sbjct  225   SQDFREASLNCYEVIKGSWAELETLSSQKEGLIELSRTFRTCKDLHSLDSVWDWLWSAYV  284

Query  989   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
              +A  + P         P YPV E+C  IDG P GA  + R+ A             C+ 
Sbjct  285   YSAMVNYPTEANFMKPLPAYPVKEMCKIIDGFPAGASKVSRVFAAASLYYNYSRGEKCF-  343

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              Q+ N P +  + GW WQ C+EM MP+    +++MF P+ +  ++F+ +C   +GV PR 
Sbjct  344   -QLENVPDAHGLHGWNWQACTEMVMPM-TCSKESMFPPSGYDYKEFAEECKKKFGVMPRQ  401

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I  VL +FGSNIIFSNG+ DP+S  GVL++IS +++A+ T+ G+H +D 
Sbjct  402   HWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWSRGGVLKNISSSIIAIVTKKGAHHVDF  461

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
               A+K DP+WL E RK+E++II  WI +YY +L+
Sbjct  462   RSATKDDPNWLKEMRKQEIQIIGRWIDEYYADLK  495



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   426 bits (1094),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 214/477 (45%), Positives = 303/477 (64%), Gaps = 28/477 (6%)
 Frame = +2

Query  200   YESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGA  379
             Y+S L++   K   P        F+  Y+ Q LDHF + P+S   FKQ+Y+++ KYW   
Sbjct  35    YQSSLKKQHVKSKIP--------FKAHYFPQILDHFTFLPKSSKVFKQKYLINDKYW---  83

Query  380   QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNN  559
             Q   PIF + G E  ID      GF+ D AP+F ALLV+IEHR+YG S+PFG  +++  +
Sbjct  84    QKGGPIFVYTGNEGNIDWFAANTGFMLDIAPKFHALLVFIEHRFYGNSMPFG--KKSYKS  141

Query  560   ETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGA  739
               T GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLASWFRLKYPH+A+GA
Sbjct  142   PKTLGYLNSQQALADYAVLIRSLKQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGA  201

Query  740   LASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSK  919
             +ASSAPIL FD ITP + +Y  V++DFKE S NCY+ I+ SW+ ++ ++    GL+ +S 
Sbjct  202   VASSAPILQFDKITPWSSFYDAVSQDFKESSLNCYEVIKGSWTELNALSKHEEGLTKVST  261

Query  920   KFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGAD  1072
              F+ CKGL S    +D+L   +   A  + P         P YPV E+C  IDG PKGA 
Sbjct  262   LFRTCKGLHSVYSARDWLWEAFVYTAMVNYPTEANFMMPLPAYPVKEMCRIIDGFPKGAS  321

Query  1073  ILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
              + R  A             C++ +  N   +  + GW WQ C+EM MP+   + ++MF 
Sbjct  322   KISRAFAAASLYYNYTQTEKCFNLEGGN--DAHGLHGWDWQACTEMVMPMTCSN-ESMFP  378

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P+ +S ++F  DC   YGV PRPHWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  G
Sbjct  379   PSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGG  438

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             VL++IS +++A+ T+ G+H +D    +K DPDWL  QRK+E+ IIQ W+ +YY++L+
Sbjct  439   VLKNISASIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEMAIIQKWLEEYYIDLK  495



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   426 bits (1095),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/504 (44%), Positives = 317/504 (63%), Gaps = 32/504 (6%)
 Frame = +2

Query  170   LHKIPRLTPLY---------ESILQRSSSKHSSPQTKPLS-----SHFRTFYYRQTLDHF  307
             LH I RL  LY           IL R  S   S + K  S     S +RT ++ Q LDHF
Sbjct  5     LHFILRLFSLYLVTSSTFALSPILPRFPSSAVSAELKQSSNSAPNSLYRTKFFTQILDHF  64

Query  308   NYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKAL  487
             N+ PQS   F+QRY+++  +WGGA++N+PIF + G E  I+   +  GF+ +NAP F AL
Sbjct  65    NFNPQSNHVFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFHAL  124

Query  488   LVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPII  664
             LV+IEHR+YGKSIPFG   + A  N +T GY +S QALADYA +++ LK    A  SP++
Sbjct  125   LVFIEHRFYGKSIPFGGNRKVAYANASTLGYLSSTQALADYATLIIDLKKNLSATDSPVV  184

Query  665   VFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCY  844
             VFGGSYGGMLA+WFR+KYPHVA+GALASSAPIL+F ++   + + +++++DF+  SENCY
Sbjct  185   VFGGSYGGMLAAWFRMKYPHVAIGALASSAPILHFMDLVSPDIFNNIISQDFRSESENCY  244

Query  845   QTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---  1012
             + ++ SW +ID  A+KP GL +L K F++CK     PG L+++L + +   A  D P   
Sbjct  245   KVLKGSWKLIDDTANKPGGLQLLQKSFRICKSNDFGPGFLENWLRTAWVYTAMTDYPTPS  304

Query  1013  ------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSET  1165
                   P YP+ ++C  ID      D L +++A         G  TC+D    +      
Sbjct  305   NFLSPLPAYPIKKMCEAIDREKN--DGLGKLYAAASVYYNYTGTATCFDLDDDS--DPHD  360

Query  1166  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1345
             + GW+WQ C+EM MP+G  ++ ++F    +S Q  +  C  +Y V PRPHWITT +GGH 
Sbjct  361   LGGWQWQACTEMIMPVGGSNKHSIFPEYVWSYQDRASACQFFYNVTPRPHWITTEFGGHA  420

Query  1346  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1525
             I+ VL +  SNIIF NGLRDP+S  GVL++IS T++A+  + G+H +D+  ++K DP WL
Sbjct  421   IQTVLKRSASNIIFFNGLRDPWSGGGVLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWL  480

Query  1526  TEQRKKEVEIIQSWITKYYVELEA  1597
              + R++EV II SWI++YY +L +
Sbjct  481   KDVRRQEVNIIASWISQYYQDLHS  504



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   426 bits (1095),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 209/464 (45%), Positives = 294/464 (63%), Gaps = 15/464 (3%)
 Frame = +2

Query  239   SPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAE  418
             S  TK  +  ++  Y+ Q LDHFN+ P+SY TF+ RY+++  YW G + NSPIF + G E
Sbjct  43    SLATKRGTKLYKARYFTQILDHFNFNPKSYQTFQHRYLINDTYWSGPEKNSPIFVYTGNE  102

Query  419   SPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQA  595
               I+   +  GF+ D AP FKALLV+IEHR+YGKSIPFG  ++ A +N +T GY  S QA
Sbjct  103   GDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDIAYSNASTLGYLTSTQA  162

Query  596   LADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDN  775
             LADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL F+N
Sbjct  163   LADYATLIIDLKKNLTADDSPVVVFGGSYGGMLATWFRLKYPHIVIGALASSAPILNFEN  222

Query  776   ITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPG  955
             IT    + +++T+DF+  SENCY+ I+ SW  I+   S+  GL +L K F++CK      
Sbjct  223   ITSPYSFNNIITQDFRSESENCYKVIKGSWEQIEDTGSRSGGLELLRKSFRICKNYIDAD  282

Query  956   ELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---  1099
              L+ +L + +   A  D P         P YPV ++C  ID    G D   +++      
Sbjct  283   ALESWLTTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKSIDDPTTGNDSFAKLYGAANVY  342

Query  1100  VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRD  1279
                 G  TC++  +   P    +  W WQ C+EM MP    ++D++F  + +S  Q +  
Sbjct  343   YNHTGTTTCFN--LAYSPDPHGLDMWSWQACTEMIMPTDGNNQDSIFPESQWSYSQRAAV  400

Query  1280  CDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAV  1459
             C  YYGV PRP+WITT +GGHDI   L +FGSNIIF NGLRDP+S  GVL++IS T++A+
Sbjct  401   CKGYYGVDPRPNWITTEFGGHDISRALKRFGSNIIFYNGLRDPWSGGGVLKNISKTIVAI  460

Query  1460  YTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
                 G+H +D+  A+  DP WL + R++EV+II +WI++YY +L
Sbjct  461   VAEQGAHHVDLRFATSQDPKWLQQVREREVKIISNWISQYYHDL  504



>ref|XP_008344907.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Malus 
domestica]
Length=355

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/326 (63%), Positives = 249/326 (76%), Gaps = 7/326 (2%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSS----HFRTFYYRQTLDHFNYGPQSYATFKQ  343
             KIPRL+P   + +    +  ++ Q K LS+     F TFYY QTLDHFN+   S+ TF+Q
Sbjct  29    KIPRLSPTGGTFVH--GNYFANDQPKALSALDQNDFETFYYTQTLDHFNFRXDSFTTFQQ  86

Query  344   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  523
             RY+++SKYWGG+  ++PI A+LGAE  ID D   IGFL++NA +F+AL ++IEHRYYGKS
Sbjct  87    RYLINSKYWGGSNVSAPILAYLGAEESIDTDLAIIGFLSENANQFQALQIFIEHRYYGKS  146

Query  524   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  703
             IPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+ SP+IV GGSYGGMLASW
Sbjct  147   IPFGSREEAFKNASTIGYFNSAQAIADYAEILIHVKKQLHAEDSPVIVIGGSYGGMLASW  206

Query  704   FRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             FRLKYPHVA+GALASSAPILYFDNI  PE GYY +VTKDF+E SE CYQTI+KSWSVID+
Sbjct  207   FRLKYPHVAVGALASSAPILYFDNIIPPEKGYYFIVTKDFQEASETCYQTIKKSWSVIDE  266

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  1060
             IASK  GLSILSKKF  C  L +  ELKDYL S Y  AAQYD PP+YPVT VCGGIDGA 
Sbjct  267   IASKDGGLSILSKKFHTCSLLNNSSELKDYLKSVYARAAQYDSPPRYPVTVVCGGIDGAS  326

Query  1061  KGADILDRIHAGVVGLEGNRTCYDPQ  1138
              G D L +I AG+V   GNR+CY  Q
Sbjct  327   SGNDTLSKIFAGLVAYRGNRSCYVNQ  352



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 293/457 (64%), Gaps = 15/457 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T Y+ Q LDHFNY P SY TF+QRY+ + K+WGGA++N+PIF + G E  I+   +  
Sbjct  52    YKTNYFTQILDHFNYNPDSYQTFQQRYLFNDKHWGGAKNNAPIFVYTGNEGDIEWFTQNT  111

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ + AP FKALLV+IEHR+YGKSIP+G  +  A +N +T GY +S QALADYA +++ 
Sbjct  112   GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKVIAYSNTSTLGYLSSTQALADYATLIID  171

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F+NIT    + ++
Sbjct  172   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSFNNI  231

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+  SENCY  I+ SW  I+  A    GL  L K F++CK   SP  L ++L + +
Sbjct  232   ITQDFRGESENCYNVIKGSWKKIEDTAKTTGGLKKLRKSFRICKNYISPDFLVNWLSTAF  291

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P YPV E+C  ID    G D  ++++          G  TC+
Sbjct  292   TYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANMYYNYSGKATCF  351

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D    + P    + GW WQ C+EM MP    +++++F P+ +   +  R C     V PR
Sbjct  352   DLNDNSDP--HGLGGWTWQACTEMVMPTDGNNKESIFPPSEWDYNERVRFCQLILDVKPR  409

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
               WITT +GG++I+ VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D
Sbjct  410   SDWITTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHVD  469

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1600
             +  +SK DP+WL E R +EV II +WI++YY  L  L
Sbjct  470   LRWSSKEDPEWLREVRGREVNIISNWISQYYQTLTDL  506



>ref|XP_006424415.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37655.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=303

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 242/308 (79%), Gaps = 8/308 (3%)
 Frame = +2

Query  689   MLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWS  868
             MLA+WFRLKYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS
Sbjct  1     MLAAWFRLKYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWS  60

Query  869   VIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI  1048
              ID++AS+P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGI
Sbjct  61    QIDEVASQPDGLAILSNKFRTCRPLGDSYELKGYLRLMYAHAAQYNHPPDYPVSMVCGGI  120

Query  1049  DGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRG  1222
             DGA  G DI+ +I AGVV  +GN +CY     NPPT  +ET VGWRWQ CSEM +PIG  
Sbjct  121   DGAAFGNDIISKIFAGVVAYKGNMSCY----VNPPTNETETTVGWRWQRCSEMVIPIGTV  176

Query  1223  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1402
             +  TMF P PF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLR
Sbjct  177   NT-TMFQPTPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLR  235

Query  1403  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKY  1579
             DPYSS GVLE+ISD+V+A+ T NGSHCLDI  A++ +DPDWL  QR+ E+EII+ WI+KY
Sbjct  236   DPYSSGGVLENISDSVVAIATINGSHCLDILRANQSSDPDWLVTQRETEIEIIEGWISKY  295

Query  1580  YVELEALK  1603
             Y +L+A+K
Sbjct  296   YADLKAIK  303



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/454 (45%), Positives = 300/454 (66%), Gaps = 15/454 (3%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             +RT ++ Q LDHFNY PQSY  F+QRY+++  YWGGA+  +PIF + G E  I+   +  
Sbjct  47    YRTKFFTQILDHFNYNPQSYQKFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFTQNT  106

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ + AP F ALLV+IEHR+YGKSIPFG  ++ A  N +T GY +SAQALADYA +++ 
Sbjct  107   GFMFEQAPYFNALLVFIEHRFYGKSIPFGGKKKVAYANSSTLGYLSSAQALADYATLIID  166

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFR+KYPHVA+GALASSAPIL FD++     + ++
Sbjct  167   LKKNLSATESPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAPILQFDDLVSPYAFDNI  226

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             +T+DF+  SENCY+ I+ SW++I++ A K  GL +L K FK+C        L+ +L   +
Sbjct  227   ITQDFRSESENCYKVIKGSWNLIEETAKKHGGLELLRKSFKICNNYIGVDALEGWLGQAW  286

Query  986   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                A  D P         P YPV ++C  ID +  G + L++++          G   C+
Sbjct  287   IYTAMTDYPTPTNFLSPLPAYPVRKMCEAIDSSVTGKNTLEKLYDAASIYYNYSGTSKCF  346

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             D   ++ P    + GW+WQ CSEM MP G   ++++F  + +S++  +  C   Y V PR
Sbjct  347   DLNDHSDP--HDLGGWQWQACSEMIMPEGASSKESIFPESKWSVKDRNAYCKFAYNVVPR  404

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             P+WIT+ +GGH+I++VL +   NIIF NGLRDP+S  GVL++IS T++A+  + G+H +D
Sbjct  405   PNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVD  464

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             +  ++K DP WL + RK+EV+II+SWI++Y+ +L
Sbjct  465   LRYSTKEDPKWLKDVRKQEVKIIESWISQYHQDL  498



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   424 bits (1089),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 215/485 (44%), Positives = 307/485 (63%), Gaps = 29/485 (6%)
 Frame = +2

Query  179   IPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVS  358
             IPR +     +L    ++ +S     L SHF T Y+ Q LDHF++ P+SY  F Q+Y+++
Sbjct  30    IPRRS---HHLLSSRQNRKTSKSNTELPSHFETRYFPQNLDHFSFQPESYQVFHQKYLIN  86

Query  359   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  538
             S++W   +   PIF + G E  I+      GF+ D AP+FKALLV+IEHR+YG+S P   
Sbjct  87    SRFW---RKGGPIFVYTGNEGDIEWFASNTGFMLDIAPKFKALLVFIEHRFYGESKPHKL  143

Query  539   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  718
                      T G+ NS QALADYA ++  LK    ++ SP+IVFGGSYGGMLA+WFRLKY
Sbjct  144   A-------NTLGFLNSQQALADYAILIRSLKQNLTSEASPVIVFGGSYGGMLAAWFRLKY  196

Query  719   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  898
             PH+A+GALASSAPIL FDNI P + +Y  V++DFKEVS NC++ I++SW  ++  ++  +
Sbjct  197   PHIAIGALASSAPILNFDNIVPSSSFYDTVSQDFKEVSVNCFEVIKRSWGEMEVFSTIKD  256

Query  899   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGID  1051
             GL  LSK F+ CK L S      +L++ +   A  + P         P YPV ++C  +D
Sbjct  257   GLQELSKMFRTCKTLHSVDSASGWLETAFIETAMVNYPTPANFMAPLPAYPVGQMCKIMD  316

Query  1052  GAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1222
               P  A  L+R  A         G+ TC+D +  N   S  + GW WQ C+EM MP+   
Sbjct  317   ELPLEASNLERAFAAASLYYNYSGSVTCFDME--NHTDSHGLNGWGWQACTEMVMPMSCS  374

Query  1223  DRDTMFFPAPFSMQQFSRD-CDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1399
             ++ TMF P     ++ +++ C   YGV PRP+WITT +GG  I++VL +FGSNIIFSNGL
Sbjct  375   NQ-TMFRPFESDDEKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGL  433

Query  1400  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1579
             +DP+S  GVL++IS +++A+ TR G+H  D+  A+K DP+WL +QR++EV II+ WI++Y
Sbjct  434   QDPWSGGGVLKNISSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEY  493

Query  1580  YVELE  1594
             Y +LE
Sbjct  494   YNDLE  498



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   423 bits (1088),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 299/459 (65%), Gaps = 21/459 (5%)
 Frame = +2

Query  266   HFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  445
             HF T +Y Q LDHF + P+S   F Q+Y+++ +YW   ++ +PIF + G E  I+     
Sbjct  48    HFETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFTAN  104

Query  446   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  625
              GFL D AP+F ALLV+IEHR+YG+S+PFG   ++ N+  T GY  S QALADYA ++  
Sbjct  105   TGFLPDIAPKFHALLVFIEHRFYGESMPFGN--DSYNSAETLGYLTSQQALADYAVLIRS  162

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    ++ SP++ FGGSYGGMLA+WFRLKYPH+ +GALASSAPIL+FDNI P + +Y  
Sbjct  163   LKQNLSSEASPVVAFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPWSSFYDA  222

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             V++DFK+ S NC++ I++SW+ +++  S+  GL+ LSK F+ CK L S   ++D+L S +
Sbjct  223   VSQDFKDASLNCFKVIKESWTELEQEFSE-EGLAELSKTFRTCKNLHSVSSVRDWLWSAF  281

Query  986   C--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                      T A + +P P YPV E+C  ID        LD++ A             C+
Sbjct  282   VYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLDKVFAAASLYYNYSHGEKCF  341

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             +  + N P    + GW WQ C+EM MP+   ++ +MF P+ F  ++F+ DC   YGV PR
Sbjct  342   N--VENGPDLHGLSGWDWQACTEMVMPMTCSNQ-SMFPPSEFDYEEFATDCKKKYGVSPR  398

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHWITT +GG  I+ VL +FGSN+IFSNG++DP+S  GVL +IS +++A+ T  G+H +D
Sbjct  399   PHWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGVLRNISTSIIAIVTEKGAHHVD  458

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
                A+K DPDWL EQRK+EVEII  WI +YY +++  K+
Sbjct  459   FRSATKDDPDWLVEQRKQEVEIIHQWINEYYADMKQDKK  497



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   423 bits (1087),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 286/451 (63%), Gaps = 16/451 (4%)
 Frame = +2

Query  281   YYRQTLDHFNYGPQSYATFKQRYIVSSKYWGG-AQSNSPIFAWLGAESPIDDDPKYIGFL  457
             ++ Q LDHFNY PQSY TF+QRY+++  YWGG A  N+PIF + G E  I+   +  GF+
Sbjct  53    FFTQILDHFNYNPQSYETFQQRYLINDNYWGGGADKNAPIFVYTGNEGDIEWFAQNTGFM  112

Query  458   TDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  634
              + AP FKALL++IEHRYYGKS+PFG + E A  N +T GY ++ QALADYA ++L LK 
Sbjct  113   FETAPIFKALLLFIEHRYYGKSMPFGGSKERAYANSSTLGYLSATQALADYATLILDLKK  172

Query  635   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  814
                A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FDNIT    + +++T 
Sbjct  173   NLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVAVGALASSAPILNFDNITSPFSFNNIITH  232

Query  815   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  994
             DF+  SENCY+ I++SW  ID  A+KP GL IL K F++CK   S   LK +L + Y   
Sbjct  233   DFRSESENCYKVIKRSWQEIDDTAAKPGGLEILRKSFRICKNYISGEALKGWLGTAYTYT  292

Query  995   AQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQ  1138
             A  D P         P YPV ++C  ID    G +  ++++          G+ TC+D  
Sbjct  293   AMTDYPTPTNFLAPLPAYPVKQMCKAIDDPKTGNNTFEKLYGAANVYYNYTGDATCFDLA  352

Query  1139  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1318
               + P    + GW WQ C+EM +       D++F P  +S       C D Y + PRP W
Sbjct  353   DDSDP--HGLGGWTWQACTEMILLTDGNTEDSIFPPNNYSYNDRFVFCKDNYNIEPRPTW  410

Query  1319  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1498
             I T +G H+I  VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D+  
Sbjct  411   IPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSLVAIVAKEGAHHVDLRF  470

Query  1499  ASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             ++  DP WL + R +EV II  W+++YY  L
Sbjct  471   STSEDPKWLEDVRNREVRIISKWLSQYYRTL  501



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/489 (44%), Positives = 311/489 (64%), Gaps = 29/489 (6%)
 Frame = +2

Query  167   PLHKIPRLTP--LYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFK  340
             P + +P   P   Y+S+++++  K S P+       F+T Y+ QTLDHF + P+S   F 
Sbjct  19    PANSLPTFFPGATYQSLIKQA--KISKPKLP-----FKTHYFPQTLDHFTFQPKSSKLFY  71

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             Q+Y+++S YW   +  +PIF + G E  I+      GF+ D AP+FKALLV+IEHR+YGK
Sbjct  72    QKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGK  128

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+PFG  +++  +  T GY NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+
Sbjct  129   SMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSLKQNLSSEASPVVVFGGSYGGMLAA  186

Query  701   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             WFRLKYPH+A+GALASSAPIL FD + P + +Y  V++DFK+VS NCYQ I+ SW+ ++ 
Sbjct  187   WFRLKYPHIAIGALASSAPILQFDKLIPWSSFYDAVSQDFKDVSLNCYQVIKGSWAELEA  246

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTE  1033
             ++++   L+ LSK F+ CK L S    +D+L + +   A  + P         P YPV +
Sbjct  247   MSTQKQALAELSKTFRTCKSLHSTASARDWLWTAFVYTAMVNYPTKADFMKPLPAYPVQK  306

Query  1034  VCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMA  1204
             +C  ID  P  A  L R  A          +  C+  +I +      + GW WQTC+EM 
Sbjct  307   MCKIIDKIPSRATKLSRAFAAASLYYNYSRSENCF--KIEHEVDGHGLHGWDWQTCTEMV  364

Query  1205  MPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNII  1384
             MP+    +++MF P+ F  ++F+  C   Y V PRPHWITT +GG  I+ VL +FGSNII
Sbjct  365   MPM-TCSKESMFPPSGFDYEEFAEQCRMKYCVSPRPHWITTEFGGERIQKVLKRFGSNII  423

Query  1385  FSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1564
             FSNG++DP+S  GVL++IS +++A+ T  G+H +D   A+K DP WL + RK+EVEIIQ 
Sbjct  424   FSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKKDPKWLIQLRKQEVEIIQK  483

Query  1565  WITKYYVEL  1591
             W+ +YY +L
Sbjct  484   WLNEYYADL  492



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 213/477 (45%), Positives = 300/477 (63%), Gaps = 28/477 (6%)
 Frame = +2

Query  200   YESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGA  379
             Y+S L++   K   P        F+  Y+ Q LDHF + P+S   FKQ+Y+++  YW   
Sbjct  35    YQSSLEKQHVKSKIP--------FKVHYFPQILDHFTFLPKSSKVFKQKYLINDNYW---  83

Query  380   QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNN  559
             +   PIF + G E  ID      GF+ D AP+F ALLV+IEHR+YG S+PFG  +++  +
Sbjct  84    KQGGPIFVYTGNEGNIDWFAANTGFMLDIAPKFHALLVFIEHRFYGDSMPFG--KKSYKS  141

Query  560   ETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGA  739
               T GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLASWFRLKYPH+A+GA
Sbjct  142   PKTLGYLNSQQALADYAVLIRSLKQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGA  201

Query  740   LASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSK  919
             +ASSAPIL FD ITP + +Y  V++DFKEVS NCY+ I+ SW+ +D ++    GL+ +SK
Sbjct  202   VASSAPILQFDKITPWSSFYDAVSQDFKEVSLNCYRVIKGSWTELDALSKHEEGLTEVSK  261

Query  920   KFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGAD  1072
              F+ CKGL S    +D+L   +   A  + P         P YPV E+C  IDG PKGA 
Sbjct  262   LFRTCKGLHSVYSARDWLWEAFVYTAMVNYPTKANFMMPLPAYPVQEMCKIIDGLPKGAS  321

Query  1073  ILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1243
              + R  A             C++  +     +  + GW WQ C+EM MP+   + ++MF 
Sbjct  322   KISRAFAAASLYYNYTKREKCFN--LEGGDDAHGLHGWDWQACTEMVMPMTCSN-ESMFP  378

Query  1244  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1423
             P+ +S ++F  DC   YGV PRPHWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  G
Sbjct  379   PSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGG  438

Query  1424  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             VL++IS +++A+ T+ G+H +D    +K DP WL  QRK+E  IIQ W+ +YY +L+
Sbjct  439   VLKNISASIVALVTQKGAHHVDFRSETKNDPGWLIMQRKQEAAIIQKWLEEYYRDLK  495



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   422 bits (1085),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 213/485 (44%), Positives = 304/485 (63%), Gaps = 24/485 (5%)
 Frame = +2

Query  188   LTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKY  367
             L P + S+  +S     +P  K   S ++  ++ Q LDHF + PQS   F Q+Y+++S+Y
Sbjct  22    LKPTFPSL--QSLCLQQNPDNK---SDYKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEY  76

Query  368   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  547
             W G +  +PIF + G E  I+      GFL D AP+F+ALLV+IEHR+YG+S+PFG  + 
Sbjct  77    WDGPKKRAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFG--KG  134

Query  548   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  727
             A  + TT GY  S QALADYA ++  LK    AQ  P++VFGGSYGGMLA+WFRLKYPH+
Sbjct  135   AYKSATTLGYLTSQQALADYATLITSLKQNLSAQACPVVVFGGSYGGMLAAWFRLKYPHI  194

Query  728   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  907
             A+GA+ASSAPIL FD+I     +Y  V+KDFK+ S NC+  IR SW  +  I+++  GL 
Sbjct  195   AMGAVASSAPILQFDDIASWTSFYDGVSKDFKDASLNCFNVIRASWDKLQVISTQEKGLQ  254

Query  908   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAP  1060
              L++ F+ C+ +KS   ++D+L S +   A  + P         P YP+ E+C  IDG P
Sbjct  255   KLNRVFRTCEDIKSVYSVRDWLWSAFVYTAMVNYPTPANFMRPLPAYPINEMCRNIDGLP  314

Query  1061  KGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1231
                D L ++ A           + C+D +  N   +  + GW WQ C+EM MP+    + 
Sbjct  315   SETDTLVKVFAAASVYYNYSSTKKCFDME--NASDAHGLHGWNWQACTEMVMPMS-CSQQ  371

Query  1232  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1411
              MF P+ FS ++   DC   YGV  RPHWITT +GGH+I+ VL +FGSNIIFSNG+ DP+
Sbjct  372   GMFPPSTFSYKEIEDDCMKKYGVKARPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPW  431

Query  1412  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             S  GVL++IS +++A+ T  G+H LD   A++ DP WL EQR++E+E+IQ WI +Y   +
Sbjct  432   SRGGVLKNISSSIVALVTEKGAHHLDFRFATRQDPRWLVEQRRQEIELIQGWIHEY--NM  489

Query  1592  EALKR  1606
             + +KR
Sbjct  490   DFMKR  494



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   422 bits (1086),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 214/478 (45%), Positives = 311/478 (65%), Gaps = 26/478 (5%)
 Frame = +2

Query  203   ESILQRSSSKHSSPQTK-PLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWG-G  376
             +S+ QR+   H+    K P ++HF    + Q LDHF + P++Y  F Q+Y+++S YW  G
Sbjct  59    QSLAQRA---HTVKDPKLPFTTHF----FPQQLDHFTFQPKAYKVFYQKYLMNSTYWDQG  111

Query  377   AQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMN  556
                 +PIF + G E  I+   +  GF+ D AP+F ALLV+IEHR+YG+S+PFG  +E+  
Sbjct  112   PNHTAPIFVYTGNEGNIEWFAENTGFMLDIAPKFNALLVFIEHRFYGESMPFG--KESYK  169

Query  557   NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALG  736
             + +T GY  S QALADYA ++  LK    A+ SP++VFGGSYGGMLA+WFRLKYPH+ +G
Sbjct  170   SASTLGYLTSTQALADYAVLIRSLKQNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITIG  229

Query  737   ALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILS  916
             ALASSAPIL FD ITP + +Y  V++D+K+ S NC++ I+ SW  +  +A++  G+  LS
Sbjct  230   ALASSAPILEFDYITPWSSFYDAVSEDYKDESINCFEVIKGSWDELMVVAAQKGGMLELS  289

Query  917   KKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGA  1069
             K F+ CK L+S   ++D+L + +   A  D P         P YP+ E+C  IDG P+GA
Sbjct  290   KTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPAYPIKEMCRIIDGFPQGA  349

Query  1070  DILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1240
               L ++ +         G+++C+D  I N      + GW WQ C+EM MP+   + ++MF
Sbjct  350   SKLTKVFSAASLYYNYSGDQSCFD--IENGTDPHGLHGWDWQACTEMVMPMICSN-ESMF  406

Query  1241  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1420
               + +   +F  +C   YGV PRPHWITT YGG+ I  VL +FGSNIIFSNG+RDP+S  
Sbjct  407   PSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWSRG  466

Query  1421  GVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             GVL +IS +++A+ T  G+H LD+  A+K DP WL EQRK+E++IIQSWI +Y+++ +
Sbjct  467   GVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYHIDFK  524



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 293/454 (65%), Gaps = 18/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             F+T Y+ Q LDHF + P+S   F Q+Y+++ +YW   +   PIF + G E  ID      
Sbjct  49    FKTHYFPQILDHFTFLPKSSKVFYQKYLINDQYWH-KEGGGPIFVYTGNEGNIDWFAVNT  107

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GF+ D AP+F ALLV+IEHR+YG S+PFG    +  +  T GY NS QALADYA ++  L
Sbjct  108   GFMVDIAPKFNALLVFIEHRFYGDSMPFGN--NSYKSAKTLGYLNSQQALADYAVLIRSL  165

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K    +  SP++VFGGSYGGMLA+WFRLKYPH+A+GA+ASSAPIL FD ITP + +Y  V
Sbjct  166   KQNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAPILQFDKITPWSSFYDAV  225

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             ++DFK+ S NCY+ I+ SW+ +D +++  +GL  +SK F+ CK L S    +D+L   + 
Sbjct  226   SQDFKDASLNCYKVIKGSWAELDALSTHDDGLIEVSKLFRTCKALHSVYSARDWLWEAFV  285

Query  989   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
               A  + P         P YPV E+C  IDG PKGA  L +  A             C++
Sbjct  286   YTAMVNYPTEANFMMPLPAYPVEEMCKIIDGLPKGASKLSKAFAAASLYYNYTQTEKCFN  345

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
               +     S  + GW WQ C+EM MP+   + ++MF P+ FS ++FS+DC   YGV PRP
Sbjct  346   --LEGGTDSHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSFSYKEFSQDCKKQYGVKPRP  402

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  GVL++IS +++A+ T+ G+H +D 
Sbjct  403   HWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISSSIVALVTQKGAHHVDF  462

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
                +K DPDWL  QRK+EV II+ W+ +YY +L+
Sbjct  463   RSETKNDPDWLIMQRKQEVAIIEKWLEEYYKDLK  496



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   421 bits (1081),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/481 (44%), Positives = 310/481 (64%), Gaps = 22/481 (5%)
 Frame = +2

Query  179   IPRLTP-LYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             IP   P  Y+S L +   K + P+  P  +H    Y+ Q LDHF + P+SY  F Q+Y++
Sbjct  23    IPVFVPGAYKSSLLKKQVKSAKPEI-PYEAH----YFPQVLDHFTFRPRSYKIFYQKYLM  77

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             +S+YW      +PIF + G E  I+      GF+ D AP+F+ALLV+IEHR+YG+S+PF 
Sbjct  78    NSQYW---HEGAPIFVYTGNEGDIEWFAANTGFMLDIAPKFRALLVFIEHRFYGESLPF-  133

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
               ++ +N+  T GY +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLK
Sbjct  134   -HKKDLNSAKTLGYLSSQQALADYAVLIRSLKRNLSSEASPVVVFGGSYGGMLAAWFRLK  192

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVA+GALASSAPIL FD+ITP + +Y  V++DFKE S NCY+ I+ +W+ +D    + 
Sbjct  193   YPHVAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASLNCYEVIKGAWTELDAFGKRK  252

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  1048
             +GL  LSK F+ CK L S    +++L S +   A  + P         P YPV E+C  I
Sbjct  253   DGLEKLSKMFRACKKLSSVDYARNWLWSAFTYTAMVNYPMEANFMKHLPAYPVEEMCKII  312

Query  1049  DG-APKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1225
             DG +P+   +   + A  +    ++T    ++ +      + GW WQ C+EM MP+   +
Sbjct  313   DGHSPRATKLSRAVAAASLYYNYSKTEKCFKLEDEDNDHGLQGWNWQACTEMVMPMTCSN  372

Query  1226  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1405
               +MF P+P+S ++F+ DC+  +GV PR HWITT +GG  I LVL +FGSNIIFSNG++D
Sbjct  373   -GSMFPPSPYSYKEFADDCNRQFGVWPREHWITTEFGGMRINLVLKRFGSNIIFSNGMQD  431

Query  1406  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1585
             P+S  GVL++IS +++A+ T  G+H +D   A+  DP+WL +QR++EVEIIQ W+ +YY 
Sbjct  432   PWSRGGVLKNISSSIVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKWLQEYYA  491

Query  1586  E  1588
             +
Sbjct  492   D  492



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   420 bits (1080),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 308/479 (64%), Gaps = 27/479 (6%)
 Frame = +2

Query  194   PLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWG  373
             P Y+S++     KH+      L   F+T Y+ QTLDHF++ P+S   F Q+Y+++++YW 
Sbjct  36    PAYQSLI-----KHAKTPKPKLP--FKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYW-  87

Query  374   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  553
                  SPIF + G E  I+      GF+ D AP+F+ALL++IEHR+YG+S+PFG  +++ 
Sbjct  88    --HKGSPIFVYTGNEGDIEWFAANTGFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSY  143

Query  554   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  733
              +  T GY NS QALAD A ++  LK    ++ SP++VFGGSYGG+LA+WFRLKYPH+A+
Sbjct  144   QSAKTLGYLNSQQALADLAVLIRSLKQNLSSEASPVVVFGGSYGGLLAAWFRLKYPHIAI  203

Query  734   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  913
             GALASSAPIL FD I P + +Y  V+ DFK+VS+NCY+ I+ SW+ +  I+++   L+ L
Sbjct  204   GALASSAPILQFDKIIPWSSFYDAVSLDFKDVSQNCYEVIKGSWAELVAISTRKQALAEL  263

Query  914   SKKFKLCKGLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKG  1066
             SK F+ CK L S   + ++L + +         T A + +P P YPV ++C  ID +P G
Sbjct  264   SKAFRTCKSLHSTASVLEWLWTAFVYTAIVNYPTEANFLKPLPAYPVQQMCKIIDKSPSG  323

Query  1067  ADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1237
                L R  A             C++ +    P    + GW WQTC+EM MP+   + ++M
Sbjct  324   ETKLSRAFAAASLYYNYSQTENCFEVEYEVDP--HGLHGWHWQTCTEMVMPMTCSN-ESM  380

Query  1238  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1417
             F P+ F  ++F+  C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S 
Sbjct  381   FPPSGFDYKRFAEQCRMKYGVLPRPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSR  440

Query  1418  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
              GVL +IS T++A+ T  G+H +D   A+K DPDWL +QR++EVEIIQ W+ +YYV+L 
Sbjct  441   GGVLRNISATIIALVTEKGAHHVDFRAATKDDPDWLIQQRRQEVEIIQRWLDEYYVDLR  499



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   420 bits (1079),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 298/470 (63%), Gaps = 26/470 (6%)
 Frame = +2

Query  218   RSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPI  397
             R +SK S  + + L  HF+T Y+ Q LDHF++ P+SY  F Q+Y++SS +W   +   PI
Sbjct  35    RQNSKTSKSKAE-LPFHFQTRYFPQNLDHFSFQPESYRIFHQKYLISSHFW---RKGGPI  90

Query  398   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  577
             F + G E  I+      GF+ D AP+F+ALLV+IEHR+YG+S P        N   T GY
Sbjct  91    FVYTGNEGDIEWFASNTGFMLDIAPKFQALLVFIEHRFYGESKP-------HNLAKTLGY  143

Query  578   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  757
              NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAP
Sbjct  144   LNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  203

Query  758   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  937
             IL FD I P + +Y++V++DFK+ S NC++ I+KSW  ++  ++  +GL  LSKKF+ CK
Sbjct  204   ILQFDKIVPSSSFYNVVSQDFKDASLNCFEVIKKSWRELEVFSTMKDGLQELSKKFRTCK  263

Query  938   GLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIH  1090
              L +      +L++ +   A  + P         P YPV E+C  ID  P  A  LDR  
Sbjct  264   DLHAVYLASRWLETAFTDTAMVNYPTPANFMAPLPAYPVEEMCKIIDWFPLEASNLDRAF  323

Query  1091  AGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1261
             A         G+  C+D  I N      + GW WQ C+EM MPI   ++ +MF P  +  
Sbjct  324   AAASLYYNYSGSENCFD--IENQTDPHGLNGWYWQACTEMVMPISCSNQ-SMFQPFEYDE  380

Query  1262  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1441
             +    DC   YGV PRPHWITT +GGH I++VL +FGSNIIFSNG++DP+S  GVL++IS
Sbjct  381   KVDQEDCLKEYGVKPRPHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNIS  440

Query  1442  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
              +++A  T+ G+H  D+  A+K DP+WL EQR++EV  I+ WI++YY +L
Sbjct  441   SSIIAFVTKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKWISEYYSDL  490



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/485 (44%), Positives = 297/485 (61%), Gaps = 21/485 (4%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIV  355
             K P + P   + L+R ++    P      S +   +  Q LDHFNY PQSY TF+QRY+V
Sbjct  14    KTPPVFPSTLAQLRRGAAGDGGP------SLYTEKFCTQILDHFNYNPQSYRTFQQRYLV  67

Query  356   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
             +  +WGGA + SPIF + G E  I+   K  GF+ + AP FKAL+V+IEHR+YGKSIP+G
Sbjct  68    NDTHWGGAAAGSPIFVYTGNEGDIEWFAKNTGFMYEIAPIFKALIVFIEHRFYGKSIPYG  127

Query  536   -TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  712
                  A +N +T GY  + QALADYA V+L LK    +++SP+IVFGGSYGGMLA+WFRL
Sbjct  128   GNRTVAYSNSSTLGYLTATQALADYATVILSLKKNLTSENSPVIVFGGSYGGMLAAWFRL  187

Query  713   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  892
             KYPHVA GAL+SSAPIL FDNIT +  +  +VT+DF+  SENCY+ I+KSW  ID  A K
Sbjct  188   KYPHVAAGALSSSAPILNFDNITSQFSFNDIVTQDFRSESENCYKVIKKSWQEIDDTAVK  247

Query  893   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGG  1045
             P GL IL K F++CK   S   L  +L +     A  D P         P +PV ++C  
Sbjct  248   PGGLEILRKHFRICKNHISAASLHSWLSTALIYTAMTDYPTPSDFLAPLPAHPVKQMCEA  307

Query  1046  IDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1216
             ID    G     +++          GN TC+D    + P    + GW WQ C+EM +   
Sbjct  308   IDDPTTGNSTFAKMYGAANVYYNYSGNATCFDLADDSDP--HGVNGWYWQACTEMILITD  365

Query  1217  RGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNG  1396
                 +++F  + +S       C D YGV PRP+W  T +G H+IK  L  FGS+IIF NG
Sbjct  366   GNREESIFTASNYSYNDRREYCKDKYGVEPRPNWAPTEFGAHNIKRALKNFGSSIIFFNG  425

Query  1397  LRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITK  1576
             LRDP+S  GVL+++S++++A+  + G+H +D+  ++K DP WL + RK+E EII +W++ 
Sbjct  426   LRDPWSGGGVLKNLSESLVAIVAKEGAHHVDLRFSTKEDPKWLVDVRKRETEIISTWLSH  485

Query  1577  YYVEL  1591
             Y+ ++
Sbjct  486   YHSDI  490



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 296/459 (64%), Gaps = 22/459 (5%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T YY Q LDHFNY PQ Y TF+QRY+++  YWGGA++NSPIF ++G E  I+   +  
Sbjct  52    YKTKYYTQILDHFNYNPQGYQTFQQRYLINDTYWGGAKNNSPIFVYMGNEGDIEWFAQNT  111

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  625
             GF+ +NAP FKALLV++EHR+YGKSIP+G  +E A  N TT+GY +S QALADYA ++L 
Sbjct  112   GFMFENAPHFKALLVFVEHRFYGKSIPYGGDKEVAYKNATTQGYLSSTQALADYATIILD  171

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASS+PIL F N+T    + ++
Sbjct  172   LKKNLTATESPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSPILNFGNLTSPFSFNNI  231

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE-LKDYLDST  982
             VT+DFK  SENCY+ I+ SW+ I++ A +  GL  L   F +CK +    E ++ +L   
Sbjct  232   VTQDFKSESENCYKVIKGSWAQIEETAQQKGGLEKLRSSFNICKNITISTEYVESWLSMA  291

Query  983   YCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTC  1126
             Y   A  D P         P +PV ++C  ID    G D   +++          GN  C
Sbjct  292   YIYTAMTDYPTPSNFLNPLPAFPVRQMCKAIDNPELGNDTFAKLYGAANIYYNYTGNVDC  351

Query  1127  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFS-RD--CDDYYG  1297
             +D  I N      +  W WQ C+EM +P    +++++F   P S   ++ RD  C   YG
Sbjct  352   FD--ITNDSDKHGLDEWTWQACTEMILPTDGNNKESIF---PTSNDDYNDRDLYCTSIYG  406

Query  1298  VPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGS  1477
             V PRPHWITT +GG DI  VL ++ SNI+F NG RDP+S  GVL++IS +++A+  + G+
Sbjct  407   VQPRPHWITTEFGGFDIHRVLRRYASNILFFNGRRDPWSGGGVLKNISSSLVAIVAKEGA  466

Query  1478  HCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             H +D+  +++ DP+WL E RK E+  I+ W+++YY +L+
Sbjct  467   HHVDLRYSTEEDPNWLKEIRKTEIHHIKKWLSRYYHDLD  505



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/492 (42%), Positives = 304/492 (62%), Gaps = 23/492 (5%)
 Frame = +2

Query  161   PPPLHKIPRLTPLYESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFK  340
             P  L+  P+    + +  +  S+    PQ      H+   Y++Q LDHF++      TF 
Sbjct  30    PLALNHSPKFLGKFAATARTHSNSEPPPQF-----HYEKRYFQQRLDHFSFS--ELPTFP  82

Query  341   QRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGK  520
             QRY++S+++W G     PIF + G E  I+   +  GF+ + APRF A++V+ EHRYYG+
Sbjct  83    QRYLISTEHWVGPHRLGPIFFYCGNEGDIEWFAQNTGFVWEIAPRFGAMVVFPEHRYYGE  142

Query  521   SIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  700
             S+P+G+ EEA  N TT  Y  + QALAD++ ++ YLK+ Y A+  P+++FGGSYGGMLA+
Sbjct  143   SVPYGSAEEAYKNATTLSYLTAEQALADFSVLITYLKHNYSAKDCPVVLFGGSYGGMLAA  202

Query  701   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  880
             W RLKYPH+A+GALASSAPIL F++I P   +Y LV+  FK  S  C+  I++SW+ I  
Sbjct  203   WMRLKYPHIAVGALASSAPILQFEDIVPPETFYDLVSNAFKRESFTCFNYIKQSWNEIAS  262

Query  881   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTE  1033
                  NGL +L+K F LC+ LK   +L D+ ++ Y   A  + P         P++P+ E
Sbjct  263   TGQTNNGLELLTKTFNLCQKLKRTKDLYDWAEAAYSYLAMVNYPYPAEFMMTLPEHPIRE  322

Query  1034  VCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMA  1204
             VC  IDG P G  IL+RI+ GV       G   C+  ++ + P    + GW WQ C+EM 
Sbjct  323   VCRRIDGGPAGTSILERIYEGVNVYYNYTGEAKCF--ELDDDP--HGMSGWEWQACTEMV  378

Query  1205  MPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNII  1384
             MP+      +MF P  ++      +C   +GV PRP WITT +GGHDI   L KFGSNII
Sbjct  379   MPMSSSQESSMFPPYEYNYTSIQAECLKKFGVKPRPRWITTEFGGHDIHATLKKFGSNII  438

Query  1385  FSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1564
             FSNGL DP+S  GVL++IS++V+++ T  G+H +D+  ++K DPDWL EQR+ E+++I+ 
Sbjct  439   FSNGLLDPWSGGGVLQNISESVVSLVTEEGAHHIDLRSSTKNDPDWLVEQRETEIKLIEG  498

Query  1565  WITKYYVELEAL  1600
             WI+ Y+ + EA+
Sbjct  499   WISDYHQKNEAM  510



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   419 bits (1078),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 212/487 (44%), Positives = 307/487 (63%), Gaps = 27/487 (6%)
 Frame = +2

Query  176   KIPRLTPLYESILQRSSSKHSSPQTKPLSSH--FRTFYYRQTLDHFNYGPQSYATFKQRY  349
             KIP   P + S+L R       PQT P+     ++T ++ Q LDHFN+ PQSY  F+QRY
Sbjct  25    KIP--LPFHSSLLLR-------PQTPPIDPLLPYQTGFFTQILDHFNFNPQSYQYFQQRY  75

Query  350   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  529
             +++  YWGGA  NSPIF + G E  I+   +  GFL  +APRF+AL+V+IEHR+YGKSIP
Sbjct  76    LINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNTGFLLQSAPRFRALVVFIEHRFYGKSIP  135

Query  530   FGTMEEAMN-NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  706
             FG  E+  N N +T G+ +S QALADYA ++  LK    A  SP++VFGGSYGGMLA+WF
Sbjct  136   FGGDEDVANSNSSTLGFLSSTQALADYATLITDLKKNLSAVDSPVLVFGGSYGGMLAAWF  195

Query  707   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  886
             RLKYPH+A+GALASSAPIL F+NIT    + ++VT+DFK  S+NCY+ I++SW +ID  +
Sbjct  196   RLKYPHIAMGALASSAPILQFENITSPYAFSNIVTQDFKSESQNCYRVIKESWHLIDITS  255

Query  887   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVC  1039
             + P G  +L K FK CK  ++   +K++L +     A  D P         P YPV ++C
Sbjct  256   THPQGPQLLRKSFKFCKEAEAE-SIKNWLSTAILYTAMTDYPTPSNFLNPLPAYPVKQMC  314

Query  1040  GGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMP  1210
               ID +  G D   +++          G  TC+D    +      +  W WQ C+EM +P
Sbjct  315   KAIDDSRTGNDTFAKLYGAANVYYNYTGTATCFDLDDDS--DPHDLGDWTWQACTEMILP  372

Query  1211  IGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1390
              G   ++++F  + +        C  ++ V PR  WI T++GGH+I+ VL +FGSNIIF 
Sbjct  373   TGGNTKESIFPASTWHFADRLHFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFF  432

Query  1391  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWI  1570
             NGLRDP+S  GVL++IS T++A+  + G+H +D+  +S  DP WL + R++E+ II+ W+
Sbjct  433   NGLRDPWSGGGVLKNISSTIIAIVAKEGAHHVDLRFSSAEDPKWLKDVRQQELSIIEDWL  492

Query  1571  TKYYVEL  1591
             ++YY++L
Sbjct  493   SQYYLDL  499



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   419 bits (1077),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/449 (45%), Positives = 292/449 (65%), Gaps = 16/449 (4%)
 Frame = +2

Query  281   YYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT  460
             Y+ QTLDHFNY P  Y TF+QRY+++SKYWGG    +PIF + G E  ++   +  GF+ 
Sbjct  72    YFTQTLDHFNYVPWGYETFQQRYLINSKYWGGPIDKAPIFVYTGNEGDVEWFAQNTGFMF  131

Query  461   DNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKY  640
             +NAP FKALLV+IEHRYYG+SIP+G+ E A  N +T GY +SAQALADYA +++ LK   
Sbjct  132   ENAPYFKALLVFIEHRYYGESIPYGSEEIAYKNASTHGYLSSAQALADYAMLIIDLKKNL  191

Query  641   LAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDF  820
              A+ SP++V GGSYGGMLA+WFRLKYPHV +GALASSAPIL F +IT    + ++VT+DF
Sbjct  192   SAEDSPVVVMGGSYGGMLATWFRLKYPHVCIGALASSAPILNFADITSPYSFNNIVTEDF  251

Query  821   KEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQ  1000
             +  SENCY+ I+ SW  I + A +P GL  L K F++C    S   L ++L+  +   A 
Sbjct  252   RSESENCYKVIKNSWQKIHETAQQPGGLEELRKSFRICPNYISEDSLTNWLERAFIYTAM  311

Query  1001  YDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIY  1144
              D P         P +P+ ++C  +D A  G +    I+          G+  C++  + 
Sbjct  312   TDYPVPSSFLAPLPAFPIEQMCKAVDDA--GDEQFKGIYEAANIFYNYTGDSMCFN--LS  367

Query  1145  NPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1324
             +      + GW +Q C+EM +  G   ++++F P  ++  Q    C   YG+ PRPHWIT
Sbjct  368   DNSDRHGLNGWGFQACTEMLLATGGRTQESIFPPYTYNYTQTQEYCQQSYGINPRPHWIT  427

Query  1325  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1504
             T++GGHDIK VL +FGSNIIF NGLRDP+S  GVLE++SD+++A+  + G+H +D+  ++
Sbjct  428   THFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENLSDSIVALVAKEGAHHIDLRFST  487

Query  1505  KTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             + DP WL+E RK+E+ I+  W+ +YY ++
Sbjct  488   EGDPMWLSEVRKREIHILSMWLEQYYKDI  516



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   418 bits (1075),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 304/475 (64%), Gaps = 21/475 (4%)
 Frame = +2

Query  200   YESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGA  379
             Y+S L+++ S +  P+       + T Y+ Q LDHF + PQSY  F Q+Y+++  +W   
Sbjct  36    YQSALRKNGSINPKPEIP-----YETHYFPQNLDHFTFLPQSYRIFNQKYLINRDFW---  87

Query  380   QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNN  559
             Q  +PIF + G E  ID      GFL D APRF+ALLV+IEHRYYG+S PFG  +++  +
Sbjct  88    QKGAPIFVYTGNEGDIDWFAANTGFLLDVAPRFRALLVFIEHRYYGESKPFG--KDSYKS  145

Query  560   ETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGA  739
                 GY NS QA+AD+A ++  LK+   +  SP++VFGGSYGGMLA+WFRLKYPH+A+GA
Sbjct  146   AKKLGYLNSQQAMADFALLIRSLKHNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGA  205

Query  740   LASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSK  919
             LASSAPIL FD+ITP + +Y  V++DFK+ S NCY+ I+ SW+ ++ I     GL+ LS+
Sbjct  206   LASSAPILQFDDITPWSSFYDAVSQDFKDASLNCYEVIKGSWAELEDIPRYKQGLAELSR  265

Query  920   KFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGAD  1072
              F+ CK ++S    +D+L   +   A  + P         P +PV ++C  IDG      
Sbjct  266   NFRACKEVRSIYSARDWLWEAFVYVAMTNYPTESNFIKPLPAHPVKQMCKIIDGLSPETT  325

Query  1073  ILDRI-HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1249
              L R+  A  +    +RT    ++ N      + GW WQ C+EM MP+   + ++MF P 
Sbjct  326   KLSRVFEAASLYYNYSRTEKCFELENENDDHGLHGWNWQACTEMVMPMSISN-ESMFPPY  384

Query  1250  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1429
              FS + FS DC   YGV PRPHWITT +GG +I+ VL +FGSNIIFSNGL+DP+S   VL
Sbjct  385   QFSYKDFSDDCLKNYGVRPRPHWITTEFGGTNIEQVLKRFGSNIIFSNGLQDPWSRGSVL  444

Query  1430  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             ++IS +++A+    G+H  D+  A++ DPDWL EQRK+E+EIIQ WI+ YY++++
Sbjct  445   KNISTSIVALVAEKGAHHTDLRRATRKDPDWLIEQRKQEIEIIQKWISDYYIDIK  499



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   417 bits (1073),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 212/456 (46%), Positives = 302/456 (66%), Gaps = 18/456 (4%)
 Frame = +2

Query  257   LSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  436
             LS  ++T ++ Q LDHF + PQS   F Q+Y+++  YW   +  +PIF + G E  I+  
Sbjct  44    LSIPYKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYW---EHGAPIFVYTGNEGNIEWF  100

Query  437   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  616
              +  GF+ D AP+F+ALLV+IEHR+YG+S+PFG  +++  +  T GY NS QALAD+A +
Sbjct  101   AENTGFMLDIAPKFRALLVFIEHRFYGESLPFG--KDSYKSAKTLGYLNSQQALADFAVL  158

Query  617   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  796
             +  +KN  L++ SP++VFGGSYGGMLA+WFRLKYPHVALGALASSAPIL FD+ITP   +
Sbjct  159   IQSMKN-LLSEVSPVLVFGGSYGGMLAAWFRLKYPHVALGALASSAPILQFDDITPWTSF  217

Query  797   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  976
             Y  VT+DFK+ S+NCY+ I+ SW+ +  + S+  GL+ LS+ F+ C+ L S    +++L 
Sbjct  218   YDAVTQDFKDASQNCYEVIKGSWAELQAV-SEQKGLAELSRSFRSCENLHSMYSARNWLW  276

Query  977   STYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV-VGLEGNRTC  1126
             + +   A  + P         P YPV E+C  IDG P  A  L R+ A   +    +RT 
Sbjct  277   TAFVYTAMVNYPTEANFMMPLPAYPVREMCKIIDGFPPRATKLSRVVAAASLYYNYSRTE  336

Query  1127  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1306
                +I N   +  + GW WQ C+EM MP+    +D+MF P+ F  + FS  C   YGV P
Sbjct  337   KCFKIENATDAHGLHGWDWQACTEMVMPMT-CSKDSMFPPSTFDYKAFSEQCMRKYGVLP  395

Query  1307  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1486
             RPHWITT +GG+ I+ VL +FGSNIIFSNG++DP+S   VL++IS +++A+ T  G+H +
Sbjct  396   RPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGSVLKNISASIIALATEKGAHHV  455

Query  1487  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             D   A+K DPDWL EQR++EVEIIQ WI +Y+ + +
Sbjct  456   DFRSATKEDPDWLVEQRRQEVEIIQRWINEYHSDFK  491



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   419 bits (1078),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 218/489 (45%), Positives = 299/489 (61%), Gaps = 25/489 (5%)
 Frame = +2

Query  200   YESILQRSSSKHSSPQTKPLSSHFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYW---  370
             Y +    S  K +    K   + FR  Y+ Q LDHF + P +   F Q+Y+V+  +W   
Sbjct  53    YAASAVASGGKAAPEPEKKTKNPFRAHYFPQELDHFTFTPNASRIFYQKYLVNDTFWRKP  112

Query  371   -----GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  535
                  G A +  P+F + G E  I+      GFL D AP+F ALLV+IEHR+YG+S PFG
Sbjct  113   TGKGRGAAAAPGPVFVYTGNEGDIEWFATNSGFLFDIAPKFSALLVFIEHRFYGESKPFG  172

Query  536   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  715
                E+  +  T GY  S QALAD+A ++  LK+   A  +P++VFGGSYGGMLASWFRLK
Sbjct  173   N--ESYGSAATLGYLTSTQALADFAVLITSLKHNLSAPVAPVVVFGGSYGGMLASWFRLK  230

Query  716   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  895
             YPHVA+GALASSAPIL FD+ITP + +Y   ++DFK  S+NC+  I+  W V+D+  S  
Sbjct  231   YPHVAMGALASSAPILQFDDITPWSSFYDAASQDFKSESKNCFSVIKAVWDVLDERGSND  290

Query  896   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  1048
              GL  LSK F+ CK +K    L ++L + +   A  D P         P YPV E+C  I
Sbjct  291   KGLLQLSKTFRACKTVKYVDSLSNWLWTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKII  350

Query  1049  DGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR  1219
             D  P GADI+D+  +         G++ C+D +  + P    + GW WQ C+EM MP+  
Sbjct  351   DAFPPGADIVDKAFSAASLYYNYTGDQKCFDVEGGDDP--HGLSGWGWQACTEMVMPMTV  408

Query  1220  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1399
              ++ +MF P+ FS ++ S  C   YGV PR HWITT YGGH I  VL +FGSNIIFSNG+
Sbjct  409   SNK-SMFPPSSFSYEEKSEGCLASYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGM  467

Query  1400  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1579
             RDP+S  GVL++IS +++A+ T  G+H LD   A+K DPDW+ EQR++EVEIIQ WI +Y
Sbjct  468   RDPWSRGGVLKNISSSIIALVTEKGAHHLDFRTATKDDPDWVIEQRRQEVEIIQGWIDQY  527

Query  1580  YVELEALKR  1606
               ++  + +
Sbjct  528   NKDIAHMSQ  536



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   417 bits (1072),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 294/452 (65%), Gaps = 20/452 (4%)
 Frame = +2

Query  275   TFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGF  454
             T Y+ Q LDHF + P+S   F Q+Y+++++YW      +PIF + G E  ID      GF
Sbjct  58    TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  114

Query  455   LTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  634
             L D AP F+A+LV+IEHR+YG+S+PFG  +E+  +  T GY NS QALAD+A ++  LK 
Sbjct  115   LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSLKQ  172

Query  635   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  814
                ++ SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FD+ITP + +Y  V++
Sbjct  173   NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILQFDDITPWSSFYDAVSQ  232

Query  815   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  994
             DFKE S NCY+ I+ SW+ +D +++K  GL+ +S+ F+ CK + S    +D+L S +   
Sbjct  233   DFKEASLNCYEVIKGSWAELDAMSAKEGGLAEVSRTFRTCKDINSVYSARDWLWSAFVYT  292

Query  995   AQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYDPQ  1138
             A  + P         P YPV E+C  ID  P GA  + R  A         G   C+D  
Sbjct  293   AMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSGTEKCFD--  350

Query  1139  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1318
             + N   +  + GW WQ C+EM MP+   + ++MF P+ F  ++F+ +C   YGV PRPHW
Sbjct  351   LENGKDAHGLHGWDWQACTEMVMPLTCSN-ESMFPPSSFEYKEFADECTRKYGVMPRPHW  409

Query  1319  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1498
             ITT +GG  I+ VL +  SNIIFSNG++DP+S   VL++IS +++A+ T+ G+H +D   
Sbjct  410   ITTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRF  469

Query  1499  ASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             A+K DPDWL EQR++EVEI+Q WI  Y  +L+
Sbjct  470   ATKEDPDWLIEQRRQEVEILQKWIHDYNADLK  501



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   417 bits (1072),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 298/454 (66%), Gaps = 20/454 (4%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  448
             ++T Y+ Q LDHF + P+S   F Q+Y+V+S YW      +PIF + G E  I+      
Sbjct  50    YKTHYFPQVLDHFTFQPKSSKIFYQKYLVNSHYW---HRGAPIFVYTGNEGDIEWFAANT  106

Query  449   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  628
             GFL D AP+F+ALLV+IEHR+YG+S+PFG   ++  +  T GY NS QALAD+A ++  L
Sbjct  107   GFLLDIAPKFRALLVFIEHRFYGESMPFGN--KSYKSAETLGYLNSQQALADFALLIRSL  164

Query  629   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  808
             K+   ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL FD+ITP + +Y  V
Sbjct  165   KHNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDDITPWSSFYDAV  224

Query  809   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  988
             ++DFKE S NCY+ I+ SW+ ++ ++++  GL+ LS+ F+ C+ L S   + ++L S + 
Sbjct  225   SQDFKEASLNCYEVIKGSWAELEALSAQNEGLAELSRTFRACQDLHSLDSVWEWLWSAFV  284

Query  989   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYD  1132
               A  + P         P YPV  +C  IDG P GA  + R+ A             C+ 
Sbjct  285   YTAMVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYSRAEKCF-  343

Query  1133  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1312
              ++ + P +  + GW WQ C+EM MP+   + ++MF  + FS ++F+ DC   +GV PRP
Sbjct  344   -KLEHGPDAHGLHGWNWQACTEMVMPMTCSE-ESMFPTSSFSYKEFAEDCMKTFGVKPRP  401

Query  1313  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1492
             HWITT +GG  I LVL + G NIIFSNG++DP+S  GVL++IS +++A+ T  G+H +D 
Sbjct  402   HWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDF  461

Query  1493  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
               A+K DP+WL E R++EVEIIQ WI +YY +L+
Sbjct  462   RSATKDDPEWLKELRRQEVEIIQGWIDQYYPDLK  495



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   417 bits (1072),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 295/459 (64%), Gaps = 21/459 (5%)
 Frame = +2

Query  266   HFRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  445
             HF T +Y Q LDHF + P+S   F Q+Y+++ +YW   ++ +PIF + G E  I+     
Sbjct  48    HFETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFAAN  104

Query  446   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  625
              GFL D AP F ALLV+IEHR+YG+S PFG   ++ N+  T GY  S QALADYA ++  
Sbjct  105   TGFLPDIAPEFHALLVFIEHRFYGESTPFGN--DSYNSAETLGYLTSQQALADYAVLIRS  162

Query  626   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  805
             LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL+FDNI P + +Y  
Sbjct  163   LKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPWSSFYDA  222

Query  806   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  985
             V++DFK+ S NC++ I+ SW+ + +  S+  GL+ LSK F+ CK L S   ++D+L S +
Sbjct  223   VSQDFKDASLNCFEVIKGSWTELQQEFSE-EGLAELSKTFRTCKNLHSVSSVQDWLWSAF  281

Query  986   C--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1129
                      T A + +P P YPV E+C  ID        L++  A             C+
Sbjct  282   VYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLNKAFAAASLYYNYSHGEKCF  341

Query  1130  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1309
             +  + N P    + GW WQ C+EM MP+   ++ +MF P+ F  ++F+ DC   YGV PR
Sbjct  342   N--VENGPDLHGLSGWNWQACTEMVMPMTCSNQ-SMFPPSKFDYEEFATDCKKKYGVSPR  398

Query  1310  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1489
             PHWITT YGG  I+ VL +FGSNIIFSNG++DP+S  GVL +IS +++A+ T  G+H +D
Sbjct  399   PHWITTEYGGERIEEVLKRFGSNIIFSNGMQDPWSRGGVLRNISTSIVALVTEKGAHHVD  458

Query  1490  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1606
                A+K DPDWL EQR++EVEII  WI ++Y +++  K+
Sbjct  459   FRSATKDDPDWLVEQRRQEVEIIHQWINEHYADMKQDKK  497



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   417 bits (1073),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 291/456 (64%), Gaps = 21/456 (5%)
 Frame = +2

Query  269   FRTFYYRQTLDHFNYGPQSYATFKQRYIVSSKYW---GGAQSNSPIFAWLGAESPIDDDP  439
             F   Y++Q LDHF++ P +   F Q+Y+V+  +W   GG  +  P+  ++G E+ I+   
Sbjct  79    FTVHYFQQELDHFSFTPNASTVFYQKYLVNDTFWRRPGGGGTAGPLLVYVGGEADIECIA  138

Query  440   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  619
               +GF+ D AP F ALLV++EHR+YG+S+PFG      N+    GY  S QALAD A ++
Sbjct  139   HNVGFMFDIAPTFGALLVFVEHRFYGESLPFGN-----NSAQALGYLTSTQALADLAILI  193

Query  620   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  799
               LK    A+ SP+++FGGSYGGMLASWFRLKYPHV +GALASSAPIL FD ITP + +Y
Sbjct  194   TDLKRNLSAETSPVVIFGGSYGGMLASWFRLKYPHVTIGALASSAPILQFDYITPWSSFY  253

Query  800   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  979
              +V++D+K  S NC+  I+ +W V+++  S  NGL  LSK F+ CK +K    ++ +L +
Sbjct  254   DVVSQDYKSESLNCFSVIKAAWDVLEERGSNGNGLVELSKLFRACKTVKYADSIRRWLRT  313

Query  980   TYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRT  1123
              + + A  D P         P YPV E+C  +DG P  ADIL+++ A         G++T
Sbjct  314   AFVSIAMMDYPTPASFLENLPAYPVKEMCKIVDGFPADADILEKVFAAASLYYNYTGDQT  373

Query  1124  CYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVP  1303
             C   +    P    +  W WQ C+E+ MP+   + D+MF P  FS +  +  C   +GV 
Sbjct  374   CNQIEDEGNPRCLNLNYWGWQACTELMMPMSSAN-DSMFPPHTFSYEDKANYCLQTFGVR  432

Query  1304  PRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHC  1483
             PRPHWITT YGG+ I  VL +FGSNIIFSNG+RDP+S  GVL++IS +++A+ T  G+H 
Sbjct  433   PRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTEKGAHH  492

Query  1484  LDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1591
             LD+  A+K DPDW+TEQR++EVEII  WI +YY ++
Sbjct  493   LDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYYRDM  528



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   416 bits (1069),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 294/452 (65%), Gaps = 20/452 (4%)
 Frame = +2

Query  275   TFYYRQTLDHFNYGPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGF  454
             T Y+ Q LDHF + P+S   F Q+Y+++++YW      +PIF + G E  ID      GF
Sbjct  44    TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  100

Query  455   LTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  634
             L D AP F+A+LV+IEHR+YG+S+PFG  +E+  +  T GY NS QALAD+A ++  LK 
Sbjct  101   LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSLKQ  158

Query  635   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  814
                ++ SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FD+ITP + +Y  V++
Sbjct  159   NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILQFDDITPWSSFYDAVSQ  218

Query  815   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  994
             DFKE S NCY+ I+ SW+ +D +++K  GL+ +S+ F+ CK + S    +D+L S +   
Sbjct  219   DFKEASLNCYEVIKGSWAELDAMSAKEGGLAEVSRTFRTCKDINSVYSARDWLWSAFVYT  278

Query  995   AQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQ  1138
             A  + P         P YPV E+C  ID  P GA  + R  A         G   C+D  
Sbjct  279   AMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSGTEKCFD--  336

Query  1139  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1318
             + N   +  + GW WQ C+EM MP+   + ++MF P+ F  ++F+ +C   YGV PRPHW
Sbjct  337   LENGKDAHGLHGWDWQACTEMVMPLTCSN-ESMFPPSSFEYKEFADECTRKYGVMPRPHW  395

Query  1319  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1498
             ITT +GG  I+ VL +  SNIIFSNG++DP+S   VL++IS +++A+ T+ G+H +D   
Sbjct  396   ITTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRF  455

Query  1499  ASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1594
             A+K DPDWL EQR++EVEI+Q WI  Y  +L+
Sbjct  456   ATKEDPDWLIEQRRQEVEILQKWIHDYNADLK  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5434158386327