BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22073_g2_i1 len=1750 path=[173:0-259 433:260-285 1474:286-334
1523:335-361 25:362-422 86:423-448 1635:449-599 1786:600-604
1791:605-630 1817:631-805 1992:806-1303 2490:1304-1749]

Length=1750
                                                                      Score     E

ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        732   0.0      
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    716   0.0      
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    712   0.0      
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    707   0.0      
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    704   0.0      
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    701   0.0      
emb|CDP17394.1|  unnamed protein product                                692   0.0      
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    690   0.0      
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        687   0.0      Vitis vinifera
emb|CAN64374.1|  hypothetical protein VITISV_018664                     687   0.0      Vitis vinifera
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    685   0.0      
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                686   0.0      
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         672   0.0      
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    667   0.0      Vitis vinifera
emb|CBI17109.3|  unnamed protein product                                678   0.0      
emb|CBI17112.3|  unnamed protein product                                665   0.0      
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        660   0.0      Vitis vinifera
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    654   0.0      
emb|CDP07008.1|  unnamed protein product                                652   0.0      
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        652   0.0      
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             645   0.0      
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    643   0.0      
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    642   0.0      
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         640   0.0      Ricinus communis
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    640   0.0      
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         637   0.0      
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    636   0.0      
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    635   0.0      
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    636   0.0      
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        634   0.0      
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             634   0.0      
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         634   0.0      
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    634   0.0      
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        633   0.0      
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             632   0.0      
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    631   0.0      
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         631   0.0      Ricinus communis
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    625   0.0      
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    622   0.0      
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             620   0.0      
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             620   0.0      
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    615   0.0      
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    615   0.0      
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             615   0.0      
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             615   0.0      Populus trichocarpa [western balsam poplar]
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       614   0.0      
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    614   0.0      
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    613   0.0      
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    612   0.0      
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    612   0.0      
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   617   0.0      
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           612   0.0      
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    611   0.0      
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    608   0.0      
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        608   0.0      Vitis vinifera
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    608   0.0      
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    607   0.0      
ref|XP_010651746.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    605   0.0      
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             604   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   603   0.0      
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    602   0.0      
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   601   0.0      
emb|CAN63232.1|  hypothetical protein VITISV_004830                     599   0.0      Vitis vinifera
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    600   0.0      
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    598   0.0      
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             599   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    598   0.0      
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    597   0.0      
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    596   0.0      
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    596   0.0      
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    595   0.0      
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    593   0.0      
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    592   0.0      
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    592   0.0      
emb|CAN65360.1|  hypothetical protein VITISV_036071                     595   0.0      Vitis vinifera
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    592   0.0      
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     592   0.0      
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         588   0.0      
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    588   0.0      
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    588   0.0      
emb|CBI17110.3|  unnamed protein product                                584   0.0      
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    586   0.0      
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    583   0.0      
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    581   0.0      
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    580   0.0      
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    579   0.0      
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             578   0.0      
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     576   0.0      
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        575   0.0      
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    573   0.0      
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     570   0.0      
ref|XP_009591854.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    566   0.0      
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   567   0.0      
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        566   0.0      
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    566   0.0      
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             565   0.0      
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     566   0.0      
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             563   0.0      
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                    563   0.0      
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g            564   0.0      
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    563   0.0      
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    562   0.0      
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg             561   0.0      
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             563   0.0      
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         560   0.0      
emb|CDY09173.1|  BnaA02g05990D                                          561   0.0      
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    559   0.0      
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    559   0.0      
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    557   0.0      
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             554   0.0      
ref|XP_006378926.1|  hypothetical protein POPTR_0009s00740g             552   0.0      
ref|XP_008458664.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    551   0.0      
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                    553   0.0      
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         552   0.0      
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    552   0.0      
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     551   0.0      
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   550   0.0      
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             550   0.0      
ref|XP_007150133.1|  hypothetical protein PHAVU_005G129500g             546   0.0      
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    554   0.0      
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        546   0.0      Vitis vinifera
gb|KDO55292.1|  hypothetical protein CISIN_1g036751mg                   545   0.0      
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             543   0.0      
emb|CDP14439.1|  unnamed protein product                                540   0.0      
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    540   0.0      
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         535   0.0      Ricinus communis
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             535   0.0      
ref|XP_006424409.1|  hypothetical protein CICLE_v10030113mg             535   0.0      
ref|XP_006369368.1|  hypothetical protein POPTR_0001s220902g            531   1e-180   
ref|XP_006485335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    531   1e-180   
ref|XP_009356965.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    530   1e-180   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         528   3e-180   
gb|KCW50727.1|  hypothetical protein EUGRSUZ_J00403                     528   1e-179   
emb|CAN64373.1|  hypothetical protein VITISV_018663                     535   7e-179   Vitis vinifera
ref|XP_006424411.1|  hypothetical protein CICLE_v10028519mg             524   9e-179   
emb|CBI17113.3|  unnamed protein product                                531   9e-179   
ref|XP_006369365.1|  hypothetical protein POPTR_0001s220902g            524   5e-178   
gb|KCW50433.1|  hypothetical protein EUGRSUZ_J00172                     525   1e-177   
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             523   4e-177   Populus trichocarpa [western balsam poplar]
gb|KDO44737.1|  hypothetical protein CISIN_1g038117mg                   523   4e-177   
ref|XP_010493397.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    517   9e-176   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         514   5e-174   Ricinus communis
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        515   6e-174   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         513   4e-173   
emb|CDY09174.1|  BnaA02g06000D                                          508   3e-171   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             503   1e-170   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    506   2e-170   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    501   2e-168   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    517   4e-167   
ref|XP_011004991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    495   2e-166   
ref|XP_011005222.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    494   5e-166   
ref|XP_010421084.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    490   3e-165   
ref|NP_197677.2|  Serine carboxypeptidase S28 family protein            489   5e-165   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         486   3e-164   
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    483   2e-163   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    484   3e-162   
gb|KCW50728.1|  hypothetical protein EUGRSUZ_J00403                     480   7e-162   
emb|CBI17114.3|  unnamed protein product                                478   2e-160   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    479   3e-160   
ref|XP_006494702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    474   5e-160   
ref|XP_004172321.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    477   5e-160   
ref|XP_006424410.1|  hypothetical protein CICLE_v10030022mg             475   3e-159   
ref|XP_006494706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    471   6e-159   
emb|CDP07009.1|  unnamed protein product                                467   4e-156   
gb|KCW50734.1|  hypothetical protein EUGRSUZ_J00406                     465   3e-155   
ref|XP_006436579.1|  hypothetical protein CICLE_v10033867mg             458   6e-153   
ref|XP_006369369.1|  hypothetical protein POPTR_0001s220902g            458   8e-153   
gb|ABR16397.1|  unknown                                                 452   2e-149   Picea sitchensis
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    449   3e-148   
ref|XP_006408697.1|  hypothetical protein EUTSA_v10002179mg             443   4e-147   
gb|KCW50724.1|  hypothetical protein EUGRSUZ_J00402                     442   6e-147   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    442   3e-146   
emb|CDX71016.1|  BnaC03g11000D                                          440   3e-146   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    442   2e-145   Vitis vinifera
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             441   7e-145   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             440   7e-145   
gb|KCW50731.1|  hypothetical protein EUGRSUZ_J004041                    434   2e-144   
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    434   2e-144   
emb|CBI30345.3|  unnamed protein product                                438   2e-144   
gb|KHN29944.1|  Lysosomal Pro-X carboxypeptidase                        432   4e-144   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    438   8e-144   
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        437   1e-143   
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    437   1e-143   
emb|CDY20293.1|  BnaC04g36630D                                          437   2e-143   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        437   2e-143   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           436   3e-143   
ref|XP_008344905.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   3e-143   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    436   4e-143   
gb|ABR17702.1|  unknown                                                 436   4e-143   Picea sitchensis
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        436   6e-143   
emb|CDP10629.1|  unnamed protein product                                436   6e-143   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             435   9e-143   Populus trichocarpa [western balsam poplar]
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    435   1e-142   
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                434   1e-142   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             434   2e-142   
emb|CDY46135.1|  BnaA04g14230D                                          434   2e-142   
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   3e-142   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    434   5e-142   
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   8e-142   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        432   1e-141   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    431   2e-141   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    441   2e-141   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   2e-141   
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        432   2e-141   
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         431   2e-141   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   3e-141   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    431   4e-141   
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              430   7e-141   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    430   1e-140   
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             429   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    429   2e-140   
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         429   3e-140   Ricinus communis
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        428   3e-140   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    429   4e-140   
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         428   5e-140   
ref|XP_006388622.1|  hypothetical protein POPTR_0135s002102g            422   6e-140   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    427   7e-140   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    427   9e-140   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           426   2e-139   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         426   3e-139   Ricinus communis
ref|XP_008344907.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   7e-139   
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    426   7e-139   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    425   8e-139   
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             416   2e-138   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    424   2e-138   
emb|CDP10200.1|  unnamed protein product                                423   2e-138   
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    423   2e-138   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             424   3e-138   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    423   3e-138   
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         423   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        422   5e-138   
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        422   8e-138   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          422   8e-138   
gb|EPS74090.1|  hypothetical protein M569_00662                         422   8e-138   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    422   9e-138   
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        422   1e-137   
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          422   1e-137   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    422   1e-137   
ref|XP_006378927.1|  hypothetical protein POPTR_0009s00740g             416   2e-137   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        421   2e-137   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        421   3e-137   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        420   4e-137   
gb|KCW50729.1|  hypothetical protein EUGRSUZ_J00403                     415   5e-137   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         419   1e-136   
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        419   1e-136   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   1e-136   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        420   2e-136   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   2e-136   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    418   2e-136   
emb|CBI18675.3|  unnamed protein product                                418   3e-136   
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         418   4e-136   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   4e-136   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                418   5e-136   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        417   6e-136   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    418   7e-136   
ref|XP_006494707.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   9e-136   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        417   1e-135   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    418   1e-135   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    416   2e-135   
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    416   2e-135   
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        416   3e-135   
emb|CDY08753.1|  BnaA06g24710D                                          415   5e-135   
emb|CDY45627.1|  BnaCnng13350D                                          415   6e-135   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    415   6e-135   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   2e-134   
ref|XP_001776094.1|  predicted protein                                  413   3e-134   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   3e-134   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   3e-134   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    412   3e-134   
ref|NP_001058206.1|  Os06g0647400                                       414   4e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    414   5e-134   
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   5e-134   
gb|EEC81080.1|  hypothetical protein OsI_23902                          414   6e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   6e-134   
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     414   7e-134   Zea mays [maize]
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   9e-134   
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   1e-133   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    411   1e-133   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    412   1e-133   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              412   3e-133   
dbj|BAJ92142.1|  predicted protein                                      411   5e-133   
dbj|BAJ87416.1|  predicted protein                                      410   8e-133   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             409   1e-132   
ref|XP_006369373.1|  hypothetical protein POPTR_0001s221002g            402   1e-132   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          410   3e-132   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    408   4e-132   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    407   4e-132   
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            407   7e-132   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             406   3e-131   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         406   3e-131   
ref|XP_008349805.1|  PREDICTED: uncharacterized protein LOC103413093    427   3e-131   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    405   3e-131   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    406   7e-131   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     402   1e-130   
dbj|BAJ86079.1|  predicted protein                                      404   2e-130   
gb|EPS59259.1|  hypothetical protein M569_15548                         402   2e-130   
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    404   2e-130   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   403   4e-130   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             403   4e-130   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    402   1e-129   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             401   2e-129   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    401   2e-129   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    401   2e-129   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        401   3e-129   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    401   4e-129   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             400   5e-129   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        400   6e-129   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        399   1e-128   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    399   2e-128   
gb|KCW50736.1|  hypothetical protein EUGRSUZ_J00407                     391   2e-128   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           398   3e-128   
ref|XP_006369370.1|  hypothetical protein POPTR_0001s220902g            393   3e-128   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   4e-128   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    397   4e-128   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     398   1e-127   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        395   1e-127   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    396   1e-127   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    397   1e-127   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   1e-127   
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       396   2e-127   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        397   3e-127   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     397   4e-127   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    394   6e-127   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    393   1e-126   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   1e-126   
ref|XP_004139566.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    387   1e-126   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    394   1e-126   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   2e-126   
emb|CDM83096.1|  unnamed protein product                                394   2e-126   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         393   3e-126   
emb|CDP02648.1|  unnamed protein product                                392   3e-126   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   4e-126   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    391   8e-126   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   9e-126   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        390   3e-125   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              390   3e-125   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             389   3e-125   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   4e-125   
ref|NP_001044360.1|  Os01g0767100                                       390   4e-125   
dbj|BAK01568.1|  predicted protein                                      389   6e-125   
gb|AFW87518.1|  putative serine peptidase S28 family protein            405   7e-125   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              386   4e-124   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    386   8e-124   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     379   8e-124   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        387   1e-123   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    386   1e-123   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        385   1e-122   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        384   1e-122   
dbj|BAK05623.1|  predicted protein                                      382   3e-122   
gb|ABR17682.1|  unknown                                                 382   5e-122   
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           380   5e-122   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          381   1e-121   
gb|AAM15096.1|  putative prolylcarboxypeptidase                         379   2e-121   
ref|XP_002299661.1|  hypothetical protein POPTR_0001s22070g             378   2e-121   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    380   2e-121   
gb|AFW87519.1|  putative serine peptidase S28 family protein            380   5e-121   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               378   2e-120   
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    378   3e-120   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        374   5e-120   
gb|AFW84965.1|  putative serine peptidase S28 family protein            375   2e-119   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    374   3e-119   
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     372   8e-119   
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    372   8e-119   
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          374   2e-118   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              371   2e-118   
gb|EAY75958.1|  hypothetical protein OsI_03875                          372   9e-118   
gb|EAY80009.1|  hypothetical protein OsI_35177                          370   3e-117   
ref|NP_001065793.1|  Os11g0156200                                       368   1e-116   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  367   1e-116   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          369   2e-116   
ref|XP_004151265.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    362   2e-116   
ref|XP_006495294.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    358   3e-116   
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    367   4e-116   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  357   5e-116   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      365   6e-116   
gb|EEE66119.1|  hypothetical protein OsJ_22160                          361   1e-115   
ref|XP_006484930.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    357   1e-115   
gb|KDO36924.1|  hypothetical protein CISIN_1g023602mg                   356   2e-115   
emb|CDX68714.1|  BnaC01g07390D                                          358   1e-114   
gb|AIA26578.1|  serine protease                                         358   2e-114   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          360   7e-113   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    353   3e-112   
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             354   3e-112   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    351   1e-111   
ref|XP_006430124.1|  hypothetical protein CICLE_v10011529mg             347   8e-110   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        352   4e-109   
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        347   5e-109   
ref|XP_006388624.1|  hypothetical protein POPTR_0135s00220g             340   2e-108   
gb|KDO60325.1|  hypothetical protein CISIN_1g023618mg                   336   2e-107   
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             342   3e-107   
ref|XP_008360152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    334   2e-106   
ref|XP_004295647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   3e-106   
ref|XP_008385547.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    332   5e-106   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   6e-105   
ref|XP_010675581.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    333   1e-103   
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             331   4e-103   
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    330   5e-103   
gb|KDO44739.1|  hypothetical protein CISIN_1g047044mg                   321   8e-102   
emb|CDY09175.1|  BnaA02g06010D                                          325   9e-102   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    323   2e-100   
ref|XP_010424236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    315   5e-99    
ref|XP_010676045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    320   5e-99    
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  316   1e-97    
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    317   3e-97    
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    313   2e-96    
ref|NP_001072639.1|  lysosomal Pro-X carboxypeptidase precursor         314   6e-96    
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    310   2e-95    
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    309   5e-95    
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    311   6e-95    
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    311   6e-95    
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    308   7e-95    
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    311   8e-95    
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        305   1e-94    
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    310   1e-94    
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        308   2e-94    
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        309   2e-94    
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    310   3e-94    
gb|KDO36925.1|  hypothetical protein CISIN_1g023602mg                   300   3e-94    
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    309   3e-94    
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181              308   5e-94    
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        308   8e-94    
ref|XP_006055696.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        308   1e-93    
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        307   2e-93    
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        307   2e-93    
ref|XP_006436577.1|  hypothetical protein CICLE_v10033555mg             300   2e-93    
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           306   2e-93    
ref|NP_001033253.1|  lysosomal Pro-X carboxypeptidase precursor         307   2e-93    
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        307   2e-93    
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        306   3e-93    
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    306   4e-93    
ref|XP_003968706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    306   5e-93    
ref|XP_001628070.1|  predicted protein                                  304   5e-93    
gb|AAH26424.1|  Prcp protein                                            304   1e-92    
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    305   2e-92    
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    304   2e-92    
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             304   2e-92    
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   3e-92    
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   3e-92    
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        304   4e-92    
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor            303   4e-92    
gb|ACE75287.1|  prolylcarboxypeptidase                                  303   5e-92    
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   6e-92    
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   6e-92    
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   7e-92    
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   7e-92    
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    303   8e-92    
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         303   8e-92    
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        303   9e-92    
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
gb|AAH55022.1|  Prcp protein                                            303   1e-91    
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   1e-91    
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    302   1e-91    
ref|XP_002532920.1|  catalytic, putative                                294   1e-91    
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   1e-91    
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        306   1e-91    
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   1e-91    
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    301   1e-91    
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   1e-91    
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    303   1e-91    
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   1e-91    
ref|XP_004683302.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   2e-91    
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   2e-91    
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   2e-91    
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        300   2e-91    
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   2e-91    
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        302   2e-91    
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   3e-91    
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   3e-91    
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        299   3e-91    
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   3e-91    
ref|XP_008476948.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    303   3e-91    
ref|XP_004560588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    301   3e-91    
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    301   3e-91    
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   3e-91    
ref|XP_004019472.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    302   3e-91    
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   3e-91    
ref|XP_006747630.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   4e-91    
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    301   4e-91    
gb|KDO70542.1|  hypothetical protein CISIN_1g0106561mg                  297   4e-91    
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   4e-91    
ref|NP_001099751.2|  lysosomal Pro-X carboxypeptidase precursor         301   4e-91    
ref|XP_007900913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        301   4e-91    
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        299   5e-91    
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   5e-91    
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    301   5e-91    
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    301   5e-91    
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   5e-91    
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    301   6e-91    
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        299   6e-91    
ref|XP_008018493.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   6e-91    
ref|XP_010002716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   7e-91    
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   7e-91    
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        299   8e-91    
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   9e-91    
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    300   9e-91    
gb|KFU94741.1|  Lysosomal Pro-X carboxypeptidase                        298   1e-90    
ref|XP_010361179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        300   1e-90    



>ref|XP_009631310.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=523

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/477 (73%), Positives = 397/477 (83%), Gaps = 4/477 (1%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSD---ILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYI  284
             PH IPRLTP   + LR   + SS     LP  F TYYY QTLDHFNY P+SY+TFKQRYI
Sbjct  43    PHKIPRLTPLLENILRDSNTLSSSSSFTLPKAFETYYYTQTLDHFNYGPKSYSTFKQRYI  102

Query  285   VSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  464
             ++S YWGG+ SNSPIFA+LGAES ID DP  IGFLTD APRFKALLVYIEHRYYGKSIPF
Sbjct  103   INSNYWGGSNSNSPIFAYLGAESSIDSDPLGIGFLTDFAPRFKALLVYIEHRYYGKSIPF  162

Query  465   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
             GTMEEA+ +E  RGYFNSAQA+ADYAE+LL++K K+ AQ+SPIIV GGSYGGMLASWFR+
Sbjct  163   GTMEEALKDEDRRGYFNSAQAIADYAELLLHVKEKFSAQNSPIIVIGGSYGGMLASWFRM  222

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKEVS+ CY+TIRKSWS+IDKIAS+
Sbjct  223   KYPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEVSKTCYRTIRKSWSIIDKIASR  282

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1004
              NGLS LS+KFK C  L S  ELKDYLDS Y TAAQY++PP YPVT VCGGIDGA KG+ 
Sbjct  283   NNGLSYLSRKFKTCSHLNSSSELKDYLDSIYATAAQYNKPPTYPVTVVCGGIDGAHKGSH  342

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             +LDRIHAG+V  +GN TCY+   YN P SET +GWRWQTCSEM MPIGRG  DTMF+ AP
Sbjct  343   VLDRIHAGIVASQGNLTCYNTNFYNQP-SETSMGWRWQTCSEMVMPIGRGKNDTMFYSAP  401

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             F++ +F   C   YGV PRPHWITTYYGGHD+KL+LH+F SNIIFSNGLRDPYSSAGVL+
Sbjct  402   FNLDEFIDACKSNYGVSPRPHWITTYYGGHDVKLILHRFASNIIFSNGLRDPYSSAGVLQ  461

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             DIS ++ AV+TRNGSHCLDI  +  TDPDWLT QRK EVEII+ WITKYY +L ALK
Sbjct  462   DISHSLRAVHTRNGSHCLDILTSKPTDPDWLTMQRKTEVEIIEGWITKYYADLNALK  518



>ref|XP_009779688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=509

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/478 (71%), Positives = 394/478 (82%), Gaps = 6/478 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLRRPESSSSD-----ILPPEFRTYYYHQTLDHFNYRPQSYATFKQRY  281
             H IPRLTP   + L+   + SS       LP EF TYYY QTLDHFNY P+SY+TFKQRY
Sbjct  28    HKIPRLTPLVENILKDSNTLSSSSSSSFTLPKEFETYYYTQTLDHFNYGPKSYSTFKQRY  87

Query  282   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             I++SKYWGG+ S+S IFA+LGAES ID DP  IGFLTD APRFKALLVY+EHRYYGKSIP
Sbjct  88    IINSKYWGGSNSSSTIFAYLGAESSIDGDPLGIGFLTDFAPRFKALLVYMEHRYYGKSIP  147

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FGTMEEA+ +E  RGYFNSAQA+ADYAE+LL++K K+ AQ+SPIIV GGSYGGMLASWFR
Sbjct  148   FGTMEEALKDEDRRGYFNSAQAIADYAELLLHVKEKFSAQNSPIIVIGGSYGGMLASWFR  207

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             +KYPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKEVS  CY+TIRKSWS+IDKIAS
Sbjct  208   MKYPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEVSNTCYRTIRKSWSIIDKIAS  267

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             + NGLS LS+KFK C  L +  ELKDYLDS Y TAAQY+ PP YPVT VCGGIDGA KG+
Sbjct  268   RKNGLSYLSRKFKTCSHLNNSSELKDYLDSIYATAAQYNTPPTYPVTVVCGGIDGAHKGS  327

Query  1002  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              +LDRI+AG+V  +G   CY+  +YN P SET +GWRWQTCSEM MPIGRG  +TMF+  
Sbjct  328   HVLDRIYAGIVAFQGKLKCYNTNLYNQP-SETYMGWRWQTCSEMVMPIGRGKNETMFYSD  386

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
             PF++ +F   C  YYGV PRPHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL
Sbjct  387   PFNLDEFVDACKSYYGVSPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVL  446

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +DIS ++ AV+TRNGSHCLDI  +  TDP+WLT QRK EVEII+ WITKYY +L ALK
Sbjct  447   QDISHSLRAVHTRNGSHCLDILTSKPTDPEWLTMQRKTEVEIIEGWITKYYADLNALK  504



>ref|XP_004250994.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/481 (70%), Positives = 394/481 (82%), Gaps = 7/481 (1%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPE----SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRY  281
             PH IPRLTP   + ++       SSS + LP EF TYYY QTLDHFNY P+SY+TFKQRY
Sbjct  25    PHKIPRLTPLIENIIQDHSNTFSSSSRNDLPKEFETYYYKQTLDHFNYGPKSYSTFKQRY  84

Query  282   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             I++SKYWGG+ SNSPIFA+LGAES ID DP  IGFLTD AP+FKALLVY+EHRYYG+SIP
Sbjct  85    IINSKYWGGSNSNSPIFAYLGAESSIDRDPLGIGFLTDFAPQFKALLVYMEHRYYGESIP  144

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             F TMEEA+ +E +RGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR
Sbjct  145   FKTMEEALKDEDSRGYFNSAQAIADYAELLLHIKQKYSAKNSPIIVIGGSYGGMLASWFR  204

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             +KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S +CY TIRKSW++IDKIAS
Sbjct  205   MKYPHIALGALASSAPILYFDNITPQNGYYSIVSRDFKEASASCYHTIRKSWAIIDKIAS  264

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
               NGLS LS+KFK C  L  P ELK+YLD+ Y  AAQY+ PP YPVT VCGGIDGAPKG+
Sbjct  265   GKNGLSYLSRKFKTCSKLNDPFELKNYLDTMYSVAAQYNSPPSYPVTIVCGGIDGAPKGS  324

Query  1002  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              ILDRI AG+V   GN +CY+    NP  SET +GWRWQTCSEM MPIGRG  DTMFF A
Sbjct  325   HILDRIFAGIVEFNGNSSCYN---MNPMPSETSLGWRWQTCSEMVMPIGRGKNDTMFFSA  381

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
             PF++  F ++C   YGV PRPHW+TTYYGG DIKL+  +F SNIIFSNGLRDPYSSAGVL
Sbjct  382   PFNLNNFIKNCKKMYGVSPRPHWVTTYYGGQDIKLIFQRFASNIIFSNGLRDPYSSAGVL  441

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*  1541
             +DISD++LAV+TRNGSHCLDI     +DP+WLT QR  EV+II+ WITKYY +L+A+K+ 
Sbjct  442   QDISDSLLAVHTRNGSHCLDILSKMSSDPEWLTMQRNTEVKIIEGWITKYYADLKAIKKG  501

Query  1542  K  1544
             K
Sbjct  502   K  502



>ref|XP_006349128.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=504

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/481 (70%), Positives = 394/481 (82%), Gaps = 7/481 (1%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPE----SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRY  281
             PH IPRLTP  ++ L+       SS++D LP EF TYYY QTLDHFNY P+SY+TFKQRY
Sbjct  25    PHKIPRLTPLIQNILQDHSNTFSSSTNDDLPKEFETYYYKQTLDHFNYGPKSYSTFKQRY  84

Query  282   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             I++SKYWGG+ S+SPIFA+LGAES ID DP  +GFLTD AP+FKALLVY+EHRYYG+S P
Sbjct  85    IINSKYWGGSNSSSPIFAYLGAESSIDGDPLGVGFLTDFAPQFKALLVYMEHRYYGESTP  144

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             F TMEEA+ +E TRGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR
Sbjct  145   FKTMEEAVKDEDTRGYFNSAQAIADYAELLLHIKEKYSAKNSPIIVIGGSYGGMLASWFR  204

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             +KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S++CY TIR SW++IDKIAS
Sbjct  205   MKYPHIALGALASSAPILYFDNITPQNGYYSVVSRDFKEASKSCYHTIRNSWAIIDKIAS  264

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             + +GLS LS+KFK C  L  P ELKDYLDS Y  AAQY+ PP YPVT VCGGIDGAPKG+
Sbjct  265   RKSGLSYLSRKFKTCSKLNDPFELKDYLDSMYSVAAQYNSPPSYPVTIVCGGIDGAPKGS  324

Query  1002  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              ILDRI AG+V   G  +CY+    NP  SET +GWRWQTCSEM MPIGRG+ DTMFF A
Sbjct  325   HILDRIFAGIVAYSGTSSCYN---MNPKPSETGLGWRWQTCSEMVMPIGRGENDTMFFSA  381

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
             PF++  F  DC   YGV PRPHWITTYYGG DIKL+L +F SNIIFSNGLRDPYSSAGVL
Sbjct  382   PFNLNNFITDCKKKYGVSPRPHWITTYYGGKDIKLILQRFASNIIFSNGLRDPYSSAGVL  441

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*  1541
             +DIS ++ AV+TRNGSHCLDI     +DP+WLT QR  EV+II+ WITKYY +L+ALK+ 
Sbjct  442   QDISHSLQAVHTRNGSHCLDILSKDSSDPEWLTMQRNTEVKIIEGWITKYYADLKALKKG  501

Query  1542  K  1544
             K
Sbjct  502   K  502



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 395/477 (83%), Gaps = 4/477 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNL--RRPESS-SSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             H IPRL+P  +  L  R P+   S+  +  +F+T++Y QTLDHFNY PQSYATF+QRY+V
Sbjct  26    HKIPRLSPHNKEALILRNPDDVISTSAISKDFKTHFYSQTLDHFNYAPQSYATFRQRYVV  85

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +SKYWGG  SNSPIFA+LGAE+P+D+D + IGFL DNAP FK+L VYIEHR+YGKS+PFG
Sbjct  86    NSKYWGGPTSNSPIFAYLGAEAPLDEDQEVIGFLNDNAPHFKSLSVYIEHRFYGKSVPFG  145

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              ME+AM N T RGYF+SAQA+ADYAE+LL++K+K+ A +SPIIV GGSYGG LASWFRLK
Sbjct  146   KMEDAMKNATLRGYFSSAQAIADYAEILLHVKHKFAAHYSPIIVVGGSYGGKLASWFRLK  205

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPH+ALGALASSAP+LYFDNITP+NGYYS+VTKDF+EVS+NCYQTI+ SW+ IDK+ASKP
Sbjct  206   YPHIALGALASSAPVLYFDNITPQNGYYSIVTKDFEEVSKNCYQTIKNSWAEIDKVASKP  265

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
              GLSILS++FK C  L +  ELKD+LD+ Y  AAQY+ PP YPVT VC GIDGAP G D+
Sbjct  266   KGLSILSQRFKTCSHLNNSDELKDFLDTMYSVAAQYNHPPTYPVTVVCKGIDGAPAGTDV  325

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             + RI AGVV   GNRTCYD   YN P SET VGW WQTCSE+ +PIGRG+ DTMF  APF
Sbjct  326   IGRIFAGVVSYRGNRTCYDTNAYNYP-SETSVGWEWQTCSEIVIPIGRGENDTMFPAAPF  384

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              + +F++ C D+YGVPPRPHWITTYYGGHDIKLVL++FGSNIIFSNGLRDPYSS GVLED
Sbjct  385   DLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGLRDPYSSGGVLED  444

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +S++++AV T  GSHCLDI  ++KTDPDWL  QRK+E+EII+ W+  YY +L+ALKR
Sbjct  445   LSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGWLKTYYSDLQALKR  501



>ref|XP_004251370.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/481 (69%), Positives = 393/481 (82%), Gaps = 7/481 (1%)
 Frame = +3

Query  114   PHTIPRLTPF----YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRY  281
             PH IPRLTP     ++ +     SS++D LP EF T YY QTLDHFNY P+SY+TFKQRY
Sbjct  25    PHKIPRLTPLIENKHQDHSNTFSSSTNDDLPKEFETCYYKQTLDHFNYGPKSYSTFKQRY  84

Query  282   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             I++SKYWGG+ S+SPIFA+LGAES ID DP  IGFLTD AP+FKALLVY+EHRYYG+S P
Sbjct  85    IINSKYWGGSNSSSPIFAYLGAESSIDSDPLGIGFLTDFAPQFKALLVYMEHRYYGESTP  144

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             F TMEEA+ +E +RGYFNSAQA+ADYAE+LL++K KY A++SPIIV GGSYGGMLASWFR
Sbjct  145   FKTMEEALKDEDSRGYFNSAQAIADYAELLLHIKQKYSAKNSPIIVIGGSYGGMLASWFR  204

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             +KYPH+ALGALASSAPILYFDNITP+NGYYS+V++DFKE S +CY TIRKSW++IDKIAS
Sbjct  205   MKYPHIALGALASSAPILYFDNITPQNGYYSIVSRDFKEASASCYHTIRKSWAIIDKIAS  264

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
               NGLS LS+KFK C  L  P ELKDYLDS Y  AAQY+ PP YPVT VCGGIDGAPKG+
Sbjct  265   GKNGLSYLSRKFKTCSKLNDPFELKDYLDSMYSEAAQYNSPPSYPVTIVCGGIDGAPKGS  324

Query  1002  DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              ILDRI AG+V  +GN +CY+    NP  SE  +GWRWQTCSEM MPIGRG+ DTMF+  
Sbjct  325   HILDRIFAGIVAYKGNSSCYN---MNPMPSEEDLGWRWQTCSEMVMPIGRGENDTMFYSD  381

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
             PF++  F +DC   YGV PR HWITTYYGG DIKL+L +F SNIIFSNGLRDPYSSAGVL
Sbjct  382   PFNLNNFIKDCKKKYGVSPRSHWITTYYGGQDIKLILQRFASNIIFSNGLRDPYSSAGVL  441

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*  1541
             +DIS+++ AV+TRNGSHCLDI   + +DP+WLT QR  EV+II+ WITKYY +L+A+K+ 
Sbjct  442   QDISNSLQAVHTRNGSHCLDILSKTSSDPEWLTMQRNTEVKIIEGWITKYYADLKAIKKG  501

Query  1542  K  1544
             K
Sbjct  502   K  502



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/476 (68%), Positives = 388/476 (82%), Gaps = 2/476 (0%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDI-LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             PH IPRL+P  R+NLR P+ + +   L  +F++Y+Y QTLDHFNY PQSY  F Q Y+++
Sbjct  32    PHKIPRLSPIRRTNLRDPDDTLTKASLSEDFKSYFYEQTLDHFNYNPQSYTKFNQSYVIN  91

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SK+WGGA+SNSPI A+LGAE+P+  D + IGFLTDNAPRFKALLVYIEHR+YGKSIP G+
Sbjct  92    SKFWGGAKSNSPILAYLGAEAPLAGDIEAIGFLTDNAPRFKALLVYIEHRFYGKSIPLGS  151

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
             ME+ M ++T RGYFNSAQALADYAEVLL++K+K+ AQ+SPIIV GGSYGGMLASWFRLKY
Sbjct  152   MEKVMKSKTVRGYFNSAQALADYAEVLLHVKHKFSAQNSPIIVVGGSYGGMLASWFRLKY  211

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAP+LYFD+ITP+NGYYS VTKDFKE SE+CYQTIR+SWS IDK+ASKPN
Sbjct  212   PHIALGALASSAPVLYFDDITPQNGYYSTVTKDFKEESEHCYQTIRQSWSEIDKVASKPN  271

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C  L S  +LKDYLDS + +AAQY+ PPKYPVTEVC GID APKG DIL
Sbjct  272   GLSILSKRFKTCTPLNSSSQLKDYLDSMFSSAAQYNSPPKYPVTEVCSGIDKAPKGTDIL  331

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              R  AGVV  + + +CYD   Y   T ET VGW+WQTCSEM MPIGRG  DTMF P+PF+
Sbjct  332   GRTFAGVVSYKKDESCYDMLEYARST-ETNVGWQWQTCSEMVMPIGRGSNDTMFPPSPFN  390

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             +  F ++C   YGV PRPHWITTYYGGHD+KLV  +FGSNIIFSNGL+DPYSS GV E++
Sbjct  391   LPDFIKNCKSSYGVSPRPHWITTYYGGHDMKLVFQRFGSNIIFSNGLKDPYSSGGVRENL  450

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             S ++LA+YT  GSHCLDI  A ++DP WL  QRK EVEII+ WI +YY ++ ++ +
Sbjct  451   SSSLLAIYTVKGSHCLDILAAKESDPSWLVAQRKLEVEIIEEWIKQYYADVHSIGK  506



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/477 (68%), Positives = 389/477 (82%), Gaps = 7/477 (1%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPE--SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             PH I  LTP  ++ L+     S+SS  LP EF TY+Y QTLDHFNY P+SY+TFKQRYI+
Sbjct  29    PHKIQTLTPLLKNILKDSNTLSNSSTNLPNEFETYFYTQTLDHFNYGPKSYSTFKQRYII  88

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +SKYWGG+ S+SPIFA+LGAES ID+DP  IGFLTD APRFKALLVY+EHRYYG+SIP G
Sbjct  89    NSKYWGGSNSSSPIFAYLGAESSIDNDPLNIGFLTDFAPRFKALLVYMEHRYYGQSIPLG  148

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              +EEA+ ++ TRGYFNSAQA+ADYAE+LL++K ++ A +SPIIV GGSYGGMLASWFRLK
Sbjct  149   KIEEALKDQDTRGYFNSAQAIADYAELLLHVKEQFSAPNSPIIVIGGSYGGMLASWFRLK  208

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPH+A+GALASSAPILYFD+ITP+NGYYS+VTKDF+E SE+CYQTIR SWS+IDKIAS  
Sbjct  209   YPHIAIGALASSAPILYFDDITPQNGYYSIVTKDFREASESCYQTIRDSWSIIDKIASTK  268

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
             +GLS LS+KFK C  L +  +LK YLDSTY  AAQYD PP+YPVT +CGGIDGA  G+D+
Sbjct  269   DGLSYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTLICGGIDGATNGSDV  328

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             LDRI AG+V  EGN++CY+     P      +GW WQTCSEM MPIGRG+ DTMF+ +PF
Sbjct  329   LDRIFAGIVAYEGNKSCYNILPGQPD-----LGWDWQTCSEMVMPIGRGENDTMFYSSPF  383

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             ++ QF  DC   YGV PRPHW+TTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL+D
Sbjct  384   NLDQFIEDCKSDYGVSPRPHWVTTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLQD  443

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +SD++LAV TRNGSHCLDI  +   DP+WLT QR +EVEII+ WIT Y  +L+ LK 
Sbjct  444   LSDSLLAVTTRNGSHCLDILTSQPNDPEWLTLQRNREVEIIEGWITTYCADLKVLKN  500



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/511 (64%), Positives = 403/511 (79%), Gaps = 19/511 (4%)
 Frame = +3

Query  6     NLSLQLYSLISMEFITLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPESSSSD  185
             +L + L  L+S+ F+ +   C +            TP  +PRL     S + R     S+
Sbjct  13    SLMISLQWLLSLMFLIIFPTCATA-----------TPSKLPRL-----STILRESEIFSE  56

Query  186   ILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDD  365
             ++  +F+T++Y+QTLDHFNYRP+SY TF+QRY+++ KYWGGA +++PIFA+LGAE+ +D 
Sbjct  57    LISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYLGAEAALDF  116

Query  366   DPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAE  545
             D   +GF  DNA +FKALLVYIEHRYYG+SIPFG+ EEA+ N +TRGYFNSAQA+ADYAE
Sbjct  117   DLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSAQAIADYAE  176

Query  546   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  725
             VL Y+K K LA++SP+IV GGSYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP+NG
Sbjct  177   VLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDITPQNG  236

Query  726   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  905
             YYS+VTKDF+E SE+CY TIR+SWS ID++AS+PNGLSILSKKF+ C  L    ELKDYL
Sbjct  237   YYSIVTKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNKSNELKDYL  296

Query  906   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1085
             ++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DIL RI AGVV   GN +CY+  + NP 
Sbjct  297   ETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCYNTSV-NP-  354

Query  1086  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYY  1265
              +ET  GWRWQTCSEM MPIGRGD DTMF P+PF++  F + C   Y VPPRPHWITTYY
Sbjct  355   -TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYY  413

Query  1266  GGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTD  1445
             GGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++IS TVLA++T NGSHCLDI  A  TD
Sbjct  414   GGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTD  473

Query  1446  PDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             P+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  474   PEWLIMQRKTEVEIIESWIAQYHADLDATRK  504



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/511 (64%), Positives = 403/511 (79%), Gaps = 19/511 (4%)
 Frame = +3

Query  6     NLSLQLYSLISMEFITLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPESSSSD  185
             +L + L  L+S+ F+ +   C +            TP  +PRL     S + R     S+
Sbjct  5     SLMISLQWLLSLMFLIIFPTCATA-----------TPSKLPRL-----STILRESEIFSE  48

Query  186   ILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDD  365
             ++  +F+T++Y+QTLDHFNYRP+SY TF+QRY+++ KYWGGA +++PIFA+LGAE+ +D 
Sbjct  49    LISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYLGAEAALDF  108

Query  366   DPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAE  545
             D   +GF  DNA +FKALLVYIEHRYYG+SIPFG+ EEA+ N +TRGYFNSAQA+ADYAE
Sbjct  109   DLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSAQAIADYAE  168

Query  546   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENG  725
             VL Y+K K LA++SP+IV GGSYGGMLASWFRLKYPHVALGALASSAPILYFD+ITP+NG
Sbjct  169   VLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDITPQNG  228

Query  726   YYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYL  905
             YYS+VTKDF+E SE+CY TIR+SWS ID++AS+PNGLSILSKKF+ C  L    ELKDYL
Sbjct  229   YYSIVTKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNKSNELKDYL  288

Query  906   DSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1085
             ++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DIL RI AGVV   GN +CY+  + NP 
Sbjct  289   ETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCYNTSV-NP-  346

Query  1086  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYY  1265
              +ET  GWRWQTCSEM MPIGRGD DTMF P+PF++  F + C   Y VPPRPHWITTYY
Sbjct  347   -TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYY  405

Query  1266  GGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTD  1445
             GGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++IS TVLA++T NGSHCLDI  A  TD
Sbjct  406   GGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTD  465

Query  1446  PDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             P+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  466   PEWLIMQRKTEVEIIESWIAQYHADLDATRK  496



>ref|XP_006349129.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=453

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/449 (71%), Positives = 377/449 (84%), Gaps = 3/449 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             EF TYYY QTLDHFNY P+SY+TFKQRYI++SKYWGG+ S+SPIFA+LGAES ID DP  
Sbjct  6     EFETYYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAYLGAESSIDGDPLG  65

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             +GFLTD AP+FKALLVY+EHRYYG+S PF TMEEA+N+E TRGYFNSAQA+ADYAE+LL+
Sbjct  66    VGFLTDFAPQFKALLVYMEHRYYGESTPFKTMEEAVNDEDTRGYFNSAQAIADYAELLLH  125

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K KY A++SPIIV GGSYGGMLASWFR+KYPH+ALGALASSAPILYFDNITP+NGYYS+
Sbjct  126   IKEKYSAKNSPIIVIGGSYGGMLASWFRMKYPHIALGALASSAPILYFDNITPQNGYYSV  185

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             V++DFKE S++CY  IRKSW +I+KIAS+ NGLS LS+KFK C  L  P ELKDYLDS Y
Sbjct  186   VSRDFKEASKSCYHNIRKSWEIINKIASRKNGLSYLSRKFKTCSKLNDPFELKDYLDSMY  245

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
               AAQY+ PP YPVT VCGGIDGAPKG+ +LDRI AG+V  +GN +C++    NP  SET
Sbjct  246   SEAAQYNSPPNYPVTIVCGGIDGAPKGSHMLDRIFAGIVAYKGNSSCHN---MNPKPSET  302

Query  1098  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1277
              +GWRWQTC+EM MP+GRG+ DTMF+  PF++  F +DC   YGV PRPHWITTYYGG D
Sbjct  303   DLGWRWQTCTEMVMPVGRGENDTMFYSDPFNLNNFIKDCKKKYGVSPRPHWITTYYGGQD  362

Query  1278  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1457
             IKL+L +F SNIIFSNGLRDPYSSAGVL+DIS +V AV+TRNGSHCLDI     TDP+WL
Sbjct  363   IKLILQRFASNIIFSNGLRDPYSSAGVLQDISHSVQAVHTRNGSHCLDILSKDSTDPEWL  422

Query  1458  TEQRKKEVEIIQSWITKYYVELEALKR*K  1544
             T QR  EV+II+ WITK+Y +L+ALK+ K
Sbjct  423   TMQRNTEVKIIEGWITKHYADLKALKKGK  451



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/481 (67%), Positives = 391/481 (81%), Gaps = 8/481 (2%)
 Frame = +3

Query  117   HTIPRLTPFYRSNL----RRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYI  284
             H  PRL+   +  L     RP  + S     +F+TY+Y QTLDHFNY PQSYATF+QRY+
Sbjct  36    HKAPRLSLHNKDALLISRSRPGGAISANALLDFKTYFYRQTLDHFNYAPQSYATFRQRYV  95

Query  285   VSSKYWGGAQ-SNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             V+SKYWGG   +NSPIFA+LGAE+PID+D   +GFL DNAP F +L+V+IEHRYYGKSIP
Sbjct  96    VNSKYWGGQSFNNSPIFAYLGAEAPIDNDLSVVGFLNDNAPSFNSLIVFIEHRYYGKSIP  155

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FGTMEEAM NETTRGYFNSAQA+ADYA +L ++K+++ A  SPIIV GGSYGGMLASWFR
Sbjct  156   FGTMEEAMKNETTRGYFNSAQAIADYAAILSHIKHQFSAHDSPIIVVGGSYGGMLASWFR  215

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             LKYPH+ALGALASSAPILYFDNITP+NGYYS+VTKDFKEVS+NCY+TIR+SW+ ID++AS
Sbjct  216   LKYPHIALGALASSAPILYFDNITPQNGYYSIVTKDFKEVSDNCYKTIRRSWAEIDRVAS  275

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             KPNGL ILS++FK C  L +  ELKDYL++ Y  AAQY++PP YPVT VC GIDG   G+
Sbjct  276   KPNGLDILSQRFKTCSKLNNAEELKDYLETIYAVAAQYNRPPNYPVTMVCRGIDGVHNGS  335

Query  1002  --DILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFF  1175
               D++ RI AGVV  +GN+TCYD   YN P SET +GW+WQTCSEM MPIGRG  +TMF 
Sbjct  336   DGDVIGRIFAGVVSYKGNKTCYDMNTYNYP-SETSIGWQWQTCSEMVMPIGRGQNETMFP  394

Query  1176  PAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
              APF++ +F + C + YGVPPRPHWITTYYGGHDIKL L++FGSNIIFSNGLRDPYSS G
Sbjct  395   AAPFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNGLRDPYSSGG  454

Query  1356  VLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             VLED+S++V+AV TRNGSHCLDI  A+KTDP+WL  QR  E++IIQ W+T YY +L++L 
Sbjct  455   VLEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGWLTTYYADLKSLN  514

Query  1536  R  1538
             +
Sbjct  515   K  515



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/471 (65%), Positives = 379/471 (80%), Gaps = 1/471 (0%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T  +IPRL    R+    P+ +SS +   +F+T++Y QTLDHFNYRP+SY TF QRY+V+
Sbjct  29    TQFSIPRLGALRRTTRTEPKITSSSV-SKDFKTFFYSQTLDHFNYRPESYTTFPQRYVVN  87

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYW GA +++PI  + G E+ +D+D   IGFLTDNAPRFKALLVYIEHR+YGKSIPFG+
Sbjct  88    SKYWSGANTSAPILVFFGEETSLDNDLSDIGFLTDNAPRFKALLVYIEHRFYGKSIPFGS  147

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              E A+ N + RGYF SAQA+ADYA ++L++K  + A++SP+IV GGSYGGMLA+WFRLKY
Sbjct  148   REAALRNASIRGYFTSAQAIADYAAIILHIKKTFFAKNSPVIVIGGSYGGMLAAWFRLKY  207

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PHVALGALASSAPILYFD++ P+ GYY++VTKDFKE SE+CY+TIR+SW  IDK+ASK N
Sbjct  208   PHVALGALASSAPILYFDDLAPQVGYYAIVTKDFKETSESCYETIRESWDEIDKVASKSN  267

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILS KFK CK LK   +LKDYLDS Y  AAQYD PP YP++ VCGGIDGAPKG DIL
Sbjct  268   GLSILSMKFKTCKKLKRTFDLKDYLDSIYSEAAQYDHPPTYPLSIVCGGIDGAPKGTDIL  327

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI AGVV   GN++CYD   YN P+ ET +GWRWQTCSEM MPIG G+ D+MF PAPF+
Sbjct  328   GRIFAGVVAYVGNKSCYDMNAYNHPSDETYMGWRWQTCSEMVMPIGHGNNDSMFPPAPFN  387

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             + +F R C   +GV P+PHW+TTYYGGHD+KL+LH+F SNIIFSNGLRDPYSS GVLE+I
Sbjct  388   LNRFIRKCKSLFGVQPQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRDPYSSGGVLENI  447

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             SD+V+AV+T +GSHCLDI    K+DP WL +QRK EV+II++W+ KYY +L
Sbjct  448   SDSVVAVHTIHGSHCLDILPEKKSDPQWLVKQRKTEVQIIEAWLAKYYTDL  498



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 382/475 (80%), Gaps = 2/475 (0%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             PH + RL    R+ LR P + S  +   EF+T+YY+QTLDHFNYRP+SY TF+QRY+V+ 
Sbjct  33    PHLL-RLGVLGRTFLREPATFSESV-SEEFQTFYYNQTLDHFNYRPESYITFQQRYVVNF  90

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKALLVYIEHRYYGKSIP+G+ 
Sbjct  91    KYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSR  150

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV G SYGGMLASWFRLKYP
Sbjct  151   EEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIVVGASYGGMLASWFRLKYP  210

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+TI +SWS ID++AS+PNG
Sbjct  211   HVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYKTISESWSEIDRVASEPNG  270

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPVT VCGGIDGAP+G+DIL 
Sbjct  271   LSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGAPEGSDILS  330

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             RI AGVV   GN +CY          ETI GW WQTCSE+ +PIGRG  DTMF  APF++
Sbjct  331   RIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNL  390

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIFSNGLRDPYS  GVL++IS
Sbjct  391   TTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNIS  450

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++VLA+ T NGSHCLD+  A+ TDP+WL  QRK EVEII+ WI +YYV+L A+ +
Sbjct  451   NSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYYVDLHAITK  505



>emb|CBI17109.3| unnamed protein product [Vitis vinifera]
Length=975

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/463 (68%), Positives = 384/463 (83%), Gaps = 3/463 (1%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S + R     S+++  +F+T++Y+QTLDHFNYRP+SY TF+QRY+++ KYWGGA +++PI
Sbjct  17    STILRESEIFSELISDDFQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPI  76

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             FA+LGAE+ +D D   +GF  DNA +FKALLVYIEHRYYG+SIPFG+ EEA+ N +TRGY
Sbjct  77    FAYLGAEAALDFDLTGVGFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGY  136

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
             FNSAQA+ADYAEVL Y+K K LA++SP+IV GGSYGGMLASWFRLKYPHVALGALASSAP
Sbjct  137   FNSAQAIADYAEVLEYIKKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAP  196

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             ILYFD+ITP+NGYYS+VTKDF+E SE+CY TIR+SWS ID++AS+PNGLSILSKKF+ C 
Sbjct  197   ILYFDDITPQNGYYSIVTKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCA  256

Query  870   GLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGN  1049
              L    ELKDYL++ Y  AAQY+ PP+YPVT VCGGIDGAP+G+DIL RI AGVV   GN
Sbjct  257   ELNKSNELKDYLETMYAVAAQYNHPPRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGN  316

Query  1050  RTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYG  1229
              +CY+  + NP  +ET  GWRWQTCSEM MPIGRGD DTMF P+PF++  F + C   Y 
Sbjct  317   SSCYNTSV-NP--TETSEGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYD  373

Query  1230  VPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGS  1409
             VPPRPHWITTYYGGHDIKL+LH+F SNIIFSNGLRDPYSSAGVL++IS TVLA++T NGS
Sbjct  374   VPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGS  433

Query  1410  HCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             HCLDI  A  TDP+WL  QRK EVEII+SWI +Y+ +L+A ++
Sbjct  434   HCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYHADLDATRK  476


 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/504 (62%), Positives = 388/504 (77%), Gaps = 14/504 (3%)
 Frame = +3

Query  21    LYSLISMEFI--TLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPE-SSSSDIL  191
             LYSL  + F+  TL++ C                  +PRL P  R  LR PE ++ S+  
Sbjct  479   LYSLQWLPFLIPTLILSCCVSAAQ----------FNVPRLGPLSRGILRNPEPAAVSESF  528

Query  192   PPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  371
               + +T++Y QTLDHFNYRP+SY TF+QRY+++ K+WGGA++ +PIFA+LGAE+P+D D 
Sbjct  529   YKDLKTFFYAQTLDHFNYRPESYKTFRQRYVMNFKHWGGAKAGAPIFAYLGAEAPLDGDL  588

Query  372   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  551
               IGF+ DNA RF ALL+YIEHRYYGKSIPFG+ + A+ N +T GYFNSAQA+ADYA VL
Sbjct  589   VNIGFVNDNAARFNALLIYIEHRYYGKSIPFGSTKVALKNASTLGYFNSAQAIADYAAVL  648

Query  552   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYY  731
             +++K +  AQ+SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILYFD I PE GYY
Sbjct  649   MHVKKRLHAQNSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFDEIAPEIGYY  708

Query  732   SLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDS  911
             S+VTKDF+E SE+CY+TIR+SWS ID+IASKPNGLSILSK+FK C  L+S  ELKDYLDS
Sbjct  709   SIVTKDFREASESCYRTIRRSWSEIDRIASKPNGLSILSKRFKTCAHLESSFELKDYLDS  768

Query  912   TYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1091
              Y  AAQY++PP YPVT VC GI+GA K  D L RI  G+V + G R+CYD + +N PT 
Sbjct  769   IYAEAAQYNEPPTYPVTVVCKGINGASKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-  827

Query  1092  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1271
             ET +GWRWQ CSEM +PIG    DTMF P PF++ +F ++C+  Y V PRPHW+TTYYGG
Sbjct  828   ETYLGWRWQKCSEMVLPIGHATNDTMFQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGG  887

Query  1272  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1451
              DIKL+LH+F SNIIFSNGLRDPYSS GVLE+ISDT++AVYTR+GSHCLDI  + K+DP 
Sbjct  888   RDIKLILHRFASNIIFSNGLRDPYSSGGVLENISDTLVAVYTRHGSHCLDILPSQKSDPQ  947

Query  1452  WLTEQRKKEVEIIQSWITKYYVEL  1523
             WL  QRK EVEII+ W+ KYY +L
Sbjct  948   WLVMQRKMEVEIIKGWMDKYYTDL  971



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 382/475 (80%), Gaps = 2/475 (0%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             PH + RL    R+ LR P + S  +   EF+T+YY+QTLDHFNYRP+SY TF+QRY+V+ 
Sbjct  152   PHLL-RLGVLGRTFLREPATFSESV-SEEFQTFYYNQTLDHFNYRPESYITFQQRYVVNF  209

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKALLVYIEHRYYGKSIP+G+ 
Sbjct  210   KYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSR  269

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV G SYGGMLASWFRLKYP
Sbjct  270   EEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIVVGASYGGMLASWFRLKYP  329

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+TI +SWS ID++AS+PNG
Sbjct  330   HVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYKTISESWSEIDRVASEPNG  389

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPVT VCGGIDGAP+G+DIL 
Sbjct  390   LSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGAPEGSDILS  449

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             RI AGVV   GN +CY          ETI GW WQTCSE+ +PIGRG  DTMF  APF++
Sbjct  450   RIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNL  509

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIFSNGLRDPYS  GVL++IS
Sbjct  510   TTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNIS  569

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++VLA+ T NGSHCLD+  A+ TDP+WL  QRK EVEII+ WI +YYV+L A+ +
Sbjct  570   NSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYYVDLHAITK  624


 Score =   115 bits (287),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  1116  QTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLH  1295
             Q C+E  MP+ RGD DTMF   PF++  F ++C   YGV P PHW TTYYGGH+I+L+LH
Sbjct  2     QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  1296  KFGSNIIFSNGLRDPYSSAG  1355
             +F SNIIFSNGLRDPY+  G
Sbjct  62    RFASNIIFSNGLRDPYAVPG  81



>ref|XP_002271733.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=505

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/503 (62%), Positives = 387/503 (77%), Gaps = 14/503 (3%)
 Frame = +3

Query  24    YSLISMEFI--TLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPE-SSSSDILP  194
             YSL  + F+  TL++ C                  +PRL P  R  LR PE ++ S+   
Sbjct  10    YSLQWLPFLIPTLILSCCVSA----------AQFNVPRLGPLSRGILRNPEPAAVSESFY  59

Query  195   PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  374
              + +T++Y QTLDHFNYRP+SY TF+QRY+++ K+WGGA++ +PIFA+LGAE+P+D D  
Sbjct  60    KDLKTFFYAQTLDHFNYRPESYKTFRQRYVMNFKHWGGAKAGAPIFAYLGAEAPLDGDLV  119

Query  375   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  554
              IGF+ DNA RF ALL+YIEHRYYGKSIPFG+ + A+ N +T GYFNSAQA+ADYA VL+
Sbjct  120   NIGFVNDNAARFNALLIYIEHRYYGKSIPFGSTKVALKNASTLGYFNSAQAIADYAAVLM  179

Query  555   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  734
             ++K +  AQ+SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILYFD I PE GYYS
Sbjct  180   HVKKRLHAQNSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFDEIAPEIGYYS  239

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             +VTKDF+E SE+CY+TIR+SWS ID+IASKPNGLSILSK+FK C  L+S  ELKDYLDS 
Sbjct  240   IVTKDFREASESCYRTIRRSWSEIDRIASKPNGLSILSKRFKTCAHLESSFELKDYLDSI  299

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y  AAQY++PP YPVT VC GI+GA K  D L RI  G+V + G R+CYD + +N PT E
Sbjct  300   YAEAAQYNEPPTYPVTVVCKGINGASKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-E  358

Query  1095  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             T +GWRWQ CSEM +PIG    DTMF P PF++ +F ++C+  Y V PRPHW+TTYYGG 
Sbjct  359   TYLGWRWQKCSEMVLPIGHATNDTMFQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGR  418

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1454
             DIKL+LH+F SNIIFSNGLRDPYSS GVLE+ISDT++AVYTR+GSHCLDI  + K+DP W
Sbjct  419   DIKLILHRFASNIIFSNGLRDPYSSGGVLENISDTLVAVYTRHGSHCLDILPSQKSDPQW  478

Query  1455  LTEQRKKEVEIIQSWITKYYVEL  1523
             L  QRK EVEII+ W+ KYY +L
Sbjct  479   LVMQRKMEVEIIKGWMDKYYTDL  501



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/476 (64%), Positives = 374/476 (79%), Gaps = 1/476 (0%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL    +     P++ S      +F+T++Y QTLDHFNYRP SYATF+QRY+++
Sbjct  24    TQFNIPRLGAHRKRFQNEPKAMSPSDQFKDFKTFFYTQTLDHFNYRPDSYATFQQRYVIN  83

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              K+WGG+ S++PIF +LGAE  +D+D    GFL DNAPRFKALLVYIEHRYYGKS+PFG+
Sbjct  84    FKHWGGSNSSAPIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGS  143

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEAM N +T GYFNSAQA+ADYA+VLL++K KY A+ SP IV GGSYGGMLA+WFRLKY
Sbjct  144   REEAMKNASTLGYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKY  203

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYF +  P+ GYY++VTKDFKE S++CY+T+RKSW  I K+AS+PN
Sbjct  204   PHIALGALASSAPILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRKVASRPN  263

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKF+ CK LK   EL+D+LDS Y   AQYD PP YP++ VCGGIDGAPKG D+L
Sbjct  264   GLSMLSKKFRTCKPLKKTSELEDFLDSLYTDVAQYDDPPTYPLSIVCGGIDGAPKGIDVL  323

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              +I  GVV  +GNR+CYD   Y  PT ET VGWRWQTCSEM MPIG G +DTMF PAPF 
Sbjct  324   GKIFKGVVAYKGNRSCYDMDEYIRPT-ETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFD  382

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             + +F++DC+  +GV P+PHW+TTYYGG D+KL+LH+FGSNIIFSNGLRDPYS+ GVL +I
Sbjct  383   LNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNI  442

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SD+V+A+ T NGSHCLDI   SK+DP WL  QRK E++II+ WI KY  +L   K 
Sbjct  443   SDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLLEFKE  498



>emb|CDP07008.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 376/482 (78%), Gaps = 14/482 (3%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             PH IPRL+P  R+NLR P+ + +     E F++Y+Y QTLDHFNY P+SY  F Q Y+++
Sbjct  31    PHKIPRLSPIRRTNLRDPDDTLTKASRSEDFKSYFYEQTLDHFNYNPKSYTKFNQSYVIN  90

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SK+WGGA+SNSPIFA+LGAE+P+  D + IGFL DNAPRFKALLVYIEHR+YG S+P G+
Sbjct  91    SKFWGGAKSNSPIFAYLGAEAPLAGDIETIGFLPDNAPRFKALLVYIEHRFYGNSVPHGS  150

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
             ME+AM N+  RGYFNSAQALADYAEVL+++K+K+ A+++PIIV GGSYGGMLASWFRLKY
Sbjct  151   MEKAMKNKAIRGYFNSAQALADYAEVLMHVKHKFSAKNAPIIVVGGSYGGMLASWFRLKY  210

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAP+LYFD+ITP+NGY S+VTK+FKE SE+CYQTIRKSWS ID++ASK N
Sbjct  211   PHIALGALASSAPVLYFDDITPQNGYDSIVTKNFKEESEHCYQTIRKSWSEIDEVASKTN  270

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C  L SP EL DYL S +  AAQY+ PP+YPV E+C GID AP+G DIL
Sbjct  271   GLSILSKRFKTCAPLSSPSELADYLASMFTMAAQYNAPPRYPVAELCSGIDKAPEGTDIL  330

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ----------TCSEMAMPIGRGDR  1160
              RI AGVV    + +CYD  I    +    + W+ +          TCSEM MP+G G  
Sbjct  331   GRIFAGVVSFRKDESCYDGIII---SGSLRIKWQSRSLVCLLFPLLTCSEMVMPMGHGSN  387

Query  1161  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
             DT+F  +PF++  F +DC   YGV PRPHWITTYYGGHDIKL+  +FGSNIIFSNGL+DP
Sbjct  388   DTIFPSSPFNLPDFIKDCKSSYGVSPRPHWITTYYGGHDIKLIFQRFGSNIIFSNGLKDP  447

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             YSSAGV E++SD++LAVYT  GSHCLDI  A KTDP WL  QRK EVEII+ WI +YY +
Sbjct  448   YSSAGVRENLSDSLLAVYTAKGSHCLDILAAQKTDPSWLVAQRKLEVEIIEGWIKQYYAD  507

Query  1521  LE  1526
             LE
Sbjct  508   LE  509



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/472 (65%), Positives = 372/472 (79%), Gaps = 7/472 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL+P     +  P+  SS  +  + +T+YY QTLDHFNY+PQSYATF+QRY+++ KYW
Sbjct  67    IPRLSPTRGIIMEDPDLLSSAAVSDDLQTFYYPQTLDHFNYQPQSYATFQQRYVMNFKYW  126

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA +N+PI A+LGAE+P+D  P  IGFL DNA  F ALLVYIEHRYYGKSIPFG+ EEA
Sbjct  127   GGANNNAPILAYLGAEAPLDGSPTAIGFLNDNAVSFTALLVYIEHRYYGKSIPFGSREEA  186

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
               N +T GYFNSAQA+ADYAE+++++KNK  A +SP+IV GGSYGGMLASW RLKYPHVA
Sbjct  187   FKNASTLGYFNSAQAIADYAEIIMHIKNKLRAFYSPVIVVGGSYGGMLASWLRLKYPHVA  246

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAPILYFD ITP   Y+S+VTKDF+E SE+CYQTIR SWSVIDKIAS+PNGLS 
Sbjct  247   LGALASSAPILYFDKITPRGAYFSVVTKDFREASESCYQTIRNSWSVIDKIASQPNGLSS  306

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIH  1022
             LS  FK CK L    ELK+ L++ Y +AAQYD PP+YPVT VC GIDGA +  DIL +I 
Sbjct  307   LSMIFKTCKPLNKSSELKNALENMYASAAQYDSPPRYPVTVVCRGIDGANEKQDILSKIF  366

Query  1023  AGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             AGVV   GNR+CY     NPPT  SET VGWRWQTCSEM +PIG G+R TMF P PF + 
Sbjct  367   AGVVAYRGNRSCY----INPPTNESETTVGWRWQTCSEMVIPIGIGNR-TMFQPEPFDLN  421

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F + C   +GVPPRPHW+T+YYGGHDIKL+L +FGSNIIFSNGLRDPYS  GVLE+IS+
Sbjct  422   SFIQQCKTIFGVPPRPHWVTSYYGGHDIKLILQRFGSNIIFSNGLRDPYSRGGVLENISE  481

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             ++LAV T NGSHCLDI   + +DP+WL +QR+ EVEI++ WI +YY +L+A+
Sbjct  482   SILAVKTVNGSHCLDILAQNASDPEWLVKQRQTEVEIMKGWIAQYYADLKAI  533



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/447 (66%), Positives = 361/447 (81%), Gaps = 1/447 (0%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F+T++Y QTLDHFNYRP SYATF+QRY+++ K+WGG+ S++PIF +LGAE  +D+D   
Sbjct  9     DFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDV  68

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GFL DNAPRFKALLVYIEHRYYGKS+PFG+ EEAM N +T GYFNSAQA+ADYA VLL+
Sbjct  69    AGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYAGVLLH  128

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K KY A+ SP IV GGSYGGMLA+WFRLKYPH+ALGALASSAPILYF +  P+ GYY++
Sbjct  129   IKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYYTI  188

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTKDFKE SE+CY+T+RKSW  I K+AS+PNGLS+LSK F+ CK LK   ELKD+LDS Y
Sbjct  189   VTKDFKETSESCYETVRKSWDEIRKVASRPNGLSMLSKTFRTCKPLKETSELKDFLDSLY  248

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
                AQYD PP YP++ VCGGIDGAP G D+L +I  GVV  +GNR+CYD   Y  PT ET
Sbjct  249   TDVAQYDDPPTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPT-ET  307

Query  1098  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1277
              VGWRWQTCSEM MPIG G +DTMF PAPF + +F++DC+  +GV P+PHW+TTYYGG D
Sbjct  308   NVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRD  367

Query  1278  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1457
             +KL+LH+FGSNIIFSNGLRDPYS+ GVL +ISD+V+A+ T NGSHCLDI   SK+DP WL
Sbjct  368   LKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWL  427

Query  1458  TEQRKKEVEIIQSWITKYYVELEALKR  1538
               QRK E++II+ WI KY  +L   K 
Sbjct  428   VMQRKSEIKIIEEWIAKYENDLLEFKE  454



>ref|XP_006495097.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Citrus 
sinensis]
Length=502

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 379/483 (78%), Gaps = 14/483 (3%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL+P   + L+ PE  S+ I   +F+T+YY+QTLDHFNYRP+SY+TF+QRY+++
Sbjct  26    TRFNIPRLSPTRGTILQNPEILSATI-SEDFQTFYYNQTLDHFNYRPESYSTFQQRYVIN  84

Query  291   SKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
              KYWGG        PIF +LG E P+D D   IGFLTDNA RF ALLVYIEHRYYGKSI 
Sbjct  85    FKYWGGGAGADANAPIFVYLGNEGPLDGDISIIGFLTDNAARFNALLVYIEHRYYGKSIS  144

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FG+ EE + N +T GYFNSAQA+ DYAE+LLY+K K+ A+HSP+IV GGSYGGMLA+WFR
Sbjct  145   FGSREEDLKNSSTLGYFNSAQAVTDYAEILLYIKEKFNARHSPVIVIGGSYGGMLATWFR  204

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             LKYPHVALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K+AS
Sbjct  205   LKYPHVALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKVAS  264

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             KP+GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDG   G 
Sbjct  265   KPDGLSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGVALGI  324

Query  1002  --DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTM  1169
               DIL +I AGVV  EGN +C+     NPPT  +ET VGWRWQTCSEM +PIG  D  TM
Sbjct  325   DNDILSKIFAGVVAYEGNMSCF----VNPPTIETETTVGWRWQTCSEMVIPIGT-DNTTM  379

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
             F PAPF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYSS
Sbjct  380   FQPAPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYSS  439

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              GVLE+ISD V+A+ T NGSHCLDI GA + +DPDWL  QR+ E+EII+ WI+KYY +L+
Sbjct  440   GGVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEGWISKYYADLK  499

Query  1527  ALK  1535
             A+K
Sbjct  500   AIK  502



>ref|XP_006488629.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=494

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/482 (65%), Positives = 376/482 (78%), Gaps = 21/482 (4%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL+P   + L+  E  SS  +  +F+T+YY+QTLDHFNYRP+SY+TF+QRYI++
Sbjct  27    TSFDIPRLSPIRETILQNFEILSSATISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  291   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  464
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  465   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A HSP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATHSPVIVIGGSYGGMLAAWFRL  206

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-  1001
             P+         +  + LK   EL+ YL S Y  AAQY+QPP+YPV  +CGGIDGA  G  
Sbjct  267   PD---------EAYEPLKDSYELEGYLKSVYADAAQYNQPPEYPVNMLCGGIDGAALGID  317

Query  1002  -DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMF  1172
              DIL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ CSEM MPIG  D  TMF
Sbjct  318   NDILSKIFAGVVAYEGNMSCY----VNPPTIETETTVGWRWQRCSEMVMPIGT-DNTTMF  372

Query  1173  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1352
              P PF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYSS 
Sbjct  373   QPTPFNLSSFIDGCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYSSG  432

Query  1353  GVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             GVLE+ISD V+A+ T NGSHCLDI GA + +DPDWL  QR+ E+EII+ WI+KYY +L+A
Sbjct  433   GVLENISDNVVAIPTINGSHCLDILGAKESSDPDWLVTQRETEIEIIEGWISKYYADLKA  492

Query  1530  LK  1535
             +K
Sbjct  493   IK  494



>ref|XP_002523752.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38692.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/500 (62%), Positives = 387/500 (77%), Gaps = 10/500 (2%)
 Frame = +3

Query  39    MEFITLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPESS-SSDILPPEFRTYY  215
             M F  ++ Q F L +   + S +  P  IPRL+P     ++ PE    S+++  +  T++
Sbjct  1     MMFPVILTQWFVLGLFILSASSTAKPFDIPRLSPTGPRIVQDPEEIFISELVSDDLETFF  60

Query  216   YHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTD  395
             Y+QTLDHFNY P+SY TF+QRYI+SSKYWGGA S+SPIF + GAE+P+D D   IGFL D
Sbjct  61    YNQTLDHFNYNPESYETFQQRYIISSKYWGGANSSSPIFVYFGAEAPLDGDLTVIGFLAD  120

Query  396   NAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYL  575
             NA +F ALL+YIEHRYYGKS+PFG+  EA+ N + RGYFNSAQA+ADYAE+++++K    
Sbjct  121   NAAQFNALLLYIEHRYYGKSVPFGSQGEALKNGSIRGYFNSAQAIADYAEIIIHVKKNLQ  180

Query  576   AQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFK  755
             A++SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAP+LYFD+ITP++GYYS+ ++DF+
Sbjct  181   AENSPVIVIGGSYGGMLASWFRLKYPHLALGALASSAPVLYFDDITPQDGYYSIASRDFR  240

Query  756   EVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQY  935
             E SENCY+TI+KSW+ ID +AS P GL +LSKKFK CK L    ELKD LDS Y  AAQY
Sbjct  241   EASENCYKTIQKSWAEIDGVASMPKGLDVLSKKFKTCKPLTDSDELKDRLDSMYSGAAQY  300

Query  936   DQPPKYPVTEVCGGIDGAPKGA-DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVG  1106
             ++PP YPV  +C GIDGA   + D LD+I AGVV   GNR+CY     NPPT  SET VG
Sbjct  301   NKPPTYPVNIICSGIDGAASSSNDTLDKIFAGVVAYRGNRSCY----INPPTNLSETSVG  356

Query  1107  WRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKL  1286
             WRWQTCSEM +PIGRG+ DTMF P+PF +  + +DC+  YGV PRPHW+TTYYGGH IKL
Sbjct  357   WRWQTCSEMVIPIGRGN-DTMFPPSPFDLNGYVQDCNAIYGVRPRPHWVTTYYGGHSIKL  415

Query  1287  VLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTE  1463
             +L +FGSNIIFSNG+RDPYSS GVLEDISDT+LAV+T NGSHCLDI  A++ TDP+WL  
Sbjct  416   ILQRFGSNIIFSNGIRDPYSSGGVLEDISDTILAVHTANGSHCLDILIANETTDPEWLVA  475

Query  1464  QRKKEVEIIQSWITKYYVEL  1523
             QRK E+ II+ WI+KYY +L
Sbjct  476   QRKTEINIIKGWISKYYDDL  495



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/474 (65%), Positives = 367/474 (77%), Gaps = 3/474 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRR-PESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IPRL  + RS   R PE SSS  L  +  +T+YY Q LDHFNYRP SY TF+QRY+V+ K
Sbjct  27    IPRLGTWQRSTKERDPEISSSLHLSDDDLKTFYYTQRLDHFNYRPDSYHTFQQRYMVNFK  86

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA+S++PIFA+ GAE P+D+D KYIGFL DNAP+F AL+V+IEHRYYGKSIPFG+ E
Sbjct  87    YWGGAKSSAPIFAFFGAEGPVDEDAKYIGFLRDNAPQFNALIVFIEHRYYGKSIPFGSSE  146

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EAM N +TRGYFNSAQA+ADYA VLL++K    AQ+SPIIV GGSYGGMLASWFRLKYPH
Sbjct  147   EAMRNASTRGYFNSAQAIADYAAVLLHIKKTLSAQNSPIIVIGGSYGGMLASWFRLKYPH  206

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             +ALGALASSAPILYF+ I P+ GYY +VTKDFKE SE+CYQTIRKSWS ID++A KPNGL
Sbjct  207   IALGALASSAPILYFNGIAPQAGYYYIVTKDFKETSESCYQTIRKSWSEIDRVAKKPNGL  266

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             SILSK+FK C  L    +LKDYLDS Y  AAQY+ P ++PV  VCG ID A K  DIL +
Sbjct  267   SILSKRFKTCDKLNKSFDLKDYLDSLYTDAAQYNYPSEHPVKIVCGAIDAAAKKTDILGQ  326

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I  GVV  + +R+CYD   YN PT E+ +GWRWQTCSE+ MPIG    D+MF PAPF+M+
Sbjct  327   IFEGVVAYKQHRSCYDMNEYNHPT-ESFLGWRWQTCSEIIMPIGHEKNDSMFPPAPFNMK  385

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F ++C   YGV P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYSS GVLE IS+
Sbjct  386   TFVQECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGGVLESISN  445

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             TV+AV T NG HCLDI      DP WL  QR  EV+II+ WI +Y  +L AL +
Sbjct  446   TVVAVTTVNGCHCLDIQSRKANDPQWLVTQRNTEVKIIKGWIAEYKADLIALTK  499



>gb|KDP43936.1| hypothetical protein JCGZ_05403 [Jatropha curcas]
Length=503

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/477 (66%), Positives = 375/477 (79%), Gaps = 13/477 (3%)
 Frame = +3

Query  120   TIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
              IPRL+P   R +L  PES S   L  +  TY+Y+QTLDHFNY P+SY TF+QRY++SSK
Sbjct  29    NIPRLSPIGPRISLEDPESLSESSLSDDLETYFYNQTLDHFNYNPESYNTFQQRYVISSK  88

Query  297   YWGGAQSN-SPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             YWGG+ S  +PIF + GAE+P+D D   +GFL+DNA +FKALLVYIEHR+YGKSIPFG+ 
Sbjct  89    YWGGSNSKYAPIFVYFGAEAPLDGDLYIVGFLSDNAIKFKALLVYIEHRFYGKSIPFGSQ  148

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N + RGYFNSAQALADYAE++L++K  + A++SP+IV GGSYGGMLASWFRLKYP
Sbjct  149   EEAVKNASVRGYFNSAQALADYAEIILHVKKTFDAENSPVIVIGGSYGGMLASWFRLKYP  208

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAPILYFD+ITP++GYYSLVTKD+KE SE+CYQTI+KSW  ID++AS+PNG
Sbjct  209   HIALGALASSAPILYFDDITPQDGYYSLVTKDYKEASESCYQTIQKSWPEIDQLASQPNG  268

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA---PKGAD  1004
             L+ILSKKFK CK L    ELKDYLD+ Y  AAQY++PPKYPVT VC GIDG+     G D
Sbjct  269   LAILSKKFKTCKPLTDVDELKDYLDTMYSGAAQYNKPPKYPVTVVCNGIDGSNTDSDGND  328

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
              L +I  GVV   GNRTCY     N PT  SET VGWRWQTCSEM +PIGRG+ DTMF P
Sbjct  329   TLSKIFGGVVAYRGNRTCY----INSPTNVSETSVGWRWQTCSEMVIPIGRGN-DTMFPP  383

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
              PF +  + +DC   YGVPPRP W+TTYYGGH IKL+L +FGSNIIFSNGLRDPYSS GV
Sbjct  384   DPFDLNAYVQDCKASYGVPPRPRWVTTYYGGHSIKLILQRFGSNIIFSNGLRDPYSSGGV  443

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             L +ISDT++AVYT  GSHCLDI  A+K TDP+WL  QR  E+ II  WI KYY +L 
Sbjct  444   LANISDTIVAVYTSEGSHCLDILQANKTTDPEWLVAQRNTEINIIDQWINKYYDDLH  500



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/476 (64%), Positives = 374/476 (79%), Gaps = 4/476 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T + IPRL+P  R+ L   E+ SS I   +F+T+YY+Q+LDHFNYRP+SY  F  RYI++
Sbjct  26    TQYRIPRLSPIGRTFLHNAEAISSSI-SDDFKTFYYNQSLDHFNYRPESYTCFPHRYIIN  84

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEHRYYGKS+PFG+
Sbjct  85    FKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAVRFDALLVYIEHRYYGKSMPFGS  144

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ N +T GYF+SAQA+ADYA VLL+LK KY A+ SP+IV GGSYGGMLA+WFRLKY
Sbjct  145   REEALKNASTLGYFSSAQAIADYAAVLLHLKQKYHAKDSPVIVLGGSYGGMLAAWFRLKY  204

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SWS I+ IASKPN
Sbjct  205   PHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSWSKIETIASKPN  264

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGGIDGA  G+ I+
Sbjct  265   GLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGASPGSGII  324

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              ++ AGV   +GN  CY+    N   +ET VGWRWQ CSEM MP+   + DTMF P  F 
Sbjct  325   SKVAAGVFAYKGNLPCYNIGPRN--DTETDVGWRWQRCSEMVMPMSTSN-DTMFPPITFD  381

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ F   C   YGV PRPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRDPYSS GVL+++
Sbjct  382   LRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNL  441

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SD++LAV+T NGSHCLDI  A++TDP WL EQR+KEV II+ WI++YY +LE  K+
Sbjct  442   SDSLLAVHTLNGSHCLDILRANETDPQWLVEQREKEVSIIEGWISQYYADLEKSKK  497



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/476 (63%), Positives = 376/476 (79%), Gaps = 13/476 (3%)
 Frame = +3

Query  120   TIPRLTPF--YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             TIPR++P   + + L    + +++    E +T+Y+ Q LDHFNYRP+SY TF+QRY+++ 
Sbjct  29    TIPRMSPIPEWETTLHNHPAINTE----EVKTFYFKQVLDHFNYRPESYTTFQQRYLINF  84

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA S++PIFA+ GAESPID+ P  +GFLTDNA  F ALLVYIEHRYYGKS+ FG+ 
Sbjct  85    KYWGGANSSAPIFAYFGAESPIDNSPNGVGFLTDNAASFNALLVYIEHRYYGKSVQFGSR  144

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQALADYA +L ++K    A++SP+IV GGSYGGMLASWFRLKYP
Sbjct  145   EEALKNASTIGYFNSAQALADYASILKHVKKTLHAKNSPVIVIGGSYGGMLASWFRLKYP  204

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+A+GALASSAPILYFD ITP+NGYYS VT+D++E SE CY+T+ KSWS I +IAS+PNG
Sbjct  205   HLAIGALASSAPILYFDKITPQNGYYSTVTRDYREASETCYETVLKSWSEIRRIASQPNG  264

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             L  LS++F  C  L    EL DYL STY  AAQY+QPP+YPV+ +CGGIDG   G+DIL 
Sbjct  265   LVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGESLGSDILS  324

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +I+AG+V L GN TC      N PT  SET VGWRWQTCSEM +PIG G+ DTMF P PF
Sbjct  325   KIYAGIVALRGNSTCK----VNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFEPIPF  379

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             ++ +++  C + YGV PRPHW+TTYYGGH+IKLVL + GSNIIFSNGLRDPYS  GVL++
Sbjct  380   NLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDN  439

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             ISD+++AV+T NGSHCLD+  A+++DP WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  440   ISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDALK  495



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/477 (62%), Positives = 367/477 (77%), Gaps = 2/477 (0%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             T   +P L  F +S +  P ++  S     + +T++Y QTLDHFNYRP+SY TF+QRY++
Sbjct  30    TQSKMPNLDVFRKSRMVNPSAAKPSSTSKDDLQTFFYTQTLDHFNYRPESYTTFQQRYMI  89

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             + KYWGG  S +PIF +LG ES +DDD + IGFLTD+APRF AL+VYIEHRYYGKS+PF 
Sbjct  90    NFKYWGGVNSIAPIFVFLGEESSLDDDIESIGFLTDHAPRFNALIVYIEHRYYGKSVPFE  149

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
             + E++  N  T GYFNSAQALADYAEV++ LK    A+  P+IV GGSYGGMLASWFRLK
Sbjct  150   SWEKSFQNTETLGYFNSAQALADYAEVIIDLKKNLSAEFCPVIVMGGSYGGMLASWFRLK  209

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHVALGALASSAPILYFD+ITP NGYYS+VTKD++E SE+C+ TIR+SWS IDK+AS+ 
Sbjct  210   YPHVALGALASSAPILYFDDITPHNGYYSIVTKDYREASESCHDTIRESWSEIDKVASQA  269

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
             +GLS+LS+KFK C  L +  ELKDYLDS Y   AQ+++PP+  V ++C  IDGAPKG DI
Sbjct  270   DGLSVLSQKFKTCSPLNTSFELKDYLDSIYAETAQFNRPPENIVNKICDVIDGAPKGTDI  329

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             L R+ AGVV   GNR+CYD   YN PT +   GWRWQTCSE+ MPIGRG  DTMF  +PF
Sbjct  330   LSRVFAGVVAYMGNRSCYDTNYYNYPT-QGYFGWRWQTCSELVMPIGRGSNDTMFPSSPF  388

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              ++ +++ C D YGVPPRPHWITT +GGHDI+LVL KF SNIIFSNGL+DPYSS GVL +
Sbjct  389   DLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGLKDPYSSGGVLAN  448

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ISD+++A+YT  GSHC+D+Y AS  DP WL  QR+ E+E I+ WI KYYVEL A  +
Sbjct  449   ISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGWIEKYYVELAAANQ  505



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/448 (66%), Positives = 363/448 (81%), Gaps = 7/448 (2%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             E +T+Y+ Q LDHFNYRP+SY TF+QRY+++ KYWGGA S++PIFA+ GAESPID+ P  
Sbjct  21    EVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYFGAESPIDNSPNG  80

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             +GFLTDNA  F ALLVYIEHRYYGKS+PFG+ EEA+ N +T GYFNSAQALADYA +L +
Sbjct  81    VGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYASILKH  140

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K    A++SP+IV GGSYGGMLASWFRLKYPH+A+GALASSAPILYFD ITP+NGYYS 
Sbjct  141   VKKTLHAKNSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDKITPQNGYYST  200

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VT+D++E SE CY+T+ KSWS I +IAS+PNGL  LS++F  C  L    EL DYL STY
Sbjct  201   VTRDYREASETCYETVLKSWSEIRRIASQPNGLVTLSQRFNTCHTLNQSYELIDYLRSTY  260

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--S  1091
               AAQY+QPP+YPV+ +CGGIDG   G+DIL +I+AG+V L GN TC      N PT  S
Sbjct  261   VYAAQYNQPPRYPVSMICGGIDGESLGSDILSKIYAGIVALRGNSTCK----VNGPTNVS  316

Query  1092  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1271
             ET VGWRWQTCSEM +PIG G+ DTMF P PF++ +++  C + YGV PRPHW+TTYYGG
Sbjct  317   ETTVGWRWQTCSEMVIPIGIGN-DTMFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGG  375

Query  1272  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1451
             H+IKLVL + GSNIIFSNGLRDPYS  GVL++ISD+++AV+T NGSHCLD+  A+++DP 
Sbjct  376   HNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPG  435

Query  1452  WLTEQRKKEVEIIQSWITKYYVELEALK  1535
             WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  436   WLVEQRKKEVKIIKRWITQYYADLDALK  463



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/478 (63%), Positives = 378/478 (79%), Gaps = 14/478 (3%)
 Frame = +3

Query  120   TIPRLTPF--YRSNLRR-PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             TIPR++P   + ++L   P +  ++    E +++++ QTLDHFNYRP+SY TF+QRY+++
Sbjct  21    TIPRMSPVPEWEASLHHDPVAVDAE----EVKSFFFKQTLDHFNYRPESYTTFQQRYLIN  76

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA S++PIFA+LGAE+PID+ P  IGFL DNAP F ALLVYIEHRYYGKS+PFG+
Sbjct  77    FKYWGGANSSAPIFAYLGAEAPIDNSPNTIGFLIDNAPSFNALLVYIEHRYYGKSVPFGS  136

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ N +T GYFNSAQALADYA VL ++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  137   REEALKNASTIGYFNSAQALADYAAVLNHIKKTLHAQNSPVIVIGGSYGGMLASWFRLKY  196

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+A+GALASSAPILYFDNITP+NGYYS+VT+D++E SE CY+TI++SWS I ++AS+PN
Sbjct  197   PHLAIGALASSAPILYFDNITPQNGYYSVVTRDYREASETCYKTIQQSWSEIRRVASQPN  256

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL  LS+ F  C  L     L DYL   Y +AAQY+ PPKYPV  +CGGIDGA  G+DIL
Sbjct  257   GLVTLSQIFNTCHSLNQVESLIDYLRLMYASAAQYNHPPKYPVNVICGGIDGASDGSDIL  316

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
              +I+AGVV L+GN TC      N PT  SET VGWRWQTCSEM +PIG  ++DTMF P P
Sbjct  317   SKIYAGVVALKGNTTC----TINGPTNVSETTVGWRWQTCSEMVIPIGI-EKDTMFEPNP  371

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             FS++++   C   +GV PRPHW+TTYYG H+IKLVL +FGSNIIFSNGL+DPYS  GVLE
Sbjct  372   FSLKRYVEGCKTTFGVSPRPHWVTTYYGAHNIKLVLGRFGSNIIFSNGLKDPYSIGGVLE  431

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +ISD ++A++T NGSHCLDI  A+++DP+WL +QRKKE++I++ WITKYY +L ALK 
Sbjct  432   NISDNIVAIHTVNGSHCLDILRANESDPEWLVKQRKKEIKIMKRWITKYYADLHALKH  489



>ref|XP_007016018.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33637.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=500

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/478 (64%), Positives = 373/478 (78%), Gaps = 12/478 (3%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL+P   + L +PE  S+ +   + RT+YY QTLDHFNY P+SY TF+QRY+++SKYW
Sbjct  29    IPRLSPTLGTILEQPEILSAPV-SEDLRTFYYTQTLDHFNYNPESYTTFQQRYVMNSKYW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA  ++PI A+LGAESP+D  P  IGFL DNA RFKAL+VYIEHRYYGKSIPFG+ EEA
Sbjct  88    GGANVSAPILAYLGAESPLDGTPAAIGFLNDNAIRFKALIVYIEHRYYGKSIPFGSREEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
               N +T GYFNSAQA+ADYA +++++K K  A++SP+IV GGSYGGMLASWFRLKYPHVA
Sbjct  148   FQNASTLGYFNSAQAIADYAAIIMHIKKKLQARYSPVIVIGGSYGGMLASWFRLKYPHVA  207

Query  663   LGALASSAPILYFDNI--TPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             LGALASSAPILYFD I   PE GYYS+VTKDF+E SE CYQTI+KSWS I+++ASKP+GL
Sbjct  208   LGALASSAPILYFDEIPLQPEGGYYSVVTKDFREASETCYQTIQKSWSEINRVASKPHGL  267

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DIL  1010
             S LSKKFK C  L S  ELK +L   Y   AQY++PP+YPV+ VCGGIDGA  G+  DIL
Sbjct  268   STLSKKFKTCYPLTSSSELKSFLRLMYAYTAQYNRPPRYPVSVVCGGIDGASFGSQDDIL  327

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
              +I +GVV   GNR+CY     NP T  SE  +GW WQ CSEM +PIG G+  TM   +P
Sbjct  328   TKIFSGVVAYYGNRSCY----VNPETNASEIEIGWSWQRCSEMVIPIGIGN-GTMLEASP  382

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             F++  F + C+ +YGVP RPHW+T+YYGGHDIKL+LH+FGSNIIFSNGLRDPYSS GVLE
Sbjct  383   FNLTSFIKQCESFYGVPSRPHWVTSYYGGHDIKLILHRFGSNIIFSNGLRDPYSSGGVLE  442

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +IS+++LAV T NGSHCLDI    +TDP+WL  QRK EV+II+ WI KYY +L+A K+
Sbjct  443   NISNSILAVSTVNGSHCLDILAERETDPEWLIRQRKIEVKIIKGWIAKYYADLKAFKQ  500



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 373/483 (77%), Gaps = 16/483 (3%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLR-------RPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATF  269
             +P  IPRL+P  R+          +P++ S +  P +F T+YY QTLDHFNYRP S++TF
Sbjct  26    SPLNIPRLSPTGRTFEHGDYFADGQPKALS-NFGPNDFETFYYKQTLDHFNYRPDSFSTF  84

Query  270   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  449
             +QRY+++SKYWG +  ++PI A+LGAE PIDDD   IGFL++NA + +AL ++IEHRYYG
Sbjct  85    QQRYLINSKYWGSSNVSAPILAYLGAEEPIDDDLSVIGFLSENANQLQALQIFIEHRYYG  144

Query  450   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  629
             KSIPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV GGSYGGMLA
Sbjct  145   KSIPFGSREEAFQNASTLGYFNSAQAIADYAEILIHVKKQLRAEHSPVIVIGGSYGGMLA  204

Query  630   SWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVI  806
             SWFRLKYPHVALGALASSAPILYFDNI  PE GYYS+ TKDF+EVSE CYQTI+KSWS I
Sbjct  205   SWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSIATKDFREVSETCYQTIKKSWSEI  264

Query  807   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG  986
             D+IAS+P GLS+LS+KF+ C  L     L+DYL   Y  AAQY++PP+YPVT VCGGIDG
Sbjct  265   DEIASQPEGLSVLSRKFQTCSQLLKSSVLEDYLMLMYTGAAQYNRPPRYPVTVVCGGIDG  324

Query  987   APKGADILDRIHAGVVGLEGNRTCYDPQIYNPP--TSETIVGWRWQTCSEMAMPIGRGDR  1160
             A  G D L +I AGVV   GN +CY     NPP   SET VGWRWQTCS+M MPIG  + 
Sbjct  325   ASHGNDTLSKIFAGVVAYRGNESCY----VNPPKNKSETDVGWRWQTCSDMVMPIGISN-  379

Query  1161  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
             D+MF    F ++++   C   YGVPPRPHW TTY+GGHDIKLVL +F SNIIFSNGLRDP
Sbjct  380   DSMFPANQFDLKEYVESCKAQYGVPPRPHWATTYFGGHDIKLVLSRFASNIIFSNGLRDP  439

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             YSS GVLE+ISDTV+AV+T+NGSHCLDI GA+ TDPDWL  QRK EV+II+ W++ YY E
Sbjct  440   YSSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLSNYYAE  499

Query  1521  LEA  1529
             L A
Sbjct  500   LRA  502



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/477 (62%), Positives = 377/477 (79%), Gaps = 10/477 (2%)
 Frame = +3

Query  123   IPRLTPF--YRSNLR-RPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             IPRL+P   + + L  R    ++D       T+YY Q LDHFNYRP+SY TF+QRY+++ 
Sbjct  31    IPRLSPIAEWETTLHNRATVVATDTDTENLITFYYKQVLDHFNYRPESYKTFQQRYLINF  90

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA S++PIFA+LGAE PID  P+ IGFLTDNA  F AL+VYIEHRYYGKS+PFG+ 
Sbjct  91    KYWGGANSSAPIFAYLGAEEPIDGSPELIGFLTDNAASFNALIVYIEHRYYGKSVPFGSR  150

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA VL+++K    AQ SP+IV GGSYGGMLASWFRLKYP
Sbjct  151   EEALKNASTIGYFNSAQAIADYASVLIHIKKTLHAQKSPVIVIGGSYGGMLASWFRLKYP  210

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+A+GALASSAPILYFDNITP++GYYS+V++DF+E SE CYQTI KSWS ID++AS+P G
Sbjct  211   HLAIGALASSAPILYFDNITPQDGYYSVVSRDFREASETCYQTILKSWSEIDRVASQPKG  270

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILS++F  C+ L    ELKDYL + Y ++AQY+ PP+YPVT +CGGID A  G+DIL 
Sbjct  271   LSILSQRFNTCRPLNESSELKDYLINMYASSAQYNHPPRYPVTVICGGIDRASFGSDILS  330

Query  1014  RIHAGVVGLEGNRTCYDPQIYNP-PTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
             +I+AG+V L GN TC   ++  P   SET +GWRWQTCSEM +PIG G+ +TMF P PFS
Sbjct  331   KIYAGLVALRGNTTC---KVNGPIIVSETTLGWRWQTCSEMVIPIGIGN-NTMFQPDPFS  386

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +++DC   +GV PRPHW+TTYYGGH I+LVL KFGSNIIFSNGLRDPYSS GVL++I
Sbjct  387   LKSYAKDCKKQFGVSPRPHWVTTYYGGHSIELVLQKFGSNIIFSNGLRDPYSSGGVLKNI  446

Query  1371  SDTVLAVYTRNGSHCLDIYG--ASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             SD+++A++T NGSHCLDI G  A+ +DP+WL EQ K+E+ +++ WI +YY +L AL 
Sbjct  447   SDSLVAIHTVNGSHCLDILGANANHSDPEWLVEQWKREIMVMKGWIAQYYDDLVALN  503



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 365/486 (75%), Gaps = 6/486 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPE--SSSSDILP--PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             IPRL  + RS  R  +  SSSSD+       +T+YY Q LDHFNYRP SY TF+QRYI+ 
Sbjct  27    IPRLGTWRRSKEREAQMSSSSSDLGDNHDHLKTFYYTQRLDHFNYRPDSYHTFQQRYIID  86

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGG +S++PIFA+ GAE P+DDD  Y+GFL DNAP+F AL+VYIEHRYYGKSIPFG+
Sbjct  87    FKYWGGPKSSAPIFAFFGAEGPVDDDIHYVGFLRDNAPQFSALIVYIEHRYYGKSIPFGS  146

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEAM N +TRGYFNSAQA+ADYA VLL++K     Q+SPIIV GGSYGGMLASWFRLKY
Sbjct  147   REEAMRNASTRGYFNSAQAIADYAAVLLHIKKTLSVQNSPIIVIGGSYGGMLASWFRLKY  206

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYF+ I P+ GYY +VTKDFKE SE CYQTI KSWS ID++A KPN
Sbjct  207   PHIALGALASSAPILYFNGIAPKAGYYYIVTKDFKETSETCYQTISKSWSEIDRVAEKPN  266

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C+ L    ELKDYLDS Y  AAQY+ P + PV  +C  ID A K  DIL
Sbjct  267   GLSILSKRFKTCEKLSKSFELKDYLDSLYTDAAQYNFPSENPVKVICSAIDAAAKKTDIL  326

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              +I  GVV    + +CYD   YN PT ET +GWRWQTCSEM MPIG    D+MF PAPF+
Sbjct  327   GQIFEGVVAFMRHHSCYDMNGYNHPT-ETNLGWRWQTCSEMVMPIGHERNDSMFPPAPFN  385

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             M++F  +C   YGV P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYSS GVLE I
Sbjct  386   MKRFVHECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGGVLESI  445

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*KTK  1550
             SD+V+AV T NG HCLDI      DP+WL  QR KEV+II+ WI +Y  +L AL + +TK
Sbjct  446   SDSVVAVTTVNGCHCLDIQSRKTNDPEWLVRQRNKEVKIIKGWIAEYQADLIALTK-QTK  504

Query  1551  LVILRK  1568
                 RK
Sbjct  505   APTPRK  510



>ref|XP_006487982.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/479 (65%), Positives = 375/479 (78%), Gaps = 14/479 (3%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL+P   + L+ PE  S+ I   +F+T+YY+QTLDHFNYRP+SY+TF+QRY+++ KYW
Sbjct  30    IPRLSPTRGTILQNPEILSATI-SEDFQTFYYNQTLDHFNYRPESYSTFQQRYVINFKYW  88

Query  303   GGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             GG        PIF +LGAE  +D D   IGFLTDNA RF ALLVYIEHRYYGKSIPFG+ 
Sbjct  89    GGGAGADAIAPIFVYLGAEEALDGDISVIGFLTDNAARFNALLVYIEHRYYGKSIPFGSR  148

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ DYA +LLY+K KY A+HSP+IV GGSYGGMLA+WFRLKYP
Sbjct  149   EEALKNASTLGYFNSAQAITDYAAILLYIKEKYNARHSPVIVVGGSYGGMLATWFRLKYP  208

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K+ASK +G
Sbjct  209   HVALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKVASKLDG  268

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DI  1007
             LSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G   D 
Sbjct  269   LSILSKKFRTCKPLKDLYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALGTDNDT  328

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
             L +I AGVV  +GN+TCY     NPP   SET VG+RWQ CSEM MPIG  D  TMF P 
Sbjct  329   LSKIFAGVVASKGNKTCY----VNPPINESETTVGYRWQRCSEMVMPIGI-DNTTMFPPD  383

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
             PF    +  DC   YGV  RPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYSS GVL
Sbjct  384   PFDRSNYIDDCKKLYGVSSRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYSSGGVL  443

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             EDIS++V+A++T NGSHCLDI  A++ +DPDWL  QRK EVEII+ WI+KYY +L+A++
Sbjct  444   EDISESVVAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEGWISKYYDDLKAVQ  502



>ref|XP_002523754.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38694.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=517

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 372/483 (77%), Gaps = 13/483 (3%)
 Frame = +3

Query  126   PRLTPFYRSNLR-RPE-----SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             PRL    +S+++ +P+     SSS DIL     T++Y Q LDHFN++P+SYATFKQRY++
Sbjct  41    PRLRALRKSHIQSQPKITTELSSSKDIL-----TFFYPQKLDHFNFKPESYATFKQRYVI  95

Query  288   SSKYWGGAQSNS-PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  464
             + KYW G    S P+  + GAE  I+DD   IGFL D A  FK LLVYIEHRYYGKSIPF
Sbjct  96    NFKYWSGPNRTSVPLLVFFGAEENIEDDVDGIGFLNDIASHFKGLLVYIEHRYYGKSIPF  155

Query  465   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
             G+ +E   N ++ GYF+SAQA+ADYA +++++K KY A+ SP+IV GGSYGGMLASWFRL
Sbjct  156   GSSKEVFRNASSLGYFSSAQAIADYAAIIMHVKKKYSAKTSPVIVIGGSYGGMLASWFRL  215

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPHVALGALASSAPILYF++I P NGYYS+VTKDFKE SE+CYQTIRKSW+ I+K+ASK
Sbjct  216   KYPHVALGALASSAPILYFEDIAPRNGYYSIVTKDFKETSESCYQTIRKSWAEIEKVASK  275

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1004
              NGLSILSKKFK C  LK   ELKDYLDS Y  AAQY+ PP+YPVT VCGGIDGAPKG D
Sbjct  276   RNGLSILSKKFKTCNPLKRTFELKDYLDSIYSEAAQYNDPPRYPVTIVCGGIDGAPKGTD  335

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             +L RI AGVV   G+R+CYD   YN PT  T + WRWQTCSE+ MPIG  +R+TMF  +P
Sbjct  336   VLGRIFAGVVAYMGDRSCYDVNGYNHPTDATSLAWRWQTCSELVMPIGH-ERNTMFPTSP  394

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             F++  +++ C   YGV P+PHW+T YYGGHD+KL+LH+F SNIIFSNGL+DPYSS GVLE
Sbjct  395   FNLNSYTQKCKALYGVLPQPHWVTNYYGGHDLKLILHRFASNIIFSNGLKDPYSSGGVLE  454

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1544
             +ISD+++A+ T NGSHCLDI     TDP WL  QRK E+EIIQ WI+KY ++L  LK  +
Sbjct  455   NISDSIVAISTVNGSHCLDIQQTQPTDPHWLVMQRKAEIEIIQGWISKYNIDLHELKDER  514

Query  1545  TKL  1553
             T++
Sbjct  515   TRV  517



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/476 (63%), Positives = 370/476 (78%), Gaps = 4/476 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T + IPRL+P  R+ L   E+  S I   +F+T+YY+QTLDHFNYRP+SY  F  RYI++
Sbjct  26    TQYRIPRLSPIGRTFLHNAEAIPSSI-SDDFKTFYYNQTLDHFNYRPESYTCFPHRYIIN  84

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEHRYYGKS+PFG+
Sbjct  85    FKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAARFDALLVYIEHRYYGKSMPFGS  144

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ N +T GYF+SAQA+ADYA VL++LK KY A+ SP+IV GGSYGGMLA+WFRLKY
Sbjct  145   REEALKNASTLGYFSSAQAIADYAAVLIHLKQKYHAKDSPVIVLGGSYGGMLAAWFRLKY  204

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SWS I+ I SKPN
Sbjct  205   PHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSWSKIEIIGSKPN  264

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGGIDGA  G+ I+
Sbjct  265   GLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGASPGSGII  324

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              ++ AGV   +GN +CY+  I     +ET VGWRWQ CSEM MP+   + DTMF P  F 
Sbjct  325   SKVAAGVFAYKGNLSCYN--IGPRSETETDVGWRWQRCSEMVMPLSTTN-DTMFPPITFD  381

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ F   C   YGV  RPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRDPYSS GVL+++
Sbjct  382   LKSFVDYCYQLYGVSSRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNL  441

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SD++LAV+T  GSHCLDI  A++TDP WL +QR+ EV II+ WI+KYY +LE  K+
Sbjct  442   SDSLLAVHTPKGSHCLDILRANETDPQWLVKQRETEVRIIEGWISKYYADLEKSKK  497



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/505 (60%), Positives = 377/505 (75%), Gaps = 15/505 (3%)
 Frame = +3

Query  57    VIQCfsllilfsttslsETPH-TIPRLTP----FYRSNL----RRPESSSSDILPPEFRT  209
             ++QC  L++  S  +   + H  IPRL+P    F R N     ++   S++D +  +F T
Sbjct  3     LLQCLVLIVSLSIKTSVSSAHLNIPRLSPNGGKFLRGNYFAHDQQKTMSAADPIN-DFET  61

Query  210   YYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFL  389
             +YY+QTLDHFN+RP S+ TF+QRY+++ K+WGG+  ++PIFA+LG E  IDDD   IGFL
Sbjct  62    FYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNVSAPIFAYLGEEEAIDDDLSIIGFL  121

Query  390   TDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNK  569
             ++NA +F+AL ++IEHRYYGKS+PFG+ EEA  N  T GYFNSAQALADYAEVL+++K K
Sbjct  122   SENAHQFQALQIFIEHRYYGKSVPFGSREEAFQNADTLGYFNSAQALADYAEVLIHVKKK  181

Query  570   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTK  746
               AQHSP+IV G SYGGMLASWFRLKYPHVALGALASSAPILYFDNI  PE+GYYS+VTK
Sbjct  182   LHAQHSPVIVIGASYGGMLASWFRLKYPHVALGALASSAPILYFDNIVPPEDGYYSIVTK  241

Query  747   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  926
             DF+E SE CYQTI+KSWS ID IAS+P GLS LS+KF  C+ L    ELK+YLD+ YC A
Sbjct  242   DFREASETCYQTIKKSWSEIDAIASQPEGLSFLSEKFHTCRPLIKSSELKNYLDNLYCNA  301

Query  927   AQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVG  1106
             AQY+ PP YPVT VCGGIDGA  G D L +I AGVV   GN +CY     N   +ET +G
Sbjct  302   AQYNSPPTYPVTAVCGGIDGA-SGNDTLTKIFAGVVAFSGNTSCYVNHPRN--LTETDMG  358

Query  1107  WRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKL  1286
             W WQTCS+M +P+     D+MF    F ++ + + C   YGVPPRPHW TTY+GGHDIKL
Sbjct  359   WSWQTCSDMVIPMTSVSNDSMFPAYQFDLKDYIKSCQAQYGVPPRPHWATTYFGGHDIKL  418

Query  1287  VLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTE  1463
              L +F SNIIFSNGLRDPYSS GVLEDISDTV+AV+ +NGSHCLD+  A+  TDPDWL  
Sbjct  419   ALERFASNIIFSNGLRDPYSSGGVLEDISDTVVAVHAKNGSHCLDLLNANNITDPDWLVN  478

Query  1464  QRKKEVEIIQSWITKYYVELEALKR  1538
             QRK EV+II+ WI KYY +L+A K+
Sbjct  479   QRKIEVKIIKRWIAKYYADLQAFKK  503



>ref|XP_006424417.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
 gb|ESR37657.1| hypothetical protein CICLE_v10028252mg [Citrus clementina]
Length=502

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/480 (65%), Positives = 379/480 (79%), Gaps = 14/480 (3%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
              IPRL+P   + L+ PE  S+ I   +F+T+YY+QTLDHFNYRP+SY+TF+QRY+++ KY
Sbjct  29    NIPRLSPTRGTILQNPEILSATI-SKDFQTFYYNQTLDHFNYRPESYSTFQQRYVINFKY  87

Query  300   WGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             WGG        PIF +LGAE  +D D   IGFLTDNA RF ALLVYIEHRYYGKSIPFG+
Sbjct  88    WGGGAGADANAPIFVYLGAEESLDGDISVIGFLTDNAARFNALLVYIEHRYYGKSIPFGS  147

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              +EA+ N +T GYFNSAQA+ DYAE+LLY+K KY A+HSP+IV GGSYGGMLA+WFRLKY
Sbjct  148   RKEALKNASTLGYFNSAQAITDYAEILLYIKEKYNARHSPVIVIGGSYGGMLAAWFRLKY  207

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH ALGALASSAPILYFD+ITP+NGYYS+VT+DF+E SE CY+TI KSW+ I+K AS+P+
Sbjct  208   PHAALGALASSAPILYFDDITPQNGYYSIVTRDFREASETCYETIMKSWAEIEKFASEPD  267

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--D  1004
             GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G   D
Sbjct  268   GLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALGTDND  327

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
             IL +I AGVV  +GN+TCY     NPP   SET VG+RWQTCSEM MPIG  D  TMF P
Sbjct  328   ILSKIFAGVVASKGNKTCY----VNPPINESETTVGYRWQTCSEMVMPIGI-DNTTMFPP  382

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
              PF +  +  DC   YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLRDPYSS GV
Sbjct  383   DPFELSNYIDDCKKLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLRDPYSSGGV  442

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             LEDIS++V+A++T NGSHCLDI  A++ +DPDWL  QRK EVEII+ WI+KYY +L+A++
Sbjct  443   LEDISESVIAIHTVNGSHCLDILRANQDSDPDWLVMQRKAEVEIIEGWISKYYDDLKAVQ  502



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/483 (62%), Positives = 366/483 (76%), Gaps = 14/483 (3%)
 Frame = +3

Query  120   TIPRLTP----FYRSNL----RRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQ  275
              IPRL+P    F R N     ++   S++D +  +F T+YY+QTLDHFN+RP S+ TF+Q
Sbjct  25    NIPRLSPNGGTFLRRNYFAHDQQKTMSAADPIN-DFETFYYNQTLDHFNFRPDSFNTFQQ  83

Query  276   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  455
             RY+++ K+WGG+  ++PIFA+LG E  ID D   +GFL++NA +F+AL ++IEHRYYGKS
Sbjct  84    RYLINFKHWGGSNVSAPIFAYLGEEEAIDVDLSIVGFLSENAHQFQALQIFIEHRYYGKS  143

Query  456   IPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASW  635
             +PFG+ EEA  N  T GYFNSAQALADYAEVL+++K K  AQHSP+IV G SYGGMLASW
Sbjct  144   VPFGSREEAFQNADTLGYFNSAQALADYAEVLIHVKKKLHAQHSPVIVIGASYGGMLASW  203

Query  636   FRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  812
             FRLKYPHVALGALASSAPILYFDNI  PE+GYYS+VTKDF+E SE CYQTI+KSWS ID 
Sbjct  204   FRLKYPHVALGALASSAPILYFDNIVPPEDGYYSIVTKDFREASETCYQTIKKSWSDIDA  263

Query  813   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP  992
             IAS+P GLS LS+KF  C+ LK   ELK+YLD+ YC AAQY+ PP YPVT VCG IDGA 
Sbjct  264   IASQPEGLSFLSEKFHTCRPLKKSSELKNYLDNLYCNAAQYNSPPSYPVTVVCGAIDGA-  322

Query  993   KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMF  1172
              G D L +I AGVV   GN +CY  Q  N   +ET +GW WQTCS+M +P+     D+MF
Sbjct  323   SGNDTLTKIFAGVVAFSGNTSCYVNQPRN--LTETDMGWSWQTCSDMVIPMASVSNDSMF  380

Query  1173  FPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSA  1352
                 F ++ + + C   YGVPPRPHW+TTY+GGHDIKL L +F SNIIFSNGLRDPYSS 
Sbjct  381   PAYQFDLKDYIKSCKAQYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRDPYSSG  440

Query  1353  GVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             GVLEDISDT++AV+ +NGSHCLDI  A   TDPDWL  QRK EV+II+ WI +YY +L+A
Sbjct  441   GVLEDISDTIVAVHAKNGSHCLDILNADNITDPDWLVNQRKIEVKIIKRWIARYYADLQA  500

Query  1530  LKR  1538
              K+
Sbjct  501   FKK  503



>ref|XP_004295650.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/483 (63%), Positives = 369/483 (76%), Gaps = 17/483 (4%)
 Frame = +3

Query  123   IPRLTPF--------YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQR  278
             IPRL+P         Y ++ R  E+SS    P +F+T+YY+QTLDHFN+R  S++TF+QR
Sbjct  27    IPRLSPTGGSLIQENYWTHGRPGEASSPSFDPKDFQTFYYNQTLDHFNFRYDSFSTFQQR  86

Query  279   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  458
             Y+++SK+WGGA  ++PI A+LG E  ID D   IGFL +NA  F+AL +YIEHRYYGKSI
Sbjct  87    YLINSKHWGGANISAPILAYLGEEDSIDSDLPIIGFLPENAIHFQALQIYIEHRYYGKSI  146

Query  459   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  638
             PFG+ E A  N +TRGYFNSAQALADYAE+L+++K +  A+HSP+IV GGSYGGMLASWF
Sbjct  147   PFGSREVAFKNASTRGYFNSAQALADYAEILIHVKKQLHAEHSPVIVIGGSYGGMLASWF  206

Query  639   RLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKI  815
             RLKYPH+ALGALASSAPILYFD+I  P+ GYYS+VT+DF+E SE CYQTI+KSWS ID I
Sbjct  207   RLKYPHIALGALASSAPILYFDDIVPPDTGYYSIVTRDFREASETCYQTIKKSWSEIDSI  266

Query  816   ASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK  995
             AS P GLS LSKKF+ C+ L    ELKDYLD+ Y TAAQYD+PP+YPVT VCGGIDGA  
Sbjct  267   ASTPGGLSFLSKKFQTCRPLNKSSELKDYLDTMYSTAAQYDRPPRYPVTVVCGGIDGASS  326

Query  996   GADILDRIHAGVVGLEGNRTCYDPQIYNPP--TSETIVGWRWQTCSEMAMPIGRGDRDTM  1169
               D L +I AGVV   GNR+CY     NPP   +ET VGW WQTCS+M +PI   + DTM
Sbjct  327   TDDTLTKIFAGVVAYTGNRSCY----VNPPRNLTETDVGWAWQTCSDMVIPINVSN-DTM  381

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
             F P  F   ++++DC   YGVPPR +W+TTY+GGHDIKL L +F  NIIFSNGLRDPYS 
Sbjct  382   FPPYKFDSDEYTKDCIATYGVPPRLNWVTTYFGGHDIKLGLSRFAGNIIFSNGLRDPYSI  441

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              GVLE+ISD+V+AVYT+NGSHCLDI  ++  TDPDWL  QRK EV II+ WI KYY +L+
Sbjct  442   GGVLENISDSVVAVYTKNGSHCLDILISNHITDPDWLVNQRKTEVRIIKGWIAKYYADLQ  501

Query  1527  ALK  1535
             ALK
Sbjct  502   ALK  504



>ref|XP_004160098.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=514

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/473 (63%), Positives = 367/473 (78%), Gaps = 7/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILP-PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
              PRL+P     L      +S  LP  +F+TYYY+QTLDHFNYRP+SY TF QRYI++ KY
Sbjct  48    FPRLSPVGEKFLHHSRVLNS--LPLDDFKTYYYNQTLDHFNYRPESYTTFPQRYIINFKY  105

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF + +E
Sbjct  106   WGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPFRSRDE  165

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRLKYPHV
Sbjct  166   ALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRLKYPHV  225

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +PNGLS
Sbjct  226   ALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQPNGLS  285

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             IL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG       L +I
Sbjct  286   ILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNGTLSKI  345

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPIG    D MF P+PF +Q 
Sbjct  346   AAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPIGSD--DDMFPPSPFDLQS  401

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
                 C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL +ISD+
Sbjct  402   VINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHNISDS  461

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI+KYY +L+  K+
Sbjct  462   LLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISKYYADLKKYKQ  514



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 370/487 (76%), Gaps = 12/487 (2%)
 Frame = +3

Query  111   TPHTIPRLTP----FYRSNL---RRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATF  269
             +P  IPRL+P    F   N     +P++ S +  P +F T+YY QTLDHFN+RP S++TF
Sbjct  26    SPLNIPRLSPTGGTFEHGNYFADGQPKALS-NFDPNDFETFYYKQTLDHFNFRPDSFSTF  84

Query  270   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  449
             +QRY+++SKYWGG+  ++PI A+LGAE  +D+    IGFL++NA + +AL ++IEHRYYG
Sbjct  85    QQRYLINSKYWGGSNVSAPILAYLGAEDAVDNSLSSIGFLSENANQLQALQIFIEHRYYG  144

Query  450   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  629
             KSIPF + EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+HSP+IV GGSYGGMLA
Sbjct  145   KSIPFRSREEAFQNASTLGYFNSAQAIADYAEILIHVKKQLHAEHSPVIVIGGSYGGMLA  204

Query  630   SWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVI  806
             SWFRLKYPHVALGALASSAPILYFDNI  PE GYYS+VTKDF+EVSE CYQTI+KSWS I
Sbjct  205   SWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSIVTKDFREVSETCYQTIKKSWSEI  264

Query  807   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG  986
             D+IAS+P GLSILS+KF+ C  L +   L++YL   Y  AAQY++PP+YPVT VCGGIDG
Sbjct  265   DEIASQPEGLSILSRKFQTCSQLLTSSVLENYLMLMYTGAAQYNRPPRYPVTVVCGGIDG  324

Query  987   APKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDT  1166
             A  G D L +I AGVV   GN++CY  +  N   SET VGW WQTCS+M +PIG  + D+
Sbjct  325   ASHGNDTLSKIFAGVVAYRGNKSCYVNEPKN--KSETDVGWGWQTCSDMVIPIGISN-DS  381

Query  1167  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1346
             MF    F +  +   C   YGVPPRPHW TTY+GGHDIKL L  F SNIIFSNGLRDPYS
Sbjct  382   MFPANEFDLNDYIETCKAQYGVPPRPHWATTYFGGHDIKLALSGFASNIIFSNGLRDPYS  441

Query  1347  SAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             S GVLE+ISDTV+AV+T+NGSHCLDI GA+ TDPDWL  QRK EV+II+ W+ KYY EL 
Sbjct  442   SGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLDKYYAELR  501

Query  1527  ALKR*KT  1547
             A    K+
Sbjct  502   AYSNNKS  508



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/475 (61%), Positives = 367/475 (77%), Gaps = 6/475 (1%)
 Frame = +3

Query  111   TPHTIPRLT---PF-YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQR  278
             +P  +PRL    P+  R++L + +  S      EFRT+YY+QTLDHFNYRP+SY TF+ R
Sbjct  30    SPSKVPRLGVHGPYGARNHLGKVKVQSLAPSDQEFRTFYYNQTLDHFNYRPESYKTFQHR  89

Query  279   YIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSI  458
             Y+VS K+W G  + +PIF +LG ES ++DD  YIG L+DNA RF AL VYIEHR+YG+SI
Sbjct  90    YVVSFKHWRGPDTMAPIFVYLGEESSLNDDLGYIGILSDNAARFGALQVYIEHRFYGESI  149

Query  459   PFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWF  638
             PF + EEA+ +   RGYF+SAQ LADYAEV+L++K K+ A  SP+IVFGGSYGGMLA+WF
Sbjct  150   PFVSREEALKDANLRGYFSSAQTLADYAEVILHIKKKHSADSSPVIVFGGSYGGMLAAWF  209

Query  639   RLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  818
             RLKYPHVALGALASSAP+LYFDNITP NGYY++VTKDFKE SE+CY+TI++SW  IDK+A
Sbjct  210   RLKYPHVALGALASSAPVLYFDNITPSNGYYTVVTKDFKESSESCYKTIKQSWFEIDKVA  269

Query  819   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  998
             +K +GLSIL KKF  CK L++  ELK++LDS +  AAQYD+PP+YPV  VC GID AP+G
Sbjct  270   AKADGLSILQKKFNTCKPLEAATELKNFLDSLFSVAAQYDRPPRYPVDLVCKGIDSAPEG  329

Query  999   ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
             +D+LDRI +G+V   G + CY+   +   +SET+ GW WQTCSE+ +PIGRG  DTMF  
Sbjct  330   SDVLDRIFSGIVAYFGKKPCYNLDAFF--SSETLEGWTWQTCSELVIPIGRGSNDTMFPA  387

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
              PF ++++  +C   +GVPPRPHWITTYYGGH  K VL +FGSNIIFSNGLRDPYSS GV
Sbjct  388   EPFDLKEYIEECKSAFGVPPRPHWITTYYGGHHFKEVLRRFGSNIIFSNGLRDPYSSGGV  447

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             LE+ISD++LAVYT  G+HC+DI  A+  DPDW+  QR  E+EII  WI KYY +L
Sbjct  448   LENISDSILAVYTTKGAHCMDILPATIGDPDWVVLQRNIEIEIINGWILKYYQDL  502



>gb|KGN46898.1| hypothetical protein Csa_6G149390 [Cucumis sativus]
Length=511

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 367/473 (78%), Gaps = 7/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILP-PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
              PRL+P     L      +S  LP  +F+TYYY+QTLDHFNYRP+SY TF QRYI++ KY
Sbjct  45    FPRLSPVGEKFLHHSRVLNS--LPLDDFKTYYYNQTLDHFNYRPESYTTFPQRYIINFKY  102

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF + +E
Sbjct  103   WGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPFRSRDE  162

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRLKYPHV
Sbjct  163   ALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRLKYPHV  222

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +PNGLS
Sbjct  223   ALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQPNGLS  282

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             IL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG       L +I
Sbjct  283   ILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNGTLSKI  342

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPI  G  D MF P+PF +Q 
Sbjct  343   AAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPI--GSDDDMFPPSPFDLQS  398

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
                 C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL +ISD+
Sbjct  399   VINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHNISDS  458

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  459   LLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISEYYADLKKYKQ  511



>ref|XP_009356983.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=507

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/517 (58%), Positives = 374/517 (72%), Gaps = 26/517 (5%)
 Frame = +3

Query  15    LQLYSLISMEFITLVIQCfsllilfsttslsETPHTIPRLTP----FYRSNL---RRPES  173
             LQ   LI   FIT+ +                TP  IP L+P    F + N      P+ 
Sbjct  8     LQCLVLIISLFITISVSA--------------TPLNIPLLSPNAGTFVQGNYFAHDHPKP  53

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
              S+     EF T+YY+QTLDHFN+RP S+ TF+QRY+++  +WGG+  ++PIFA+LG E 
Sbjct  54    LSAFDPATEFETFYYNQTLDHFNFRPDSFNTFQQRYLINFNHWGGSNISAPIFAYLGEEE  113

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              ID D   IGFL++NA +F+AL ++IEHRYYG+S+PFG+ EEA  N +T GYFNSAQA+A
Sbjct  114   AIDADLSIIGFLSENANQFQALQIFIEHRYYGQSVPFGSREEAFKNASTIGYFNSAQAMA  173

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYAE+L+++K +  A+HSP+IV G SYGGMLASWFRLKYPHVALGALASSAPILYFDNIT
Sbjct  174   DYAEILIHVKKQLRAEHSPVIVIGASYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  233

Query  714   -PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  890
              PE GYYS+VTKDF+E SE CYQTI+KSWS ID IASKP GLS LS KF  C  L +  E
Sbjct  234   PPEKGYYSIVTKDFQEASETCYQTIKKSWSEIDDIASKPEGLSFLSNKFHTCSPLTTSSE  293

Query  891   LKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQ  1070
             LK+YLD  YC AAQY+ PP YPVT  CGGIDG   G D L +I AGVV   GNR+CY  +
Sbjct  294   LKNYLDGLYCGAAQYNSPPSYPVTVFCGGIDGVSSGNDTLSKIFAGVVAYSGNRSCYVNE  353

Query  1071  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1250
               N   SET VGW WQTCS+M +PI   + D+MF P  F +Q++  +C   YGVPPRPHW
Sbjct  354   PRN--LSETDVGWSWQTCSDMVIPISVSN-DSMFPPYQFDLQEYIDNCKAIYGVPPRPHW  410

Query  1251  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1430
             +T Y+GGHDIKL L++F SNIIFSNGLRDP+S AGVLE+ISDTV+AV+ +NGSHCLD+  
Sbjct  411   VTAYFGGHDIKLALYRFASNIIFSNGLRDPFSGAGVLENISDTVVAVHAKNGSHCLDVLR  470

Query  1431  ASK-TDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++  TDPDWL EQRK EV+II+ W+ +YY +L A K+
Sbjct  471   SNNITDPDWLVEQRKTEVKIIEGWLAEYYSKLRAFKQ  507



>ref|XP_004145824.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=507

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 367/473 (78%), Gaps = 7/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILP-PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
              PRL+P     L      +S  LP  +F+TYYY+QTLDHFNYRP+SY TF QRYI++ KY
Sbjct  41    FPRLSPVGEKFLHHSRVLNS--LPLDDFKTYYYNQTLDHFNYRPESYTTFPQRYIINFKY  98

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGG  S++PIFA+LGAE+PIDDD  +IGF+TDNA +F ALL+YIEHRYYGKSIPF + +E
Sbjct  99    WGGPNSSAPIFAYLGAEAPIDDDLDFIGFMTDNAIQFNALLIYIEHRYYGKSIPFRSRDE  158

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRLKYPHV
Sbjct  159   ALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRLKYPHV  218

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I+ +A +PNGLS
Sbjct  219   ALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIETVAYQPNGLS  278

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             IL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG       L +I
Sbjct  279   ILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNGTLSKI  338

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPIG    D MF P+PF +Q 
Sbjct  339   AAGVFAFRGSVSCYINEPRN--ETETDVGWRWQSCSEMVMPIGSD--DDMFPPSPFDLQS  394

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
                 C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL +ISD+
Sbjct  395   VINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHNISDS  454

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +LAVYT NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  455   LLAVYTTNGSHCLDILKAHETDPEWLVRQRKTEVGIIKGWISEYYADLKKYKQ  507



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/516 (59%), Positives = 373/516 (72%), Gaps = 25/516 (5%)
 Frame = +3

Query  15    LQLYSLISMEFITLVIQCfsllilfsttslsETPHTIPRLTP----FYRSNL---RRPES  173
             LQ   LI   FIT+ +                T   IPRL+P    F + N      P+ 
Sbjct  8     LQCLVLIISLFITISVSA--------------TRFNIPRLSPNAGAFVQGNYFARDHPKP  53

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
              S+     EF+T YY+QTLDHFN+RP S+ TF+QRY+++ K+WGG+  ++PIFA+LG E 
Sbjct  54    LSAFDPVTEFQTIYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNISAPIFAYLGEEE  113

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              ID D   IGFL++NA +F+AL ++IEHRYYG+S+PFG+ EE   N +T GYFNSAQA+A
Sbjct  114   AIDADLSIIGFLSENADKFQALQIFIEHRYYGQSVPFGSREEGFKNASTIGYFNSAQAMA  173

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYAE+L+++K +  A+HSP+IV G SYGGMLASWFRLKYPHVALGALASSAPILYF++I 
Sbjct  174   DYAEILIHVKKQLRAEHSPVIVIGASYGGMLASWFRLKYPHVALGALASSAPILYFEDII  233

Query  714   -PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  890
              PE GYYS+VTKDF+E SE CYQTI+KSWS ID IASKP GLS LS KF+ C  L    E
Sbjct  234   PPEKGYYSIVTKDFQEASETCYQTIKKSWSEIDDIASKPEGLSFLSNKFRTCSPLTKSSE  293

Query  891   LKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQ  1070
             LKDYLDS YC AAQY+ PP YPVT VCGGIDG   G D L +I AGVV   GNR+CY  +
Sbjct  294   LKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGVSSGNDTLSKIFAGVVAYYGNRSCYVNE  353

Query  1071  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1250
               N   SET VGW WQTCS++ +P+G  + ++MF P  F +Q++   C   YGVPPRPHW
Sbjct  354   PRN--LSETDVGWSWQTCSDLVIPMGVSN-ESMFPPYQFDLQEYIDSCKALYGVPPRPHW  410

Query  1251  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1430
              TTY+GGHDIKL L++F SNIIFSNGLRDPYSS GVLE+ISDTV+AV  +NGSHCLD+  
Sbjct  411   ATTYFGGHDIKLALYRFASNIIFSNGLRDPYSSGGVLENISDTVVAVLAKNGSHCLDVLL  470

Query  1431  ASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +  TDPDWL EQRK EV+II+ W+ +YY EL A ++
Sbjct  471   SDSTDPDWLVEQRKTEVKIIEGWLAEYYGELRAFEQ  506



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 351/441 (80%), Gaps = 1/441 (0%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F+ Y+Y QTLDHFNYRP+SYATFKQRY+++ K+WGGA S++PIF +LG ESP+D+    
Sbjct  61    DFKDYFYEQTLDHFNYRPESYATFKQRYVINYKFWGGANSSAPIFVYLGEESPLDNYIDA  120

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGFLTD+AP+F AL+V+IEHRYYG+S+PFG+MEEA  N +T GYF+S+QALADYAEV+LY
Sbjct  121   IGFLTDHAPKFNALVVFIEHRYYGQSVPFGSMEEAFQNASTLGYFSSSQALADYAEVILY  180

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K    A+  P++V GGSYGGMLA+WFRLKYPH+ALGALASSAPILYF++ITP+NGYYS+
Sbjct  181   IKKSLSAESCPVVVIGGSYGGMLAAWFRLKYPHIALGALASSAPILYFEDITPQNGYYSI  240

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTKDF+E SENCY TIR+SWS IDK AS+PNGLS+L+KKFK C  L    ELKDYL++ Y
Sbjct  241   VTKDFRETSENCYNTIRQSWSEIDKTASQPNGLSVLTKKFKTCFPLNLSSELKDYLETIY  300

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
              +AAQYD+PP +PV+ +C  ID   KGAD+L ++ AG+V  +GN++CYD + +   T ET
Sbjct  301   NSAAQYDRPPTFPVSAICSAIDNTSKGADLLSKVFAGLVAYKGNQSCYDTKEFKYST-ET  359

Query  1098  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1277
               GW WQ CSEM MPIGRG  DTMF  APF++  F + C   YG+ PR +WITT +GGHD
Sbjct  360   KRGWNWQRCSEMVMPIGRGSNDTMFQAAPFNLTNFKQRCKRLYGISPRSNWITTQFGGHD  419

Query  1278  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1457
             I+LVL +FG NIIFSNGLRDPYSS  VL++ISD+++A+YT  GSHC+DI      DP WL
Sbjct  420   IELVLKRFGGNIIFSNGLRDPYSSGSVLKNISDSLVAIYTTQGSHCMDILPELPDDPKWL  479

Query  1458  TEQRKKEVEIIQSWITKYYVE  1520
               QR +E++II  WI +YY++
Sbjct  480   VMQRNQEIKIIGQWIKQYYMD  500



>ref|XP_010100139.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81590.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=652

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 364/467 (78%), Gaps = 8/467 (2%)
 Frame = +3

Query  147   RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSP  326
             +  L +  +  S+    ++ T++Y+QTLDHFNYRP+SY+TF+QRY+V+SKYWGG  SN+P
Sbjct  191   KGGLEKLNTLFSNSRSEDYETFFYNQTLDHFNYRPESYSTFQQRYVVNSKYWGG--SNAP  248

Query  327   IFAWLGAESPIDDDP-KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  503
             IFA LGAE+P+D      IGFLTDNAP FKALL+YIEHRYYGKSIPFG+ EEA+ N +T 
Sbjct  249   IFAHLGAEAPLDAGALSAIGFLTDNAPEFKALLIYIEHRYYGKSIPFGSREEALKNASTL  308

Query  504   GYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASS  683
             GYFNSAQA+ADYAE+LL++K K+ A+ SP+IV GGSYGGMLASWFRLKYPH+ALGALASS
Sbjct  309   GYFNSAQAIADYAEILLHVKRKFHAEKSPVIVIGGSYGGMLASWFRLKYPHIALGALASS  368

Query  684   APILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  863
             APILYFDNITP++GYYS+VTKDF E SE+CY+TI+KSWS ID++A+ PNGLSILS+KF  
Sbjct  369   APILYFDNITPQDGYYSIVTKDFIEASESCYKTIQKSWSEIDRVAALPNGLSILSEKFHT  428

Query  864   CKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVG  1037
             C+ L+   ELK YL   Y TAAQY+ PP+YPV+ +CGGIDGA      DIL +I  G+  
Sbjct  429   CRPLEKSSELKRYLRIMYATAAQYNHPPRYPVSVICGGIDGANDIDDHDILGKIFLGLSS  488

Query  1038  LEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCD  1217
                N TCY  Q  N   SET VGW WQTCSEM +PIG  + +TMF  +PF +Q F  +C 
Sbjct  489   YITNSTCYVNQPRN--LSETDVGWNWQTCSEMVIPIGISN-NTMFSASPFELQDFINECK  545

Query  1218  DYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYT  1397
               Y VPPRPHW+TTYYGG DIKL+L +F SNIIFSNGLRDPYSS GVLE+IS +V+AV T
Sbjct  546   AAYDVPPRPHWVTTYYGGKDIKLILRRFASNIIFSNGLRDPYSSGGVLENISKSVVAVTT  605

Query  1398  RNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
               GSHCLDI+ A +TDPDWL +QRK EV II+ WI +YY +LEA  +
Sbjct  606   TKGSHCLDIHRAKETDPDWLVKQRKIEVNIIKRWIAQYYFDLEAFNK  652


 Score =   216 bits (550),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 143/214 (67%), Gaps = 18/214 (8%)
 Frame = +3

Query  219  HQTL-DHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTD  395
            HQT  DHFNY+P+S  T + +YIV+ K+WGGA + SPIF +   E+PID      GF+ D
Sbjct  5    HQTRSDHFNYKPESDTTSQHKYIVNFKHWGGANTCSPIFVYTRHEAPIDAAVSGAGFMVD  64

Query  396  NAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYL  575
             A RF  LL+YIE    G S PFG+ EEA  N +T G+F+S Q LADYA+++  LK    
Sbjct  65   LASRFNGLLLYIE----GDSTPFGSAEEAFQNASTLGFFSSTQTLADYAQLITDLKKNLS  120

Query  576  AQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFK  755
            A+             MLASWFRLKYPHV  G  ASSAPILYFD+ITP+N Y+ +VTKDF+
Sbjct  121  AE-------------MLASWFRLKYPHVIAGDSASSAPILYFDDITPQNAYHVIVTKDFR  167

Query  756  EVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  857
            E SE+CY TIR+SWS ID++A++  GL  L+  F
Sbjct  168  ETSESCYNTIRQSWSEIDRVAAEKGGLEKLNTLF  201



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/478 (62%), Positives = 361/478 (76%), Gaps = 12/478 (3%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             TIPRL+PF    L    +  S+  P +  T+YY Q LDHFNY P+SY TF QRY+++ KY
Sbjct  29    TIPRLSPFQEKTLHDIATLVSND-PKDVETFYYKQVLDHFNYNPESYNTFNQRYLINFKY  87

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGGA S++PIF + G E PID  PK IGF+ + AP FKALLVYIEHRYYGKS+PFG+ EE
Sbjct  88    WGGANSSAPIFVYFGPEQPIDGSPKSIGFMVEKAPTFKALLVYIEHRYYGKSVPFGSREE  147

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A  N  T GYFNSAQALADYAEV++ +K    AQ+SP+++ GGSYGGMLASWFRLKYPH+
Sbjct  148   AFKNANTLGYFNSAQALADYAEVIIDIKKTLHAQNSPVVLIGGSYGGMLASWFRLKYPHL  207

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             A+GALASSAPILYFD+IT  N Y+ +V++DFKEVSE CY+TI  SWS IDK+AS+PNGLS
Sbjct  208   AIGALASSAPILYFDDITSPNAYFDVVSRDFKEVSETCYETILNSWSEIDKVASQPNGLS  267

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             ILS++F  C+ L    EL + L+S Y +AAQY+ PP YPVT +C GID A  G +ILD+I
Sbjct  268   ILSQRFNTCRPLNHSFELSEDLESMYTSAAQYNHPPDYPVTVICSGIDKASFGNNILDKI  327

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT-SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             ++GVV  +GN TC   ++ NP   SET VGWRWQTCSEM MP   G+ DTMF P+PF ++
Sbjct  328   YSGVVAYKGNGTC---KVNNPKNISETDVGWRWQTCSEMVMPFAIGN-DTMFQPSPFDLK  383

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
             +F   C   YGV PRPHWITTYYGGHDIK VL KFGSNIIFSNGL+DPYSSAGVL D+S 
Sbjct  384   RFVERCKKKYGVSPRPHWITTYYGGHDIKRVLQKFGSNIIFSNGLKDPYSSAGVLHDLSK  443

Query  1377  TVLAVYTRN------GSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             +++AV T N      GSHCLDI  + ++DP WL EQR KEV+IIQ WI +YY++L AL
Sbjct  444   SLVAVPTINDINSIAGSHCLDILPSKESDPKWLIEQRNKEVKIIQEWIAQYYIDLGAL  501



>ref|XP_010031429.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50725.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
 gb|KCW50726.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=496

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/475 (62%), Positives = 364/475 (77%), Gaps = 9/475 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P L+      LR PE + S  +  +F T++++QTLDHFNYRP+SY TF+QRY++ S++WG
Sbjct  27    PTLSLQREGVLRDPERAVSASIADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAESPID  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA
Sbjct  87    GANSSAPIFVYLGAESPIDGSPTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             ++    RGYF+SAQALADYA +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ 
Sbjct  147   LHETNIRGYFSSAQALADYAAIIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLT  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPILYFD+ITP++ YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S 
Sbjct  207   VGALASSAPILYFDDITPQDAYYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSN  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRI  1019
             LS+ FK CK L+S  ELK+YL S Y  AAQYD PP+YPVT +C GIDGA    + IL +I
Sbjct  267   LSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AGVV  +GN  CY     NPPT  S+T +GW WQ CSEM MPIG  + ++MF   PF++
Sbjct  327   FAGVVAYKGNSACY----VNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNL  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               F  +C+D YGV PRPHWITTYYGGHDI+L+L +FGSNIIFSNGLRDPYSSAGVL++IS
Sbjct  382   SSFIDECNDQYGVTPRPHWITTYYGGHDIELILLRFGSNIIFSNGLRDPYSSAGVLKNIS  441

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             D+++AVYT  GSHCLDI    +TDPDWL  QRK EVEII+ WI KYY +L A K+
Sbjct  442   DSIIAVYTEKGSHCLDILAEKQTDPDWLVMQRKVEVEIIKGWIAKYYSDLLAFKQ  496



>ref|XP_007016019.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
 gb|EOY33638.1| Serine carboxypeptidase S28 family protein, putative [Theobroma 
cacao]
Length=468

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/441 (66%), Positives = 347/441 (79%), Gaps = 8/441 (2%)
 Frame = +3

Query  222   QTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNA  401
             +TLDHFNY+P+SYATF+QRY+++ ++WGGA + +PI  +LGAESP+  D   IGFL DNA
Sbjct  33    KTLDHFNYKPESYATFQQRYVLNFQHWGGANATAPILVYLGAESPLGGDLSGIGFLHDNA  92

Query  402   PRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQ  581
               FKAL VYIEHRYYGKSIPF + +EA  N +T GYFNSAQA+ADYA++++++K K  A 
Sbjct  93    APFKALCVYIEHRYYGKSIPFRSRKEAFKNASTLGYFNSAQAIADYADIIMHIKKKLHAM  152

Query  582   HSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEV  761
              SP+IV GGSYGGMLASWFRLKYPHVALGALASSAPILYF+NITP   YYS+V+KDF+E 
Sbjct  153   SSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFNNITPSGAYYSIVSKDFREA  212

Query  762   SENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQ  941
             SE CYQTIRKSWS IDKIASK +GLS LSKKFK C+ L S  E K+YLD+ Y  AAQYD+
Sbjct  213   SETCYQTIRKSWSEIDKIASKHHGLSTLSKKFKTCEPLTSSSEFKNYLDTMYTGAAQYDR  272

Query  942   PPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRW  1115
             PP YPV EVC GIDG+ K  DIL +I  GVV   GNRTCY     N PT  SET  GWRW
Sbjct  273   PPSYPVNEVCRGIDGSKK-QDILSKIFDGVVAYYGNRTCY----LNQPTSDSETDQGWRW  327

Query  1116  QTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLH  1295
             QTCSEM MPIG G+ +TMF P PF +  F ++C  YYGVP RPHWIT+YYGG DIKL+L 
Sbjct  328   QTCSEMVMPIGVGE-NTMFQPDPFDLDSFIKNCKGYYGVPARPHWITSYYGGQDIKLILQ  386

Query  1296  KFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKK  1475
             +FGSNIIFSNGLRDPYSS GVLE++SD++LAV T  GSHCLDI    +TDP+WL EQRK 
Sbjct  387   RFGSNIIFSNGLRDPYSSGGVLENLSDSILAVSTVKGSHCLDIQPKRETDPEWLVEQRKT  446

Query  1476  EVEIIQSWITKYYVELEALKR  1538
              V+II+ W+ KYY +L+A KR
Sbjct  447   VVKIIKGWMAKYYADLKAFKR  467



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 358/472 (76%), Gaps = 6/472 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSS-----DILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             IPRL     S+L   E SSS       L   F+T++Y QTLDHFNYRP+SY TF+ RY+V
Sbjct  29    IPRLGVLRGSSLSVLEGSSSLRTVSVNLSENFQTFFYPQTLDHFNYRPESYTTFQHRYMV  88

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +  YWGGA+S + IF +LG ES +D D   IGFL DN  RF ALLVYIEHRYYGKS PFG
Sbjct  89    NFNYWGGARSAAQIFVYLGEESDLDKDINSIGFLVDNGARFGALLVYIEHRYYGKSNPFG  148

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
             +M++++ N + RGYFNS QALADYAEV++ LK    A  SP+IV GGSYGG+LA+WFRLK
Sbjct  149   SMQKSLQNASRRGYFNSGQALADYAEVIINLKKNLSADSSPVIVVGGSYGGLLAAWFRLK  208

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHVALGALASSAPILYFD+ITP++GYYSLVTKDF++ SE+CY TI+ SW+ IDK A++ 
Sbjct  209   YPHVALGALASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEIDKAAAEA  268

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
             NGL  LSKKF+ CK L+S  +LKDYL++ Y  AAQYD+PP YPVT VC GIDG  +G DI
Sbjct  269   NGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTVVCNGIDGGLQGTDI  328

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             LDRI +G+V   GN++CYD    + P SET  GW WQ CSE+ +PIGRG  DTMF  APF
Sbjct  329   LDRIFSGIVASRGNKSCYDMGQSSFP-SETEEGWNWQVCSELVIPIGRGSNDTMFPAAPF  387

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
               ++++  C   YGV PRPHWIT+YYGGH+IKL+L +FGSNIIFSNGLRDPYSS GVLED
Sbjct  388   DFKEYADSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGVLED  447

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             IS +++AV+T  GSHCLDI  +++ DP+WL  QR  E+EII  W+ KYY +L
Sbjct  448   ISHSIIAVHTPRGSHCLDILPSTEDDPNWLVLQRNVEIEIIHGWLLKYYEDL  499



>ref|XP_008458665.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Cucumis 
melo]
Length=511

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/473 (62%), Positives = 363/473 (77%), Gaps = 7/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
              PRL+P     L    +  S  LP + F+TYYY+QTLDHFNYRP+SY TF QRYI++ KY
Sbjct  45    FPRLSPIGEKFLHHSRALYS--LPSDDFKTYYYNQTLDHFNYRPESYTTFLQRYIINFKY  102

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGG  S++PIFA+LGAE+PID D  +IGFLTDNA +F ALL+YIEHRYYGKSIPF + +E
Sbjct  103   WGGPNSSAPIFAYLGAEAPIDGDLNFIGFLTDNAIQFNALLIYIEHRYYGKSIPFRSRDE  162

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSYGGMLASWFRLKYPHV
Sbjct  163   ALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSYGGMLASWFRLKYPHV  222

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KSWS I  +AS+PNGLS
Sbjct  223   ALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKSWSEIKTVASQPNGLS  282

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             IL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C  IDG       L +I
Sbjct  283   ILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICDAIDGTYSVNGTLSKI  342

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPI     D MF P PF +Q 
Sbjct  343   AAGVFAFRGSISCYINEPRN--ETETDVGWRWQSCSEMVMPI--SSDDDMFPPYPFDLQS  398

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
                 C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+DPYS AGVL  ISD+
Sbjct  399   VINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHSISDS  458

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +LAV+T NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY +L+  K+
Sbjct  459   LLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGWISEYYADLKKYKQ  511



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 354/472 (75%), Gaps = 4/472 (1%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILP-PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             PRL    R   R+    +    P  ++  YYY+QTLDHFNYRP+SY TF+Q+Y+++S YW
Sbjct  33    PRLRVMRRMKDRKVGDMAGTPSPKADYNVYYYNQTLDHFNYRPESYTTFQQKYVINSNYW  92

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA S++PIF +LG ES IDDD +  GFL++NAP+F AL+V+IEHRYYGKS+PFG+ +EA
Sbjct  93    GGANSSAPIFVYLGDESAIDDDIRTTGFLSENAPKFNALIVFIEHRYYGKSVPFGSRDEA  152

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
               + +T GYF+S+QALADYAE++L +K    A+ SP+IV GGSYGGMLA+WFRLKYPH+A
Sbjct  153   FRDASTLGYFSSSQALADYAEIILAIKKNLSAERSPVIVVGGSYGGMLAAWFRLKYPHIA  212

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAPILYFD+ITP++GYYS+VTKDF++ SE+CY TIR+SWS ID+++S+PNGLSI
Sbjct  213   LGALASSAPILYFDDITPQDGYYSVVTKDFRDASESCYNTIRQSWSEIDRVSSEPNGLSI  272

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIH  1022
             LSK+F  C  + S  +LKDYL+  YC AAQY  P    V ++C  IDG     DI+ ++ 
Sbjct  273   LSKQFMTCNPITSASQLKDYLEYMYCEAAQYAFPSDDSVLKICNAIDGTSNNTDIIGKVV  332

Query  1023  AGVVGLEGNRTCYDPQIYNPPT---SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             AGVV   GN +CYD    N P+    ET  GW WQTCSEM MP+GRG  DTMF  APF +
Sbjct  333   AGVVSYNGNSSCYDLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSNDTMFEAAPFDL  392

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F + C   Y V PRPHWITT +GGHDIKL+L +FGSNIIFSNGLRDPYSSAGVL  IS
Sbjct  393   EAFIQGCKSAYSVSPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRDPYSSAGVLTSIS  452

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             D++LA+YT  G HCLDI  +S  DP+WL  QR++E+EII  WI +YY +L A
Sbjct  453   DSLLAIYTNEGCHCLDIVQSSPDDPNWLVMQRRREIEIISDWIKQYYADLAA  504



>ref|XP_010651746.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Vitis 
vinifera]
Length=465

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/430 (67%), Positives = 347/430 (81%), Gaps = 2/430 (0%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             PH + RL    R+ LR P + S  +   EF+T+YY+QTLDHFNYRP+SY TF+QRY+V+ 
Sbjct  33    PHLL-RLGVLGRTFLREPATFSESV-SEEFQTFYYNQTLDHFNYRPESYITFQQRYVVNF  90

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PIFA+LGAE+ +D D   IGFLTDNA +FKALLVYIEHRYYGKSIP+G+ 
Sbjct  91    KYWGGANASAPIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSR  150

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV G SYGGMLASWFRLKYP
Sbjct  151   EEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIVVGASYGGMLASWFRLKYP  210

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+TI +SWS ID++AS+PNG
Sbjct  211   HVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYKTISESWSEIDRVASEPNG  270

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPVT VCGGIDGAP+G+DIL 
Sbjct  271   LSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGAPEGSDILS  330

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             RI AGVV   GN +CY          ETI GW WQTCSE+ +PIGRG  DTMF  APF++
Sbjct  331   RIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNL  390

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIFSNGLRDPYS  GVL++IS
Sbjct  391   TTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNIS  450

Query  1374  DTVLAVYTRN  1403
             ++VLA+ T N
Sbjct  451   NSVLAILTVN  460



>ref|XP_002313555.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|EEE87510.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=495

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/472 (63%), Positives = 366/472 (78%), Gaps = 8/472 (2%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +F T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  26    HTIPRLSPIGPRVWLDHPDQILGESVREDFETFFYNQTLDHFNYRPESYDTFLQRYLINS  85

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PI  +LGAE+PID D   +GFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  86    KYWGGANASAPILVYLGAEAPIDGDLDAVGFLVDTAVEFNSLLVYVEHRYYGKSIPFGSR  145

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  146   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  205

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIR+SW  ID++ASKP+G
Sbjct  206   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRESWEEIDEVASKPDG  265

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  266   LSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGCGFGDDLLG  325

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET VGWRWQTCSEM MPIG G+ D+MF P PF
Sbjct  326   RVFGGLVAYKGNRSCY----VNEPTNQSETSVGWRWQTCSEMVMPIGYGN-DSMFPPDPF  380

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  381   DLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGGVLEN  440

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  441   ISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  492



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/439 (64%), Positives = 346/439 (79%), Gaps = 2/439 (0%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F T YY QTLDHF+Y P+S+ TFKQRY ++SKYWGGA S++PI A+LGAE PID D  Y
Sbjct  63    DFETLYYPQTLDHFSYGPESFTTFKQRYAINSKYWGGANSSAPILAFLGAEGPIDYDVGY  122

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGFL +NAPR KAL VYIEHRYYGKS+PFG++++AM N + RGYFN+ QA+ADYA VLL+
Sbjct  123   IGFLNENAPRLKALQVYIEHRYYGKSVPFGSVKKAMKNASIRGYFNTDQAIADYAVVLLH  182

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K K  A +SPIIV GGSYGGMLA+WFRLKYPHVA+GALASSAPILYFD+ITPE+GYYS+
Sbjct  183   VKKKLSAHNSPIIVVGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDDITPESGYYSV  242

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTKDFK+ SE+CY+TIRKSW+ ID++AS+P+GLSILS+KFK C  LK+  +LKDYLD+ Y
Sbjct  243   VTKDFKDTSESCYETIRKSWAEIDRVASEPSGLSILSRKFKTCGKLKTSADLKDYLDTVY  302

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
             C AAQY+ P   P++ +C  IDGAP   D L ++ AGV    GNR+CY+    N  + + 
Sbjct  303   CGAAQYNGPSTRPLSHLCNAIDGAPNNTDTLGKLFAGVSAYRGNRSCYNIS-GNNLSDQL  361

Query  1098  IVGWRWQTCSEMAMPIGRG-DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             + GW WQ+CSEM MPI  G D D+MF    F ++ ++ DC   YGV PRPHW+TTYYGGH
Sbjct  362   LDGWYWQSCSEMVMPIAHGSDEDSMFPKDHFDLESYTNDCKRLYGVVPRPHWVTTYYGGH  421

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1454
             DIKLV H+F SNIIFSNGLRDPYS  GVLE+I+++V+AV T NGSHCLD+  +  +DP W
Sbjct  422   DIKLVFHEFASNIIFSNGLRDPYSRGGVLENITESVVAVTTDNGSHCLDLLSSRPSDPQW  481

Query  1455  LTEQRKKEVEIIQSWITKY  1511
             L  QRK E+EII+ WI KY
Sbjct  482   LVMQRKNEIEIIEGWIAKY  500



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/476 (62%), Positives = 361/476 (76%), Gaps = 4/476 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T + IP+L  F ++  R    +SS     +  T+YY QTLDHF+Y+P+SY TF+QRY++ 
Sbjct  23    TQYKIPKLGAFPKNIHRTEPQTSSKSSSKDLVTFYYTQTLDHFSYKPESYTTFRQRYVID  82

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              +YWGGA +++PIF + GAE  +DDD   IGFL+DNAP FKALL+YIEHRYYGKSIPFG+
Sbjct  83    FRYWGGANTSAPIFVFFGAEEDLDDDLDAIGFLSDNAPHFKALLIYIEHRYYGKSIPFGS  142

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              +EA+ N  T GY NSAQA+AD A V+++LK KY A+ SP+IV GGSYGGML SWFRLKY
Sbjct  143   RKEALKNAETLGYLNSAQAIADCAAVIMHLKKKYSAKDSPVIVIGGSYGGMLTSWFRLKY  202

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+I P+ GYYS+VTKDFKE SE+CY TIRKSW  I KIASKPN
Sbjct  203   PHIALGALASSAPILYFDDIAPQEGYYSIVTKDFKETSESCYNTIRKSWGEIKKIASKPN  262

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG-ADI  1007
             GL+ILSKKFK C  L    EL+D+LDS YC AAQYD PP++PV+ VCGGI+ A      I
Sbjct  263   GLAILSKKFKTCYPLNRTFELEDFLDSIYCEAAQYDYPPEFPVSTVCGGINKASAARTGI  322

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             LDRI AGVV   GN +CYD   +N    +    WRWQTCSE+ MPIG  + ++MF PAPF
Sbjct  323   LDRIFAGVVAYMGNISCYDMNAFN--YQDKTEEWRWQTCSELVMPIGH-ESNSMFPPAPF  379

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             +++ + +DC   +GV P+P WITTYYGGHD+KL+LH+FGSNIIFSNGLRDPYS  GVL +
Sbjct  380   NLKNYIKDCKSLFGVLPQPRWITTYYGGHDLKLILHRFGSNIIFSNGLRDPYSGGGVLNN  439

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             ISD+++AV   NGSHCLDI  AS +DP WL  QRK EV+II+ WI+KYY +L   K
Sbjct  440   ISDSIVAVSAVNGSHCLDIQRASPSDPHWLVTQRKIEVKIIEGWISKYYTDLLEFK  495



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/468 (62%), Positives = 352/468 (75%), Gaps = 4/468 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL    R+    P   S+     +++T+ Y Q LDHFNYRP SY TF+QRY+++ KYW
Sbjct  30    IPRLRTRPRTIQNEPILMSAS-ESKDYKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYW  88

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
              GA +++PIF   G E  ID D    GFL +NAP FKALLVYIEHRYYGKS+PFGT EEA
Sbjct  89    DGANTSAPIFVLFGGEESIDYDRDINGFLPENAPHFKALLVYIEHRYYGKSVPFGTKEEA  148

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             M N +T GY NSAQA+ADYA VLL++K KY A+  P+IV GGSYGGMLASWFRLKYPH+A
Sbjct  149   MKNASTLGYCNSAQAIADYAAVLLHIKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIA  208

Query  663   LGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             LGALASS+PILYFD +  P+ GYY++VTKDFKE SE+CY+TIRKSW  ID++ S+PNGLS
Sbjct  209   LGALASSSPILYFDGVVDPQVGYYTIVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLS  268

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
             ILSKKF+ C  L S  ELKDYLDS Y  AAQYD+PPKYPV+ VCG IDGA +G D LD+I
Sbjct  269   ILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA-EGTDTLDKI  327

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              A VV   GN +CYD + +  PTS T   + WQ C+E+  PIG G  DTMF  APF +  
Sbjct  328   FAAVVTYMGNTSCYDMKEFGSPTS-TFDMFTWQVCTELVFPIGHGHNDTMFPLAPFDLSS  386

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             FS+ C+  +GV P+PHW+TTYYGG DIKL+LH F SNIIFSNGLRDPYSS GVL++ISD+
Sbjct  387   FSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRDPYSSGGVLKNISDS  446

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             V+A+ T NGSHCLDI  A ++DP WL  QRK EVEII+ W+ KY+ +L
Sbjct  447   VVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGWLAKYHADL  494



>emb|CAN63232.1| hypothetical protein VITISV_004830 [Vitis vinifera]
Length=468

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/430 (67%), Positives = 344/430 (80%), Gaps = 2/430 (0%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             PH + RL    R+ LR P + S  +   EF+T+YY+QTLDHFNYRP+SY TF+QRY+V+ 
Sbjct  33    PHLL-RLGVLGRTFLREPATFSESV-SEEFQTFYYNQTLDHFNYRPESYITFQQRYVVNF  90

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PIFA+LG E+ +D D   IGFLTDNA +FKALLVYIEHRYYGKSIP G+ 
Sbjct  91    KYWGGANASAPIFAYLGXEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPXGSR  150

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA  N +T GYFNSAQA+ADYAEVL+Y+K K LA++SP+IV G SYGGMLASWFRLKYP
Sbjct  151   EEAFKNASTLGYFNSAQAIADYAEVLIYIKKKLLAENSPVIVVGASYGGMLASWFRLKYP  210

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD+ITP NGY+S+VTKDF+E SE+CY+TI +SWS ID++AS+PNG
Sbjct  211   HVALGALASSAPILYFDDITPHNGYFSIVTKDFREASESCYKTISESWSEIDRVASEPNG  270

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKF++C  L +  ELK++L+ TY  AAQYD PP YPVT VCGGIDGAP+G+DIL 
Sbjct  271   LSILSKKFRICGQLNNSDELKEFLERTYSIAAQYDAPPSYPVTVVCGGIDGAPEGSDILS  330

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             RI AGVV   GN +CY          ETI GW WQTCSE+ +PIGR   DTMF  APF++
Sbjct  331   RIFAGVVAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRXVNDTMFPLAPFNL  390

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               FS+DC   YGV PRPHWITTYYGGHDI+L+L +F SNIIFSNGLRDPYS  GVL++IS
Sbjct  391   TTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNIS  450

Query  1374  DTVLAVYTRN  1403
             ++VLA+ T N
Sbjct  451   NSVLAILTVN  460



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/475 (61%), Positives = 358/475 (75%), Gaps = 8/475 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PR+ P  R + R   S ++  +    +T+YY+QTLDHFNYRP S+  F+QRY+++SKYWG
Sbjct  44    PRVRPLGRIS-RNSASFAASSIYHNLQTFYYNQTLDHFNYRPDSFDMFQQRYVINSKYWG  102

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             GA SN+PIF + G E+P++ D   IG L +NA RFKAL VYIEHRYYGKSIPFG+  EA 
Sbjct  103   GAISNAPIFVYFGEEAPLEYDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAF  162

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N +T GYFNSAQALADYAE+++++K K+ AQ SP+IV G SYGGMLASWFRLKYPH+AL
Sbjct  163   KNASTLGYFNSAQALADYAEIIIHVKEKFHAQRSPVIVVGASYGGMLASWFRLKYPHIAL  222

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             GALASSAPILYF +ITP + Y S+VTKDF+E S++C+ TI+KSW+VIDKIASKP+GLSIL
Sbjct  223   GALASSAPILYFTDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASKPDGLSIL  282

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHA  1025
             SKKFK CK L +  ELKDYL   Y  AAQYD PP YPVT +C  ID    G DIL RI A
Sbjct  283   SKKFKTCKPLNNSSELKDYLAGIYMAAAQYDAPPSYPVTVICRSIDEPSFGNDILGRIFA  342

Query  1026  GVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
             G+V   G   CY     N PT  +ET VGW WQTC++M +P G  + D+MF P PF +  
Sbjct  343   GMVAYRGELPCY----VNKPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPFDLNV  397

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             +  DC D YGVPPRPHW+TTY+GGHDIKL+L +FGSNIIFSNGLRDPYSS GVL++IS++
Sbjct  398   YINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISES  457

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*K  1544
             V+A+ T  GSHCLD+   +K+DP WL  QRK+EV II+ WI  Y+ +L+A ++ K
Sbjct  458   VVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDLDACEKGK  512



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/443 (64%), Positives = 343/443 (77%), Gaps = 3/443 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +++T+ Y Q LDHFNYRP SY TF+QRY+++ KYW GA +++PIF   G E  ID D   
Sbjct  8     DYKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANTSAPIFVLFGGEESIDYDRDI  67

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GFL +NAP FKALLVYIEHRYYGKS+PFG+ EEAM N +T GY NSAQA+ADYA VLL+
Sbjct  68    NGFLPENAPHFKALLVYIEHRYYGKSVPFGSKEEAMKNASTLGYCNSAQAIADYAAVLLH  127

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGYYS  734
             +K KY A+  P+IV GGSYGGMLASWFRLKYPH+ALGALASS+PILYFD +  P+ GYY+
Sbjct  128   IKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIALGALASSSPILYFDGVVDPQVGYYT  187

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             +VTKDFKE SE+CY+TIRKSW  ID++ S+PNGLSILSKKF+ C  L S  ELKDYLDS 
Sbjct  188   IVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLSILSKKFRTCNPLNSTSELKDYLDSL  247

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y  AAQYD+PPKYPV+ VCG IDGA +G D LD+I A VV   GN +CYD + +  PTS 
Sbjct  248   YTDAAQYDEPPKYPVSRVCGAIDGA-EGTDTLDKIFAAVVTYMGNTSCYDMKEFGSPTS-  305

Query  1095  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             T   + WQ C+E+  PIG G  DTMF  APF +  FS+ C+  +GV P+PHW+TTYYGG 
Sbjct  306   TFDMFTWQVCTELVFPIGHGHNDTMFPLAPFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQ  365

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1454
             DIKL+LH F SNIIFSNGLRDPYSS GVL++ISD+V+A+ T NGSHCLDI  A ++DP W
Sbjct  366   DIKLILHNFASNIIFSNGLRDPYSSGGVLKNISDSVVALNTVNGSHCLDILPAKESDPLW  425

Query  1455  LTEQRKKEVEIIQSWITKYYVEL  1523
             L  QRK EVEII+ W+ KY+ +L
Sbjct  426   LIMQRKAEVEIIEGWLAKYHADL  448



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/477 (60%), Positives = 358/477 (75%), Gaps = 8/477 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PR+ P  R + R   S ++  +    +T+YY+QTLDHFNYRP S+  F+QRY+++SKYWG
Sbjct  40    PRVKPLGRIS-RNSASFAASSIYHNLQTFYYNQTLDHFNYRPDSFDMFQQRYVINSKYWG  98

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             GA SN+PIF + G E+P+++D   IG L +NA RFKAL VYIEHRYYGKSIPFG+  EA 
Sbjct  99    GANSNAPIFVYFGEEAPLENDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAF  158

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N +T GYFNSAQALADYAE+++++  K+  Q SP+IV G SYGGMLASWFRLKYPH+AL
Sbjct  159   KNASTLGYFNSAQALADYAEIIIHVNEKFHVQRSPVIVVGASYGGMLASWFRLKYPHIAL  218

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             GALASSAPILYF +ITP + Y S+VTKDF+E S++C+ TI+KSW+VIDKIAS+P+GLSIL
Sbjct  219   GALASSAPILYFTDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASEPDGLSIL  278

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHA  1025
             SKKF+ CK L +  EL DYL   Y  AAQYD PP YPVT VC  ID    G DIL RI A
Sbjct  279   SKKFETCKPLNNSSELTDYLAGIYMAAAQYDAPPSYPVTMVCKSIDEPSFGNDILGRIFA  338

Query  1026  GVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
             G+V  +G   CY     N PT  +ET VGW WQTC++M +P G  + D+MF P PF +  
Sbjct  339   GMVAYQGELPCY----VNEPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPFDLNA  393

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             +  DC D YGVPPRPHW+TTY+GGHDIKL+L +FGSNIIFSNGLRDPYSS GVL++ISD+
Sbjct  394   YINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISDS  453

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR*KTK  1550
             V+A+ T  GSHCLD+   +K+DP WL  QRK+EV II+ WI  Y+ +L+A ++ K +
Sbjct  454   VVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDLDACEKGKHR  510



>ref|XP_010031433.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=496

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/475 (60%), Positives = 365/475 (77%), Gaps = 9/475 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P L+     NLR  + + S  +  ++ T++++QTLDHFNYRP+SY  FKQRY+++S YWG
Sbjct  27    PTLSLHREHNLRDSKHAVSASIANDYETFFFNQTLDHFNYRPESYTAFKQRYLINSNYWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAESPID +P  IGFLTDNA +FKALLVYIEHRYYG+SIP G T++ A
Sbjct  87    GANSSAPIFVYLGAESPIDGEPTAIGFLTDNAAQFKALLVYIEHRYYGESIPLGMTLKGA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + +   RGYF+SAQALADYA +++++K K  A  SP+IV G SYGGMLASWFRLKYPHVA
Sbjct  147   LEDANIRGYFSSAQALADYAAIIMHVKQKLKASFSPVIVVGASYGGMLASWFRLKYPHVA  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAPILYFD ITP++ Y+ ++TKDFKE SE CYQTIR SWS ID++A +P+GLS 
Sbjct  207   LGALASSAPILYFDGITPQDAYHWVITKDFKEASETCYQTIRDSWSEIDRVAHEPDGLSN  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRI  1019
             L+K FK CK L+S  ELK YL S Y +AAQYD PP YPVT +C GIDGA    + IL +I
Sbjct  267   LNKLFKTCKPLESVDELKGYLKSLYWSAAQYDDPPIYPVTMICNGIDGANTIENGILGKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AGVV  +GN TCY     NP T  S+T +GW WQ CSEM MPIG  + ++MF P PF +
Sbjct  327   FAGVVAYDGNSTCY----VNPSTDVSQTSLGWSWQKCSEMVMPIGITN-NSMFQPHPFIL  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               F  +C+  YGV P+ HW++TYYGG+DI+L+L +FGSNIIFSNGLRDP+SSAGVL++IS
Sbjct  382   SDFIDECNSSYGVLPQLHWVSTYYGGYDIELILRRFGSNIIFSNGLRDPWSSAGVLKNIS  441

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++++AVYT  GSHCLD+Y   +TDP+WL  QRK EV+II++WI +YY +L A K+
Sbjct  442   NSIIAVYTEKGSHCLDLYSEMQTDPNWLVMQRKTEVKIIKAWIAEYYADLLAFKQ  496



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/473 (61%), Positives = 357/473 (75%), Gaps = 5/473 (1%)
 Frame = +3

Query  123   IPRLTPFYR--SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IPRLTP Y+  + L   E   S I      T+YY Q LDHFNYRP+SY  F+QRY ++ K
Sbjct  31    IPRLTPLYKWKTTLHNLEKLVS-IEKENVETFYYKQVLDHFNYRPESYHKFEQRYFMNFK  89

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA S++PIFA+LGAE  ID  P  IGF+TDNA  FKALLVYIEHRYYGKS+PFG+ +
Sbjct  90    YWGGANSSAPIFAYLGAEDSIDTYPTGIGFMTDNAATFKALLVYIEHRYYGKSVPFGSRK  149

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             +A  N +T GYFNSAQA+ADYA VL+++K    A +SPIIV GGSYGGMLASWFRLKYPH
Sbjct  150   KAFRNASTLGYFNSAQAIADYAAVLIHIKKTLHAHNSPIIVLGGSYGGMLASWFRLKYPH  209

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             + +GALASSAPILYFDNITP N Y  LV+++FKEVSE CY+TI KSWS I++I+S+ +GL
Sbjct  210   LTIGALASSAPILYFDNITPHNAYMDLVSREFKEVSETCYETILKSWSEIERISSQSDGL  269

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             SILS++F  C+ LK   +L +YL+S Y  A QY+ P    V+E+C GIDGA  G DIL +
Sbjct  270   SILSERFNTCRPLKQYSDLSEYLESMYTAAVQYNGPTSSRVSEICRGIDGASFGNDILSK  329

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I++G+V  EGN TC      +  + E   GW WQ CSEM MPIG G+ DTMF P PF+++
Sbjct  330   IYSGLVAYEGNGTCKINYAPSNISDEVYEGWSWQRCSEMVMPIGTGN-DTMFQPDPFNLK  388

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
             ++  +C   YGV PRPHW+TTYYGGH+IKLVL KFGSNIIFSNGL+DPYS+ GVL ++SD
Sbjct  389   RYVEECKKQYGVSPRPHWVTTYYGGHNIKLVLQKFGSNIIFSNGLKDPYSTGGVLSNLSD  448

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +++AVYT NGSHCLDI    ++DP WL +QRKKEVEII+ WI +YY +L ALK
Sbjct  449   SLIAVYTTNGSHCLDILQTRQSDPKWLIQQRKKEVEIIKRWIEQYYSDL-ALK  500



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/458 (60%), Positives = 346/458 (76%), Gaps = 3/458 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+ S+  +   + + +Y++QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG
Sbjct  42    PDGSTQKVDASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES +D D   +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQ
Sbjct  102   EESSLDSDLSAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA++LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAKILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L   
Sbjct  222   DTRPKFGYYYIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTC  1058
               +KD+LD+ Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTC
Sbjct  282   SNIKDFLDTIYAESVQYNRGPSYSVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTC  341

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YDP ++  PT+  I+ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPP
Sbjct  342   YDPNMFAQPTNN-IIAWRWQSCSEIVMPVGFDKQDTMFPTAPFNMTSYIEGCESNYGVPP  400

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             R HWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDTV+A+ T NGSHC 
Sbjct  401   RQHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVGGILEDISDTVVAITTNNGSHCQ  460

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             DI   SK DP+WL  QR+KE++II SWI+ Y  +L  L
Sbjct  461   DISLKSKEDPEWLVMQREKEIKIIDSWISTYQKDLRDL  498



>ref|XP_010031432.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50733.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=504

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/473 (60%), Positives = 353/473 (75%), Gaps = 8/473 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP+L       L  P  +   ++  +F T++Y+QTLDHFNYRP+SY  F QRY+V+S+YW
Sbjct  35    IPKLGMSRPEFLLDPARAVQALVAEDFVTFFYNQTLDHFNYRPESYTAFNQRYVVNSEYW  94

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S +PIFA+LGAE+PID D    GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+E 
Sbjct  95    GGADSGAPIFAFLGAEAPIDGDIANAGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLER  154

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ +  TRGYF+SAQALADYAE+L++LK K  A+HSPIIVFGGSYGGMLASWFRLKYPHV
Sbjct  155   ALGDADTRGYFSSAQALADYAEILIHLKQKLKAEHSPIIVFGGSYGGMLASWFRLKYPHV  214

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+I P++ YYS+V K F E S +C+QTIR+SW  +D++AS+P GL+
Sbjct  215   ALGALASSAPILYFDDIIPQDAYYSVVAKSFLESSSSCHQTIRQSWEELDRVASEPRGLT  274

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS  FK C  L+S  ELK YL   Y    QY+ P   P+  +C  I+GAP    +L +I
Sbjct  275   KLSNAFKTCSPLQSSSELKKYLKLLYVQVVQYNDPSAQPLKLMCDAINGAPPRKGLLQKI  334

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTS--ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AG+V + GN TCY     NP  S  +T  GW WQTC+EMA PIG   R+TMF P PF++
Sbjct  335   FAGLVAINGNLTCY----VNPSGSDAQTPSGWFWQTCTEMAFPIGI-TRNTMFPPEPFNL  389

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               FS  C   +GVP RP W+TTY+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++IS
Sbjct  390   NSFSNACKSEFGVPARPRWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNIS  449

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
              TV+A+YT  GSHCLDI GA K+DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  450   STVVAIYTAKGSHCLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYYADLHAF  502



>ref|XP_010036093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=509

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/473 (60%), Positives = 361/473 (76%), Gaps = 3/473 (1%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PRL+    + L+ P+      +  +F T+Y++QTLDHFNY+P+SY TF+QRY+++S+YWG
Sbjct  27    PRLSLHRENVLQDPQRRVPVSVTNDFTTFYFNQTLDHFNYQPKSYTTFRQRYLINSRYWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAE+PI++D   IGFLT+NA +FKA LVYIEHRYYG+SIPFG ++EEA
Sbjct  87    GANSSAPIFIYLGAEAPIENDLNGIGFLTENAAQFKAFLVYIEHRYYGRSIPFGMSLEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             +N+   RGYF+S+QALADYA ++ ++K K  A+  P+IV GGSYGGMLASWFRLKYPH+A
Sbjct  147   LNDPIARGYFSSSQALADYAAIIRHVKEKLKARDCPVIVVGGSYGGMLASWFRLKYPHLA  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
              GALASSAPILYFD ITP++ Y+S+VTKDFKE S+ CYQTIR SW+ ID++ SKP+GLS 
Sbjct  207   FGALASSAPILYFDGITPQDAYFSVVTKDFKEASKTCYQTIRDSWAEIDRVISKPSGLSR  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA-PKGADILDRI  1019
             LSK FK C+ LKS  ELK+YL   Y  AAQYD PP+YPV  VC GIDGA   G  IL +I
Sbjct  267   LSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGANASGKGILKKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGVV L+ N TCY         ++T +G+ WQ CSEM M IG  + + MF   PF++  
Sbjct  327   FAGVVALDRNSTCYIVPPNGTTPTQTELGYSWQRCSEMVMGIGITN-NAMFQAYPFNLTD  385

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             F   C+  YGV PRPHWITTYYGGHDI+ VLH+FGSNIIFSNGLRDPYSS G+L++ISDT
Sbjct  386   FINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRDPYSSGGILKNISDT  445

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             + AVYT+ GSHCLDI  + + DP+WL  QRK+EVEII+ WITKY+  L A K+
Sbjct  446   IDAVYTQKGSHCLDILASEQADPNWLVRQRKREVEIIKGWITKYHAHLLAFKQ  498



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/474 (60%), Positives = 357/474 (75%), Gaps = 9/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPP--EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IPRL+P     L   ++     LPP  +F+T+Y++QTLDHFNYRP+SY TF QRYI++ K
Sbjct  25    IPRLSPIGEKFLHHSKALE---LPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYIINFK  81

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG+ +
Sbjct  82    YWGGANSSAPILAYLGPEAPIDSAMNVIGFMTDNAVKFNALLVYIEHRYYGKSIPFGSRK  141

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EA+ N +T GYFNSAQALADYA +L+++K ++ A++SP+IV GGSYGGMLA+WFRLKYPH
Sbjct  142   EALRNASTLGYFNSAQALADYAAILIHVKKEFSAKYSPVIVIGGSYGGMLATWFRLKYPH  201

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPILYF++ITPENGYY +VTKDF+EVS+ CY++IR+SWS I+ +AS+ NGL
Sbjct  202   VALGALASSAPILYFNDITPENGYYVIVTKDFREVSQTCYESIRESWSEIETVASQSNGL  261

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             S+L K FK C  L+S  +L++YL   Y +AAQY+ P +YPV  +C  ID        L +
Sbjct  262   SVLDKVFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTYSNG-TLGK  320

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGV    G  +CY  +  N  T+ET VGW+WQ CSEM MPI  G+ DTMF    F  +
Sbjct  321   IAAGVFAYRGELSCYINEPIN--TTETTVGWQWQRCSEMVMPISTGN-DTMFPSETFDHE  377

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              FS  C+  YGV PRPHW+TTYYGGHDI L+LH+F SNIIFSNGL+DPYS  GVL +ISD
Sbjct  378   SFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHNISD  437

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++LAVYT NGSHCLDI  A++ DP+WL  QRK EV II+ WI +YY +L   K+
Sbjct  438   SLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEWIDEYYADLANYKK  491



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/474 (60%), Positives = 358/474 (76%), Gaps = 9/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPP--EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IPRL+P     L   ++     LPP  +F+T+Y++QTLDHFNYRP+SY TF QRYI++ K
Sbjct  25    IPRLSPIGEKFLHHSKALE---LPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYIINFK  81

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG+ +
Sbjct  82    YWGGAYSSAPILAYLGPEAPIDSAMNVIGFMTDNAVKFNALLVYIEHRYYGKSIPFGSRK  141

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EA+ N +T GYFNSAQA+ADYA +L+++K ++ A++SP+IV GGSYGGMLA+WFRLKYPH
Sbjct  142   EALRNASTLGYFNSAQAIADYAAILIHVKKEFSAKYSPVIVIGGSYGGMLATWFRLKYPH  201

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPILYF++ITPENGYY +VTKDF+EVS+ CY++IR+SWS I+ +AS+ NGL
Sbjct  202   VALGALASSAPILYFNDITPENGYYVIVTKDFREVSQTCYESIRESWSEIETVASQSNGL  261

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             S+L K+FK C  L+S  +L++YL   Y +AAQY+ P +YPV  +C  ID        L +
Sbjct  262   SVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSRYPVNRICDAIDQTYSNG-TLGK  320

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGV    G  +CY  +  N  T+ET VGW+WQ CSEM MPI  G+ DTMF    F  +
Sbjct  321   IAAGVFAYRGELSCYINEPIN--TTETTVGWQWQRCSEMVMPISTGN-DTMFPSETFDHE  377

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              FS  C+  YGV PRPHW+TTYYGGHDI L+LH+F SNIIFSNGL+DPYS  GVL +ISD
Sbjct  378   SFSIYCNQLYGVTPRPHWVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHNISD  437

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++LAVYT NGSHCLDI  A++ DP+WL  QRK EV II+ WI +YY +L   K+
Sbjct  438   SLLAVYTANGSHCLDILTANRMDPEWLVTQRKTEVGIIKEWIDEYYADLANYKK  491



>ref|XP_008458662.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=495

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/474 (60%), Positives = 358/474 (76%), Gaps = 9/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPP--EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IPRL+P     L   ++     LPP  +F+T+Y++QTLDHFNYRP+SY TF QRYI++ K
Sbjct  29    IPRLSPIGEKFLYHSKALE---LPPSDDFKTFYFNQTLDHFNYRPESYTTFPQRYIINFK  85

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA S++PI A+LG E+PID     IGF+TDNA +F ALLVYIEHRYYGKSIPFG+ +
Sbjct  86    YWGGANSSAPILAYLGPEAPIDSAMNAIGFMTDNAVKFNALLVYIEHRYYGKSIPFGSRK  145

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EA+ N +T GYFNSAQA+ADYA +L+++KN++ A++SP+IV GGSYGGMLA+WFRLKYPH
Sbjct  146   EALRNASTLGYFNSAQAIADYAAILIHVKNEFNAKYSPVIVIGGSYGGMLATWFRLKYPH  205

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPILYF++ITP+NGYY  VTKDF+EVS+ CY+TIR+SWS I+ +AS+PNGL
Sbjct  206   VALGALASSAPILYFNDITPQNGYYVTVTKDFREVSQTCYETIRESWSEIETVASQPNGL  265

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             S+L K+FK C  L+S  +L++YL   Y +AAQY+ P  YPVT +C  ID        L +
Sbjct  266   SVLDKEFKTCSPLRSSTQLENYLWFMYASAAQYNHPSSYPVTRICDAIDRTYSNG-TLGK  324

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGV    GN +CY  +  N  T+ET VGW+WQ CSEM MPI   + DTMF P  F  +
Sbjct  325   IAAGVFAYRGNLSCYINEPIN--TTETTVGWQWQRCSEMVMPISTSN-DTMFPPRTFDHE  381

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              FS  C+  YGV PRPHW+TTYYGG D+ L+LH+F SNIIFSNGL+DPYS  GVL +ISD
Sbjct  382   SFSIYCNQLYGVTPRPHWVTTYYGGDDVHLILHRFASNIIFSNGLKDPYSIGGVLHNISD  441

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             ++ AVYT NGSHCLDI  +++ DP+WL  QRK EV II+ WI KYY +L   K+
Sbjct  442   SLPAVYTANGSHCLDILSSNRMDPEWLVTQRKTEVRIIKEWIDKYYADLANYKK  495



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 353/472 (75%), Gaps = 6/472 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSS-----DILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             IPRL     S+L   E SSS       L   F+T++Y QTLDHFNYRP+SY TF+ RY+V
Sbjct  29    IPRLGVLRGSSLSVLEGSSSLRTVSVNLSENFQTFFYPQTLDHFNYRPESYTTFQHRYMV  88

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +  YWGGA+S + IF +LG ES +D D   IGFL +N  RF ALLVYIEHRYYGKS PFG
Sbjct  89    NFNYWGGARSAAXIFVYLGEESDLDKDINSIGFLVENGARFGALLVYIEHRYYGKSNPFG  148

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
             +M++++ N   RGYFNS QALAD+AEV++ LK    A  SP+IV GGS GG+LA+WFRLK
Sbjct  149   SMQKSLQNAGQRGYFNSGQALADFAEVIINLKKNLSADSSPVIVVGGSDGGLLAAWFRLK  208

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHVALGALASSAPILYFD+ITP++GYYSLVTKDF++ SE+CY TI+ SW+ IDK A++ 
Sbjct  209   YPHVALGALASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEIDKAAAEA  268

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
             NGL  LSKKF+ CK L+S  +LKDYL++ Y  AAQYD+PP YPVT VC GIDG  +G DI
Sbjct  269   NGLLNLSKKFRTCKPLESASQLKDYLETMYSIAAQYDRPPMYPVTIVCNGIDGGLQGTDI  328

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             L RI +G+V   GN++CYD    + P SET  GW WQ CSE+ +PIGRG  DTMF  APF
Sbjct  329   LGRIFSGIVASRGNKSCYDMGQSSFP-SETEEGWNWQVCSELVIPIGRGSNDTMFPAAPF  387

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
               +++   C   YGV PRPHWIT+YYGGH+IKL+L +FGSNIIFSNGLRDPYSS GVLED
Sbjct  388   DFKEYDDSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGVLED  447

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             IS +++AV+T  GSHCLDI  + + DP+WL  QR  E+EI+  W+ KYY +L
Sbjct  448   ISHSIIAVHTPRGSHCLDILPSREDDPNWLVLQRNVEIEILHGWLLKYYEDL  499



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/474 (59%), Positives = 354/474 (75%), Gaps = 8/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP+L       L  P  +    +  +F T++Y+QTLDHFNY P+SY  F QRY+V+SKYW
Sbjct  35    IPKLGMSRPEFLLDPARAVQASVAEDFVTFFYNQTLDHFNYGPESYTAFNQRYVVNSKYW  94

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S +PIFA+ GAE+PID D   +GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+++
Sbjct  95    GGADSGAPIFAFFGAEAPIDGDIANVGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLKK  154

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ +   RGYF+SAQALADYAE+LL+LK K  A+HSPIIV GGSYGGMLASWFRLKYPHV
Sbjct  155   ALGDPNIRGYFSSAQALADYAEILLHLKQKLKAEHSPIIVLGGSYGGMLASWFRLKYPHV  214

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+I P++ YYS+V K F E S +C++TIR+SW  IDK+AS+P GL+
Sbjct  215   ALGALASSAPILYFDDIIPQDAYYSVVAKSFLESSSSCHETIRRSWEEIDKVASEPRGLT  274

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS  FK C  L+S  ELK YL   Y    QY+ P   P+  +C  ++G P    +L +I
Sbjct  275   KLSNTFKTCSPLQSSSELKKYLRFLYAQVVQYNDPSTQPLKLMCDAVNGVPPRKGLLQKI  334

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT---SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              AG+V + GN TCY   +  PP+   ++T++GW WQTC+EM +P+G   R+TMF P PF+
Sbjct  335   FAGLVAINGNLTCY---VNAPPSGTFAQTLLGWSWQTCTEMVIPMGI-TRNTMFPPKPFN  390

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             +  FS  C   +GVPPRPHW+TTY+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++I
Sbjct  391   LNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNI  450

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             S TV+A+YT  GSH LDI GA K+DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  451   SSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYYADLRAF  504



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/474 (59%), Positives = 354/474 (75%), Gaps = 8/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP+L       L  P  +    +  +F T++Y+QTLDHFNY P+SY  F QRY+V+SKYW
Sbjct  29    IPKLGMSRPEFLLDPARAVQASVAEDFVTFFYNQTLDHFNYGPESYTAFNQRYVVNSKYW  88

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S +PIFA+ GAE+PID D   +GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+++
Sbjct  89    GGADSGAPIFAFFGAEAPIDGDIANVGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLKK  148

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ +   RGYF+SAQALADYAE+LL+LK K  A+HSPIIV GGSYGGMLASWFRLKYPHV
Sbjct  149   ALGDPNIRGYFSSAQALADYAEILLHLKQKLKAEHSPIIVLGGSYGGMLASWFRLKYPHV  208

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+I P++ YYS+V K F E S +C++TIR+SW  IDK+AS+P GL+
Sbjct  209   ALGALASSAPILYFDDIIPQDAYYSVVAKSFLESSSSCHETIRRSWEEIDKVASEPRGLT  268

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS  FK C  L+S  ELK YL   Y    QY+ P   P+  +C  ++G P    +L +I
Sbjct  269   KLSNTFKTCSPLQSSSELKKYLRFLYAQVVQYNDPSTQPLKLMCDAVNGVPPRKGLLQKI  328

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT---SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              AG+V + GN TCY   +  PP+   ++T++GW WQTC+EM +P+G   R+TMF P PF+
Sbjct  329   FAGLVAINGNLTCY---VNAPPSGTFAQTLLGWSWQTCTEMVIPMGI-TRNTMFPPKPFN  384

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             +  FS  C   +GVPPRPHW+TTY+GGHDIKL+LH+F SNIIFSNGL+DPYSS GVL++I
Sbjct  385   LNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNI  444

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             S TV+A+YT  GSH LDI GA K+DPDWL EQRK EV+I++ W+ KYY +L A 
Sbjct  445   SSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYYADLRAF  498



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/414 (66%), Positives = 330/414 (80%), Gaps = 1/414 (0%)
 Frame = +3

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYW G  +++PIF + GAE  IDDD   IGFL DNA  FKALL+YIEHRYYGKSIPFG+ 
Sbjct  4     KYWSGPNTSAPIFVFFGAEENIDDDVSGIGFLPDNASHFKALLLYIEHRYYGKSIPFGSS  63

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             +EA+ N ++ GYFNSAQALADYA V++++K KY A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  64    KEALRNASSLGYFNSAQALADYASVIMHVKKKYSAKSSPVIVIGGSYGGMLASWFRLKYP  123

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPILYFD I P NGYYS+VTKDFKE SE+CY+TI KSW+ I+K ASKPNG
Sbjct  124   HVALGALASSAPILYFDEIAPRNGYYSVVTKDFKEASESCYKTISKSWAEIEKAASKPNG  183

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKF  C  LK   ELKDYLDS Y  AAQY+ PP YPV+ VC GID AP+G DIL 
Sbjct  184   LSILSKKFNTCSPLKRTFELKDYLDSIYAEAAQYNDPPNYPVSIVCDGIDRAPEGTDILG  243

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             RI AGVV   G+++CYD   +N PT +T + WRWQTCSE+ MPIG  DR+TMF PAPF++
Sbjct  244   RIFAGVVAYMGHKSCYDMNEFNDPTDQTSLAWRWQTCSELVMPIGH-DRNTMFPPAPFNL  302

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + + ++C   +G+ P+PHW+TTYYGG D+KL+LH+F SNIIFSNGLRDPYS+ GVLE+IS
Sbjct  303   KSYIKECKSLFGILPQPHWVTTYYGGQDLKLILHRFASNIIFSNGLRDPYSTGGVLENIS  362

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             D+++A+ T NGSHCLDI     +DP+WL  QRK EVEIIQ WI+KYY +L  LK
Sbjct  363   DSIVAISTVNGSHCLDIQKEKPSDPNWLVMQRKTEVEIIQGWISKYYTDLLELK  416



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/442 (61%), Positives = 342/442 (77%), Gaps = 2/442 (0%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +++ YY++QTLDHFNYRP+SY TF+QRY++++KYWGGA +++PIF +LG E+ +D     
Sbjct  26    DYKVYYHNQTLDHFNYRPESYTTFRQRYVMNAKYWGGANTSAPIFVYLGDEAALDFQIGS  85

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GFL+DNAP+FKALLVYIEHRYYGKSIPF + EEA +N +T GYF+S+QA+ADYAE++L+
Sbjct  86    AGFLSDNAPKFKALLVYIEHRYYGKSIPFSSREEAFSNASTLGYFSSSQAIADYAEIILH  145

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K    A+ SP+IV GGSYGGMLA+WFRLKYPH+ALGALASSAPILYFD+ITP++GYYS+
Sbjct  146   IKKNLSAEKSPVIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFDDITPQDGYYSV  205

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             V+KDF+E SENCY T+++SWS ID++AS+PNGLSILSK+F  C  + S  +LKDYLDS Y
Sbjct  206   VSKDFREKSENCYNTLKQSWSEIDRVASQPNGLSILSKQFMTCSPITSASQLKDYLDSNY  265

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
             C AAQY  P    V+ +C  IDG     DIL +I  G+V   GN TCYD   +N P SET
Sbjct  266   CEAAQYASPSGDGVSRICNAIDGTSNHTDILGKIFKGLVSFNGNWTCYDVNAFNNP-SET  324

Query  1098  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1277
               GW WQTCSEM MPI  G+ DTMF    F +  F +DC + YGV PRPHWIT  +GG D
Sbjct  325   DEGWSWQTCSEMVMPIAHGN-DTMFQAESFDLDAFVQDCKNAYGVSPRPHWITAEFGGDD  383

Query  1278  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1457
             IKL+L +FGSNIIFSNGL+DPYSS GVL+ IS ++ A+YT  GSHCLDI  +   DP WL
Sbjct  384   IKLILERFGSNIIFSNGLKDPYSSGGVLKSISKSLPAIYTTEGSHCLDILPSLPNDPKWL  443

Query  1458  TEQRKKEVEIIQSWITKYYVEL  1523
              +QR++EVEII +W  +YY +L
Sbjct  444   IKQRRREVEIISNWFRQYYTDL  465



>ref|XP_010493394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010493396.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/458 (59%), Positives = 345/458 (75%), Gaps = 4/458 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+ S+  +   + + +Y++QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG
Sbjct  42    PDGSTQKVDASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES +D D   +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQ
Sbjct  102   EESSLDSDLSAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYATILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L   
Sbjct  222   DTRPKFGYYYIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTC  1058
               +KD+L++ Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTC
Sbjct  282   SNIKDFLNTIYAESVQYNRGPSYWVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTC  341

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YDP ++  PT+  ++ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPP
Sbjct  342   YDPNMFAQPTNN-VIAWRWQSCSEIVMPVGYDKQDTMFPTAPFNMTSYIEGCESNYGVPP  400

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             R HWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDTV+A+ T NGSHC 
Sbjct  401   RQHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVGGILEDISDTVVAI-TTNGSHCQ  459

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             DI   SK DP+WL  QR+KE++II SWI+ Y  +L  L
Sbjct  460   DITLKSKEDPEWLVRQREKEIKIIDSWISTYQKDLRDL  497



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 323/387 (83%), Gaps = 3/387 (1%)
 Frame = +3

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             +GFLTDNA RFKALLVYIEHRY GKSIPFG+ EEA+ N + RGYFNSAQA+ADYAEVL+Y
Sbjct  22    LGFLTDNAHRFKALLVYIEHRYCGKSIPFGSREEALKNASIRGYFNSAQAIADYAEVLIY  81

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K K LA++SP+IV GGSYGGMLASWFRLKYPHVALG LASSAPILYF++ITP+NGYYS+
Sbjct  82    IKKKLLAENSPVIVVGGSYGGMLASWFRLKYPHVALGVLASSAPILYFEDITPQNGYYSI  141

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTKDF+E SE+CY+TIR+SWS ID++AS+PNG+SILSKKF+ C  L +  ELKDYLD+ Y
Sbjct  142   VTKDFREASESCYKTIRESWSEIDRVASEPNGISILSKKFRTCDRLNNSDELKDYLDTIY  201

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSET  1097
             CTAAQY+ PP YPVT  C GIDGAP+G+DIL RI AGVV   GN +CY    +NP  +ET
Sbjct  202   CTAAQYNDPPMYPVTMACSGIDGAPEGSDILSRIFAGVVAYGGNSSCYTTS-HNP--TET  258

Query  1098  IVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHD  1277
               GW WQTCSEM MPIGRGD DTMF PAPF++  F ++C   YGV PRPHW+TTYYGGH+
Sbjct  259   SEGWAWQTCSEMVMPIGRGDNDTMFPPAPFNLTTFIQECTSIYGVSPRPHWVTTYYGGHN  318

Query  1278  IKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWL  1457
             I+L+L +F SNIIFSNGLRDPYSS GVL++ISD+VLA+ T NGSHCLDI  A+ TDP+WL
Sbjct  319   IELILRRFASNIIFSNGLRDPYSSGGVLKNISDSVLAILTVNGSHCLDILPATSTDPEWL  378

Query  1458  TEQRKKEVEIIQSWITKYYVELEALKR  1538
               QRK EVE+I+SWI +YY +L A+ +
Sbjct  379   VMQRKAEVEVIESWIAQYYADLHAITK  405



>ref|XP_010034183.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 367/476 (77%), Gaps = 14/476 (3%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             H IP+L+   ++ ++ R ++  + IL  +F+T++Y+QTLDHF+YRP+SYATFKQRY+++ 
Sbjct  34    HRIPKLSVRRQTFIQDRKQAVRASILSEDFQTFFYNQTLDHFDYRPESYATFKQRYVINF  93

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-T  470
              +WGGA +++PIFA+LGAE+ IDD    +GFL DNA +F+AL VYIEHR+YG+SIP+G T
Sbjct  94    NHWGGANASAPIFAYLGAEAAIDDHG--VGFLIDNAAQFRALSVYIEHRFYGESIPYGLT  151

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
             +++A+++   RGYF+SAQALADYAE+L+YLK+K  A+ SPIIV GGSYGGMLASWFRLKY
Sbjct  152   LDKALSDPNVRGYFSSAQALADYAEILVYLKHKLNAKDSPIIVIGGSYGGMLASWFRLKY  211

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PHVALGALASSAPILYF ++TP+  +YS+V KDF E S +C++TIR SW  ID++AS+P+
Sbjct  212   PHVALGALASSAPILYFLDVTPQGAFYSVVAKDFLETSFSCHETIRLSWEEIDRVASEPH  271

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL+ LS  FK C+ L+S  +LKD+L   Y  AAQY+ P   PV E+C  IDGA    DIL
Sbjct  272   GLTKLSNTFKTCRPLQSSSQLKDHLIYAYEGAAQYNDP---PVKEICNAIDGASPRNDIL  328

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              +I AG+V  +GN  CY     NP  S+T +GW WQTCSEM MPIG  + +TMF P PF 
Sbjct  329   GKIFAGLVASDGNLPCY----VNP--SQTDLGWSWQTCSEMVMPIGITE-NTMFQPEPFD  381

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             +  ++ DC   YG+ PRPHWITTYYGGHDIKLVLH+F SNIIFSNGL+DPYSS GVL++I
Sbjct  382   LNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNIIFSNGLQDPYSSGGVLKNI  441

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SDTV+AVYT  GSHCLDI  A+K DPDWL +QRK E+EIIQ WI  Y+ +L  L +
Sbjct  442   SDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQKWIATYHADLRTLGK  497



>ref|XP_011004990.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/472 (63%), Positives = 364/472 (77%), Gaps = 8/472 (2%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +  T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  62    HTIPRLSPIGPRVWLDHPDQILGESVREDLETFFYNQTLDHFNYRPESYDTFLQRYLINS  121

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  122   KYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIPFGSR  181

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  182   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  241

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++ASKP+G
Sbjct  242   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVASKPDG  301

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  302   LSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGDDLLG  361

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET  GWRWQTCSEM +PIG G+ D+MF P PF
Sbjct  362   RVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFPPDPF  416

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  417   DLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGGVLEN  476

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  477   ISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  528



>ref|XP_011005221.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Populus 
euphratica]
Length=531

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/472 (63%), Positives = 364/472 (77%), Gaps = 8/472 (2%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +  T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  62    HTIPRLSPIGPRVWLDHPDQILGESVREDLETFFYNQTLDHFNYRPESYDTFLQRYLINS  121

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  122   KYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIPFGSR  181

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  182   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  241

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++ASKP+G
Sbjct  242   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVASKPDG  301

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    EL+++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  302   LSILSKKFKTCNPLTDASELRNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGDDLLG  361

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET  GWRWQTCSEM +PIG G+ D+MF P PF
Sbjct  362   RVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQTCSEMVIPIGYGN-DSMFPPDPF  416

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  417   DLKAYIEDCKSLYNVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGGVLEN  476

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  477   ISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  528



>ref|XP_006485332.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=511

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/476 (59%), Positives = 356/476 (75%), Gaps = 6/476 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRR--PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IP+L      N+ +   E+ +S     + +T YY QTLDHFNY P+SY TF QRY+++ K
Sbjct  32    IPKLGVLRGINIFQNPSENLTSSEPKSDLKTLYYDQTLDHFNYNPESYLTFPQRYVLNFK  91

Query  297   YWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             +WGG    +  PI A+LG ES +DDD + I +L+DNA RFKAL VYIEHR+YGKS+PF +
Sbjct  92    HWGGGGGAAAAPILAYLGEESSLDDDLRGIEWLSDNAHRFKALQVYIEHRFYGKSVPFVS  151

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGMLA+WFRLKY
Sbjct  152   SEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGMLAAWFRLKY  211

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALG +ASSAPILYFD ITP + YYS VTKDF+E SE+CY TI++SW+ IDK  +K N
Sbjct  212   PHIALGEVASSAPILYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAAIDKTGAKRN  271

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GIDGA +G D +
Sbjct  272   GLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGASQGTDTV  331

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI +G+V   G ++CY+  I    + ET+ GW W+TCSE+ MPIG G   +MF   PF+
Sbjct  332   ARIFSGIVASWGKKSCYN--IGEFFSDETLNGWGWKTCSEIVMPIGIGKNKSMFPAEPFN  389

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++++   C   YGV PR HWITTYYGG DI++VL +FGSNIIFS+GL DPYS+AGVLEDI
Sbjct  390   LKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHDPYSTAGVLEDI  449

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SD++LAV T+NGSHCLDI  A K DPDWLT QR+ EV I+ +WI KYY +L  + +
Sbjct  450   SDSILAVPTKNGSHCLDILPAKKDDPDWLTMQRQVEVNIVHAWILKYYADLLQISK  505



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/470 (60%), Positives = 352/470 (75%), Gaps = 2/470 (0%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             +PRL    R+   R   ++      +F+ +YY QTLDHFNYRP+SY TF+Q+Y+VS KYW
Sbjct  31    VPRLGVVGRTTRVRNLGTTKTSSTWDFKKFYYTQTLDHFNYRPESYRTFQQKYVVSFKYW  90

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA +++PIFA+LG E+P+ D     G + DNAPRF AL+++IEHR+YG+SIPF + +EA
Sbjct  91    GGANASAPIFAYLGYEAPLYDQSPATGLILDNAPRFHALVIHIEHRFYGESIPFESRDEA  150

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GYFNSAQALADYAE++L LK    A+ SP+I  GGSYGGMLA+WFRLKYPHV 
Sbjct  151   LRNSSTLGYFNSAQALADYAEIILDLKKNLSAETSPVIAVGGSYGGMLAAWFRLKYPHVT  210

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPILYFD+ITPENGYYS+V+K F+E SE+CY+TI++SWS ID++AS+ NGLS+
Sbjct  211   VGALASSAPILYFDDITPENGYYSIVSKGFRESSESCYKTIKQSWSEIDELASQSNGLSL  270

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIH  1022
             LS+KF+ C  L    ELK YL+  Y  AAQY+ PP+YPV  +C  IDGA +G DIL RI 
Sbjct  271   LSQKFQTCSALNKSSELKGYLEYVYTDAAQYNAPPEYPVDRICSAIDGASEGTDILSRIF  330

Query  1023  AGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP-FSMQQ  1199
             AGVV    N +CYD   YN PT ET VGW WQTCSEM  PI  G   T  FPA  F ++ 
Sbjct  331   AGVVASRVNSSCYDTNEYNYPT-ETFVGWDWQTCSEMVFPIDHGRDPTSMFPASTFVLRD  389

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             +  DC+  YGVPPRPHWITT +GGHDIKLVL +F SNIIFSNGLRDPYS  GVL++ISD+
Sbjct  390   YIEDCNRSYGVPPRPHWITTEFGGHDIKLVLKRFASNIIFSNGLRDPYSIGGVLQNISDS  449

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             V+A+ T NGSHCLDI   S  DP WL+ QR+ E+EII+ WI KYY +L A
Sbjct  450   VVALATVNGSHCLDILSESPNDPKWLSMQRQSEIEIIEGWIEKYYADLAA  499



>ref|XP_006408695.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
 gb|ESQ50148.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
Length=502

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/476 (57%), Positives = 343/476 (72%), Gaps = 3/476 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
              P  IP+L           ++ +  +   +   +Y++Q LDHF + P+SY TF+QRY++ 
Sbjct  24    APSKIPQLGMSSTKLKNTHDALTQKVDKSDLEIFYFNQDLDHFTFTPKSYMTFQQRYVID  83

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             S++W GA+ N+PI A+LG ES +D D   IGFL DN PR KALLVYIEHRYYGKS+PFG+
Sbjct  84    SQHWAGAKVNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKSMPFGS  143

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ N +T GY NSAQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKY
Sbjct  144   AEEALKNASTLGYLNSAQALADYAAILLHIKEKYSTKHSPIIVIGGSYGGMLAAWFRLKY  203

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAP+LYF++  P+ GYY +VTK  KE SE CY TI KSW  ID++A+KPN
Sbjct  204   PHIALGALASSAPLLYFEDTRPKFGYYYIVTKVIKETSEKCYNTICKSWKEIDRVAAKPN  263

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGAD  1004
             GL ILS+KFK C  L    ++KD+L + Y  A QY++ P Y VT VC  ID  P     D
Sbjct  264   GLLILSQKFKTCGPLNGSSDIKDFLGTIYAEAVQYNRGPSYWVTSVCHAIDANPPTHKND  323

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             +L+R+ AG V L GNRTCYD  +++ PT+ +I  WRWQ+CSE+ MPIG   +DTMF  AP
Sbjct  324   LLNRVFAGAVALIGNRTCYDTNMFSQPTNNSI-AWRWQSCSEIVMPIGYDKQDTMFQLAP  382

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             F+M  F   C  YYGVPPRPHWI TY+G  DIKL+L +FGSNIIFSNGL DPYS  GVLE
Sbjct  383   FNMTSFIEGCKSYYGVPPRPHWIMTYFGTQDIKLILKRFGSNIIFSNGLSDPYSVGGVLE  442

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             DISD+++A+ T+NGSHC DI    K DP+WL  QR+KE +II+SWI+ Y  +L  L
Sbjct  443   DISDSIVAIKTKNGSHCQDISLKRKGDPEWLVMQREKEFKIIESWISMYQKDLRDL  498



>gb|KCW50732.1| hypothetical protein EUGRSUZ_J00405 [Eucalyptus grandis]
Length=476

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/448 (62%), Positives = 351/448 (78%), Gaps = 13/448 (3%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F+T++Y+QTLDHF+YRP+SYATFKQRY+++  +WGGA +++PIFA+LGAE+ IDD    
Sbjct  41    DFQTFFYNQTLDHFDYRPESYATFKQRYVINFNHWGGANASAPIFAYLGAEAAIDDHG--  98

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLL  554
             +GFL DNA +F+AL VYIEHR+YG+SIP+G T+++A+++   RGYF+SAQALADYAE+L+
Sbjct  99    VGFLIDNAAQFRALSVYIEHRFYGESIPYGLTLDKALSDPNVRGYFSSAQALADYAEILV  158

Query  555   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  734
             YLK+K  A+ SPIIV GGSYGGMLASWFRLKYPHVALGALASSAPILYF ++TP+  +YS
Sbjct  159   YLKHKLNAKDSPIIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFLDVTPQGAFYS  218

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             +V KDF E S +C++TIR SW  ID++AS+P+GL+ LS  FK C+ L+S  +LKD+L   
Sbjct  219   VVAKDFLETSFSCHETIRLSWEEIDRVASEPHGLTKLSNTFKTCRPLQSSSQLKDHLIYA  278

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y  AAQY+ P   PV E+C  IDGA    DIL +I AG+V  +GN  CY     NP  S+
Sbjct  279   YEGAAQYNDP---PVKEICNAIDGASPRNDILGKIFAGLVASDGNLPCY----VNP--SQ  329

Query  1095  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             T +GW WQTCSEM MPIG  + +TMF P PF +  ++ DC   YG+ PRPHWITTYYGGH
Sbjct  330   TDLGWSWQTCSEMVMPIGITE-NTMFQPEPFDLNSYNNDCKRSYGITPRPHWITTYYGGH  388

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDW  1454
             DIKLVLH+F SNIIFSNGL+DPYSS GVL++ISDTV+AVYT  GSHCLDI  A+K DPDW
Sbjct  389   DIKLVLHRFASNIIFSNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKADPDW  448

Query  1455  LTEQRKKEVEIIQSWITKYYVELEALKR  1538
             L +QRK E+EIIQ WI  Y+ +L  L +
Sbjct  449   LVKQRKIEIEIIQKWIATYHADLRTLGK  476



>ref|XP_009126572.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=502

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/472 (57%), Positives = 341/472 (72%), Gaps = 3/472 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL    +     P+S +  +  P+ + +Y++Q LDHF + P+SY TF+QRY + SK+W
Sbjct  28    IPRLGISPKMLKNEPDSPTQKLNDPDLKMFYFNQNLDHFTFTPKSYMTFQQRYAIDSKHW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
              GA+ N+PI A+LG ES +D D   IGFL DN PR KALLVYIEHRYYGK++PFG+ EEA
Sbjct  88    AGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKTMPFGSAEEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  148   LKNASTLGYLNAAQALADYASILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIA  207

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY +VTK  K  SE CY  IRKSW  ID++A+KPNGL I
Sbjct  208   LGALASSAPLLYFEDTRPKFGYYYIVTKVIKGTSERCYNMIRKSWKEIDRVAAKPNGLLI  267

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD--ILDR  1016
             LSK+FK C  L +  ++KD+L + Y  A QY++ P Y VT VC  ID  P  +   +LDR
Sbjct  268   LSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNNPPNSKKGLLDR  327

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AG V L GN++CYD  ++  PT+     WRWQTCSE+ MP+G   +DTMF   PF+M 
Sbjct  328   IFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQTCSEIVMPVGYDKQDTMFPTTPFNMT  386

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              +   C   YGV PRPHWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  GVLEDISD
Sbjct  387   SYIERCKADYGVTPRPHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVGGVLEDISD  446

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             +V+A+ + NGSHC DI    K DP+WL  QR KE++II+SWI+ Y  +L+AL
Sbjct  447   SVVAIKSNNGSHCQDIVMKMKGDPEWLVMQRDKEIKIIESWISTYQKDLKAL  498



>ref|XP_004295648.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/463 (60%), Positives = 343/463 (74%), Gaps = 18/463 (4%)
 Frame = +3

Query  192   PPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDP  371
             P E+ T+YY+QTLDHFN+RP S++TF+Q+Y+++SKYWGG+  ++PIFA+LGAE  +D   
Sbjct  15    PSEYETFYYNQTLDHFNFRPDSFSTFQQKYVINSKYWGGSNISAPIFAYLGAEVSLDSVI  74

Query  372   KYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVL  551
              Y GFL +NA +F+ALL+YI+HRYYG+SIPFG+  EA  N +T GYFNSAQALADYAE+L
Sbjct  75    SYTGFLPENANQFQALLIYIQHRYYGESIPFGSRTEAFQNASTLGYFNSAQALADYAEIL  134

Query  552   LYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGY  728
             +++K +  A+HSP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILYFD+I  PENGY
Sbjct  135   VHVKTQLNAEHSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFDDIIPPENGY  194

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
              S+VTKDF+E SE CYQTI++SWS ID IAS P+GLS LSK F+ C  L++   LK  L 
Sbjct  195   LSIVTKDFREASETCYQTIKQSWSEIDTIASMPDGLSNLSKIFRTCSPLRTAHHLKYSLQ  254

Query  909   STYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIHAGVVGLEGNRTCY--------  1061
               Y  AAQ+D P   PV  +C GIDGA     D L +I AG+V +EGNR+CY        
Sbjct  255   LMYTRAAQFDDPSTNPVNVICSGIDGAASLTNDTLAKIFAGLVAIEGNRSCYLSIAPSSS  314

Query  1062  ----DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYG  1229
                  P   N  TSE   GW WQ CSEM MP+     +TMF P  F +Q +  +C   YG
Sbjct  315   STNALPSNANDETSE---GWSWQACSEMVMPVFAVGNNTMFQPYSFDVQSYINNCKAQYG  371

Query  1230  VPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGS  1409
             VP RP+WITTYYGGHDIKL L++F SNIIFSNGLRDPYSS  VL++ISD+++AVYT+NGS
Sbjct  372   VPSRPNWITTYYGGHDIKLTLYRFASNIIFSNGLRDPYSSGRVLQNISDSLVAVYTKNGS  431

Query  1410  HCLDIYGAS-KTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             HCLD+  ++  TDPDWL  QRK EVEII+ W+T YY  L+  K
Sbjct  432   HCLDLVPSNPSTDPDWLINQRKIEVEIIKGWMTTYYAALQTFK  474



>gb|KCW84338.1| hypothetical protein EUGRSUZ_B01187, partial [Eucalyptus grandis]
Length=478

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/453 (60%), Positives = 346/453 (76%), Gaps = 3/453 (1%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PRL+    + L+ P+      +  +F T+Y++QTLDHFNY+P+SY TF+QRY+++S+YWG
Sbjct  27    PRLSLHRENVLQDPQRRVPVSVTNDFTTFYFNQTLDHFNYQPKSYTTFRQRYLINSRYWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAE+PI++D   IGFLT+NA +FKA LVYIEHRYYG+SIPFG ++EEA
Sbjct  87    GANSSAPIFIYLGAEAPIENDLNGIGFLTENAAQFKAFLVYIEHRYYGRSIPFGMSLEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             +N+   RGYF+S+QALADYA ++ ++K K  A+  P+IV GGSYGGMLASWFRLKYPH+A
Sbjct  147   LNDPIARGYFSSSQALADYAAIIRHVKEKLKARDCPVIVVGGSYGGMLASWFRLKYPHLA  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
              GALASSAPILYFD ITP++ Y+S+VTKDFKE S+ CYQTIR SW+ ID++ SKP+GLS 
Sbjct  207   FGALASSAPILYFDGITPQDAYFSVVTKDFKEASKTCYQTIRDSWAEIDRVISKPSGLSR  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGA-PKGADILDRI  1019
             LSK FK C+ LKS  ELK+YL   Y  AAQYD PP+YPV  VC GIDGA   G  IL +I
Sbjct  267   LSKIFKTCRPLKSGDELKNYLILRYAAAAQYDDPPRYPVEIVCRGIDGANASGKGILKKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AGVV L+ N TCY         ++T +G+ WQ CSEM M IG  + + MF   PF++  
Sbjct  327   FAGVVALDRNSTCYIVPPNGTTPTQTELGYSWQRCSEMVMGIGITN-NAMFQAYPFNLTD  385

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             F   C+  YGV PRPHWITTYYGGHDI+ VLH+FGSNIIFSNGLRDPYSS G+L++ISDT
Sbjct  386   FINGCNSSYGVVPRPHWITTYYGGHDIERVLHRFGSNIIFSNGLRDPYSSGGILKNISDT  445

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKE  1478
             + AVYT+ GSHCLDI  + + DP+WL  QRK+E
Sbjct  446   IDAVYTQKGSHCLDILASEQADPNWLVRQRKRE  478



>ref|XP_009591854.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Nicotiana 
tomentosiformis]
Length=412

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/389 (69%), Positives = 318/389 (82%), Gaps = 7/389 (2%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLR--RPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             PH IPRLTP  ++ L+     S+SS  LP EF TY+Y QTLDHFNY P+SY+TFKQRYI+
Sbjct  29    PHKIPRLTPLLKNILKDFNTLSNSSTTLPKEFETYFYTQTLDHFNYGPKSYSTFKQRYII  88

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +SKYWGG+ S+SPIFA+LGAES ID+DP  IGFLTD APRFKALLVY+EHRYYG+SIPF 
Sbjct  89    NSKYWGGSNSSSPIFAYLGAESYIDNDPLSIGFLTDFAPRFKALLVYLEHRYYGQSIPFE  148

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              +EEA+ +E  RGYFNSAQA+ADYAE+LL++K ++ A +SPIIV GGSYGGMLASWFRLK
Sbjct  149   KIEEALKDEDRRGYFNSAQAIADYAELLLHVKEQFSAPNSPIIVIGGSYGGMLASWFRLK  208

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPH+ALGALASSAPILYFD+ITP+NGYYS+VTKDFKE SE+CYQTIR SWS+IDKIAS  
Sbjct  209   YPHIALGALASSAPILYFDDITPQNGYYSIVTKDFKEASESCYQTIRDSWSIIDKIASTK  268

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
             +GL+ LS+KFK C  L +  +LK YLDSTY  AAQYD PP+YPVT +CGGIDGA  G+D+
Sbjct  269   DGLAYLSQKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDPPRYPVTVICGGIDGATNGSDV  328

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             LDRI AG+V  EGN++C     YN    +T +GW WQTCSEM MPIGRG+ DTMF+ APF
Sbjct  329   LDRIFAGIVAYEGNKSC-----YNILPGQTDLGWDWQTCSEMVMPIGRGENDTMFYSAPF  383

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             S+ +F  DC   YGV PRPHW+TTYYGGH
Sbjct  384   SLDEFIEDCKSDYGVSPRPHWVTTYYGGH  412



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/474 (59%), Positives = 344/474 (73%), Gaps = 48/474 (10%)
 Frame = +3

Query  123   IPRLTP--FYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IP+L+P   + + L  PE+ ++D L  ++ T++Y+QTLDHFNYRP+SY+TF+QRY+V+SK
Sbjct  35    IPKLSPTGHHETFLHDPETPTADSLSEDYETFFYNQTLDHFNYRPESYSTFRQRYVVNSK  94

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGG  SN+PIFA+LGAE+P+D D   IGFLTDNA  FKAL +YIEHRYYGKSIP+G+ E
Sbjct  95    YWGG--SNAPIFAYLGAEAPLDGDLSVIGFLTDNALEFKALQIYIEHRYYGKSIPYGSRE  152

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EA+NN +T GYFNSAQA+ADYAE+LL++K K+ A+ SP+IV GGSYGGMLASWFRLKYPH
Sbjct  153   EALNNASTLGYFNSAQAIADYAEILLHVKQKFHAEKSPVIVIGGSYGGMLASWFRLKYPH  212

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             +ALGALASSAPILYFDNIT ++GYYS+VTKDF + S                        
Sbjct  213   IALGALASSAPILYFDNITSQDGYYSIVTKDFIKSS------------------------  248

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
                              ELKD+L+STY TAAQY+ PP+YPV  +CG IDGA     IL +
Sbjct  249   -----------------ELKDHLESTYATAAQYNHPPRYPVNVICGAIDGANNDDGILGK  291

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AG+     NRTCY  Q  N   SET VGW WQTCSEM +PIG  + +TMF  +PF +Q
Sbjct  292   IFAGLASYRTNRTCYVNQPRN--LSETDVGWNWQTCSEMVIPIGISN-NTMFPASPFELQ  348

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F  +C   Y VPPRPHW+TTYYGG DIKL+L +F SNIIFSNGLRDPYSS GVLE+IS 
Sbjct  349   DFINECKAAYDVPPRPHWVTTYYGGKDIKLILRRFASNIIFSNGLRDPYSSGGVLENISK  408

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +V+AV T  GSHCLDI  A +TDPDWL +QRK EV II+ WI +YY +LE L++
Sbjct  409   SVVAVTTTKGSHCLDILQAKETDPDWLVKQRKVEVNIIKRWIAQYYFDLEVLRK  462



>gb|AAM61502.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
Length=502

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/473 (58%), Positives = 349/473 (74%), Gaps = 3/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             I RL    ++    P+ S+  +   + + YY++QTLDHF + P+SY TF+QRY + S +W
Sbjct  28    IARLGISSKTLKNEPDGSTQKVDESDLKMYYFNQTLDHFTFTPESYMTFQQRYAIDSTHW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++PFG+ EEA
Sbjct  88    GGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETMPFGSAEEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  148   LKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWFRLKYPHIA  207

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A KPNGLSI
Sbjct  208   LGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWKEIDRVAGKPNGLSI  267

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDR  1016
             LSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  +  ++LDR
Sbjct  268   LSKQFKTCDPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPNRRYNLLDR  327

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF  APF+M 
Sbjct  328   IFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMFPTAPFNMT  386

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  GVLEDISD
Sbjct  387   SYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVGGVLEDISD  446

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             T++A+ T+NGSHCLDI   SK DP+WL  QR+KE+++I SWI+ Y  +L  L 
Sbjct  447   TLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTYQNDLRDLN  499



>ref|XP_010535638.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=507

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 344/457 (75%), Gaps = 10/457 (2%)
 Frame = +3

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
             S SD+   EF  + + Q LDHF Y P+SY  F+QRY V ++YWGGA++NSPI A+LG E+
Sbjct  55    SDSDV---EF--FIFDQDLDHFTYTPESYTKFRQRYAVDTRYWGGAEANSPILAYLGEET  109

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              +D D + IGFL +N P FKALLVY+EHRYYG+S+PFG+ +EA+ N T  GYFN+AQALA
Sbjct  110   SMDTDLRAIGFLRENGPHFKALLVYMEHRYYGESMPFGSAKEALKNATAMGYFNTAQALA  169

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYA +LL++K+KY A+HSPIIV GGSYGGMLA+WFRLKYPH+A+GALASSAP+LYF++  
Sbjct  170   DYAAILLHVKDKYAAKHSPIIVVGGSYGGMLAAWFRLKYPHIAIGALASSAPVLYFEDTV  229

Query  714   PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGEL  893
             P++GYY +VTK  K+ S  C++ IRKSW  ID++AS+PNGLS LS+KFK C  L    +L
Sbjct  230   PKHGYYYIVTKIIKKTSVRCHKRIRKSWDEIDRVASQPNGLSFLSEKFKTCAPLNGSFDL  289

Query  894   KDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG-APKG--ADILDRIHAGVVGLEGNRTCYD  1064
             KD+LDS Y  A QY++ P YPVT +C  ID  +P+G   D+L RI AGVV   GNR+CYD
Sbjct  290   KDFLDSVYAEAVQYNRHPNYPVTSICKAIDSESPRGKKKDLLGRIFAGVVAYIGNRSCYD  349

Query  1065  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1244
               +++ PT+  +  WRWQ+CSE+ MPIG   +DT++   P+++  +  +C   YGV PRP
Sbjct  350   TTMFSQPTNNNL-AWRWQSCSELVMPIGHDKQDTLYQTMPYNISNYISECKSMYGVSPRP  408

Query  1245  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1424
             HWI TYYGG D KL+L +FGSNIIFSNGL DPYS  GVLEDISDT++A+ T NGSHCLD+
Sbjct  409   HWINTYYGGQDFKLILRRFGSNIIFSNGLSDPYSVGGVLEDISDTIVAIKT-NGSHCLDL  467

Query  1425  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
                +K DP WL  QR+KEV+II SWI+ Y  +L+ LK
Sbjct  468   IFKTKDDPKWLVMQRQKEVKIIDSWISNYQKDLKDLK  504



>ref|NP_851059.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 dbj|BAB10607.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AED93088.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=502

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/473 (58%), Positives = 348/473 (74%), Gaps = 3/473 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             I RL    ++    P+ S+  +     + YY++QTLDHF + P+SY TF+QRY + S +W
Sbjct  28    IARLGISSKTLKNEPDGSTQKVDESNLKMYYFNQTLDHFTFTPESYMTFQQRYAIDSTHW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++PFG+ EEA
Sbjct  88    GGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETMPFGSAEEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  148   LKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWFRLKYPHIA  207

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A KPNGLSI
Sbjct  208   LGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWIEIDRVAGKPNGLSI  267

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDR  1016
             LSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  +  ++LDR
Sbjct  268   LSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPNRRYNLLDR  327

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF  APF+M 
Sbjct  328   IFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMFPTAPFNMT  386

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  GVLEDISD
Sbjct  387   SYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVGGVLEDISD  446

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             T++A+ T+NGSHCLDI   SK DP+WL  QR+KE+++I SWI+ Y  +L  L 
Sbjct  447   TLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTYQNDLRDLN  499



>ref|XP_010031431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 344/477 (72%), Gaps = 11/477 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP LT      LR PES+ S  +  +F T+++ QTLDHF+Y PQSYATFKQRY + S+YW
Sbjct  26    IPTLTLQLEDFLRDPESAVSASITDDFETFFFDQTLDHFSYTPQSYATFKQRYFIDSRYW  85

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S++PIF +LGAES +D  P  IGFL DNA +FKALLVYIEHRYYG+SIP G + EE
Sbjct  86    GGANSSAPIFVYLGAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGMSFEE  145

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N   RGYF+SAQALADY  V++++K +  A  SP+IV GGSYGGMLASW RLKYPHV
Sbjct  146   ALENADIRGYFSSAQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHV  205

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAP+LYF++ITP++ YYS+V KDFKE SE C+Q I  SWS ID++A + +GLS
Sbjct  206   ALGALASSAPVLYFEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLS  265

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-DILDR  1016
              LSK F  C+ L+S   LK +L   Y  AAQ+D PP YPV  +C GIDGA     DIL +
Sbjct  266   NLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGANTTENDILGK  325

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV    N TCY     NP    T  GW WQ CSEM MP+G  + ++MF  APF + 
Sbjct  326   ISAGVVAYYWNSTCY----VNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPRAPFVLD  380

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL++IS+
Sbjct  381   DFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISE  440

Query  1377  TVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A K
Sbjct  441   SIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADLRASK  497



>ref|XP_006287572.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
 gb|EOA20470.1| hypothetical protein CARUB_v10000782mg [Capsella rubella]
Length=502

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/460 (59%), Positives = 344/460 (75%), Gaps = 5/460 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+ S+  +     + +Y++QTLDHF +RP+SY TF+QRY ++S +WGGA++N+PI A+LG
Sbjct  40    PDGSTQKVDESGLQMFYFNQTLDHFTFRPESYMTFQQRYAINSTHWGGAKANAPILAFLG  99

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              E+ +D D   IGFL DN PR KALLVYIEHRYYGK++PFG+ EE + N +T GY N+AQ
Sbjct  100   EETSLDSDLSGIGFLRDNGPRLKALLVYIEHRYYGKTMPFGSAEETLKNASTLGYLNAAQ  159

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  160   ALADYAAILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  219

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY +VTK FKE SE CY TIRKSW  ID++A+KPNGL ILSKKFK C  L   
Sbjct  220   DTLPKFGYYYIVTKVFKETSERCYNTIRKSWKEIDRVAAKPNGLLILSKKFKTCAPLNGS  279

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP----KGADILDRIHAGVVGLEGNR  1052
              ++KD+LDS Y  + QY++ P Y VT+VC  I+          D+LD+I AGVV L GNR
Sbjct  280   FKIKDFLDSVYAESVQYNRGPSYWVTKVCNAINTNTYPPNSKHDLLDQIFAGVVALIGNR  339

Query  1053  TCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGV  1232
             TCYD  ++  PT+  I  WRWQ+CSE+ MP+G   +DTMF   PF+M  +   C+ YYGV
Sbjct  340   TCYDTNMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMFPTTPFNMTSYISGCESYYGV  398

Query  1233  PPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSH  1412
             PPR HWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  G+LEDISDT++A+ T+NGSH
Sbjct  399   PPRQHWITTYFGIQDVKLILQKFGSNIIFSNGLSDPYSVGGILEDISDTIVAITTKNGSH  458

Query  1413  CLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             C DI   SK DP+WL  QR+KE++I+ SWI+ Y  +L  L
Sbjct  459   CQDIGLKSKDDPEWLVMQREKEIKILDSWISTYQKDLRDL  498



>gb|KCW50722.1| hypothetical protein EUGRSUZ_J00400 [Eucalyptus grandis]
Length=535

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 344/477 (72%), Gaps = 11/477 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP LT      LR PES+ S  +  +F T+++ QTLDHF+Y PQSYATFKQRY + S+YW
Sbjct  64    IPTLTLQLEDFLRDPESAVSASITDDFETFFFDQTLDHFSYTPQSYATFKQRYFIDSRYW  123

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S++PIF +LGAES +D  P  IGFL DNA +FKALLVYIEHRYYG+SIP G + EE
Sbjct  124   GGANSSAPIFVYLGAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGMSFEE  183

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N   RGYF+SAQALADY  V++++K +  A  SP+IV GGSYGGMLASW RLKYPHV
Sbjct  184   ALENADIRGYFSSAQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHV  243

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAP+LYF++ITP++ YYS+V KDFKE SE C+Q I  SWS ID++A + +GLS
Sbjct  244   ALGALASSAPVLYFEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLS  303

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA-DILDR  1016
              LSK F  C+ L+S   LK +L   Y  AAQ+D PP YPV  +C GIDGA     DIL +
Sbjct  304   NLSKIFNTCRPLESGATLKSFLKGLYTKAAQHDNPPTYPVRLICKGIDGANTTENDILGK  363

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV    N TCY     NP    T  GW WQ CSEM MP+G  + ++MF  APF + 
Sbjct  364   ISAGVVAYYWNSTCY----VNPLLPVTPSGWSWQRCSEMVMPLGITN-NSMFPRAPFVLD  418

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL++IS+
Sbjct  419   DFMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISE  478

Query  1377  TVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A K
Sbjct  479   SIIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADLRASK  535



>ref|XP_006388621.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
 gb|ERP47535.1| hypothetical protein POPTR_0135s00200g [Populus trichocarpa]
Length=496

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/471 (62%), Positives = 366/471 (78%), Gaps = 5/471 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y+QTLDHFNYRP+SY  F QRY+++
Sbjct  26    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYNQTLDHFNYRPESYDKFPQRYLIN  85

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIPFG+
Sbjct  86    SKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIPFGS  145

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  146   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFRLKY  205

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  206   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  265

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G D L
Sbjct  266   GLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGDDTL  325

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGW+WQTCSEMA+PIG G+ ++MF P PF 
Sbjct  326   SRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQTCSEMAIPIGVGN-NSMFPPDPFD  382

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +  +C   YGVP RPHWITTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVLE+I
Sbjct  383   LEDYIENCKSLYGVPTRPHWITTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVLENI  442

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             SDTV+AV T NGSHCLDI  A + DP WL  QRK E++II+ WI KYY +L
Sbjct  443   SDTVVAVKTVNGSHCLDILFAEENDPAWLVTQRKIEIKIIKEWINKYYADL  493



>gb|KFK27606.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=499

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 338/447 (76%), Gaps = 3/447 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +   +Y++Q LDHF Y  +SY TF+QRY + SK+W G+++N+PI A+LG E+ +D D   
Sbjct  50    DLEMFYFNQNLDHFTYTAKSYTTFQQRYAIDSKHWAGSKANAPILAFLGEETSLDSDLST  109

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGFL DNA RFK+LLVYIEHRYYG ++PFG+  EA+ N +T GY N+AQALADYA +LL+
Sbjct  110   IGFLRDNALRFKSLLVYIEHRYYGMTMPFGSANEALKNASTLGYLNAAQALADYAAILLH  169

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K  Y A+HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P++GYY +
Sbjct  170   VKQNYSAKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTLPKHGYYYI  229

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTK FKE SE CYQTIRKSW  I+++A+KPNGL  L KKFK C  L     +KD+LDS Y
Sbjct  230   VTKVFKETSERCYQTIRKSWKEIERVAAKPNGLLTLGKKFKTCAPLNGSFNIKDFLDSIY  289

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1091
               A QY++ P Y VT VC GI+  P  +  D+LDRI AGVV L GNR+CYD  ++  PT+
Sbjct  290   AEAVQYNRGPSYWVTNVCNGINANPSNRKIDLLDRIFAGVVALVGNRSCYDTNMFAQPTN  349

Query  1092  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1271
               +  WRWQ+C+E+ MP+G   +DTMF  APF+M  F   C+ YYGVPPRPHW+TTY+G 
Sbjct  350   NNL-AWRWQSCTEIVMPVGYDKQDTMFPTAPFNMTSFIAGCESYYGVPPRPHWVTTYFGI  408

Query  1272  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1451
              D+KL+L +FGSNIIFSNGL+DPYS  GVLEDIS +V+A+ T NGSHC DI   SK DP+
Sbjct  409   QDVKLILRRFGSNIIFSNGLKDPYSVGGVLEDISGSVVAIKTENGSHCQDIVLKSKEDPE  468

Query  1452  WLTEQRKKEVEIIQSWITKYYVELEAL  1532
             WL  QR+KE++II+SWIT Y  +L  L
Sbjct  469   WLVMQREKEIDIIESWITSYKRDLRDL  495



>ref|XP_006369367.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65936.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=517

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/471 (62%), Positives = 367/471 (78%), Gaps = 5/471 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y+QTLDHFNYRP+SY  F QRY+++
Sbjct  47    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYNQTLDHFNYRPESYDKFPQRYLIN  106

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIPFG+
Sbjct  107   SKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIPFGS  166

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  167   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFRLKY  226

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  227   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  286

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G D L
Sbjct  287   GLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGDDTL  346

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P PF 
Sbjct  347   SRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPDPFD  403

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVLE+I
Sbjct  404   LKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVLENI  463

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             SDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYYV+L
Sbjct  464   SDTVVAVKTVNGSHCLDILFAKETDPEWLVTQRKIEIKIIKEWINKYYVDL  514



>ref|XP_011005420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005421.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
 ref|XP_011005422.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=496

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/471 (63%), Positives = 366/471 (78%), Gaps = 5/471 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y QTLDHFNYRP+SY TF QRY+++
Sbjct  26    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYEQTLDHFNYRPESYDTFLQRYLIN  85

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE+PID D   IGFL DNA +F +LLVYIEHRYYGKSIPFG+
Sbjct  86    SKYWGGANVSAPILVYLGAEAPIDGDLAAIGFLVDNAVQFNSLLVYIEHRYYGKSIPFGS  145

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K      +SP+IV GGSYGGMLASWFRLKY
Sbjct  146   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLTTLYSPVIVIGGSYGGMLASWFRLKY  205

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  206   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  265

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    +LKD+LD+ Y +AAQY++PP YP+ EVC GIDG   G DIL
Sbjct  266   GLSMLSKKFKTCNPLTDASKLKDHLDTMYASAAQYNRPPTYPINEVCKGIDGGGFGDDIL  325

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGWRWQTCSEMA+PIG G+ ++MF P PF 
Sbjct  326   SRIFGGLVAYNGNLSCYVNARTDP--SETAVGWRWQTCSEMAIPIGVGN-NSMFPPDPFD  382

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVLE+I
Sbjct  383   LEDYIEHCKSMYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVLENI  442

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             SDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  443   SDTVVAVKTANGSHCLDILFAEETDPEWLVTQRKIEIKIIKEWINKYYADL  493



>ref|XP_010527988.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Tarenaya hassleriana]
Length=493

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/472 (58%), Positives = 346/472 (73%), Gaps = 12/472 (3%)
 Frame = +3

Query  126   PRLTP-FYRSNLRRPES--SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             PR+ P   R N  +P++  S+SD+   EF  +++ Q LDHF Y P+SY TF+QRY +   
Sbjct  26    PRVYPDASRQNQLKPDNYGSASDV---EF--FFFDQNLDHFTYTPESYTTFRQRYAIDFS  80

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YWGGA++NSPI A+LGAESP+D D   +GFL DN   FKALLVYIEHRYYG+S+PFG+ +
Sbjct  81    YWGGAKTNSPILAYLGAESPMDSDLSVVGFLRDNGLHFKALLVYIEHRYYGESMPFGSAK  140

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             EA+ N TT GYFN+AQALADYAE+L+++K+KY  +HSPIIV GGSYGGMLA+WFRLKYPH
Sbjct  141   EALKNATTMGYFNTAQALADYAEILMHIKDKYATKHSPIIVIGGSYGGMLATWFRLKYPH  200

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VA+GALASSAP+LYF++  P+ GY+ +VT+  K+ S+ CY+TIRKSW  ID++A  PNGL
Sbjct  201   VAIGALASSAPLLYFEDTVPKYGYFYVVTQVIKKTSQTCYETIRKSWDDIDRVAWHPNGL  260

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG-APKGA-DIL  1010
             SILS+KFK C  L    +LKDYL+S Y    QY+  P Y V   C  ID  +PK   D+L
Sbjct  261   SILSEKFKTCAPLNRSSDLKDYLESMYSLVVQYNGLPYYSVDATCKAIDSESPKDTEDLL  320

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
             DRI AGVV   GN+ CYD  I +PPT+  +  W WQ CSE+ MPIG   +DT+F   PF+
Sbjct  321   DRIFAGVVAQFGNQVCYDISIGSPPTNSEL-AWMWQICSELVMPIGLDKQDTLFQTNPFN  379

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             M  ++  C+  YG+ PRPHWI+ YYGG D KL L +FGSNIIFSNGL DPYS  GVLEDI
Sbjct  380   MSDYTSKCESMYGISPRPHWISAYYGGEDFKLSLRRFGSNIIFSNGLSDPYSVGGVLEDI  439

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             SDT+LAV T NGSHC+D+   +K DP WL  QR+KEVEII SWI+ Y  +L+
Sbjct  440   SDTILAVKT-NGSHCMDLVFETKEDPKWLVLQRQKEVEIIDSWISIYQNDLK  490



>ref|XP_006436581.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
 gb|ESR49821.1| hypothetical protein CICLE_v10033696mg [Citrus clementina]
Length=506

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 351/476 (74%), Gaps = 11/476 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRR--PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IP+L      N+ +   E+ +S     + +T YY QTLDHFNY P+SY TF QRY+++ K
Sbjct  32    IPKLGVLRGINIFQNPSENLTSSEPKSDLKTLYYDQTLDHFNYNPESYLTFPQRYVLNFK  91

Query  297   YWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             +WGG    +  PI A+LG ES +DDD + I +L+DNA RFKAL VYIEHR+YGKS+PF +
Sbjct  92    HWGGGGGAAAAPILAYLGEESSLDDDLRGIEWLSDNAHRFKALQVYIEHRFYGKSVPFVS  151

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGMLA+WFRLKY
Sbjct  152   SEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGMLAAWFRLKY  211

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALG +ASSAPILYFD ITP + YYS VTKDF+E SE+CY TI++SW+ IDK  +K N
Sbjct  212   PHIALGEVASSAPILYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAAIDKTGAKRN  271

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GIDGA +G D +
Sbjct  272   GLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGASQGTDTV  331

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI +G+V   G ++CY+  I    + ET+ GW W+TCSE+ MPIG G   +MF   PF+
Sbjct  332   ARIFSGIVASWGKKSCYN--IGEFFSDETLNGWGWKTCSEIVMPIGIGKNKSMFPAEPFN  389

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++++   C   YGV PR HWITTYYGG DI++VL +FGSNIIFS+GL DPYS+AGVLEDI
Sbjct  390   LKEYMDSCKSSYGVVPRTHWITTYYGGLDIRVVLKRFGSNIIFSSGLHDPYSTAGVLEDI  449

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             SD++LAV T+N     DI  A K DPDWLT QR+ EV I+ +WI KYY +L  + +
Sbjct  450   SDSILAVPTKN-----DILPAKKDDPDWLTMQRQVEVNIVHAWILKYYADLLQISK  500



>ref|XP_006369363.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
 gb|ERP65932.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
Length=576

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/476 (61%), Positives = 343/476 (72%), Gaps = 14/476 (3%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++S     E F T +Y QTLDHFNYRP+SY TF QRY ++
Sbjct  94    NTIPRLSPIGPRVWRDQPDKTTSGEFDGEGFETCFYSQTLDHFNYRPESYDTFLQRYAIN  153

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYW GA  N+ I  +LGAE+ ID      GFL DNA +FK+LLV IEHRYYG+SIP G+
Sbjct  154   SKYWAGA--NASILVYLGAEASIDPYLDAGGFLVDNAVQFKSLLVVIEHRYYGQSIPPGS  211

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
               +       RGYFNSAQALADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  212   WGK-------RGYFNSAQALADYAAIIIHIKKTLRAQYSPVIVIGGSYGGMLASWFRLKY  264

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++ YYS+VTK F+E SE CYQTI+ SWS ID++ASKPN
Sbjct  265   PHIALGALASSAPILYFDDITPQDAYYSVVTKAFREASETCYQTIKTSWSEIDELASKPN  324

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LS K K C  L     LKDYL   Y  AAQY+ PP YPV EVC GID    G DIL
Sbjct  325   GLSMLSDKLKTCN-LTDASTLKDYLRIMYANAAQYNSPPTYPVNEVCKGIDDDASGDDIL  383

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  GVV   GNRTCY         SE  + W WQTCSEM M +G G+ ++MF P PF 
Sbjct  384   SRIFRGVVAYYGNRTCYFNNNAYAYQSEATLDWSWQTCSEMVMSLGVGN-NSMFEPDPFD  442

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
              + +   C   YGV PRPHW+TTYYGGHDIKL+L +FGSNIIFSNGLRDPYSS GVL +I
Sbjct  443   WKDYIDRCKSLYGVRPRPHWVTTYYGGHDIKLILQRFGSNIIFSNGLRDPYSSGGVLNNI  502

Query  1371  SDTVLAVYTRNGSHCLDIYGAS-KTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             SD+++AV T NGSHCLDI  A+  TDPDWL  QRKKEVEII+ WIT+YY +L   K
Sbjct  503   SDSIVAVTTVNGSHCLDIQRANPSTDPDWLVMQRKKEVEIIEGWITQYYEDLYEFK  558



>ref|XP_002874097.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50356.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=501

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/459 (59%), Positives = 341/459 (74%), Gaps = 4/459 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+ S+  I   + + YY++QTLDHF + P+SY TF+QRY ++S +WGGA++N+PI A+LG
Sbjct  42    PDGSTQKIDESDLKMYYFNQTLDHFTFTPKSYMTFQQRYAINSSHWGGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES +D D   IGFL DN P  KALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQ
Sbjct  102   EESSLDSDLSGIGFLRDNGPHLKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAAILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY +VTK FKE SE CY  IRKSW  ID++A KPNGLSILSK FK C  L   
Sbjct  222   DTRPKIGYYYIVTKVFKETSERCYTRIRKSWKEIDRVAVKPNGLSILSKTFKTCAPLNGS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG-APKGAD-ILDRIHAGVVGLEGNRTC  1058
               +KD+LD+ Y  A QY++ P Y V  VC  I+   P   D +LDRI AGVV L GNRTC
Sbjct  282   FNIKDFLDTIYAEAVQYNRGPTYWVANVCNAINANTPNRKDTLLDRIFAGVVALIGNRTC  341

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YD  +++ PT+  I  WRWQ+CSE+ +P+G   +DTMF  APF+M  +   C+ YYGVPP
Sbjct  342   YDTNMFSQPTNNHI-AWRWQSCSEIVIPVGYDKQDTMFPTAPFNMTSYIDGCESYYGVPP  400

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             RPHWITTY+G  D+KL+L +FGSNIIFSNGL DPYS  GVLEDISDTV+A+ T NGSHC 
Sbjct  401   RPHWITTYFGIQDVKLILRRFGSNIIFSNGLSDPYSVGGVLEDISDTVVAI-TTNGSHCQ  459

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             DI   +K DP WL  QR+KE+++I SWI+ Y  +L  L 
Sbjct  460   DISLKNKEDPQWLVMQREKEIKVIDSWISTYQNDLRDLN  498



>emb|CDY09173.1| BnaA02g05990D [Brassica napus]
Length=517

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/487 (55%), Positives = 341/487 (70%), Gaps = 18/487 (4%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL    +     P+S +  +  P+ + +Y++Q LDHF + P+SY TF+QRY + SK+W
Sbjct  28    IPRLGISPKMLKNEPDSPTQKLNDPDLKMFYFNQNLDHFTFTPKSYMTFQQRYAIDSKHW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
              GA+ N+PI A+LG ES +D D   IGFL DN PR KALLVYIEHRYYGK++PFG+ EEA
Sbjct  88    AGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKTMPFGSAEEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  148   LKNASTLGYLNAAQALADYASILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIA  207

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY +VTK  K  SE CY  IRKSW  ID++A+KPNGL I
Sbjct  208   LGALASSAPLLYFEDTRPKFGYYYIVTKVIKGTSERCYNMIRKSWKEIDRVAAKPNGLLI  267

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD--ILDR  1016
             LSK+FK C  L +  ++KD+L + Y  A QY++ P Y VT VC  ID  P  +   +LDR
Sbjct  268   LSKQFKTCAPLNASFDIKDFLSTIYAEAVQYNRGPSYSVTNVCNAIDNNPPNSKKGLLDR  327

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ--------------TCSEMAMPIGRG  1154
             I AG V L GN++CYD  ++  PT+     WRWQ              TCSE+ MP+G  
Sbjct  328   IFAGAVALLGNQSCYDTNMFAHPTNNN-KAWRWQARKFTLKTMLKPDRTCSEIVMPVGYD  386

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
              +DTMF   PF+M  +   C   YGV PRPHWITTY+G  D+KL+L KFGSNIIFSNGL 
Sbjct  387   KQDTMFPTTPFNMTSYIERCKADYGVTPRPHWITTYFGIQDVKLILRKFGSNIIFSNGLS  446

Query  1335  DPYSSAGVLEDISDTVLAVYTRN-GSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1511
             DPYS  GVLEDISD+V+A+ + N GSHC DI    K DP+WL  QR KE++II+SWI+ Y
Sbjct  447   DPYSVGGVLEDISDSVVAIKSNNAGSHCQDIVMKMKGDPEWLVMQRDKEIKIIESWISTY  506

Query  1512  YVELEAL  1532
               +L+AL
Sbjct  507   QKDLKAL  513



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/458 (57%), Positives = 335/458 (73%), Gaps = 5/458 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+  +  I   + + +Y++QTLDHF + P+SY TF+QRY + SK+W GA++N+PI A+LG
Sbjct  42    PDRPTQKIAESDLKLFYFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES ++ D    GFL DNAP FKAL VYIEH YYGK+IPFG+++EAM N +T GY N+AQ
Sbjct  102   LESSLETDFSAFGFLRDNAPHFKALCVYIEHTYYGKTIPFGSVKEAMKNASTLGYLNTAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAAILLHVKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY ++TK FKE ++ CY TIRKSW  IDK+A+KPNGL IL KKFK C  L   
Sbjct  222   DTRPKFGYYYIITKVFKETNKRCYNTIRKSWKQIDKVAAKPNGLLILGKKFKTCAPLNKS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTC  1058
              +LKD+LD+ Y  A QY++   + VT VC  I+  P  +  DILDRI AGVV L GN++C
Sbjct  282   FDLKDFLDTIYAEAVQYNE--GFLVTNVCSAINANPPNRKIDILDRIFAGVVALTGNQSC  339

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YD   Y+   +   + WRWQ CSE+ +P+G   +D MF  +PF+M  F   C+  YGV P
Sbjct  340   YDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDAMFPTSPFNMTSFIEGCESNYGVSP  398

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             RPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS  GVLED+SD+V+A+ T NGSHC 
Sbjct  399   RPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVGGVLEDLSDSVVAITTNNGSHCQ  458

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             DI   SK DP+WL  QR+KE++II  W+ KY  +L  L
Sbjct  459   DINLKSKGDPEWLVMQREKEIKIIDYWLLKYQKDLRDL  496



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/459 (57%), Positives = 336/459 (73%), Gaps = 5/459 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+  +  I   + + +Y++QTLDHF + P+SY TF+QRY + SK+W GA++N+PI A+LG
Sbjct  42    PDRPTQKIAESDLKFFYFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES ++ D    GFL DNAP FKAL VYIEHRYYGK+IPFG+++EAM N +T GY N+AQ
Sbjct  102   LESSLETDMSAFGFLRDNAPHFKALCVYIEHRYYGKTIPFGSVKEAMKNASTLGYLNTAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAAILLHIKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY ++TK FKE +  CY TIRKSW  IDK+A+KPNGL IL KKFK C  L   
Sbjct  222   DTRPKFGYYYIITKVFKETNMRCYNTIRKSWKEIDKVAAKPNGLLILGKKFKTCAPLNRS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTC  1058
              +LKD+LD+ Y  A QY++     V+ VC  I+  P  +  DILDRI AGVV L GN++C
Sbjct  282   FDLKDFLDTIYAEAVQYNE--GILVSNVCNAINANPPNRKIDILDRIFAGVVALTGNQSC  339

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YD   Y+   +   + WRWQ CSE+ +P+G   +DTMF  +PF+M  F   C+  YGV P
Sbjct  340   YDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDTMFPTSPFNMTSFIEGCESNYGVSP  398

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             RPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS  GVLED+SD+V+A+ T NGSHC 
Sbjct  399   RPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVGGVLEDLSDSVVAITTNNGSHCQ  458

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             DI   SK DP+WL  QR++E++II SW++ Y  ++  L 
Sbjct  459   DINLKSKGDPEWLVMQREEEIKIIDSWLSTYQKDIRDLN  497



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/477 (58%), Positives = 344/477 (72%), Gaps = 11/477 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP LT       + PE + S     +F T+++ QTLDHF+YRPQSYATFKQRY ++S YW
Sbjct  26    IPALTLEREDFHQDPERAVSASTTDDFETFFFDQTLDHFSYRPQSYATFKQRYFINSSYW  85

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA+S++PIF +LGAES +D  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EE
Sbjct  86    GGAKSSAPIFVYLGAESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGMSFEE  145

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N   RGYF+SAQALADY  +++++K +  A  SP+IV GGSYGGMLASW RLKYPHV
Sbjct  146   ALENADIRGYFSSAQALADYVAIIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHV  205

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAP+LYF+++TP++ YYS+V KDFKE SE C+Q I  SWS ID++A + +GLS
Sbjct  206   ALGALASSAPVLYFEDMTPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLS  265

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDR  1016
              LS+ F  C+ L+S   LK +L   Y TAAQ D PP YPVT +C GIDGA    + IL +
Sbjct  266   NLSQIFNTCRPLESGATLKSFLKDMYTTAAQQDNPPTYPVTRICEGIDGANTTENGILGK  325

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV    N  C      N P + +  GW WQ CSEM MP+G   R++MF PAPF + 
Sbjct  326   ISAGVVAYYWNSNC----CLNTPLTVSPDGWSWQKCSEMVMPLGI-TRNSMFPPAPFLLD  380

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F   C   YGV PRPHW+TT+YGGHDI+L+L +FGSNIIFSNGLRDP+S AGVL++IS+
Sbjct  381   DFMEHCRCEYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISE  440

Query  1377  TVLAVYTRNGSHCLDIYGASKT----DPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +++AV T  GSHC+DIY  S      DPDWL +QRK EVEII+ WI +YY +L A K
Sbjct  441   SIIAVITDQGSHCVDIYPESHDTQCPDPDWLVKQRKTEVEIIKGWIDQYYADLRASK  497



>ref|XP_006424402.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
 gb|ESR37642.1| hypothetical protein CICLE_v10030021mg, partial [Citrus clementina]
Length=429

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/415 (64%), Positives = 319/415 (77%), Gaps = 3/415 (1%)
 Frame = +3

Query  282   IVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             +++ KYW GA +++P F   G E  ID D    GFL +NAP FKALLVYIEHRYYGKS+P
Sbjct  2     LINFKYWDGANTSAPNFVLFGGEESIDYDRDINGFLPENAPHFKALLVYIEHRYYGKSVP  61

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FGT EEAM N +T GY NSAQA+ADYA VLL++K KY A+  P+IV GGSYGGMLASWFR
Sbjct  62    FGTKEEAMKNASTLGYCNSAQAIADYAAVLLHIKQKYSAEKCPVIVIGGSYGGMLASWFR  121

Query  642   LKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIA  818
             LKYPH+ALGALASS+PILYFD +  P+ GYY++VTKDFKE SE+CY+TIRKSW  ID++ 
Sbjct  122   LKYPHIALGALASSSPILYFDGVVDPQVGYYTIVTKDFKETSESCYETIRKSWGEIDEVG  181

Query  819   SKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG  998
             S+PNGLSILSKKF+ C  L S  ELKDYLDS Y  AAQYD+PPKYPV+ VCG IDGA +G
Sbjct  182   SRPNGLSILSKKFRTCNPLNSTSELKDYLDSLYTDAAQYDEPPKYPVSRVCGAIDGA-EG  240

Query  999   ADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
              D LD+I A VV   GN +CYD + +  PTS T   + WQ C+E+  PIG G  DTMF  
Sbjct  241   TDTLDKIFAAVVTYMGNTSCYDMEEFGSPTS-TYDMFTWQVCTELVFPIGHGHNDTMFPL  299

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
             APF +  FS+ C+  +GV P+PHW+TTYYGG DIKL+LH F SNIIFSNGLRDPYSS GV
Sbjct  300   APFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRDPYSSGGV  359

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             L++ISD+V+A+ T NGSHCLDI  A ++DP WL  QRK EVEII+ W+ KY+ +L
Sbjct  360   LKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGWLAKYHADL  414



>ref|XP_006378926.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|ERP56723.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=456

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/436 (63%), Positives = 337/436 (77%), Gaps = 8/436 (2%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +F T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  26    HTIPRLSPIGPRVWLDHPDQILGESVREDFETFFYNQTLDHFNYRPESYDTFLQRYLINS  85

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PI  +LGAE+PID D   +GFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  86    KYWGGANASAPILVYLGAEAPIDGDLDAVGFLVDTAVEFNSLLVYVEHRYYGKSIPFGSR  145

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  146   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  205

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIR+SW  ID++ASKP+G
Sbjct  206   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRESWEEIDEVASKPDG  265

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  266   LSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGCGFGDDLLG  325

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET VGWRWQTCSEM MPIG G+ D+MF P PF
Sbjct  326   RVFGGLVAYKGNRSCY----VNEPTNQSETSVGWRWQTCSEMVMPIGYGN-DSMFPPDPF  380

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              ++ +  DC   Y V PR HW+TTYYGGH I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  381   DLKAYIEDCKSLYDVTPRFHWVTTYYGGHSIRLILQRFASNIIFSNGLRDPYSSGGVLEN  440

Query  1368  ISDTVLAVYTRNGSHC  1415
             ISDTV+AV T NG H 
Sbjct  441   ISDTVVAVKTVNGKHA  456



>ref|XP_008458664.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Cucumis 
melo]
Length=436

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/415 (65%), Positives = 323/415 (78%), Gaps = 4/415 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T + IPRL+P  R+ L   E+ SS I   +F+T+YY+Q+LDHFNYRP+SY  F  RYI++
Sbjct  26    TQYRIPRLSPIGRTFLHNAEAISSSI-SDDFKTFYYNQSLDHFNYRPESYTCFPHRYIIN  84

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA S++PI A+LGAE P++ D   IGF+TDNA RF ALLVYIEHRYYGKS+PFG+
Sbjct  85    FKYWGGANSSAPILAYLGAEGPLEGDLNAIGFMTDNAVRFDALLVYIEHRYYGKSMPFGS  144

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ N +T GYF+SAQA+ADYA VLL+LK KY A+ SP+IV GGSYGGMLA+WFRLKY
Sbjct  145   REEALKNASTLGYFSSAQAIADYAAVLLHLKQKYHAKDSPVIVLGGSYGGMLAAWFRLKY  204

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PHVALGALASSAPILYF++ITP NGYYS+ TKDF+EVSE CY+TIR SWS I+ IASKPN
Sbjct  205   PHVALGALASSAPILYFEDITPHNGYYSIATKDFREVSETCYETIRDSWSKIETIASKPN  264

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLSILSK+FK C  L S  +L+DYL S Y  AAQY+ PP+YPVT +CGGIDGA  G+ I+
Sbjct  265   GLSILSKEFKTCSPLNSSSQLEDYLWSMYAGAAQYNHPPRYPVTRICGGIDGASPGSGII  324

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              ++ AGV   +GN  CY+    N   +ET VGWRWQ CSEM MP+   + DTMF P  F 
Sbjct  325   SKVAAGVFAYKGNLPCYNIGPRN--DTETDVGWRWQRCSEMVMPMSTSN-DTMFPPITFD  381

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             ++ F   C   YGV PRPHW+TTYYGG+DIKL+L +FGSNIIFSNGLRDPYSS G
Sbjct  382   LRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGG  436



>gb|KFK27605.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=509

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/457 (58%), Positives = 338/457 (74%), Gaps = 13/457 (3%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +   +Y++Q LDHF Y  +SY TF+QRY + SK+W G+++N+PI A+LG E+ +D D   
Sbjct  50    DLEMFYFNQNLDHFTYTAKSYTTFQQRYAIDSKHWAGSKANAPILAFLGEETSLDSDLST  109

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGFL DNA RFK+LLVYIEHRYYG ++PFG+  EA+ N +T GY N+AQALADYA +LL+
Sbjct  110   IGFLRDNALRFKSLLVYIEHRYYGMTMPFGSANEALKNASTLGYLNAAQALADYAAILLH  169

Query  558   LKNKYLAQHSPIIVFGGSYGG----------MLASWFRLKYPHVALGALASSAPILYFDN  707
             +K  Y A+HSPIIV GGSYGG          +LA+WFRLKYPH+ALGALASSAP+LYF++
Sbjct  170   VKQNYSAKHSPIIVIGGSYGGKECTLSHNLPLLAAWFRLKYPHIALGALASSAPLLYFED  229

Query  708   ITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPG  887
               P++GYY +VTK FKE SE CYQTIRKSW  I+++A+KPNGL  L KKFK C  L    
Sbjct  230   TLPKHGYYYIVTKVFKETSERCYQTIRKSWKEIERVAAKPNGLLTLGKKFKTCAPLNGSF  289

Query  888   ELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCY  1061
              +KD+LDS Y  A QY++ P Y VT VC GI+  P  +  D+LDRI AGVV L GNR+CY
Sbjct  290   NIKDFLDSIYAEAVQYNRGPSYWVTNVCNGINANPSNRKIDLLDRIFAGVVALVGNRSCY  349

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D  ++  PT+  +  WRWQ+C+E+ MP+G   +DTMF  APF+M  F   C+ YYGVPPR
Sbjct  350   DTNMFAQPTNNNL-AWRWQSCTEIVMPVGYDKQDTMFPTAPFNMTSFIAGCESYYGVPPR  408

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             PHW+TTY+G  D+KL+L +FGSNIIFSNGL+DPYS  GVLEDIS +V+A+ T NGSHC D
Sbjct  409   PHWVTTYFGIQDVKLILRRFGSNIIFSNGLKDPYSVGGVLEDISGSVVAIKTENGSHCQD  468

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             I   SK DP+WL  QR+KE++II+SWIT Y  +L  L
Sbjct  469   IVLKSKEDPEWLVMQREKEIDIIESWITSYKRDLRDL  505



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/473 (56%), Positives = 345/473 (73%), Gaps = 10/473 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDI-LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             PR    + +N++R  +S     LPPEF  +YY QTLDHFNY+P+SY TF+QRYI++ KYW
Sbjct  25    PRKLAKFSTNVKRFAASGDSFGLPPEFEIHYYTQTLDHFNYKPESYDTFQQRYILNYKYW  84

Query  303   GGAQSNSPIFAWLGAESPIDDDPKY-IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             GGA ++SPIF + G E    DD  Y +  +TD A RFK LL+YIEHRYYG+S+PFG+ ++
Sbjct  85    GGANNSSPIFVYTGEE----DDVTYDVDAITDLAARFKGLLLYIEHRYYGESMPFGSEDQ  140

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A  N +T GYF+S QALADYA+V+  +K    A++ P I  G SYGGMLASWFRLKYPH+
Sbjct  141   AFQNSSTLGYFSSEQALADYAQVVTDVKKNLSAENCPAIAVGASYGGMLASWFRLKYPHI  200

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
              +GALASS+PILYFD+ITP+NGY+ +VTKDFKE SE+CY TI +SW  ID++A++PNGL 
Sbjct  201   VIGALASSSPILYFDDITPQNGYHVVVTKDFKETSESCYNTIIQSWPEIDRVAAEPNGLL  260

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS KF  C+ L S  ELKD L  +Y +AAQYD PP YPV  +C  IDGAP+G DIL R+
Sbjct  261   TLSNKFNTCRTLNSSKELKDRLAISYISAAQYDNPPYYPVQNICHAIDGAPEGTDILGRV  320

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
              AG+    G + C +  I++   S    GW WQTC+E+ MPIG GD +TMF   PF ++ 
Sbjct  321   AAGLHRYPG-QGCVN--IFSFELSNK-SGWDWQTCTEIVMPIGYGDNETMFQAEPFDLKN  376

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             ++RDC + +GV PRPHW+TT +GGHDIK VL  F SNIIFSNGLRDP+SS GVLEDISD+
Sbjct  377   YTRDCVNCFGVVPRPHWVTTEFGGHDIKTVLGNFASNIIFSNGLRDPWSSGGVLEDISDS  436

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             V+A++T  G+HC D++ +S  DP WL EQR+KEV+II  WI +YY +L   +R
Sbjct  437   VVAIHTEYGAHCADLFPSSPDDPVWLVEQREKEVKIIAVWIAEYYAKLSTKER  489



>ref|XP_006485136.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=498

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/478 (55%), Positives = 355/478 (74%), Gaps = 17/478 (4%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PRL    RS +   + S+       F+T++Y+QT+DHF+Y P+SY TF +RY+++SK+WG
Sbjct  31    PRLGRIRRSRILEQKDSNHG-----FKTFFYNQTIDHFSYGPESYQTFPERYVINSKFWG  85

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             G   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+ + A+
Sbjct  86    GG--NSPILAFLGAEAPIDDNIQLSGFTYENAHQFKALIVILEHRYYGKSVPFGSRKAAL  143

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKYPHV +
Sbjct  144   KNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKYPHVVI  203

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+GL+IL
Sbjct  204   GSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPDGLAIL  263

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIH  1022
             SKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DIL +I 
Sbjct  264   SKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAPNCGDDILCKIA  323

Query  1023  AGVVGLE------GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             AGVV  +       N  CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M+ P P
Sbjct  324   AGVVEADSLEYDGNNSRCYINE--DKTGDESDEGWEWQSCSEMVVPMGK-DKNSMYQPEP  380

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             +++ ++ ++C + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S  GVLE
Sbjct  381   WNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSRGGVLE  440

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +ISD+++A+ T+ GSHCLD+ GA K+DPDWL +QRK EV+I+Q WIT+YY + +A+ +
Sbjct  441   NISDSIIALSTKYGSHCLDLDGAKKSDPDWLVQQRKTEVKIMQGWITQYYDDFKAINK  498



>gb|KCW50493.1| hypothetical protein EUGRSUZ_J00219 [Eucalyptus grandis]
Length=503

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/475 (57%), Positives = 351/475 (74%), Gaps = 9/475 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPE-SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             IP+L+ F+ + ++ P  +  + I   +FRT++Y+QTLDHFNYRP+SY TFKQRYI++SKY
Sbjct  30    IPKLSVFHPTFIQDPTWAVQTSISSKDFRTFFYNQTLDHFNYRPESYTTFKQRYIINSKY  89

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIE-HRYYGKSIPFG-TM  473
             WGGA +++PIFA+LG E PID      GF+TDNA  FKALLVYI  HR+YG+SIP+G T+
Sbjct  90    WGGANASAPIFAFLGDEEPIDSGTTGAGFMTDNAAEFKALLVYIVLHRFYGESIPYGWTL  149

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             ++A+ +  TRGYF+SAQALADYAE+LLYLK K  A+HSPIIV GGSYGGMLA+W RLKYP
Sbjct  150   DKALKDANTRGYFSSAQALADYAEILLYLKQKLNAKHSPIIVSGGSYGGMLAAWLRLKYP  209

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             HVALGALASSAPIL F +I P++ +YS V KDF E S +C+QTIR+SW  ID++AS+P+G
Sbjct  210   HVALGALASSAPILAFPDIMPQDTFYSGVAKDFLEASFSCHQTIRRSWEEIDRVASEPHG  269

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             L+ LSK FK C+ L+S  +LK+YL S Y  AAQY+ P + PV  +C  I+GA    D L 
Sbjct  270   LAKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGASPRNDTLR  329

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +I AG+   + N TCY   I  PPT  S+T +GW WQTC+E+A  +     +TMF PAP 
Sbjct  330   KIFAGLAASDRNSTCY---INPPPTPPSQTELGWHWQTCTEIAA-LWSITNNTMFQPAPS  385

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              + +F   C   + + PR HW++TYYGG DI+LVLH+F SNIIFSNGL+DP+S  G+L+ 
Sbjct  386   GLDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQDPFSYGGILKS  445

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             IS++V+AVYT  GSHCLDI  A+K DP WL  QRK EVEII+ WI  Y+ +L A 
Sbjct  446   ISNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKWIATYHADLRAF  500



>ref|XP_003596267.1| Lysosomal Pro-X carboxypeptidase [Medicago truncatula]
 gb|AES66518.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=479

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 338/470 (72%), Gaps = 18/470 (4%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             T+PRL+PF  S     +++ +  L  + + Y+Y QTLDHFNY   SY TFKQRYI++  Y
Sbjct  26    TLPRLSPFSESKTTEYQNTKTFNLNEDMQPYFYEQTLDHFNYLSDSYKTFKQRYIINFNY  85

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGGA S++PIFA+LG E   DD    +GF+TDNA  FKALLVYIEHRYYGKS+P      
Sbjct  86    WGGANSSAPIFAYLGGE---DDIVNTLGFMTDNATSFKALLVYIEHRYYGKSVP------  136

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
               +   + GY NSAQALADYAEVLLYLK+   AQ SP+IV GGSY GMLA+WFRLKYPH+
Sbjct  137   --SFNASYGYLNSAQALADYAEVLLYLKDSLHAQKSPVIVVGGSYAGMLAAWFRLKYPHI  194

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             A+GALASSAP+LYFDNITP +GY  ++T+DF+E S+ CY+TIR SW  ID++ASKPNGL+
Sbjct  195   AIGALASSAPLLYFDNITPASGYNDVITRDFQETSKTCYETIRNSWFEIDEVASKPNGLN  254

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LSKKF  C  L+ PGELKDYL + Y  AAQY+ P   P T +C  ID A  G DIL RI
Sbjct  255   FLSKKFNTCYPLEQPGELKDYLGNMYQKAAQYNDP---PTTTICEAIDRASYGDDILSRI  311

Query  1020  HAGVVGLEGNRTC-YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             + G+V   GN+ C  +P  Y    ++    WRWQTC+E+ MPIG GD  ++F P PF+  
Sbjct  312   YGGMVASYGNKKCNVNPDKYT--GAKPFDRWRWQTCTEIVMPIGIGD-SSLFQPKPFNFT  368

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F+ +C   +GV PRPHWIT+YYGG DI+LVL +FGSNIIFSNGLRDPYSS GVL +ISD
Sbjct  369   SFAENCKKDFGVQPRPHWITSYYGGQDIQLVLKRFGSNIIFSNGLRDPYSSGGVLNNISD  428

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             +++A+ T NG HC DI  A ++DP WL  QR  EVEIIQSWI KYY E+ 
Sbjct  429   SLVALPTVNGYHCQDIVPAIESDPAWLVHQRNTEVEIIQSWIKKYYDEVN  478



>ref|XP_006424406.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
 gb|ESR37646.1| hypothetical protein CICLE_v10030241mg, partial [Citrus clementina]
Length=501

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/478 (55%), Positives = 356/478 (74%), Gaps = 17/478 (4%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PRL    RS +   + S+       F T++Y+QT+DHF+Y P+SY TF QRY+++SK+WG
Sbjct  34    PRLGRIRRSRILEQKDSNHG-----FETFFYNQTIDHFSYGPESYQTFPQRYVINSKFWG  88

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             G   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+ + A+
Sbjct  89    GG--NSPILAFLGAEAPIDDNIQPSGFTYENAHQFKALIVILEHRYYGKSVPFGSRKAAL  146

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKYPHV +
Sbjct  147   KNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKYPHVVI  206

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+GL+IL
Sbjct  207   GSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPDGLAIL  266

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIH  1022
             SKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DIL +I 
Sbjct  267   SKKFKTCTPLKNTTELKDGLDTVYSEAAQYDSPSNIPVKRICNAIENAPNCGDDILCKIA  326

Query  1023  AGVVGL-----EGNRT-CYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             AGVV       +GN + CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M+ P P
Sbjct  327   AGVVEAYLLEYDGNNSRCYINE--DRTGDESDEGWEWQSCSEMVVPMGK-DKNSMYQPEP  383

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             +++ ++ +DC + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S  GVLE
Sbjct  384   WNLTKYIKDCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSRGGVLE  443

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +ISD+++A+ T++GSHCLD+  A K+DPDWL +QRK EV+I+Q WIT+YY + +A+ +
Sbjct  444   NISDSIIALSTKHGSHCLDLDEAKKSDPDWLVQQRKTEVKIMQGWITQYYDDFKAINK  501



>ref|XP_007150133.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
 gb|ESW22127.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
Length=440

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 333/445 (75%), Gaps = 11/445 (2%)
 Frame = +3

Query  39    MEFITLVIQCfsllilfsttslsETPHT--IPRLTPFYR--SNLRRPESSSSDILPPEFR  206
             ME   L+ QC   + L   ++   + H   IPRL+P  R  ++L  P +S +       +
Sbjct  1     MEHHPLLFQCLLFIFLMYYSTYFTSTHAVEIPRLSPIPRWDTSLHHPATSDAKTYADNIQ  60

Query  207   TYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGF  386
             T+YY Q LDHFNYRP+SY TF QRY+++ KYWGGA S+SPIFA+LGAE PID+ P+ I F
Sbjct  61    TFYYEQVLDHFNYRPESYKTFLQRYLINFKYWGGANSSSPIFAYLGAEEPIDNSPEGIAF  120

Query  387   LTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  566
             LTDNA  F ALLVYIEHRYYGKS+PFG+ EEA+ N +T GYFNSAQALADYA VL+++K 
Sbjct  121   LTDNAASFNALLVYIEHRYYGKSVPFGSREEALQNASTIGYFNSAQALADYASVLIHIKK  180

Query  567   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  746
                A +SP+IV GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP++GY+ +V++
Sbjct  181   TLHAPNSPVIVIGGSYGGMLASWFRLKYPHITIGALASSAPILYFDDITPQDGYFYVVSR  240

Query  747   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  926
              F+EVSE CYQTI KSWS ID+ AS+P+G ++LS++F  C+ L    ELK+YL+S Y +A
Sbjct  241   SFREVSETCYQTILKSWSEIDRTASQPSGKTLLSQRFNTCRPLNESLELKEYLESMYASA  300

Query  927   AQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETI  1100
             AQY+ P + PV+ +CGGID    G+D+L +I+AGVV L GN TC      N PT  SET 
Sbjct  301   AQYNDPARNPVSVICGGIDRGSFGSDVLSKIYAGVVALRGNTTCK----VNAPTIVSETT  356

Query  1101  VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDI  1280
             +GWRWQTCSEM +PIG G+ ++MF P PFS + F+  C   YGV PRPHW+TTYYGGH+I
Sbjct  357   LGWRWQTCSEMVIPIGIGN-NSMFQPQPFSFKSFANGCKKLYGVSPRPHWVTTYYGGHNI  415

Query  1281  KLVLHKFGSNIIFSNGLRDPYSSAG  1355
             KL+L KFGSNIIF NGLRDPYSS G
Sbjct  416   KLILQKFGSNIIFYNGLRDPYSSGG  440



>ref|XP_010034149.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=670

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/474 (57%), Positives = 353/474 (74%), Gaps = 8/474 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPE-SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             IP+L+ F+ + ++ P  +  + I   +F+T++Y+QTLDHFNYRP+SY TFKQRYI++SKY
Sbjct  198   IPKLSVFHPTFIQDPTWAVQTSISSKDFQTFFYNQTLDHFNYRPESYTTFKQRYIINSKY  257

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TME  476
             WGGA +++PIFA+LG E PI+     +GF+TDNA  FKALLVYIEHR+YG+SIP+G T++
Sbjct  258   WGGANASAPIFAFLGDELPINSATTNVGFMTDNAAEFKALLVYIEHRFYGESIPYGWTLD  317

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             +A+ +  TRGYF+SAQALADYAE+LLYLK K  A+HSPIIV GGSYGGMLA+W RLKYPH
Sbjct  318   KALKDANTRGYFSSAQALADYAEILLYLKQKLNAKHSPIIVSGGSYGGMLAAWLRLKYPH  377

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPIL F +I P++ +YS V KDF E S +C+QTIR+SW  ID++AS+P+GL
Sbjct  378   VALGALASSAPILAFPDIMPQDTFYSGVAKDFLEASFSCHQTIRRSWEEIDRVASEPHGL  437

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             + LSK FK C+ L+S  +LK+YL S Y  AAQY+ P + PV  +C  I+GA    D L +
Sbjct  438   AKLSKTFKTCRPLESSSQLKEYLKSVYVEAAQYNDPFRRPVEVICNAINGASPRNDTLRK  497

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
             I AG+   + N TCY   I  PPT  S+T +GW WQTC+E+A  +     +TMF PAP  
Sbjct  498   IFAGLAASDRNSTCY---INPPPTPPSQTELGWHWQTCTEIAA-LWSITNNTMFQPAPSG  553

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             + +F   C   + + PR HW++TYYGG DI+LVLH+F SNIIFSNGL+DP+S  G+L+ I
Sbjct  554   LDKFVTRCKRDFIIAPRQHWVSTYYGGQDIELVLHRFASNIIFSNGLQDPFSYGGILKSI  613

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             S++V+AVYT  GSHCLDI  A+K DP WL  QRK EVEII+ WI  Y+ +L A 
Sbjct  614   SNSVVAVYTAKGSHCLDIMPATKKDPKWLVNQRKTEVEIIRKWIATYHADLRAF  667


 Score =   187 bits (475),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  432  EHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGG  608
            +HR+YG+SIP+G T+++A+ +  TRGYF+SAQALADY E+LLYLK K  A+HSPIIV GG
Sbjct  51   KHRFYGESIPYGWTLDKALKDANTRGYFSSAQALADYVEILLYLKQKLNAKHSPIIVSGG  110

Query  609  SYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIR  788
            SYGGMLA+W RLKYPHVALGALASSAPIL F +I P + +YS V KDF E S +C+QTIR
Sbjct  111  SYGGMLAAWLRLKYPHVALGALASSAPILAFPDIMPRDTFYSGVAKDFLEASFSCHQTIR  170

Query  789  KSWSVIDKIASKPNGLSILSKKF  857
            +SW  ID++AS+P+  +   K  
Sbjct  171  RSWEEIDRVASEPHVCAATKKNL  193



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 323/445 (73%), Gaps = 4/445 (1%)
 Frame = +3

Query  189   LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  368
             L PEF TY+Y+QTLDHFNY+P+SY TF+QRYI++S+YWGGA S+SPIF + G E+ I   
Sbjct  44    LLPEFVTYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAV  103

Query  369   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  548
               + GF+ + A RF  LL+YIEHRYYG S+PFG+ +EA +N +T GYF S QALADYAE+
Sbjct  104   AAFAGFIVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAEL  163

Query  549   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  728
             +  LK    A++ P+I  GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP N Y
Sbjct  164   ITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPGNAY  223

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
             + +VTKDF+E SE+CY TIR SWS IDK+A++PNGL+ LS+ F  C+ L S  ELK YL 
Sbjct  224   HVIVTKDFRETSESCYSTIRDSWSEIDKVAAEPNGLANLSQIFMTCEPLNSSQELKYYLA  283

Query  909   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1088
               Y  +AQ D PP YPV +VC  IDGAP+G DI+ R+ AG+    G   C+    + P  
Sbjct  284   LCYVVSAQNDNPPAYPVKKVCDAIDGAPEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSN  342

Query  1089  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1268
                   W WQTC+EM MPIG G  DTMF   PF +   ++ C D +GV PRPHWITT +G
Sbjct  343   RSE---WTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWITTEFG  399

Query  1269  GHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDP  1448
             GHDIK V+  F SNIIFSNGLRDPYS+ GVL+DISD+V+A+YT  G+HCLD+   + TDP
Sbjct  400   GHDIKSVVGNFASNIIFSNGLRDPYSAGGVLQDISDSVVAIYTDKGAHCLDLSTPTATDP  459

Query  1449  DWLTEQRKKEVEIIQSWITKYYVEL  1523
             DWL  Q++KEV+II  W+ +Y   L
Sbjct  460   DWLVSQQEKEVKIIGLWLAEYNARL  484



>gb|KDO55292.1| hypothetical protein CISIN_1g036751mg [Citrus sinensis]
Length=492

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 342/471 (73%), Gaps = 27/471 (6%)
 Frame = +3

Query  123   IPRLTPFYRSNLRR--PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             IP+L      N+ +   E+ +S     + +T YY QTLDHFNY P+SY TF QRY+++ K
Sbjct  32    IPKLGVLRGINIFQNPSENLTSSEPKSDLKTLYYDQTLDHFNYNPESYLTFPQRYVLNFK  91

Query  297   YWGGAQSNS--PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             +WGG    +  PI A+LG ES +DDD + IG+L+DNA RFKAL VYIEHR+YGKS+PF +
Sbjct  92    HWGGGGGAAAAPILAYLGEESSLDDDLRGIGWLSDNAHRFKALQVYIEHRFYGKSVPFVS  151

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              E+A+ N T RGYFNSAQALADYAE+LL++K K  A+ SPIIV GGSYGGMLA+WFRLKY
Sbjct  152   SEDALKNATLRGYFNSAQALADYAEILLHIKEKLSAKTSPIIVVGGSYGGMLAAWFRLKY  211

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGA+ASSAP+LYFD ITP + YYS VTKDF+E SE+CY TI++SW+ IDK  +K N
Sbjct  212   PHIALGAVASSAPVLYFDKITPSDAYYSRVTKDFREASESCYATIKRSWAAIDKAGAKRN  271

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL+ LSKKFK CK LKS  ELKDYL++ Y  AAQYD+PP YPV +VC GIDGA +G D +
Sbjct  272   GLAFLSKKFKTCKPLKSVSELKDYLENMYTVAAQYDRPPNYPVNQVCNGIDGASQGTDTV  331

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI +G+V   G ++CY+  I    + ET+ GW WQTCSE+ MPIG G   TMF   PF+
Sbjct  332   ARIFSGIVASRGKKSCYN--IGEFFSDETLNGWGWQTCSEIVMPIGIGKNKTMFPADPFN  389

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++++   C++ YGV PRPHWITTYYGG DI++VL  FGSNIIFSNGLRDPYS+AGVLEDI
Sbjct  390   LKEYMDSCENSYGVVPRPHWITTYYGGLDIRVVLKSFGSNIIFSNGLRDPYSTAGVLEDI  449

Query  1371  SDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             SD+++A+                     + + R+ EV I+ +WI KYY +L
Sbjct  450   SDSIIAL---------------------VQKMRQIEVNIVHAWILKYYADL  479



>ref|XP_006287573.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
 gb|EOA20471.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
Length=502

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 326/447 (73%), Gaps = 5/447 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             + + +Y++QTLDHF + P+SY TF+QRY V +K+W GA+ N+PI  +LG ES ++ D   
Sbjct  54    DLKFFYFNQTLDHFTFTPESYMTFQQRYAVDAKHWAGAKVNAPILVFLGMESSLETDMSA  113

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GFL DNAP FKAL VYIEHRYYGK+IPFG+++EAM N +T GY N+AQALADYA +LL+
Sbjct  114   YGFLRDNAPHFKALNVYIEHRYYGKTIPFGSLKEAMKNSSTLGYLNTAQALADYAAILLH  173

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+A GALASSAP+LYF++  P+ GYY +
Sbjct  174   VKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIAHGALASSAPLLYFEDTLPKFGYYYI  233

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +TK +KE +E CY TIR+SW  ID++A+KPNGL ILSKKFK C  L    +LKD+LD+ Y
Sbjct  234   ITKVYKETNEKCYNTIRESWEEIDRVAAKPNGLLILSKKFKTCTPLNKSFDLKDFLDTIY  293

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1091
               + QYD+     VT+VC  I+  P  +  DILDRI AGVV   GN++CYD   Y+   +
Sbjct  294   VESVQYDEGSW--VTDVCDAINAGPPNRKIDILDRIFAGVVASHGNQSCYDTN-YSVLVA  350

Query  1092  ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1271
                + + WQ CSE+ +PIG   +DTMF  +PF+M  +   C   YGV PRPHWITTY+G 
Sbjct  351   SDAMAYSWQCCSEIVIPIGHDKQDTMFQTSPFNMTSYIEGCKSQYGVIPRPHWITTYFGI  410

Query  1272  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1451
              DIKL+L +FGSNIIFSNGL DPYS  GVLEDISD+V+A+ T  GSHC DI    K DP+
Sbjct  411   QDIKLILRRFGSNIIFSNGLSDPYSVGGVLEDISDSVVAITTEKGSHCRDINSKKKDDPE  470

Query  1452  WLTEQRKKEVEIIQSWITKYYVELEAL  1532
             WL  QR+KE++II SW+  Y  +L  L
Sbjct  471   WLVMQREKEIKIIDSWLLTYQKDLRDL  497



>emb|CDP14439.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/413 (64%), Positives = 316/413 (77%), Gaps = 5/413 (1%)
 Frame = +3

Query  309   AQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMN  488
             A+SNS I A+LGAE+P+ +D + IGFLTDNAP FKALLVYIEHR+YGKSIP G+ME+AM 
Sbjct  80    ARSNSSILAYLGAEAPLAEDLESIGFLTDNAPWFKALLVYIEHRFYGKSIPLGSMEKAMK  139

Query  489   NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALG  668
             N+T RGYFN AQALA+YAE+LL++K+K+ AQ SP+IV GGSYGGML SWFRLKYPH+AL 
Sbjct  140   NKTMRGYFNLAQALANYAEILLHVKDKFSAQSSPVIVVGGSYGGMLTSWFRLKYPHIALV  199

Query  669   ALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILS  848
             ALASS PILYF++ITP++GYYS+VTKDFK  SE+C Q IRKSW  IDK+ASKPNGLSILS
Sbjct  200   ALASSDPILYFNHITPQHGYYSIVTKDFKVKSEHCCQIIRKSWFEIDKVASKPNGLSILS  259

Query  849   KKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAG  1028
             K+FK C  L S  ELKDYL+  Y  AAQY+ P  YPVTE+C GID  PKG D+L RI  G
Sbjct  260   KRFKTCSPLNSSSELKDYLNYVYTLAAQYNSPSNYPVTEICNGIDKVPKGTDLLGRIFVG  319

Query  1029  VVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR---GDRDTMFFPAPFSMQQ  1199
             VV  +G+ +CYDP  Y  P SE  +GW WQTCSE+ MPIG+      DTMF P+PF +  
Sbjct  320   VVSYKGDNSCYDPLEYAYP-SEACIGWTWQTCSEIVMPIGKSHLSSNDTMFPPSPFILLD  378

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             F   C+  YGV PRPHWIT  YG HDIKLV  +FGSNIIFSNGLRDPYSSAG+L D +  
Sbjct  379   FIEYCESSYGVSPRPHWITN-YGCHDIKLVFQRFGSNIIFSNGLRDPYSSAGILLDSACY  437

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
              L   T+  SHCLDI  A K+D  +L  QRK EVEII+ WI +YY +L A+++
Sbjct  438   FLPSITKLRSHCLDILPAGKSDLSYLVAQRKIEVEIIEGWIKQYYADLYAIRK  490



>ref|XP_010034145.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=502

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/477 (54%), Positives = 346/477 (73%), Gaps = 10/477 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPE-SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             IP+L  F R+ ++ P  +  + +   +F+T++Y+QTLDHFNYR +SY TFKQRY+++SKY
Sbjct  30    IPKLGIFPRTFIQDPTWAIQASVSSKDFQTFFYNQTLDHFNYRLESYTTFKQRYVINSKY  89

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TME  476
             WGGA +++PIF + G E+P D     +GF+T+NA  FKALLVYIEHR+YG+SIP+G T++
Sbjct  90    WGGANASAPIFVFFGDEAPFDTAMTEVGFMTENAAEFKALLVYIEHRFYGESIPYGWTLD  149

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             +A+ +  TRGYF S QALADYAE+L+YLK    A+HSP IV GGSYGGMLA+WFRLKYPH
Sbjct  150   KALKDANTRGYFTSVQALADYAEILVYLKQILNAKHSPTIVIGGSYGGMLAAWFRLKYPH  209

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPIL   +ITP +  YS V K F E S +C+QTIRKSW  ID++AS+P+GL
Sbjct  210   VALGALASSAPILASPDITPRDTIYSAVAKVFLETSFSCHQTIRKSWEEIDRVASEPHGL  269

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             + LS+ FK C+ L+S  +LK+YL   Y  AAQY+ P   PV  +C  I+GA    DIL +
Sbjct  270   AKLSRTFKTCRPLESSSQLKEYLKLVYAEAAQYNDPLSRPVEVICNAINGASPRNDILGK  329

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTS---ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             I AG+   + N TCY     NPP +   +T +GW WQTCSE+ + +G    +TMF PAP 
Sbjct  330   IFAGLASADRNSTCY----VNPPPTPLPQTYLGWHWQTCSEI-LFVGSITNNTMFQPAPS  384

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              + +F   C   +G+ PR HW++T+YGG DIKLVLH+F SNIIFSNGL+DP S  G+L++
Sbjct  385   GLDKFVNSCKREFGIAPRQHWVSTHYGGQDIKLVLHRFASNIIFSNGLQDPLSYGGILKN  444

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             IS++V+A++T  GSHCLDI+ A+K DP WL +QRK EVEII+ WI  Y+ +L A  +
Sbjct  445   ISNSVVAIHTAKGSHCLDIWPATKKDPIWLVKQRKTEVEIIRKWIATYHADLRAFGK  501



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/472 (55%), Positives = 335/472 (71%), Gaps = 10/472 (2%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             P  + RLT F    ++R  +S  S  LPPE+  +YY QTLDHFNY PQSYATF+QRYI++
Sbjct  25    PRELTRLTRF--GGVKRFAASEFSYQLPPEYEIHYYTQTLDHFNYNPQSYATFQQRYILN  82

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA ++SPIF + G E  +  D   I  L   A RFKALL+YIEHRYYG+S+PFG+
Sbjct  83    FKYWGGANTSSPIFVYTGEEVDVTYDVDTILHL---AARFKALLLYIEHRYYGESMPFGS  139

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              ++A  N +T GY +S QALADYA+V+  +K K  A++ P I  G SYGGMLA+WFRLKY
Sbjct  140   EDQAFQNSSTLGYLSSEQALADYAQVVTDVKKKLSAENCPAIAVGASYGGMLAAWFRLKY  199

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ +G+LASS+PILYFD+ITP+NGY+ +VTKD+++ SE+CY TI++SWS ID++A++PN
Sbjct  200   PHIVIGSLASSSPILYFDDITPQNGYHVVVTKDYRDTSESCYNTIKQSWSEIDRVAAQPN  259

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GL  LS  F  C  L S  EL++YL+  Y +AAQYD PP  PV   C GIDGAP G DIL
Sbjct  260   GLLTLSNMFNTCSPLNSSTELREYLEILYVSAAQYDNPPYNPVQNTCRGIDGAPPGTDIL  319

Query  1011  DRIHAGVVG-LEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
              RI AG+   +    +CYD   ++         W WQTC+EM  PIG G  +TMF P+PF
Sbjct  320   GRIVAGLKSRIPSWSSCYDVPTWDLSNKS---AWDWQTCTEMVFPIGYGYNETMFQPSPF  376

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
              +  ++  C   +G+ PRP W TT +GGHDIK VL  F SNIIF+NGLRDP+S+ GVLED
Sbjct  377   DINNYTEACVQVFGIKPRPQWATTEFGGHDIKTVLGNFASNIIFANGLRDPWSAGGVLED  436

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AVYT  G+HCLD+Y  +  DPDWL EQR KE++II +WI +YY +L
Sbjct  437   ISDTVVAVYTEYGAHCLDLYPPTPNDPDWLVEQRDKEIKIIAAWIAEYYAKL  488



>ref|XP_002874100.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50359.1| hypothetical protein ARALYDRAFT_910290 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/441 (59%), Positives = 328/441 (74%), Gaps = 9/441 (2%)
 Frame = +3

Query  210   YYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFL  389
             +++ QTLDHF Y P SY  F+QRY V+SKYW G ++N+PI A+LGAES +D +   +GFL
Sbjct  57    FFFEQTLDHFTYTPGSYKKFRQRYAVNSKYWEGGKTNAPILAYLGAESSLDSELSVLGFL  116

Query  390   TDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNK  569
              DNAP FKAL+VYIEHR+YG+++PFG+ EE + N  T GY N+AQALADYA +LL++K  
Sbjct  117   KDNAPHFKALMVYIEHRFYGETMPFGSAEETLKNAKTLGYLNAAQALADYAAILLHIKET  176

Query  570   YLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKD  749
             Y A+HSP+IV GGSYGGMLA+WF+LKYPH+ALGALASSAP+LYF++  P++GY+ +VTK 
Sbjct  177   YSAKHSPVIVIGGSYGGMLAAWFKLKYPHIALGALASSAPLLYFEDTLPKHGYFYIVTKV  236

Query  750   FKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAA  929
             FKE S+ C+  IRKSW  ID+IA+KPNGLSILSKKFKLC  L    ELK YL + Y   A
Sbjct  237   FKETSQKCHNKIRKSWDEIDRIAAKPNGLSILSKKFKLCNPLNDTIELKSYLSNIYAGTA  296

Query  930   QYDQPPKYPVTEVCGGIDGAPKG--ADILDRIHAGVVGLEGNRTCYD-PQIYNPPTSETI  1100
             QY+  P Y V  +C  I+ +P    +D+LD+I AGVV   GN +CY   QI N   +   
Sbjct  297   QYNNNP-YSVASLCEAINTSPPNTKSDLLDQIFAGVVASGGNISCYGMDQITNDARA---  352

Query  1101  VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDI  1280
               W WQ+CSEM MPIG    DTMF P PF+M  F+++C+  YGV PRPHW+T Y+G  D+
Sbjct  353   --WTWQSCSEMVMPIGYEKEDTMFQPKPFNMSSFTKNCESQYGVSPRPHWVTAYFGSQDV  410

Query  1281  KLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLT  1460
             KL+  +FG+NIIFSNGL DPYS  GVLEDISDTV+A+ TR+GSHC DI   SK DP+WL 
Sbjct  411   KLIFRRFGNNIIFSNGLLDPYSVGGVLEDISDTVIAITTRDGSHCQDIVLKSKEDPEWLV  470

Query  1461  EQRKKEVEIIQSWITKYYVEL  1523
             EQR+KEV+II SWI+ Y  +L
Sbjct  471   EQREKEVKIIDSWISTYQKDL  491



>ref|XP_006424409.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
 gb|ESR37649.1| hypothetical protein CICLE_v10030113mg [Citrus clementina]
Length=521

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/468 (55%), Positives = 340/468 (73%), Gaps = 23/468 (5%)
 Frame = +3

Query  189   LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  368
             +P  F T++Y+QT+DHFNYRP+S+ TF+QRY++ SK+WGG Q+  PI A++GAE PIDDD
Sbjct  52    IPDGFETFFYNQTIDHFNYRPESFTTFRQRYLIYSKHWGGGQA--PILAFMGAEEPIDDD  109

Query  369   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  548
              K IGFLT+N+ R KAL+V++EHRYYG+S+PFG+  EA+NN   RGYFNSAQALADYAE+
Sbjct  110   LKAIGFLTENSERLKALVVFMEHRYYGQSVPFGSRSEALNNTNNRGYFNSAQALADYAEI  169

Query  549   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  728
             LL++K  + A +SP+IV GGSYGG LA+WFRLKYPH+ALGALASSAP+LY+++ITP N Y
Sbjct  170   LLHIKKTHDATYSPVIVVGGSYGGELATWFRLKYPHIALGALASSAPVLYYEDITPHNAY  229

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
             YS+VTK++++ SE CYQTI KSW+ I ++   P+G SILS++FK C  L++  EL+D L 
Sbjct  230   YSIVTKNYRDTSETCYQTILKSWAEIQRVGELPDGASILSRQFKTCTPLRNENELRDALA  289

Query  909   STYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIHAGVVGLEGNRTCYDPQIYNPP  1085
               Y + +QY +PP+ P+ + C  +D A   G D L +I A V   +G+R CY  +  N  
Sbjct  290   GMYASTSQYGRPPENPIEKFCSAVDRATACGNDSLCKIAAAVFAQKGDRPCYINKPKN--  347

Query  1086  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP-FSMQQFSRDCDDYYGVPPRPHWITTY  1262
              +ET  GW WQ+CSEM +P+   D  TM  P   F++ +    C   YGVPPRP+WITTY
Sbjct  348   RTETDEGWPWQSCSEMVVPMSI-DEKTMLRPVNLFNLTEVIDQCQQEYGVPPRPNWITTY  406

Query  1263  YGGH---------------DIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYT  1397
             YGGH               DIKL L +   NIIFSNGLRDPYS+ GVL++ISD ++A+ T
Sbjct  407   YGGHLIINFGLLHFCEKLQDIKLTLQRSTGNIIFSNGLRDPYSAGGVLKNISDNIIALPT  466

Query  1398  RNGSHCLDIYGASKT-DPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
              NGSHCLDI  ++KT DPDWL +QRK EVEII+ WI KYY +L+A+ +
Sbjct  467   VNGSHCLDIVKSNKTSDPDWLVQQRKTEVEIIKGWIAKYYADLKAINK  514



>ref|XP_006369368.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65937.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=486

 Score =   531 bits (1369),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/436 (62%), Positives = 338/436 (78%), Gaps = 5/436 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y+QTLDHFNYRP+SY  F QRY+++
Sbjct  47    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYNQTLDHFNYRPESYDKFPQRYLIN  106

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIPFG+
Sbjct  107   SKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIPFGS  166

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  167   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFRLKY  226

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  227   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  286

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G D L
Sbjct  287   GLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGDDTL  346

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P PF 
Sbjct  347   SRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPDPFD  403

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVLE+I
Sbjct  404   LKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVLENI  463

Query  1371  SDTVLAVYTRNGSHCL  1418
             SDTV+AV T NG H L
Sbjct  464   SDTVVAVKTVNGKHAL  479



>ref|XP_006485335.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=471

 Score =   531 bits (1367),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 260/444 (59%), Positives = 321/444 (72%), Gaps = 6/444 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS-NSPIFAWLGAESPIDDDPK  374
             +  TYYY Q LDH NY PQSY TF  RY+++ K+WGG  +  +PI A+LG ES +DDD  
Sbjct  7     DLETYYYDQILDHSNYNPQSYLTFPHRYVLNFKHWGGGGAMAAPILAYLGEESSLDDDHG  66

Query  375   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  554
              IG+LTDNA RFKAL VYIEHR+YGKS+PF   ++A+ N T RGYFNSAQALADYAE+LL
Sbjct  67    GIGWLTDNAHRFKALEVYIEHRFYGKSVPFVPSKDALKNATLRGYFNSAQALADYAEILL  126

Query  555   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  734
             ++K    A+ SP IV G SYGGML +WFRLKYP +ALGA+ASSAPILYFDNITP N +Y 
Sbjct  127   HIKKNLSAEMSPTIVVGASYGGMLVAWFRLKYPDIALGAVASSAPILYFDNITPSNAFYD  186

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             LV+KDF+E SE+CY+TI++SW    K   K NGL+ LSKKFK CK LK   ELKDYL+S 
Sbjct  187   LVSKDFREASESCYKTIKQSWLKSIKPLLKKNGLTFLSKKFKTCKPLKDVSELKDYLESM  246

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y +AAQYD P +YPV + C GIDGA +G D L RI +G+V L G  +CYD  + + P   
Sbjct  247   YTSAAQYDDPQEYPVNKACNGIDGASEGTDTLGRIFSGIVALRGESSCYDVLMNSSPMKH  306

Query  1095  -TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGG  1271
              T  G      SEM  PI  G  DT F   PF+  +    C+  YGV PRPHWITTY  G
Sbjct  307   WTPAG----AGSEMVSPIKIGKNDTTFQANPFNPTESMDSCNKSYGVVPRPHWITTYCSG  362

Query  1272  HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPD  1451
             HDI++VL++FGSNIIFSNGLR+PYSSAGVLEDIS++++ V TRNGS+CLDI   ++ DP 
Sbjct  363   HDIRMVLNRFGSNIIFSNGLRNPYSSAGVLEDISNSIIVVTTRNGSYCLDIQPETEDDPK  422

Query  1452  WLTEQRKKEVEIIQSWITKYYVEL  1523
             W+  QRK EV+++  WI KY+ +L
Sbjct  423   WVVVQRKIEVDVVHDWILKYFADL  446



>ref|XP_009356965.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=445

 Score =   530 bits (1364),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 265/455 (58%), Positives = 325/455 (71%), Gaps = 25/455 (5%)
 Frame = +3

Query  15    LQLYSLISMEFITLVIQCfsllilfsttslsETPHTIPRLTP----FYRSNL---RRPES  173
             LQ   LI   FIT+ +                T   IPRL+P    F + N      P+ 
Sbjct  8     LQCLVLIISLFITISVSA--------------TRFNIPRLSPNAGAFVQGNYFARDHPKP  53

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
              S+     EF+T YY+QTLDHFN+RP S+ TF+QRY+++ K+WGG+  ++PIFA+LG E 
Sbjct  54    LSAFDPVTEFQTIYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNISAPIFAYLGEEE  113

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              ID D   IGFL++NA +F+AL ++IEHRYYG+S+PFG+ EE   N +T GYFNSAQA+A
Sbjct  114   AIDADLSIIGFLSENADKFQALQIFIEHRYYGQSVPFGSREEGFKNASTIGYFNSAQAMA  173

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYAE+L+++K +  A+HSP+IV G SYGGMLASWFRLKYPHVALGALASSAPILYF++I 
Sbjct  174   DYAEILIHVKKQLRAEHSPVIVIGASYGGMLASWFRLKYPHVALGALASSAPILYFEDII  233

Query  714   -PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  890
              PE GYYS+VTKDF+E SE CYQTI+KSWS ID IASKP GLS LS KF+ C  L    E
Sbjct  234   PPEKGYYSIVTKDFQEASETCYQTIKKSWSEIDDIASKPEGLSFLSNKFRTCSPLTKSSE  293

Query  891   LKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQ  1070
             LKDYLDS YC AAQY+ PP YPVT VCGGIDG   G D L +I AGVV   GNR+CY  +
Sbjct  294   LKDYLDSLYCEAAQYNSPPSYPVTVVCGGIDGVSSGNDTLSKIFAGVVAYYGNRSCYVNE  353

Query  1071  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1250
               N   SET VGW WQTCS++ +P+G  + ++MF P  F +Q++   C   YGVPPRPHW
Sbjct  354   PRN--LSETDVGWSWQTCSDLVIPMGVSN-ESMFPPYQFDLQEYIDSCKALYGVPPRPHW  410

Query  1251  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
              TTY+GGHDIKL L++F SNIIFSNGLRDPYSS G
Sbjct  411   ATTYFGGHDIKLALYRFASNIIFSNGLRDPYSSGG  445



>ref|XP_002874098.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50357.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=427

 Score =   528 bits (1360),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 317/426 (74%), Gaps = 6/426 (1%)
 Frame = +3

Query  264   TFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRY  443
             TF+QRY + +K+W GA++N+PI A+LG E+ ++ D    GFL+DNAP FKAL VYIEHRY
Sbjct  2     TFQQRYAIDAKHWAGAKANAPILAFLGLEASLETDLAAFGFLSDNAPHFKALKVYIEHRY  61

Query  444   YGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGM  623
             YGK+IPFG+ +EAM N +T GY NSAQALADYA +LL++K KY A HSPIIV GGSYGGM
Sbjct  62    YGKTIPFGSAKEAMKNASTLGYLNSAQALADYAAILLHIKEKYSATHSPIIVVGGSYGGM  121

Query  624   LASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSV  803
             LA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY ++TK FKE ++ CY TIRKSW  
Sbjct  122   LAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYYYIITKVFKETNKRCYNTIRKSWEE  181

Query  804   IDKIASKPNGLSILSKKFKLCKG-LKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI  980
             ID++ASKPNGL ILSKKFK C   L    +LKD+LD+ Y    QY+      VT VC  I
Sbjct  182   IDRVASKPNGLLILSKKFKTCASPLSRSFDLKDFLDTVYAETVQYND--GVWVTNVCNAI  239

Query  981   DGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1154
             +  P  +  DILDRI AGVV L G+++CY+   Y+   +   + WRWQ CSE+ +P+G  
Sbjct  240   NANPPNRKIDILDRIFAGVVALTGSQSCYNTN-YSVQVTNNDMAWRWQCCSEIVVPVGHD  298

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
              +DTM+  +PF+M  +  DC+  YGV PRPHWITTY+G  ++KL+L +FGSNIIFSNGL 
Sbjct  299   KQDTMYQTSPFNMTSYIEDCESSYGVSPRPHWITTYFGIQNVKLILQRFGSNIIFSNGLS  358

Query  1335  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             DPYS  GVLEDISDTV+A+ T+NGSHC DI   SK DP+WL  QR+KE+++I SWI+ Y 
Sbjct  359   DPYSVGGVLEDISDTVVAITTKNGSHCQDINLKSKGDPEWLVMQREKEIKVINSWISTYQ  418

Query  1515  VELEAL  1532
              +L  L
Sbjct  419   NDLRDL  424



>gb|KCW50727.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=458

 Score =   528 bits (1359),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 257/414 (62%), Positives = 317/414 (77%), Gaps = 9/414 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P L+      LR PE + S  +  +F T++++QTLDHFNYRP+SY TF+QRY++ S++WG
Sbjct  27    PTLSLQREGVLRDPERAVSASIADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAESPID  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA
Sbjct  87    GANSSAPIFVYLGAESPIDGSPTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             ++    RGYF+SAQALADYA +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ 
Sbjct  147   LHETNIRGYFSSAQALADYAAIIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLT  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPILYFD+ITP++ YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S 
Sbjct  207   VGALASSAPILYFDDITPQDAYYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSN  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRI  1019
             LS+ FK CK L+S  ELK+YL S Y  AAQYD PP+YPVT +C GIDGA    + IL +I
Sbjct  267   LSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AGVV  +GN  CY     NPPT  S+T +GW WQ CSEM MPIG  + ++MF   PF++
Sbjct  327   FAGVVAYKGNSACY----VNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNL  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
               F  +C+D YGV PRPHWITTYYGGHDI+L+L +FGSNIIFSNGLRDPYSSAG
Sbjct  382   SSFIDECNDQYGVTPRPHWITTYYGGHDIELILLRFGSNIIFSNGLRDPYSSAG  435



>emb|CAN64373.1| hypothetical protein VITISV_018663 [Vitis vinifera]
Length=702

 Score =   535 bits (1377),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 317/422 (75%), Gaps = 14/422 (3%)
 Frame = +3

Query  24    YSLISMEFI--TLVIQCfsllilfsttslsETPHTIPRLTPFYRSNLRRPE-SSSSDILP  194
             YSL  + F+  TL++ C                  +PRL P  R  LR PE ++ S+   
Sbjct  10    YSLQWLPFLIPTLILSCCVSA----------AQFNVPRLGPLSRGILRNPEPAAVSESFY  59

Query  195   PEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPK  374
              + +T++Y QTLDHFNYRP+SY TF+QRY+++ K+WGGA++ +PIFA+LGAE+P+D D  
Sbjct  60    KDLKTFFYAQTLDHFNYRPESYKTFRQRYVMNFKHWGGAKAGAPIFAYLGAEAPLDGDLV  119

Query  375   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  554
              IGF+ DNA RF ALL+YIEHRYYGKSIPFG+ + A+ N +T GYFNSAQA+ADYA VL+
Sbjct  120   NIGFVNDNAARFNALLIYIEHRYYGKSIPFGSTKVALKNASTLGYFNSAQAIADYAAVLM  179

Query  555   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  734
             ++K +  AQ+SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAPILYFD I PE GYYS
Sbjct  180   HVKKRLHAQNSPVIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFDEIAPEIGYYS  239

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             +VTKDF+E SE+CY+TIR+SWS ID+IASKPNGLSILSK+FK C  L+S  ELKDYLDS 
Sbjct  240   IVTKDFREASESCYRTIRRSWSEIDRIASKPNGLSILSKRFKTCAHLESSFELKDYLDSI  299

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y  AAQY++PP YPVT VC GI+GA K  D L RI  G+V + G R+CYD + +N PT E
Sbjct  300   YAEAAQYNEPPTYPVTVVCKGINGASKRTDTLGRIFHGLVAIAGKRSCYDTKEFNYPT-E  358

Query  1095  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             T +GWRWQ CSEM +PIG    DTMF P PF++ +F ++C+  Y V PRPHW+TTYYGG 
Sbjct  359   TYLGWRWQKCSEMVLPIGHATNDTMFQPEPFNLNRFIKECNSLYSVSPRPHWVTTYYGGR  418

Query  1275  DI  1280
              +
Sbjct  419   TL  420



>ref|XP_006424411.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
 gb|ESR37651.1| hypothetical protein CICLE_v10028519mg [Citrus clementina]
Length=418

 Score =   524 bits (1349),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 307/395 (78%), Gaps = 13/395 (3%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL+P   + L+ PE  S+ I   +F+T+YY+QTLDHFNYRP+SY+TF+QRY+++
Sbjct  26    TRFNIPRLSPTRGTILQNPEILSATI-SEDFQTFYYNQTLDHFNYRPESYSTFQQRYVIN  84

Query  291   SKYWGGAQSNS---PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
              KYWGG        PIF +LGAE P+D D   IGFLTDNA RF ALLVYIEHRYYGKSIP
Sbjct  85    FKYWGGGAGADANAPIFVYLGAEGPLDGDISIIGFLTDNAARFNALLVYIEHRYYGKSIP  144

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FG+ EEA+ N +T GYFNSAQA+ DYAE+LLY+K K+ A+HSP+IV GGSYGGMLA+WFR
Sbjct  145   FGSREEALKNASTLGYFNSAQAVTDYAEILLYIKEKFNARHSPVIVIGGSYGGMLATWFR  204

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             LKYPHVALGALASSAPILYFD+ITP NGYYS+VT+DF+E SE CY+TI KSW+ I+K+AS
Sbjct  205   LKYPHVALGALASSAPILYFDDITPRNGYYSIVTRDFREASETCYETIMKSWAEIEKVAS  264

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             KP+GLSILSKKF+ CK LK   EL+DYL+  Y  AAQY+QPPKYPV  +CGGIDGA  G 
Sbjct  265   KPDGLSILSKKFRTCKPLKDSYELEDYLELVYADAAQYNQPPKYPVNMLCGGIDGAALGT  324

Query  1002  --DILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTM  1169
               DIL +I AGVV  EGN +CY     NPPT  SET VGWRWQTCSEM +PIG  D  TM
Sbjct  325   DNDILSKIFAGVVAHEGNMSCY----VNPPTIESETTVGWRWQTCSEMVIPIGT-DNTTM  379

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
             F PAPF++  F   C+  YGV PRPHW+T YYGG+
Sbjct  380   FQPAPFNLSSFIDGCESLYGVSPRPHWVTAYYGGY  414



>emb|CBI17113.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   531 bits (1369),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 251/446 (56%), Positives = 322/446 (72%), Gaps = 9/446 (2%)
 Frame = +3

Query  189   LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  368
             L  +F TYYY+QTLDHFNYRP+SY  F+QRY+++S YWGGA S+SPIF + G E  I   
Sbjct  46    LSSDFVTYYYNQTLDHFNYRPESYTNFQQRYLINSAYWGGANSSSPIFVYTGDEGSITGA  105

Query  369   PKYIGFLTDNAPRFKALLVY---IEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADY  539
               + GF+ D A RFK LL+Y   ++HRYYG S+PF + + A NN +T GYF+S QALADY
Sbjct  106   AAFAGFMVDLASRFKGLLLYYLILQHRYYGDSVPFRSKDIAFNNTSTLGYFSSTQALADY  165

Query  540   AEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPE  719
             AE++  LK    A++ P+I  GGSYGGMLASWFRLKYPHV +GALASSAPILYFD+ITP 
Sbjct  166   AELITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHVVIGALASSAPILYFDDITPH  225

Query  720   NGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKD  899
             NGY S+VTKDF+E SE CY TI++SWS ID++A +PNGL+ LS+ F+ C+ L S  +LK 
Sbjct  226   NGYDSIVTKDFRETSETCYTTIKQSWSEIDEVAGQPNGLANLSQIFRTCEPLNSSQQLKL  285

Query  900   YLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYN  1079
             YL+ TY  +AQYD PP + V+++C  IDGAP+G  IL R+  GV    G   C+    + 
Sbjct  286   YLEYTYEASAQYDNPPAHYVSDICNAIDGAPEGTSILGRVAEGVNASAG-PPCHRIYDFQ  344

Query  1080  PPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYG--VPPRPHWI  1253
             P     + GW WQTC+EM MP GRG+ DTMF  +PF +  +++ C D +G  V PRPHWI
Sbjct  345   P---SNMSGWLWQTCTEMVMPFGRGENDTMFQASPFDLNNYTKTCQDIFGASVTPRPHWI  401

Query  1254  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1433
             TT +GGH+IK VL  F SNIIFSNGLRDPYS  GVL+DIS++V+AVYT  G+HCLD+   
Sbjct  402   TTEFGGHNIKSVLGNFASNIIFSNGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTP  461

Query  1434  SKTDPDWLTEQRKKEVEIIQSWITKY  1511
               +DPDWL  QR KE++I+  W+ +Y
Sbjct  462   MPSDPDWLVAQRDKEIKIVALWLAEY  487


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  756  EVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  890
            + SE+CY+TI++SW  I+K+AS+PNGL ILSKKF  CKG +   E
Sbjct  530  QASESCYKTIQESWPEINKVASEPNGLLILSKKFGTCKGEQKTQE  574



>ref|XP_006369365.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 ref|XP_006369366.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65934.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
 gb|ERP65935.1| hypothetical protein POPTR_0001s220902g, partial [Populus trichocarpa]
Length=474

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 268/431 (62%), Positives = 335/431 (78%), Gaps = 5/431 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y+QTLDHFNYRP+SY  F QRY+++
Sbjct  47    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYNQTLDHFNYRPESYDKFPQRYLIN  106

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIPFG+
Sbjct  107   SKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIPFGS  166

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  167   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFRLKY  226

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  227   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  286

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G D L
Sbjct  287   GLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGDDTL  346

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P PF 
Sbjct  347   SRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPDPFD  403

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDI  1370
             ++ +   C   YGVP RPHW+TTYYGGH IKL+L +F SNIIFSNGLRDPYSS GVLE+I
Sbjct  404   LKDYIEHCKSLYGVPTRPHWVTTYYGGHSIKLILQRFASNIIFSNGLRDPYSSGGVLENI  463

Query  1371  SDTVLAVYTRN  1403
             SDTV+AV T N
Sbjct  464   SDTVVAVKTVN  474



>gb|KCW50433.1| hypothetical protein EUGRSUZ_J00172, partial [Eucalyptus grandis]
Length=516

 Score =   525 bits (1352),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 343/478 (72%), Gaps = 11/478 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPE-SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             IP+L  F R+ ++ P  +  + +   +F+T++Y+QTLDHFNYR +SY TFKQRY+++SKY
Sbjct  43    IPKLGIFPRTFIQDPTWAIQASVSSKDFQTFFYNQTLDHFNYRLESYTTFKQRYVINSKY  102

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TME  476
             WGGA +++PIF + G E+P D     +GF+T+NA  FKALLVYIEHR+YG+SIP+G T++
Sbjct  103   WGGANASAPIFVFFGDEAPFDTAMTEVGFMTENAAEFKALLVYIEHRFYGESIPYGWTLD  162

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             +A+ +  TRGYF S QALADYAE+L+YLK    A+HSP IV GGSYGGMLA+WFRLKYPH
Sbjct  163   KALKDANTRGYFTSVQALADYAEILVYLKQILNAKHSPTIVIGGSYGGMLAAWFRLKYPH  222

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VALGALASSAPIL   +ITP +  YS V K F E S +C+QTIRKSW  ID++AS+P+GL
Sbjct  223   VALGALASSAPILASPDITPRDTIYSAVAKVFLETSFSCHQTIRKSWEEIDRVASEPHGL  282

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDR  1016
             + LS+ FK C+ L+S  +LK+YL   Y  AAQY+ P   PV  +C  I+GA    DIL +
Sbjct  283   AKLSRTFKTCRPLESSSQLKEYLKLVYAEAAQYNDPLSRPVEVICNAINGASPRNDILGK  342

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTS---ETIVG-WRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             I AG+   + N TCY     NPP +   +T +G    QTCSE+   +G    +TMF PAP
Sbjct  343   IFAGLASADRNSTCY----VNPPPTPLPQTYLGCLGLQTCSEILF-VGSITNNTMFQPAP  397

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
               + +F   C   +G+ PR HW++T+YGG DIKLVLH+F SNIIFSNGL+DP S  G+L+
Sbjct  398   SGLDKFVNSCKREFGIAPRQHWVSTHYGGQDIKLVLHRFASNIIFSNGLQDPLSYGGILK  457

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
             +IS++V+A++T  GSHCLDI+ A+K DP WL +QRK EVEII+ WI  Y+ +L A  +
Sbjct  458   NISNSVVAIHTAKGSHCLDIWPATKKDPIWLVKQRKTEVEIIRKWIATYHADLRAFGK  515



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   523 bits (1346),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 323/450 (72%), Gaps = 3/450 (1%)
 Frame = +3

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
             +S + + PEF  + Y Q+LDHFN++P+SYATF+QRYI++ KYWGGA ++SPIF +LGAE 
Sbjct  43    ASVNAISPEFEVHNYTQSLDHFNFKPESYATFQQRYILNYKYWGGANTSSPIFVYLGAE-  101

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              ID        + D A RFK LL+YIEHRYYG S+PFG+ +EA  N +T GY +S QALA
Sbjct  102   -IDVTQNLDLSIVDLAARFKGLLLYIEHRYYGVSMPFGSEDEAFQNSSTFGYLSSEQALA  160

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYA+V++ +K    A++ P I  GGSYGGMLASWFRLKYPH+ +G+LASSAPILYFD+IT
Sbjct  161   DYAQVIVDVKKDLSAENCPAIAIGGSYGGMLASWFRLKYPHIVIGSLASSAPILYFDDIT  220

Query  714   PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGEL  893
             P+NGY+ +V+KDF++ SE+CY TI++SW+ ID++AS+ NGL  LS  F  C  L S  +L
Sbjct  221   PQNGYHVIVSKDFRDTSESCYNTIQQSWAEIDRVASETNGLLNLSNIFTTCSPLNSSKDL  280

Query  894   KDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQI  1073
             K Y +  Y  AAQ D PP YPV ++C  IDGAP G DIL R+ AGV       +C+    
Sbjct  281   KVYTEIAYMWAAQLDNPPSYPVNKICSAIDGAPSGTDILGRVAAGVNASVFGNSCHSAS-  339

Query  1074  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1253
              +  + ++   W WQTC+EM  P+G G+ +TMF   P  +  ++++C D +G+ PRPHWI
Sbjct  340   GSGLSRKSASAWEWQTCTEMVFPMGYGENETMFQSDPLDINNYTKECVDVFGIKPRPHWI  399

Query  1254  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1433
             TT +GGHDIK VL  F SNIIFSNGLRDP+S+ GVLEDISD+V+A+YT  GSHCLD+Y  
Sbjct  400   TTEFGGHDIKTVLGNFASNIIFSNGLRDPWSAGGVLEDISDSVVALYTEQGSHCLDLYPP  459

Query  1434  SKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             + +DPDWL   R KE +II  W+ +YY +L
Sbjct  460   TSSDPDWLLALRDKENKIIAYWLAEYYAKL  489



>gb|KDO44737.1| hypothetical protein CISIN_1g038117mg [Citrus sinensis]
Length=500

 Score =   523 bits (1347),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 343/480 (71%), Gaps = 19/480 (4%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             PRL    RS +   + S+       F T++Y+QT+DHF+Y P+SY TF QRY+++SK+WG
Sbjct  31    PRLGRIRRSRILEQKDSNHG-----FETFFYNQTIDHFSYGPESYQTFPQRYVINSKFWG  85

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             G   NSPI A+LGAE+PIDD+ +  GF  +NA +FKAL+V +EHRYYGKS+PFG+ + A+
Sbjct  86    GG--NSPILAFLGAEAPIDDNIQLSGFTYENAHQFKALIVILEHRYYGKSVPFGSRKAAL  143

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N   RGYFNSAQALADYA +LL++K+KY A H+P+I  G SYGG LA+WFRLKYPHV +
Sbjct  144   KNARHRGYFNSAQALADYASILLHIKDKYNATHAPVIAIGASYGGELATWFRLKYPHVVI  203

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             G+LASSAPILY+ +ITP   Y+S+V+KDF++ SE C+QTI+KSWS ID IASKP+GL+IL
Sbjct  204   GSLASSAPILYYGDITPWTTYHSVVSKDFRDTSEECFQTIKKSWSEIDNIASKPDGLAIL  263

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPK-GADILDRIH  1022
             SKKFK C  LK+  ELKD LD+ Y  AAQYD P   PV  +C  I+ AP  G DIL +I 
Sbjct  264   SKKFKTCTPLKNTTELKDGLDTVYSEAAQYDTPSNIPVKRICNAIENAPNCGDDILCKIA  323

Query  1023  AGVVGLE------GNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             AGVV  +       N  CY  +  +    E+  GW WQ+CSEM +P+G+ D+++M+ P P
Sbjct  324   AGVVEADSLEYDGNNSRCYINE--DRTGDESDEGWEWQSCSEMVVPMGK-DKNSMYQPEP  380

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             +++ ++ ++C + YGV PRP W+ TYYGGHDIKL+L +  SNIIFSNG+RDP+S  G ++
Sbjct  381   WNLTKYIKNCKEQYGVSPRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSRGGWVK  440

Query  1365  --DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
                  D   +     GSHCLD+  A K+DPDWL +QRK EV+I+Q WIT+YY + +A+ +
Sbjct  441   TYHFFDLSFSQDLNLGSHCLDLDEAKKSDPDWLVQQRKTEVKIMQGWITQYYDDFKAINK  500



>ref|XP_010493397.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X3 [Camelina 
sativa]
Length=439

 Score =   517 bits (1332),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 301/399 (75%), Gaps = 3/399 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+ S+  +   + + +Y++QTLDHF + P+SY TF+QRY + S +WGGA++N+PI A+LG
Sbjct  42    PDGSTQKVDASDLKMFYFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES +D D   +GFL DN PRFKALLVYIEHRYYGK++PFG+ EEA+ N +T GY N+AQ
Sbjct  102   EESSLDSDLSAVGFLRDNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYATILLHVKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY +VTK FK+ SE CY TIRKSW  ID++A+KP GL ILSKKFK C  L   
Sbjct  222   DTRPKFGYYYIVTKVFKKTSERCYNTIRKSWKEIDRVAAKPQGLLILSKKFKTCAPLNGS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA--DILDRIHAGVVGLEGNRTC  1058
               +KD+L++ Y  + QY++ P Y VT VC  I+  P  +  D+LDRI AGVV L GNRTC
Sbjct  282   SNIKDFLNTIYAESVQYNRGPSYWVTNVCNAINANPPNSKHDLLDRIFAGVVALVGNRTC  341

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YDP ++  PT+  ++ WRWQ+CSE+ MP+G   +DTMF  APF+M  +   C+  YGVPP
Sbjct  342   YDPNMFAQPTNN-VIAWRWQSCSEIVMPVGYDKQDTMFPTAPFNMTSYIEGCESNYGVPP  400

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             R HWITTY+G  D+KL+L KFGSNIIFSNGL DPYS  G
Sbjct  401   RQHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVGG  439



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   514 bits (1325),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 249/475 (52%), Positives = 334/475 (70%), Gaps = 18/475 (4%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             P  + R T F     R   S  S  LP ++  +YY QTLDHFNY+P+SYATF+QRYI++ 
Sbjct  25    PRKLTRTTRF-GGEKRFAASEFSYQLPSDYEIHYYTQTLDHFNYKPESYATFQQRYILNF  83

Query  294   KYWGGAQSNSPIFAWLGAESP----IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIP  461
             KYWGGA ++SPIF + GAE      +D        + + A RF+ LL+YIEHRYYG+S+P
Sbjct  84    KYWGGANTSSPIFLYTGAEENLIYHVDRS------IVELAARFRGLLLYIEHRYYGESMP  137

Query  462   FGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFR  641
             FG+ E+A+ N +T GY +S QALADYA+V+  +K    A++ P I  G SYGGMLA+WFR
Sbjct  138   FGSEEQALQNSSTLGYLSSEQALADYAQVITDVKKNLSAENCPAIAVGASYGGMLAAWFR  197

Query  642   LKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS  821
             LKYPH+ +G+LASS+PILYFD+ITP+NGY+ L  +    + E+C+ TI++SWS ID++A+
Sbjct  198   LKYPHIVIGSLASSSPILYFDDITPQNGYHVLSRRI---LDESCHNTIKQSWSEIDRVAA  254

Query  822   KPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGA  1001
             +PNGL  LS  F  C+ L S  E K+YL+  Y TAAQYD PP  PV   C GIDGAP G 
Sbjct  255   QPNGLLTLSNMFNTCRPLVSSAEFKEYLELLYITAAQYDNPPDNPVQSTCRGIDGAPPGT  314

Query  1002  DILDRIHAGVVG-LEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
             DIL RI  G+ G + G  +C+D  I+    S     W WQTC+EM  PIG GD +TMF P
Sbjct  315   DILGRIVEGLNGRIPGWSSCHD--IFTLELSNN-GSWDWQTCTEMVFPIGYGDNETMFQP  371

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
             +PF +  + ++C   +G+ PRPHW+TT +GGHDIK VL  F SNIIF+NGLRDP+S+ GV
Sbjct  372   SPFDINNYKKECLQVFGIKPRPHWVTTEFGGHDIKTVLGNFASNIIFANGLRDPWSAGGV  431

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             LEDISD+++AVYT +G+HCLD+Y ++  DP+WL EQR+KE++II +W+ +YY +L
Sbjct  432   LEDISDSIVAVYTEHGAHCLDLYPSTPDDPNWLVEQREKEIKIIAAWLAEYYAKL  486



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   515 bits (1326),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 256/450 (57%), Positives = 322/450 (72%), Gaps = 8/450 (2%)
 Frame = +3

Query  189   LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  368
             +  + +  YY QTLDHFNY+PQSY  FKQ+Y++ SKYWGGA+ NSPI  +LG E P+ DD
Sbjct  53    IDKDLKILYYPQTLDHFNYQPQSYMIFKQKYMIYSKYWGGAKVNSPILVYLGDEGPMYDD  112

Query  369   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAE  545
                   L D A + KAL+V IEHRYYG+S PFG +MEE + N + RGYFNSAQA+ADYAE
Sbjct  113   QIDALILPDYAAKLKALIVIIEHRYYGESKPFGMSMEEIVKNASIRGYFNSAQAIADYAE  172

Query  546   VLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDN-ITPEN  722
             V+L++K    A +SP+IV GGSYGGMLASWFRLKYPH+ALGALASSAP+LYFD+ I+P +
Sbjct  173   VILHVKETMNAHYSPLIVVGGSYGGMLASWFRLKYPHIALGALASSAPVLYFDDMISPNH  232

Query  723   GYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDY  902
             GY  +VTKDFKE SE+CY+TI+ SWS IDKI S  +GL+ LSKKF  C  L     LK++
Sbjct  233   GYNYVVTKDFKEASESCYRTIKNSWSEIDKIGSSGDGLAYLSKKFNTCVHLADTSALKNF  292

Query  903   LDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGL--EGNRTCYDPQIY  1076
             L S Y + AQY      P T +C  ID   K  DI+ RI+AGV+      +  C D   +
Sbjct  293   LQSLYDSTAQYGNLETNPST-ICKAIDEGMKTTDIVSRIYAGVLDYFNSTHHDCVDTNYF  351

Query  1077  NPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1256
                  E+IVG+ WQTCSEM MPIG   + +MF P PF+++ F +DC + Y V PRPHWIT
Sbjct  352   Q--IGESIVGYDWQTCSEMVMPIGTS-KWSMFPPQPFNLRDFIQDCKNKYNVMPRPHWIT  408

Query  1257  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1436
             +YYGGHD+KL+  +FGSNIIFSNGL+DPYSSAGVL ++SD+++AVY   GSHC+DI  A 
Sbjct  409   SYYGGHDMKLIFGRFGSNIIFSNGLQDPYSSAGVLYNLSDSIIAVYATQGSHCVDIQHAK  468

Query  1437  KTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             K DP+WL   R  E+EII  WI KYY +L+
Sbjct  469   KDDPEWLINMRNTEIEIISGWIRKYYDDLK  498



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score =   513 bits (1321),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 250/451 (55%), Positives = 321/451 (71%), Gaps = 13/451 (3%)
 Frame = +3

Query  171   SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAE  350
             + +++ LPPEF T YY QTLDHFNY+P+SY TF+QRYI++SKYWGG  ++SPIF + GAE
Sbjct  32    TDATEELPPEFVTLYYTQTLDHFNYKPESYETFQQRYILNSKYWGGPNTSSPIFVYAGAE  91

Query  351   SPID-DDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQA  527
               I    P   GF+   A RF ALL+YIEHR+YG+S PFG    ++ N TT GY +SAQA
Sbjct  92    CNITLVIPPGGGFMAHLASRFNALLLYIEHRFYGESNPFG--PSSLQNATTLGYLSSAQA  149

Query  528   LADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDN  707
             LADYA+++L +K    A+ SP+IV GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+
Sbjct  150   LADYAQLILDVKKNLSAESSPVIVVGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDD  209

Query  708   ITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPG  887
             ITP++G++ + +KDFK+ SE+CY TI++SWS IDK+A++ NGL  L   F LC  L S G
Sbjct  210   ITPQDGFFVVASKDFKDTSESCYNTIKQSWSEIDKVAAQQNGLETLRSIFSLCDRLHSVG  269

Query  888   ELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDP  1067
              LK  L   Y  +AQYD PP + V +VCG I+GAP+G D L RI AG+     N + +  
Sbjct  270   MLKFILRRVYLYSAQYDNPPYFYVEKVCGAINGAPEGTDTLGRIAAGL-----NASIF--  322

Query  1068  QIYNPPTSETIVG---WRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
               ++ PT ++IV    W WQ C+E+ MPIG  + +TMF   PF M +    C   +G+ P
Sbjct  323   SCHSNPTWKSIVDEDLWLWQVCTELVMPIGLDNNNTMFEALPFDMNRHVNMCQSIFGISP  382

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCL  1418
             RPHWITT YGGHDIK VL  F SNIIFSNGLRDP+S  GVLEDISD+V+A+ T  G+HCL
Sbjct  383   RPHWITTEYGGHDIKSVLGNFASNIIFSNGLRDPFSVGGVLEDISDSVVAIKTEKGAHCL  442

Query  1419  DIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1511
             D+Y A+  D DWL  QR++E+ II  WI +Y
Sbjct  443   DLYTATPNDSDWLVAQREEEINIIAHWIDEY  473



>emb|CDY09174.1| BnaA02g06000D [Brassica napus]
Length=502

 Score =   508 bits (1308),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 325/450 (72%), Gaps = 6/450 (1%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             + + +YY Q LDHF++ P+SY TF+QRY V SK+W GA +++PI A+LG E+ ++ D   
Sbjct  51    DLKFFYYDQILDHFSFTPESYQTFQQRYAVDSKHWAGANASAPILAFLGEEAWLEVDLHD  110

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             +GF  DN PR KAL VYIEHRYYG S+PFG+ +EA+ N TT GY N+AQALADYA +L++
Sbjct  111   VGFFQDNGPRLKALCVYIEHRYYGMSMPFGSAKEALKNATTLGYLNAAQALADYAAILVH  170

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K KY A+HSPIIV G SYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY +
Sbjct  171   VKEKYSAKHSPIIVVGASYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKYGYYHV  230

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T  FKE SE CY+TIRKSW  ID++A+K NGL ILSKKF+ C  L    ++KD+LDS Y
Sbjct  231   ITNVFKETSERCYKTIRKSWREIDRVAAKSNGLLILSKKFRTCAPLSRSFDIKDFLDSIY  290

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
               + Q+++ P   V  +C  ID  P   + +LDRI AG+V   GN++CYD  ++  P+++
Sbjct  291   AESVQFNRNPGDWVATLCNAIDNPPNRKNYVLDRIFAGIVAYIGNQSCYDTGLFIQPSND  350

Query  1095  TIVGWRWQTCS----EMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTY  1262
              ++ W WQ C+    E+ MPIG    DTMF  APF+M     +C   YGV PRPHW+TTY
Sbjct  351   -VIAWSWQACTLHFGEIMMPIGHDKHDTMFQTAPFNMTSAIDNCKSSYGVSPRPHWVTTY  409

Query  1263  YGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKT  1442
             +G  D+KL+L +FGSNIIFSNGL DPYS  GVLED+SD+++A+ T  G+H  D+    K 
Sbjct  410   FGIQDVKLILRRFGSNIIFSNGLADPYSVGGVLEDVSDSIVAIKTLKGTHSQDLSTRRKD  469

Query  1443  DPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             DP+WL  QR+KE++II+SWI+ Y  +L  L
Sbjct  470   DPEWLVMQREKEIKIIESWISTYQKDLRGL  499



>ref|XP_006286678.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
 gb|EOA19576.1| hypothetical protein CARUB_v10002667mg [Capsella rubella]
Length=424

 Score =   503 bits (1296),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/424 (58%), Positives = 304/424 (72%), Gaps = 6/424 (1%)
 Frame = +3

Query  267   FKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYY  446
             F+QRY V+SKYW G +SN+PI A+LGAES +D D   IGF+ DNAP FKAL+VYIEHR+Y
Sbjct  3     FRQRYAVNSKYWEGGKSNAPILAYLGAESSMDGDLGNIGFIEDNAPHFKALIVYIEHRFY  62

Query  447   GKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGML  626
             GK++PFG+ EE +    T GY N+AQALADYA +LL++K  Y A HSP+IV GGSYGGML
Sbjct  63    GKTMPFGSAEETLKTAKTLGYLNTAQALADYALILLHIKESYSAHHSPVIVIGGSYGGML  122

Query  627   ASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVI  806
             A+WF+LKYPH+ALGALASSAP+LYF+   P++GY+ +VTK FK+ S+ C+  IR+SW  I
Sbjct  123   AAWFKLKYPHIALGALASSAPLLYFEETLPKHGYFYIVTKVFKQTSKKCHDQIRRSWDEI  182

Query  807   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPP-KYPVTEVCGGID  983
             D IA+KP GLSILSKK KLC  LK   ELK +L   Y   AQY+       VT VC  I+
Sbjct  183   DIIAAKPAGLSILSKKIKLCNPLKDTYELKSFLSYVYAGTAQYNNNVYSATVTSVCEAIN  242

Query  984   GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1163
               P   D+LD+I AGVV   GN +CY    +N  T+     W WQ CSE+ MPIG  + D
Sbjct  243   TTPP-RDLLDQIFAGVVAYAGNISCYG---FNQLTNSD-RAWGWQVCSEIVMPIGYNEED  297

Query  1164  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1343
             +MF   P++M  +S DC   YGV PRPHWIT++YG  D+KL+  +FG+NIIFSNGL DPY
Sbjct  298   SMFQTRPYNMTSYSEDCQSNYGVIPRPHWITSHYGTQDVKLIFRRFGNNIIFSNGLLDPY  357

Query  1344  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             S   VLE+ISDTV+A+ T NGSHC+DI    K DPDWL EQR+KEV+II SWI  Y  +L
Sbjct  358   SVGSVLENISDTVVAITTNNGSHCMDITLKRKDDPDWLVEQREKEVQIIGSWIRTYQKDL  417

Query  1524  EALK  1535
             + LK
Sbjct  418   KELK  421



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   506 bits (1303),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/484 (54%), Positives = 332/484 (69%), Gaps = 18/484 (4%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             TP  +PRL     + + R  ++ S I   +F+TY+Y QTLDHFNYRP+SY TF+QRY+++
Sbjct  30    TPLNMPRLGVIPDTEVWRLRAAQSSI-SSDFKTYFYTQTLDHFNYRPESYTTFQQRYVIN  88

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              KYWGGA+S +PI  +LGAE  +D+   + GFLTD+AP+F AL+VYIEHRYYG+S+PFG 
Sbjct  89    FKYWGGAKSGAPILVYLGAEQSLDN-INFDGFLTDHAPQFNALIVYIEHRYYGESVPFGK  147

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
             ++    N +T GYF+S+QAL DYAE++L +K    A   P+IV GGSYGGMLASWFRLKY
Sbjct  148   VQ----NASTLGYFSSSQALEDYAEIILDIKKNLSANGCPVIVIGGSYGGMLASWFRLKY  203

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIAS---  821
             PH+ALGALASSAPILYFD+ITP++G+ S+ ++ FK+ S++CY TI +SW+ IDK+AS   
Sbjct  204   PHIALGALASSAPILYFDDITPDDGFLSVASRVFKKTSKSCYNTILQSWAEIDKVASSQP  263

Query  822   KPNGLSILSKKFKLCK-GLKSPGELKDYLD-STYCTAAQYDQPPKYPVTEVCGGIDGAPK  995
             +  GLSIL  +FK C     +  ELK YL  S Y  AAQYD P +  V  +C  IDG PK
Sbjct  264   QGQGLSILHNRFKTCGVSFTNLSELKGYLTYSIYARAAQYDYP-RRSVDLICKAIDGTPK  322

Query  996   GA--DILDRIHAGVVGLEGNRTCYD--PQIYNPPTSE--TIVGWRWQTCSEMAMPIGRGD  1157
                 DI+ +I AGV   +GN +     P    P   +      W WQTC+EM MPIG G 
Sbjct  323   AGTTDIVGKIIAGVSAYKGNVSSKSNVPSALAPGNVQLNENTAWNWQTCTEMVMPIGGGI  382

Query  1158  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1337
               T+F   PF +      C  +YGV PRPHWITTY+GGHDIK VL +FGSNIIFSNGLRD
Sbjct  383   NATLFPVPPFDLNSRIETCKSFYGVSPRPHWITTYFGGHDIKRVLKRFGSNIIFSNGLRD  442

Query  1338  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1517
             PYS AGVL  +S +++A+ T+ GSHCLD+  AS  DP WLT QR +EV II  WIT+Y  
Sbjct  443   PYSVAGVLRSLSHSLVALITKQGSHCLDLLPASPDDPHWLTAQRSREVRIIARWITQYKA  502

Query  1518  ELEA  1529
             +  A
Sbjct  503   DRAA  506



>ref|XP_004293172.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=522

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/479 (53%), Positives = 330/479 (69%), Gaps = 12/479 (3%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPRL+   R    R  S+S  +    FRTY+Y QTLDHF+Y P SY TF QRY+VSS +W
Sbjct  39    IPRLSILQRPITFRNHSNSVAV-RHRFRTYFYAQTLDHFSYEPASYTTFLQRYMVSSMHW  97

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
              GA + +PIF +LG E  +++    IGFLTDNA +F AL+VY+EHRYYGKSIP     + 
Sbjct  98    RGALAAAPIFVYLGGEESLEESIGSIGFLTDNAQKFGALMVYLEHRYYGKSIPSRDNMQD  157

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N T+ GY NS QALADYA+++L+LK    A+ SP+IV GGSYGGMLA+WFRLKYPH+A
Sbjct  158   IYNTTSLGYLNSGQALADYADIILHLKRNLSAEASPVIVIGGSYGGMLAAWFRLKYPHIA  217

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK-IASKPNGLS  839
             +GALASSAP+LYFD+ITP +G++S+V+ +F+E SE+CY TI+KSWS ID+ +  + NGL 
Sbjct  218   MGALASSAPLLYFDDITPSDGFHSVVSDNFREASESCYNTIKKSWSEIDRMVLDQDNGLD  277

Query  840   ILSKKFKLCKGLKSPG--ELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI-DGAPKGADIL  1010
             +L++KF+ C+ L+     ELK YL++ Y TA+QYD PP YPV+++C  I + A +G D +
Sbjct  278   MLTEKFRTCEPLEDGDELELKTYLENLYITASQYDDPPTYPVSQICNSIEEAAARGDDTI  337

Query  1011  DRIHAGVVGL----EGNRTCYDPQIYNPPTSETIVG--WRWQTCSEMAMPIGRGDRDTMF  1172
             DRI + V  L    E +  C +      P+ +T+ G  W WQ C+E+ MPIGR   +TMF
Sbjct  338   DRIASAVNNLTRPGENSGRCLELSSELRPSDDTVNGLNWLWQACTELLMPIGRETNETMF  397

Query  1173  FPAPFSMQQFSRDCDDYY-GVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
                PF +  +SR C   Y G   RP+WITTYYGGH I++ L KF SNIIFSNG RDP+S+
Sbjct  398   QAEPFDVDSYSRMCRQLYQGSRLRPNWITTYYGGHHIRMTLEKFASNIIFSNGRRDPFSA  457

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             AGVL +IS +V+AV T  GSHCLDI  A   DP WL  QR  E+ II  WI  YY +L 
Sbjct  458   AGVLTNISPSVVAVTTSQGSHCLDILPARINDPRWLVLQRNIELGIIAGWIRNYYNDLR  516



>gb|KFK36399.1| hypothetical protein AALP_AA4G119300 [Arabis alpina]
Length=1109

 Score =   517 bits (1332),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/451 (56%), Positives = 324/451 (72%), Gaps = 3/451 (1%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             T  ++ P   S   RP          + +T+YY Q LDHF Y P+SY TF+QRY + SK+
Sbjct  24    THSKVAPLGISPTTRPTKKVDAFADSDIKTFYYDQNLDHFTYTPESYKTFQQRYAIDSKH  83

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             W GA++N+PI A+LG ES +++D   +GF  DN PR KA+LVYIEHRYYGKS+PFG+ +E
Sbjct  84    WAGAKANAPILAFLGEESWLENDLFRVGFFQDNGPRLKAILVYIEHRYYGKSMPFGSAKE  143

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ NE+T GY N+AQALADYA +LL++K KY A+HSPIIV G SYGGMLA+WFRLKYPH+
Sbjct  144   ALKNESTLGYLNAAQALADYAAILLHVKEKYSAKHSPIIVVGASYGGMLAAWFRLKYPHI  203

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAP+LYF +  P+ GYY ++TK FKE SE CY TIR SW  ID+IA+K NGL 
Sbjct  204   ALGALASSAPLLYFQDTRPKFGYYYIITKIFKETSERCYNTIRTSWEEIDRIAAKSNGLL  263

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILD  1013
             ILSKKFK C  L    ++KD+LDS Y  A Q+++     VT +C  I+  P  +  D+LD
Sbjct  264   ILSKKFKTCAPLSRTFDIKDFLDSIYAEAVQFNRNTGDWVTTICNAINDNPANRKHDVLD  323

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             R+ AGVV   GN++CYD  ++  P++++I  WRWQ CSE+ MPIG   +DTMF  APF+M
Sbjct  324   RVLAGVVAYIGNQSCYDTDLFVRPSNDSI-AWRWQGCSEIVMPIGYDKQDTMFPTAPFNM  382

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
               F  DC   YGV PRPHWITTY+G  D+KL+L +FGSNIIFSNGL DPYS  GVLED+S
Sbjct  383   TSFIDDCKSNYGVTPRPHWITTYFGIQDVKLILKRFGSNIIFSNGLADPYSVGGVLEDVS  442

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQ  1466
             D+V+A+ T NG+HC D+      DP+WL ++
Sbjct  443   DSVVAIKTVNGTHCQDLSLRRNEDPEWLLQR  473



>ref|XP_011004991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 266/472 (56%), Positives = 328/472 (69%), Gaps = 59/472 (13%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +  T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  62    HTIPRLSPIGPRVWLDHPDQILGESVREDLETFFYNQTLDHFNYRPESYDTFLQRYLINS  121

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  122   KYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIPFGSR  181

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  182   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  241

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++ASKP+G
Sbjct  242   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVASKPDG  301

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  302   LSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGDDLLG  361

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET  GWRWQ+                      
Sbjct  362   RVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQS----------------------  395

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
                                           I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  396   ------------------------------IRLILQRFASNIIFSNGLRDPYSSGGVLEN  425

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  426   ISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  477



>ref|XP_011005222.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Populus 
euphratica]
Length=480

 Score =   494 bits (1271),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 265/472 (56%), Positives = 328/472 (69%), Gaps = 59/472 (13%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +  T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  62    HTIPRLSPIGPRVWLDHPDQILGESVREDLETFFYNQTLDHFNYRPESYDTFLQRYLINS  121

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA + +PI  +LGAE+PID+D   IGFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  122   KYWGGANACAPILVYLGAEAPIDEDLDVIGFLVDTAAEFSSLLVYVEHRYYGKSIPFGSR  181

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  182   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  241

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIRKSW  ID++ASKP+G
Sbjct  242   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRKSWEEIDEVASKPDG  301

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    EL+++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  302   LSILSKKFKTCNPLTDASELRNHLDSMYANAAQYNKPPTYPVNKVCGGIDGGGFGDDLLG  361

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             R+  G+V  +GNR+CY     N PT  SET  GWRWQ+                      
Sbjct  362   RVFGGLVAYKGNRSCY----VNEPTNQSETSAGWRWQS----------------------  395

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
                                           I+L+L +F SNIIFSNGLRDPYSS GVLE+
Sbjct  396   ------------------------------IRLILQRFASNIIFSNGLRDPYSSGGVLEN  425

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ISDTV+AV T NGSHCLDI  A +TDP+WL  QRK E++II+ WI KYY +L
Sbjct  426   ISDTVVAVKTVNGSHCLDILFAKETDPEWLVAQRKTEIKIIKEWINKYYADL  477



>ref|XP_010421084.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=437

 Score =   490 bits (1262),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 230/399 (58%), Positives = 292/399 (73%), Gaps = 5/399 (1%)
 Frame = +3

Query  165   PESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLG  344
             P+  +  I   + + +Y++QTLDHF + P+SY TF+QRY + SK+W GA++N+PI A+LG
Sbjct  42    PDRPTQKIAESDLKLFYFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLG  101

Query  345   AESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQ  524
              ES ++ D    GFL DNAP FKAL VYIEH YYGK+IPFG+++EAM N +T GY N+AQ
Sbjct  102   LESSLETDFSAFGFLRDNAPHFKALCVYIEHTYYGKTIPFGSVKEAMKNASTLGYLNTAQ  161

Query  525   ALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFD  704
             ALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF+
Sbjct  162   ALADYAAILLHVKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFE  221

Query  705   NITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSP  884
             +  P+ GYY ++TK FKE ++ CY TIRKSW  IDK+A+KPNGL IL KKFK C  L   
Sbjct  222   DTRPKFGYYYIITKVFKETNKRCYNTIRKSWKQIDKVAAKPNGLLILGKKFKTCAPLNKS  281

Query  885   GELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTC  1058
              +LKD+LD+ Y  A QY++   + VT VC  I+  P  +  DILDRI AGVV L GN++C
Sbjct  282   FDLKDFLDTIYAEAVQYNE--GFLVTNVCSAINANPPNRKIDILDRIFAGVVALTGNQSC  339

Query  1059  YDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPP  1238
             YD   Y+   +   + WRWQ CSE+ +P+G   +D MF  +PF+M  F   C+  YGV P
Sbjct  340   YDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDAMFPTSPFNMTSFIEGCESNYGVSP  398

Query  1239  RPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             RPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS  G
Sbjct  399   RPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVGG  437



>ref|NP_197677.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|AED93089.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=439

 Score =   489 bits (1260),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 302/413 (73%), Gaps = 3/413 (1%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             I RL    ++    P+ S+  +     + YY++QTLDHF + P+SY TF+QRY + S +W
Sbjct  28    IARLGISSKTLKNEPDGSTQKVDESNLKMYYFNQTLDHFTFTPESYMTFQQRYAIDSTHW  87

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
             GGA++N+PI A+LG ES +D D   IGFL DN PR  ALLVYIEHRYYG+++PFG+ EEA
Sbjct  88    GGAKANAPILAFLGEESSLDSDLAAIGFLRDNGPRLNALLVYIEHRYYGETMPFGSAEEA  147

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             + N +T GY N+AQALADYA +LL++K KY   HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  148   LKNASTLGYLNAAQALADYAAILLHVKEKYSTNHSPIIVIGGSYGGMLAAWFRLKYPHIA  207

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY +VTK FKE SE CY TIR SW  ID++A KPNGLSI
Sbjct  208   LGALASSAPLLYFEDTRPKFGYYYIVTKVFKEASERCYNTIRNSWIEIDRVAGKPNGLSI  267

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDR  1016
             LSK+FK C  L    ++KD+LD+ Y  A QY++ P + V +VC  I+  P  +  ++LDR
Sbjct  268   LSKQFKTCAPLNGSFDIKDFLDTIYAEAVQYNRGPNFWVAKVCNAINANPPNRRYNLLDR  327

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV L GNRTCYD +++  PT+  I  WRWQ+CSE+ MP+G   +DTMF  APF+M 
Sbjct  328   IFAGVVALVGNRTCYDTKMFAQPTNNNI-AWRWQSCSEIVMPVGYDKQDTMFPTAPFNMT  386

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
              +   C  Y+GV PRPHWITTY+G  ++KL+L KFGSNIIFSNGL DPYS  G
Sbjct  387   SYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVGG  439



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score =   486 bits (1251),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/389 (59%), Positives = 288/389 (74%), Gaps = 2/389 (1%)
 Frame = +3

Query  357   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALAD  536
             +D+D    G LTDNA RF AL+V+IEHR+YG+S+PF + EEA+ N T RGYF+SAQALAD
Sbjct  1     MDNDIDVAGILTDNADRFGALVVFIEHRFYGESVPFVSREEALRNATLRGYFSSAQALAD  60

Query  537   YAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP  716
             YAE++LY+K +  A  SP+IVFGGSYGGMLA+WFRLKYPH+ALGALASSAPILYFD + P
Sbjct  61    YAEIILYIKKELSADKSPVIVFGGSYGGMLATWFRLKYPHIALGALASSAPILYFDGLIP  120

Query  717   ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELK  896
             ++ Y+++ +KDF E SE+CY TI +SW+ ID+ A+  NGLS+LSKKFK CK L++  ELK
Sbjct  121   QDSYFAVASKDFWETSESCYNTIVQSWAEIDRFAAMENGLSLLSKKFKTCKNLENVYELK  180

Query  897   DYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIY  1076
             + L +TY  +AQYD+P  + V+ VC  I  AP+G DILD+I  G V   G + CYDP   
Sbjct  181   EILVTTYAASAQYDKPSNH-VSRVCEAITSAPQGTDILDKIFLGFVAFAGKKDCYDPNTL  239

Query  1077  NPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWIT  1256
                + ET  GW WQ CS++ +P+G     TMF   PF M+ F+  C + YGV PRPHW+T
Sbjct  240   F-WSQETTEGWNWQVCSDLVIPMGIDSNRTMFQHDPFVMEIFTESCKESYGVLPRPHWVT  298

Query  1257  TYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGAS  1436
             TYYGG  IK VL +FGSNIIFSNGLRDPYSS GVLEDISD+++A+ TR GSHC+DI  A+
Sbjct  299   TYYGGQHIKEVLRRFGSNIIFSNGLRDPYSSGGVLEDISDSIVALTTREGSHCMDILYAT  358

Query  1437  KTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             K DP+WL  QR   +EII  WI  YY +L
Sbjct  359   KDDPEWLVLQRNTALEIISGWILTYYQDL  387



>ref|XP_008458666.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Cucumis 
melo]
Length=365

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 284/368 (77%), Gaps = 4/368 (1%)
 Frame = +3

Query  435   HRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSY  614
             HRYYGKSIPF + +EA+ N +T GYFNSAQA+ADYA +L+++K ++ A +SP+IV GGSY
Sbjct  2     HRYYGKSIPFRSRDEALGNASTLGYFNSAQAIADYAAILIHVKKEFHANYSPVIVIGGSY  61

Query  615   GGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKS  794
             GGMLASWFRLKYPHVALGALASSAPILYFD+ITP++GYYS+VTKDF+ +SE CY+TI+KS
Sbjct  62    GGMLASWFRLKYPHVALGALASSAPILYFDDITPQDGYYSVVTKDFRGLSETCYETIKKS  121

Query  795   WSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCG  974
             WS I  +AS+PNGLSIL ++FK C+ L+   EL+DYL S Y +AAQY+ PPKYPVT +C 
Sbjct  122   WSEIKTVASQPNGLSILDQEFKTCRPLRGYFELEDYLWSMYASAAQYNHPPKYPVTRICD  181

Query  975   GIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1154
              IDG       L +I AGV    G+ +CY  +  N   +ET VGWRWQ+CSEM MPI   
Sbjct  182   AIDGTYSVNGTLSKIAAGVFAFRGSISCYINEPRN--ETETDVGWRWQSCSEMVMPI--S  237

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
               D MF P PF +Q     C+  YGVPPRPHW TTYYGGHDI+LVL +FGSNIIFSNGL+
Sbjct  238   SDDDMFPPYPFDLQSVINYCNRLYGVPPRPHWATTYYGGHDIRLVLQRFGSNIIFSNGLK  297

Query  1335  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             DPYS AGVL  ISD++LAV+T NGSHCLDI  A +TDP+WL  QRK EV II+ WI++YY
Sbjct  298   DPYSIAGVLHSISDSLLAVHTTNGSHCLDILKAHETDPEWLVTQRKTEVGIIKGWISEYY  357

Query  1515  VELEALKR  1538
              +L+  K+
Sbjct  358   ADLKKYKQ  365



>ref|XP_010254367.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Nelumbo 
nucifera]
Length=476

 Score =   484 bits (1245),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 313/450 (70%), Gaps = 10/450 (2%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F TY+Y Q LDHFNYR +S ATF+Q+Y+++SK+WGGA S++PIF +LGA +P+DD  + 
Sbjct  26    DFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSAPIFVYLGANAPLDDQIRR  85

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGF+TDNAP+F ALLVYIEHR+YG+S PFG+ EEA  N+ T  Y N +Q L DYAEV+L 
Sbjct  86    IGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTLDYLNLSQTLEDYAEVILD  145

Query  558   LKNKYLAQHS-PIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP--ENGY  728
             +K    A +S P+IV GGSYGG+LA+ FRL+YP++ALGALASSAPILY D + P  ++GY
Sbjct  146   IKKNLSANNSTPVIVIGGSYGGVLATLFRLRYPYIALGALASSAPILYLDGLKPQLQDGY  205

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
             +S+V+KDF+E SE+CY TI++SWS IDKIAS+ +GLS+LS++F  C  L++   LKD L 
Sbjct  206   FSIVSKDFREASESCYNTIQQSWSEIDKIASQEDGLSVLSRRFNTCTPLENSSWLKDALK  265

Query  909   STYCTAAQYDQPP-KYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1085
               Y  AAQYD P     V  +C  ID A  G D+LD++ A +           P  Y   
Sbjct  266   LVYAAAAQYDAPQINQAVNLICTAIDRATNGTDVLDKVIAAMFAFFSKYP--GPHEYCDE  323

Query  1086  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVP--PRPHWITT  1259
               +    W WQ C+E+ +P G    DTMF   PF++  +   C   Y +   P P WIT+
Sbjct  324   MHQW--AWNWQICTEILIPTGISGTDTMFQAEPFNLTSYKETCKGLYDLRLMPEPFWITS  381

Query  1260  YYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK  1439
              +GG D+KLVL +FGSNIIFSNGLRDP+S+ GVLE +SD+++A+ T  GSHCLDIY A  
Sbjct  382   QFGGQDVKLVLGRFGSNIIFSNGLRDPFSAGGVLESLSDSLVALPTAKGSHCLDIYAALP  441

Query  1440  TDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
              DPDWL  QR+ E++II  WI +Y+++  A
Sbjct  442   NDPDWLIVQRRSELKIISQWIAQYHMDRAA  471



>gb|KCW50728.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=409

 Score =   480 bits (1236),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 234/387 (60%), Positives = 291/387 (75%), Gaps = 9/387 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P L+      LR PE + S  +  +F T++++QTLDHFNYRP+SY TF+QRY++ S++WG
Sbjct  27    PTLSLQREGVLRDPERAVSASIADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAESPID  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA
Sbjct  87    GANSSAPIFVYLGAESPIDGSPTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             ++    RGYF+SAQALADYA +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ 
Sbjct  147   LHETNIRGYFSSAQALADYAAIIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLT  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPILYFD+ITP++ YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S 
Sbjct  207   VGALASSAPILYFDDITPQDAYYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSN  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRI  1019
             LS+ FK CK L+S  ELK+YL S Y  AAQYD PP+YPVT +C GIDGA    + IL +I
Sbjct  267   LSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AGVV  +GN  CY     NPPT  S+T +GW WQ CSEM MPIG  + ++MF   PF++
Sbjct  327   FAGVVAYKGNSACY----VNPPTNVSQTDLGWGWQRCSEMVMPIGITN-NSMFQSYPFNL  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGH  1274
               F  +C+D YGV PRPHWITTYYGGH
Sbjct  382   SSFIDECNDQYGVTPRPHWITTYYGGH  408



>emb|CBI17114.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   478 bits (1229),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 281/389 (72%), Gaps = 4/389 (1%)
 Frame = +3

Query  189   LPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDD  368
             L PEF TY+Y+QTLDHFNY+P+SY TF+QRYI++S+YWGGA S+SPIF + G E+ I   
Sbjct  44    LLPEFVTYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAV  103

Query  369   PKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEV  548
               + GF+ + A RF  LL+YIEHRYYG S+PFG+ +EA +N +T GYF S QALADYAE+
Sbjct  104   AAFAGFIVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAEL  163

Query  549   LLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGY  728
             +  LK    A++ P+I  GGSYGGMLASWFRLKYPH+ +GALASSAPILYFD+ITP N Y
Sbjct  164   ITNLKKNLSAENCPVIAIGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPGNAY  223

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
             + +VTKDF+E SE+CY TIR SWS IDK+A++PNGL+ LS+ F  C+ L S  ELK YL 
Sbjct  224   HVIVTKDFRETSESCYSTIRDSWSEIDKVAAEPNGLANLSQIFMTCEPLNSSQELKYYLA  283

Query  909   STYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT  1088
               Y  +AQ D PP YPV +VC  IDGAP+G DI+ R+ AG+    G   C+    + P  
Sbjct  284   LCYVVSAQNDNPPAYPVKKVCDAIDGAPEGTDIIGRVAAGLNASVG-PPCHFVYDFKPSN  342

Query  1089  SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYG  1268
                   W WQTC+EM MPIG G  DTMF   PF +   ++ C D +GV PRPHWITT +G
Sbjct  343   RSE---WTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWITTEFG  399

Query  1269  GHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             GHDIK V+  F SNIIFSNGLRDPYS+ G
Sbjct  400   GHDIKSVVGNFASNIIFSNGLRDPYSAGG  428



>ref|XP_010254366.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 234/452 (52%), Positives = 313/452 (69%), Gaps = 12/452 (3%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +F TY+Y Q LDHFNYR +S ATF+Q+Y+++SK+WGGA S++PIF +LGA +P+DD  + 
Sbjct  26    DFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSAPIFVYLGANAPLDDQIRR  85

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGF+TDNAP+F ALLVYIEHR+YG+S PFG+ EEA  N+ T  Y N +Q L DYAEV+L 
Sbjct  86    IGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTLDYLNLSQTLEDYAEVILD  145

Query  558   LKNKYLAQHS-PIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP--ENGY  728
             +K    A +S P+IV GGSYGG+LA+ FRL+YP++ALGALASSAPILY D + P  ++GY
Sbjct  146   IKKNLSANNSTPVIVIGGSYGGVLATLFRLRYPYIALGALASSAPILYLDGLKPQLQDGY  205

Query  729   YSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLD  908
             +S+V+KDF+E SE+CY TI++SWS IDKIAS+ +GLS+LS++F  C  L++   LKD L 
Sbjct  206   FSIVSKDFREASESCYNTIQQSWSEIDKIASQEDGLSVLSRRFNTCTPLENSSWLKDALK  265

Query  909   STYCTAAQYDQPP-KYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPP  1085
               Y  AAQYD P     V  +C  ID A  G D+LD++ A +           P  Y   
Sbjct  266   LVYAAAAQYDAPQINQAVNLICTAIDRATNGTDVLDKVIAAMFAFFSKYP--GPHEYCDE  323

Query  1086  TSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVP--PRPHWITT  1259
               +    W WQ C+E+ +P G    DTMF   PF++  +   C   Y +   P P WIT+
Sbjct  324   MHQW--AWNWQICTEILIPTGISGTDTMFQAEPFNLTSYKETCKGLYDLRLMPEPFWITS  381

Query  1260  YYGG--HDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1433
              +GG   D+KLVL +FGSNIIFSNGLRDP+S+ GVLE +SD+++A+ T  GSHCLDIY A
Sbjct  382   QFGGQQQDVKLVLGRFGSNIIFSNGLRDPFSAGGVLESLSDSLVALPTAKGSHCLDIYAA  441

Query  1434  SKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
                DPDWL  QR+ E++II  WI +Y+++  A
Sbjct  442   LPNDPDWLIVQRRSELKIISQWIAQYHMDRAA  473



>ref|XP_006494702.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   474 bits (1220),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 272/341 (80%), Gaps = 8/341 (2%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL+P   + L+  E  SS  +  +F+T+YY+QTLDHFNYRP+SY+TF+QRYI++
Sbjct  27    TSFDIPRLSPIRETILQNFEILSSATISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  291   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  464
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  465   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A HSP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATHSPVIVIGGSYGGMLAAWFRL  206

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1004
             P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGIDGA  G D
Sbjct  267   PDGLAILSNKFRTCRPLGDSYELKGYLRLMYAYAAQYNHPPDYPVSMVCGGIDGAAFGND  326

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQT  1121
             IL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ 
Sbjct  327   ILSKIFAGVVAYEGNMSCY----VNPPTNETETTVGWRWQV  363



>ref|XP_004172321.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal Pro-X carboxypeptidase-like 
[Cucumis sativus]
Length=440

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 233/387 (60%), Positives = 288/387 (74%), Gaps = 5/387 (1%)
 Frame = +3

Query  207   TYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGF  386
             T+ Y Q LDHFNY+PQSY TF QRYI+  KYW G    +PIFA+LGAES ID+D  Y+GF
Sbjct  55    TFXYKQPLDHFNYQPQSYVTFDQRYIIDFKYWEGINPKTPIFAYLGAESDIDNDVPYVGF  114

Query  387   LTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  566
                 A ++KA+ VY+EHR+YGKSIPFG++E+AM N + RGYFNSAQALADYAE+LL++K 
Sbjct  115   PLRFASQYKAMSVYLEHRFYGKSIPFGSLEKAMKNGSIRGYFNSAQALADYAELLLHIKK  174

Query  567   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  746
              +    SPIIV G SYGGMLASWFRLKYPH+ALGALASSAPILYFDNITP++GYYS+V+K
Sbjct  175   MFAYDTSPIIVMGASYGGMLASWFRLKYPHIALGALASSAPILYFDNITPQDGYYSIVSK  234

Query  747   DFKEVSENCYQTIRKSWSVIDKIASKPN-GLSILSKKFKLCKGLKSPGELKDYLDSTYCT  923
              FKE S+ C+ TIR+SW  ID+IA K   GLSILSK+FK C  LK+  E+K+ +DS +  
Sbjct  235   SFKETSKTCHDTIRRSWGEIDRIAGKTQGGLSILSKQFKTCGKLKTSSEIKNLMDSVFTM  294

Query  924   AAQYDQPPKYPVTEVCGGID-GAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETI  1100
             AAQY+ P + PV  +C  ID  A K ++++ ++ AGV+   G R CYD   +  P ++ +
Sbjct  295   AAQYNDPYENPVRGICVAIDEEAKKKSNVIKQVVAGVIAYLGERPCYDVYEFGYP-NDPL  353

Query  1101  VGWRWQTCSEMAMPIGRGDRD--TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
               + WQ CSEM MPIG   RD  +MF P+PF    F   C D YGV PRPHWITT+YGG 
Sbjct  354   NQYGWQVCSEMVMPIGSSGRDKNSMFPPSPFQFNDFKTMCKDLYGVTPRPHWITTFYGGQ  413

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             DIKLVLH+FGSNIIFSNGL+DPYSS G
Sbjct  414   DIKLVLHRFGSNIIFSNGLKDPYSSGG  440



>ref|XP_006424410.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
 gb|ESR37650.1| hypothetical protein CICLE_v10030022mg [Citrus clementina]
Length=436

 Score =   475 bits (1222),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/414 (55%), Positives = 293/414 (71%), Gaps = 3/414 (1%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             T P  +  + +  RR  S S+  LPPEF TYYY QTLDHFNY+P+SYATF+Q+YI + KY
Sbjct  24    TYPGSSTRFDTMRRRMTSKSNSHLPPEFVTYYYTQTLDHFNYKPESYATFQQKYIKNFKY  83

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGGA ++SPI  ++G E+P+       GF+ D A RFKA+L+YIEHRYYG S+PFG+ +E
Sbjct  84    WGGASTSSPIIVYIGEEAPLTFGVHGKGFIVDLASRFKAMLLYIEHRYYGDSMPFGSFDE  143

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A  +  T G+ +S QALAD A+++  +K    A++ P+I  GGSYGGMLASW RLKYPH+
Sbjct  144   AFRDANTLGFLSSTQALADCAQLITDVKRNLSAENCPVIAIGGSYGGMLASWLRLKYPHI  203

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             A GALASSAPILYFD++TP+NGY+ +VT DF++VSE+CY TI++SWS ID++A + NGL+
Sbjct  204   ATGALASSAPILYFDDLTPQNGYHVVVTNDFRDVSESCYNTIKQSWSEIDRVAGQTNGLT  263

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS  F+ C  L S  ELKD+L   Y  +AQ D PP  PV++VCG IDGAPKG DIL ++
Sbjct  264   TLSNIFQTCSPLNSSKELKDHLGMIYVISAQNDNPPYNPVSKVCGAIDGAPKGTDILGKV  323

Query  1020  HAGVVG--LEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AG+    L G        I +  T +   GW WQTC+EM MPIG G+ DTMF  +PF +
Sbjct  324   AAGLNASLLRGGPEAQCNHIID-FTPKNTSGWTWQTCTEMVMPIGHGENDTMFQGSPFDL  382

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
               +++ C   +GV P+PHWITT +GGHDIK VL  F SNIIFSNGLRDPYS  G
Sbjct  383   NNYTKSCQALFGVTPKPHWITTEFGGHDIKSVLGNFSSNIIFSNGLRDPYSVGG  436



>ref|XP_006494706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   471 bits (1213),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 229/341 (67%), Positives = 272/341 (80%), Gaps = 8/341 (2%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T   IPRL+P   + L+  E  SS  +  +F+T+YY+QTLDHFNYRP+SY+TF+QRYI++
Sbjct  27    TSFDIPRLSPIRETILQNFEILSSATISEDFQTFYYNQTLDHFNYRPESYSTFQQRYIIN  86

Query  291   SKYWGGA--QSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPF  464
              KYWGG   QSN+PIFA+LGAESP+D+ P  IGFLTDNAP+FKALLVYIEHRYYGKSIPF
Sbjct  87    FKYWGGGADQSNAPIFAYLGAESPLDNAPSVIGFLTDNAPQFKALLVYIEHRYYGKSIPF  146

Query  465   GTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
             G+ EEA+ N +T GYFNSAQA+ADYAE+LLY+K KY A +SP+IV GGSYGGMLA+WFRL
Sbjct  147   GSREEALKNASTLGYFNSAQAIADYAEILLYIKQKYNATNSPVIVIGGSYGGMLAAWFRL  206

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS ID++AS 
Sbjct  207   KYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWSKIDEVASH  266

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD  1004
             P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGIDGA  G D
Sbjct  267   PDGLAILSNKFRTCRPLGDSYELKGYLRLMYAYAAQYNHPPDYPVSMVCGGIDGAAFGND  326

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQT  1121
             IL +I AGVV  EGN +CY     NPPT  +ET VGWRWQ 
Sbjct  327   ILSKIFAGVVAYEGNMSCY----VNPPTNETETTVGWRWQV  363



>emb|CDP07009.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   467 bits (1202),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/407 (58%), Positives = 290/407 (71%), Gaps = 40/407 (10%)
 Frame = +3

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             + YWGGA S+SPIFA LGAESP+D D   +GF  D+AP F AL+VY+EHR+YG+S+PFG+
Sbjct  13    NTYWGGANSSSPIFAHLGAESPLDHDFLRVGFPVDHAPFFNALVVYVEHRHYGESVPFGS  72

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
             MEEA+ NETTRG+FNSAQA+ADYAEVLLY+K ++    SP+IV+GGSYGGMLA+WFRLKY
Sbjct  73    MEEALKNETTRGFFNSAQAIADYAEVLLYVKERF---SSPVIVYGGSYGGMLAAWFRLKY  129

Query  651   PHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             PH+A+GALASSAP+LYFDNIT P++GYY +VTKDF   S +CY+TI+ SW V+D IAS+P
Sbjct  130   PHIAIGALASSAPVLYFDNITRPQDGYYWIVTKDFPATSGSCYRTIKDSWDVVDNIASQP  189

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADI  1007
              GLSILS++FK C  L S  ELK++L S   ++AQY+ PP YP+T +C  ID A    DI
Sbjct  190   GGLSILSQRFKTCSHLNSGVELKNFLVSMCASSAQYNHPPDYPLTVLCEAIDRAGSRTDI  249

Query  1008  LDRIHAGVVGLEG-NRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
               +I AGV    G N +CYD   ++ PT ET  GW WQ CSEM MPIGR     MF PAP
Sbjct  250   FGQIFAGVESAFGKNSSCYDVNYFHRPT-ETNEGWGWQVCSEMVMPIGRTVEAHMFQPAP  308

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG---  1355
             F++ +F++ C   YGVPPRPHWITTYYGGHDIKL L KF SNIIFSNG +DPYSS G   
Sbjct  309   FNLTEFTQYCKLVYGVPPRPHWITTYYGGHDIKLTLQKFASNIIFSNGRKDPYSSGGYVI  368

Query  1356  -------------------------------VLEDISDTVLAVYTRN  1403
                                            VLED+SD++LA+ TR+
Sbjct  369   YTIKEIIVFCLSFEVMPILDHLVMVFWLIYRVLEDLSDSLLAISTRS  415



>gb|KCW50734.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=454

 Score =   465 bits (1197),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 294/422 (70%), Gaps = 12/422 (3%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP+L       L  P  +   ++  +F T++Y+QTLDHFNYRP+SY  F QRY+V+S+YW
Sbjct  35    IPKLGMSRPEFLLDPARAVQALVAEDFVTFFYNQTLDHFNYRPESYTAFNQRYVVNSEYW  94

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA S +PIFA+LGAE+PID D    GFLTDNA +F+ALLVYIEHR+YGKSIP+G T+E 
Sbjct  95    GGADSGAPIFAFLGAEAPIDGDIANAGFLTDNAAQFRALLVYIEHRFYGKSIPYGMTLER  154

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ +  TRGYF+SAQALADYAE+L++LK K  A+HSPIIVFGGSYGGMLASWFRLKYPHV
Sbjct  155   ALGDADTRGYFSSAQALADYAEILIHLKQKLKAEHSPIIVFGGSYGGMLASWFRLKYPHV  214

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAPILYFD+I P++ YYS+V K F E S +C+QTIR+SW  +D++AS+P GL+
Sbjct  215   ALGALASSAPILYFDDIIPQDAYYSVVAKSFLESSSSCHQTIRQSWEELDRVASEPRGLT  274

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRI  1019
              LS  FK C  L+S  ELK YL   Y    QY+ P   P+  +C  I+GAP    +L +I
Sbjct  275   KLSNAFKTCSPLQSSSELKKYLKLLYVQVVQYNDPSAQPLKLMCDAINGAPPRKGLLQKI  334

Query  1020  HAGVVGLEGNRTCYDPQIYNPPTS--ETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
              AG+V + GN TCY     NP  S  +T  GW WQTC+EMA PIG   R+TMF P PF++
Sbjct  335   FAGLVAINGNLTCY----VNPSGSDAQTPSGWFWQTCTEMAFPIGI-TRNTMFPPEPFNL  389

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGH----DIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
               FS  C   +GVP RP W+TTY+GGH      ++ L  F S+++  N    P   A  L
Sbjct  390   NSFSNACKSEFGVPARPRWVTTYFGGHVGHSANQINLAVFFSSLLLINFCAKPEEMASDL  449

Query  1362  ED  1367
              +
Sbjct  450   SN  451



>ref|XP_006436579.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
 gb|ESR49819.1| hypothetical protein CICLE_v10033867mg, partial [Citrus clementina]
Length=421

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 272/387 (70%), Gaps = 19/387 (5%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS-NSPIFAWLGAESPIDDDPK  374
             +  TYYY Q LDH NY PQSY TF  RY+++ K+WGG  +  +PI A+LG ES +DDD  
Sbjct  53    DLETYYYDQILDHSNYNPQSYLTFPHRYVLNFKHWGGGGAMAAPILAYLGEESSLDDDHG  112

Query  375   YIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLL  554
              IG+LTDNA RFKAL VYIEHR+YGKS+PF   ++A+ N T RGYFNSAQALADYAE+LL
Sbjct  113   GIGWLTDNAHRFKALEVYIEHRFYGKSVPFVPSKDALKNATLRGYFNSAQALADYAEILL  172

Query  555   YLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYS  734
             ++K    A+ SP IV G SYGGML +WFRLKYP +ALGA+ASSAPILYFDNITP N +Y 
Sbjct  173   HIKKNLSAEMSPTIVVGASYGGMLVAWFRLKYPDIALGAVASSAPILYFDNITPSNAFYD  232

Query  735   LVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST  914
             LV+KDF+E SE+CY+TI++SW    K   K NGL+ LSKKFK CK LK   ELKDYL+S 
Sbjct  233   LVSKDFREASESCYKTIKQSWLKSIKPLLKKNGLTFLSKKFKTCKPLKDVSELKDYLESM  292

Query  915   YCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSE  1094
             Y +AAQYD P +YPV + C GIDGA +G D L RI +G+V L G  +CYD          
Sbjct  293   YTSAAQYDDPQEYPVNKACNGIDGASEGTDTLGRIFSGIVALRGESSCYD----------  342

Query  1095  TIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGH  1274
                     TCSEM  PI  G  DT F   PF+  +    C+  YGV PRPHWITTY  GH
Sbjct  343   --------TCSEMVSPIKIGKNDTTFQANPFNPTESMDSCNKSYGVVPRPHWITTYCSGH  394

Query  1275  DIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             DI++VL +FGSNIIFSNGLR PY S G
Sbjct  395   DIRVVLKRFGSNIIFSNGLRYPYGSEG  421



>ref|XP_006369369.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
 gb|ERP65938.1| hypothetical protein POPTR_0001s220902g [Populus trichocarpa]
Length=435

 Score =   458 bits (1179),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 299/392 (76%), Gaps = 5/392 (1%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLR-RPESSS-SDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             +TIPRL+P      R +P+ ++  +    +F T++Y+QTLDHFNYRP+SY  F QRY+++
Sbjct  47    NTIPRLSPIGPRVWRDQPDKTTLGEFDGEDFETFFYNQTLDHFNYRPESYDKFPQRYLIN  106

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             SKYWGGA  ++PI  +LGAE PID+D   +GFL DNA +F +LLV+IEHRYYGKSIPFG+
Sbjct  107   SKYWGGANVSAPILVFLGAEEPIDEDLAAVGFLVDNAVQFNSLLVFIEHRYYGKSIPFGS  166

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              EEA+ + +  GYFNSAQA+ADYA +++++K    AQ+SP+IV GGSYGGMLASWFRLKY
Sbjct  167   REEALKDASKLGYFNSAQAIADYAAIIIHIKETLRAQYSPVIVIGGSYGGMLASWFRLKY  226

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+ITP++GYYS+VTKDF+E SE CYQTI+ SWS ID++ASKP+
Sbjct  227   PHIALGALASSAPILYFDDITPQDGYYSIVTKDFREASETCYQTIKTSWSEIDELASKPD  286

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADIL  1010
             GLS+LSKKFK C  L    ELKD+LD+ Y +AAQY++PP YPV EVC GIDG   G D L
Sbjct  287   GLSMLSKKFKTCNPLTDASELKDHLDTMYASAAQYNRPPTYPVNEVCKGIDGGGFGDDTL  346

Query  1011  DRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFS  1190
              RI  G+V   GN +CY     +P  SET VGW+WQ CSEMA+PIG G+ ++MF P PF 
Sbjct  347   SRIFGGLVAYNGNLSCYVNAHTDP--SETTVGWQWQKCSEMAIPIGVGN-NSMFPPDPFD  403

Query  1191  MQQFSRDCDDYYGVPPRPHWITTYYGGHDIKL  1286
             ++ +   C   YGVP RPHW+TTYYGGH   L
Sbjct  404   LKDYIEHCKSLYGVPTRPHWVTTYYGGHVCSL  435



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/450 (49%), Positives = 300/450 (67%), Gaps = 10/450 (2%)
 Frame = +3

Query  174   SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAES  353
             SS   L  ++ T  Y QTLDHF +RP  Y TF QRY+V+  YWGG Q+NSPIF  LG E 
Sbjct  69    SSRRPLSLDYTTNQYMQTLDHFTFRPDGYRTFPQRYLVNKTYWGGPQNNSPIFVCLGNEE  128

Query  354   PIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALA  533
              I     Y G +T++A  F+AL+V+IEHRYYG S+PFG+ +E+  N +T GY++++QALA
Sbjct  129   DIITQLPYFGIMTEHAADFRALIVFIEHRYYGTSMPFGSQDESYANASTLGYYSASQALA  188

Query  534   DYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT  713
             DYA V+  LK    A   P++VFGGSYGGMLA+W RLKYPH+ +GALASS+PILYF+++T
Sbjct  189   DYAIVITDLKKNLSADDCPVVVFGGSYGGMLAAWLRLKYPHITIGALASSSPILYFEDMT  248

Query  714   PENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGEL  893
             P + Y  +VTKDF++ S+ CY+ I++SW+ ++K+AS+P GL  L+K F  C+ L S  +L
Sbjct  249   PHDAYDRVVTKDFRDASDICYRRIKESWAEMEKVASQPGGLQKLAKLFNTCQSLSSWTDL  308

Query  894   KDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQI  1073
               ++      +AQY+      V  +C  I+   +G DIL R+ AG         C +   
Sbjct  309   FYWIYPALQVSAQYNFA---EVKAICRVINSQARGTDILTRLAAGAEYANEGLGCLN---  362

Query  1074  YNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWI  1253
                  S T+ GW WQTCSEM +P+      TMF  APF ++ +   C   YGV PRP+WI
Sbjct  363   ----LSTTLSGWDWQTCSEMVIPLAPNANTTMFPSAPFDLKSYFSGCFKTYGVLPRPYWI  418

Query  1254  TTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGA  1433
             TT +GGH+IK VL +FGSNIIFSNGLRDPYSS GVL++ISD+++A+  + G HC DI  +
Sbjct  419   TTEFGGHNIKRVLKRFGSNIIFSNGLRDPYSSGGVLKNISDSIVAITAKEGVHCEDIRSS  478

Query  1434  SKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             +  DP+WL EQR+KE+ II+ WI  Y + +
Sbjct  479   TNDDPNWLKEQRQKEINIIRKWIIDYKMSM  508



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   449 bits (1156),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/485 (45%), Positives = 317/485 (65%), Gaps = 16/485 (3%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEF-RTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             +P +  ++   + S++ RP+ +S  I   +F  T Y+ QTLDHFN++PQSY TF+QRY++
Sbjct  21    SPTSNAKIASRFPSSIVRPDLASLSIKSQQFYETKYFTQTLDHFNFQPQSYQTFQQRYLI  80

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             + KYWGGAQ+N+PIF + G E  I+   +  GF+ + AP+FKALLV+IEHR+YG SIPFG
Sbjct  81    NDKYWGGAQNNAPIFVYTGNEGDIEWFAQNTGFMYETAPKFKALLVFIEHRFYGSSIPFG  140

Query  468   TMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
               +E A +N +T GY +S QALADYA +++ LK    A+ SP+I FGGSYGGMLA+WFRL
Sbjct  141   GDKEVAYSNASTLGYLSSTQALADYATLIIDLKKNLTAEDSPVIAFGGSYGGMLAAWFRL  200

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPHV +GALASS+PIL F+++T   G+ S++T DF+  SENCY+ I+ SW  I+  A +
Sbjct  201   KYPHVVVGALASSSPILNFEDLTSPYGFNSIITNDFRSESENCYKVIKGSWKEIEDTAKQ  260

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGG  977
               GL +L   FKLCK   +  +L+ ++++     A  D P         P YPV ++C  
Sbjct  261   QGGLEVLRNSFKLCKKAFTADDLESWIETALIYTAMTDYPTPSNFLQPLPAYPVKQMCKA  320

Query  978   IDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1148
             ID    G D   R++  V       GN TC+D +  + P    +  W WQ C+EM +P  
Sbjct  321   IDNPTVGNDTFARLYGAVNIYYNNTGNATCFDIEDDSDP--HGLSEWTWQACTEMILPTD  378

Query  1149  RGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNG  1328
                 D++F  + +     + +C   +G+ PRPHWITT YGG+DI+ VL +FGSNIIF NG
Sbjct  379   GNKNDSIFPASEWDYANRATNCQFAFGINPRPHWITTEYGGYDIRRVLKRFGSNIIFFNG  438

Query  1329  LRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITK  1508
             LRDP+S  GVLE IS +++A+  + G+H +D+  ++K DP+WL + RK+EV II+ W+++
Sbjct  439   LRDPWSGGGVLESISKSIIAIVAKEGAHHVDLRFSTKEDPEWLRDVRKREVGIIRKWLSQ  498

Query  1509  YYVEL  1523
             YY +L
Sbjct  499   YYNDL  503



>ref|XP_006408697.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
 gb|ESQ50150.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
Length=418

 Score =   443 bits (1140),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 207/367 (56%), Positives = 263/367 (72%), Gaps = 13/367 (4%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +   +Y++Q LDHF + P+SY TF+QRY +  K+W GA++N+PI A+LG E+ +D D   
Sbjct  53    DHEIFYFNQDLDHFTFTPKSYMTFQQRYAIDFKHWAGAKANAPILAFLGEEASLDHDLAV  112

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             +GFL DN PR KALLVYIEHRYYGKS+PFG+ EEA+ N +T GY NSAQALADYA +LL+
Sbjct  113   VGFLGDNGPRLKALLVYIEHRYYGKSMPFGSAEEALKNASTLGYLNSAQALADYAAILLH  172

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+ALGALASSAP+LYF++  P+ GYY +
Sbjct  173   IKEKYSTKHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYYYI  232

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTK  KE SE CY TIRKSW  ID++A+KPNGL ILS+KFK C  L    ++KD+L + Y
Sbjct  233   VTKVIKETSERCYNTIRKSWKEIDRVAAKPNGLLILSQKFKTCSPLNESSDIKDFLGTIY  292

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDRIHAGVVGLEGNRTCYDPQIYNPPTS  1091
               A QY++     VT +C  I+  P  +  D+LDRI AGVV L+ N+TCY   +   PT 
Sbjct  293   AEAVQYNRD---WVTNMCNAINADPPNRKNDLLDRIFAGVVALKRNQTCYGTNMLLQPTK  349

Query  1092  ETI--------VGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPH  1247
               I        + W WQ+C+E+ MPIG   +DTMF PAP++M  F   C  YYGVPPRPH
Sbjct  350   NNIAWNEKNNHIAWSWQSCTEIVMPIGYDKQDTMFQPAPYNMSSFIEGCQSYYGVPPRPH  409

Query  1248  WITTYYG  1268
             WI TY+G
Sbjct  410   WIMTYFG  416



>gb|KCW50724.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=408

 Score =   442 bits (1137),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 219/386 (57%), Positives = 273/386 (71%), Gaps = 7/386 (2%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IP LT       + PE + S     +F T+++ QTLDHF+YRPQSYATFKQRY ++S YW
Sbjct  26    IPALTLEREDFHQDPERAVSASTTDDFETFFFDQTLDHFSYRPQSYATFKQRYFINSSYW  85

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA+S++PIF +LGAES +D  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EE
Sbjct  86    GGAKSSAPIFVYLGAESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGMSFEE  145

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A+ N   RGYF+SAQALADY  +++++K +  A  SP+IV GGSYGGMLASW RLKYPHV
Sbjct  146   ALENADIRGYFSSAQALADYVAIIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHV  205

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             ALGALASSAP+LYF+++TP++ YYS+V KDFKE SE C+Q I  SWS ID++A + +GLS
Sbjct  206   ALGALASSAPVLYFEDMTPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLS  265

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDR  1016
              LS+ F  C+ L+S   LK +L   Y TAAQ D PP YPVT +C GIDGA    + IL +
Sbjct  266   NLSQIFNTCRPLESGATLKSFLKDMYTTAAQQDNPPTYPVTRICEGIDGANTTENGILGK  325

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV    N  C      N P + +  GW WQ CSEM MP+G   R++MF PAPF + 
Sbjct  326   ISAGVVAYYWNSNC----CLNTPLTVSPDGWSWQKCSEMVMPLGI-TRNSMFPPAPFLLD  380

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGH  1274
              F   C   YGV PRPHW+TT+YGGH
Sbjct  381   DFMEHCRCEYGVVPRPHWVTTHYGGH  406



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   442 bits (1136),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 228/476 (48%), Positives = 299/476 (63%), Gaps = 72/476 (15%)
 Frame = +3

Query  120   TIPRLTPF--YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             TIPR++P   + + L    + +++    E +T+Y+ Q LDHFNYRP+SY TF+QRY+++ 
Sbjct  29    TIPRMSPIPEWETTLHNHPAINTE----EVKTFYFKQVLDHFNYRPESYTTFQQRYLINF  84

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA S++PIFA+ GAESPID+ P  +GFLTDNA  F ALLV                
Sbjct  85    KYWGGANSSAPIFAYFGAESPIDNSPNGVGFLTDNAASFNALLV----------------  128

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
                                  Y E LL+                   G  + +W  + +P
Sbjct  129   ---------------------YIECLLH-----------------GLGSNIPTWRLVPWP  150

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H        S  ++   +          +    +E SE CY+T+ KSWS I +IAS+PNG
Sbjct  151   HQL-----QSYTLIKLHHKMVTTLLSQGIIDGLQEASETCYETVLKSWSEIRRIASQPNG  205

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             L  LS++F  C  L    EL DYL STY  AAQY+QPP+YPV+ +CGGIDG   G+DIL 
Sbjct  206   LVTLSQRFNTCHTLNQSYELIDYLRSTYVYAAQYNQPPRYPVSMICGGIDGESLGSDILS  265

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +I+AG+V L GN TC      N PT  SET VGWRWQTCSEM +PIG G+ DTMF P PF
Sbjct  266   KIYAGIVALRGNSTCK----VNGPTNVSETTVGWRWQTCSEMVIPIGIGN-DTMFEPIPF  320

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             ++ +++  C + YGV PRPHW+TTYYGGH+IKLVL + GSNIIFSNGLRDPYS  GVL++
Sbjct  321   NLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDN  380

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             ISD+++AV+T NGSHCLD+  A+++DP WL EQRKKEV+II+ WIT+YY +L+ALK
Sbjct  381   ISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDALK  436



>emb|CDX71016.1| BnaC03g11000D [Brassica napus]
Length=407

 Score =   440 bits (1132),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/417 (53%), Positives = 280/417 (67%), Gaps = 33/417 (8%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             TP  +    P   S  R+    S+D    + + +YY Q LDHF + P+SY TF+QRY + 
Sbjct  22    TPLRVFAKIPRNASEERQQVDDSTD---SDLKIFYYDQNLDHFTFTPKSYMTFQQRYAIQ  78

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLT-DNAPRFKALLVYIEHRYYGKSIPFG  467
             SK+W                          GF+  DN PR KALLVYIEHRYYG S+PFG
Sbjct  79    SKHWAD------------------------GFICHDNGPRLKALLVYIEHRYYGTSMPFG  114

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
             + +EA+ N +T GY NSAQALADYA +LL++K KY A HSPIIV GGSYGGMLA+WFRLK
Sbjct  115   SGKEALKNASTLGYLNSAQALADYAAILLHVKEKYSADHSPIIVIGGSYGGMLAAWFRLK  174

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPH+ALGALASSAP+LYF +  P++GYY +VTK FKE +E+CY TIRKSW  ID++A KP
Sbjct  175   YPHIALGALASSAPLLYFQDTLPKHGYYYIVTKVFKETNESCYNTIRKSWEEIDRVAVKP  234

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI-DGAPKGAD  1004
             NGL ILSKKF++C  L +  ELK++LD+ Y +AAQY+   +YPV  +C  I +G     D
Sbjct  235   NGLLILSKKFRICNTLNNTFELKNFLDTIYASAAQYNS-NQYPVASLCEAINNGVNSEND  293

Query  1005  ILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             +L +I AGVV   GNR+CY   +   PT ++I  W+WQTCSE+ +PIG  ++DTMF   P
Sbjct  294   LLGQIFAGVVYDRGNRSCYPLSV--QPTEDSI-AWKWQTCSEIVLPIGHDEQDTMFQTEP  350

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAG  1355
             F M      C   YGVPPRPHW+T YYG  D+KL+L +FGSNIIFSNGL DPYS  G
Sbjct  351   FRMDIKIDRCKLQYGVPPRPHWVTAYYGIQDVKLILRRFGSNIIFSNGLLDPYSVGG  407



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 308/478 (64%), Gaps = 15/478 (3%)
 Frame = +3

Query  129   RLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGG  308
             ++TP + S++ RPE  S       +   Y+ Q LDHFNY+PQSY TF+QRY+++ KYWGG
Sbjct  27    KITPRFPSSIVRPEQLSVSSQTELYEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGG  86

Query  309   AQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAM  485
             A   +PIF + G E  I+   +  GF+ D AP F+ALLV+IEHR+YGKSIPFG     A 
Sbjct  87    ADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAY  146

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
             +N +T GY +S QALADYA +++ LK    A +SP++VFGGSYGGMLA+WFRLKYPHVA+
Sbjct  147   SNASTLGYLSSTQALADYATLIIDLKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPHVAI  206

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             GALASSAPIL F+NIT    + +++T+DF+  SENCY+ I+ SW  I++ A K  GL +L
Sbjct  207   GALASSAPILNFENITSPYTFNNIITQDFRSESENCYKVIKGSWEQIEETAMKNGGLEVL  266

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKG  998
              K F++CK   S G ++++L + Y   A  D P         P YPV ++C  ID   +G
Sbjct  267   RKSFRICKNYISGGAIENWLSTAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPAQG  326

Query  999   ADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1169
              D   +++          G   C+D    + P    +  W WQ C+EM MP+   + +++
Sbjct  327   NDTFAKLYGAANVYYNYTGTAACFDLADDSDP--HGLGEWTWQACTEMIMPVNANNEESI  384

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
             F  + ++    +  C   + + PRP+WITT +GGHDIK VL +FGSNIIF NGLRDP+S 
Sbjct  385   FPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSG  444

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
              GVLE IS +++A+  ++G+H +D+  A+  DP+WL + RK+EV+II  W ++YY +L
Sbjct  445   GGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYHDL  502



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   441 bits (1133),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 220/478 (46%), Positives = 308/478 (64%), Gaps = 20/478 (4%)
 Frame = +3

Query  129   RLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGG  308
             R+TP   S+L      S  +    ++T Y+ Q LDHFNY PQSY TF+QRY+++  +WGG
Sbjct  33    RITPEKLSSLISNSKDSQGL----YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGG  88

Query  309   AQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AM  485
             +++N+PIF + G E  I+   +  GF+ D AP+FKALLV+IEHRYYGKSIP+G  +E A 
Sbjct  89    SKNNAPIFVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAY  148

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+
Sbjct  149   KNASTTGYLSSTQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAI  208

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             GALASSAPIL FDNI     + +++T+DF+ VSENCY+ I+ SW  I++ A KP GL  L
Sbjct  209   GALASSAPILNFDNIVSPYSFSNIITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKL  268

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKG  998
              K F++CK  K+   ++ +L + +   A  D P         P +PV E+C  ID    G
Sbjct  269   QKAFRICKSEKNLA-IESWLSTAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTG  327

Query  999   ADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1169
              D+  +++          G   C+D    + P    +  W WQ C+EM M  G  ++D++
Sbjct  328   NDVFAKLYGAASVYYNYSGTAKCFDLNGDSDP--HGLSEWGWQACTEMIMLTGGDNKDSI  385

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
             F  +       +R C + YGV PRP+WITT +GGH I LVL +F SNIIF NGLRDP+S 
Sbjct  386   FEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSG  445

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
              GVL++IS TVLA+  + G+H +D+  ++K DP WL + R++EVEI+  WI++Y+ +L
Sbjct  446   GGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIVGKWISQYFQDL  503



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   440 bits (1132),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 309/470 (66%), Gaps = 20/470 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++RP+SY  F Q+Y+++S++W   +   PI
Sbjct  29    SSLRQNKKASKSKSELPFETLYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPI  85

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F ALLV+IEHR+YG+S PFG  +++  +  T GY
Sbjct  86    FVYTGNEGDIDWFASNTGFMSDIAPKFGALLVFIEHRFYGESTPFG--KKSHKSAETLGY  143

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  144   LNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  203

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  +++DFK+ S NC++ I++SW  ++ +++  +GL  LSKKF+ CK
Sbjct  204   ILHFDNIVPLTSFYDAISQDFKDASVNCFEVIKRSWQELEAVSNMKHGLPELSKKFRTCK  263

Query  870   GLKSPGELKDYLDST--------YCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL S    +D+L S         Y TAA +  P P YPV ++C  IDG P+G+  LDR  
Sbjct  264   GLHSQYAARDWLMSAFIYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  323

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C+  ++  P     + GW WQ C+EM MP+   ++ +MF P     
Sbjct  324   AAASLYYNYSGSEKCF--ELEQPTDDHGLDGWGWQACTEMVMPMSCSNQ-SMFPPYDNDY  380

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS
Sbjct  381   EAFKEQCMSRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNIS  440

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
              +++A+ T+ G+H  D+  ASK DP+WL EQR++EV II+ WI++Y+  L
Sbjct  441   SSIIALVTKKGAHHADLRAASKGDPEWLKEQRRQEVAIIEKWISEYHRAL  490



>gb|KCW50731.1| hypothetical protein EUGRSUZ_J004041, partial [Eucalyptus grandis]
Length=346

 Score =   434 bits (1115),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 260/351 (74%), Gaps = 9/351 (3%)
 Frame = +3

Query  435   HRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGS  611
             HRYYG+SIP G ++EEA+ +   RGYF+SAQALAD+A +++++K    A+ SP+IV G S
Sbjct  1     HRYYGESIPHGMSLEEALKDANIRGYFSSAQALADFAAIIMHVKQDLKARDSPVIVVGAS  60

Query  612   YGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRK  791
             YGGMLASWFRLKYPHV LGALASSAPILYFD+I  ++ Y S+VTKDFKE SE CYQ I  
Sbjct  61    YGGMLASWFRLKYPHVTLGALASSAPILYFDDIISQDAYSSVVTKDFKEASETCYQAIGD  120

Query  792   SWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVC  971
             SWS I++IA  PNG S LSK FK CK L+S  ELKDYL S Y  AAQYD PP YP + +C
Sbjct  121   SWSEINRIAQNPNGTSKLSKMFKTCKPLESGDELKDYLISMYEGAAQYDLPPTYPASVIC  180

Query  972   GGIDGAPKGAD-ILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMP  1142
               IDGA    + IL ++ AGV+    N  CY     NPPT  S++ +GW WQ CSEM MP
Sbjct  181   NAIDGANTTENGILGKVFAGVIAYNTNSACY----VNPPTAISQSSLGWGWQRCSEMVMP  236

Query  1143  IGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1322
              G  + ++MF P PF +  F+ +C+  YGV PRPHWITTYYG HDI+L+L +FGSNIIFS
Sbjct  237   KGVTN-NSMFQPDPFILSSFTDECNHQYGVVPRPHWITTYYGAHDIELILCRFGSNIIFS  295

Query  1323  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKK  1475
             NGLRDP+SSAGVL++ISD+++AVYT  G+HCLD+Y   ++DPDWL  QRK 
Sbjct  296   NGLRDPFSSAGVLKNISDSIVAVYTEKGAHCLDVYAEDQSDPDWLVMQRKN  346



>ref|XP_010651835.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=376

 Score =   434 bits (1117),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 264/363 (73%), Gaps = 6/363 (2%)
 Frame = +3

Query  429   IEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGG  608
             ++HRYYG S+PF + + A NN +T GYF+S QALADYAE++  LK    A++ P+I  GG
Sbjct  11    LQHRYYGDSVPFRSKDIAFNNTSTLGYFSSTQALADYAELITNLKKNLSAENCPVIAIGG  70

Query  609   SYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIR  788
             SYGGMLASWFRLKYPHV +GALASSAPILYFD+ITP NGY S+VTKDF+E SE CY TI+
Sbjct  71    SYGGMLASWFRLKYPHVVIGALASSAPILYFDDITPHNGYDSIVTKDFRETSETCYTTIK  130

Query  789   KSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEV  968
             +SWS ID++A +PNGL+ LS+ F+ C+ L S  +LK YL+ TY  +AQYD PP + V+++
Sbjct  131   QSWSEIDEVAGQPNGLANLSQIFRTCEPLNSSQQLKLYLEYTYEASAQYDNPPAHYVSDI  190

Query  969   CGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1148
             C  IDGAP+G  IL R+  GV    G   C+    + P     + GW WQTC+EM MP G
Sbjct  191   CNAIDGAPEGTSILGRVAEGVNASAG-PPCHRIYDFQP---SNMSGWLWQTCTEMVMPFG  246

Query  1149  RGDRDTMFFPAPFSMQQFSRDCDDYYG--VPPRPHWITTYYGGHDIKLVLHKFGSNIIFS  1322
             RG+ DTMF  +PF +  +++ C D +G  V PRPHWITT +GGH+IK VL  F SNIIFS
Sbjct  247   RGENDTMFQASPFDLNNYTKTCQDIFGASVTPRPHWITTEFGGHNIKSVLGNFASNIIFS  306

Query  1323  NGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWI  1502
             NGLRDPYS  GVL+DIS++V+AVYT  G+HCLD+     +DPDWL  QR KE++I+  W+
Sbjct  307   NGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTPMPSDPDWLVAQRDKEIKIVALWL  366

Query  1503  TKY  1511
              +Y
Sbjct  367   AEY  369



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/481 (45%), Positives = 309/481 (64%), Gaps = 15/481 (3%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             ++  L+ ++ S++ RPE  S       +   Y+ Q LDHFNY+PQSY TF+QRY+++ KY
Sbjct  2     SLAPLSLWFPSSIVRPEQLSVSSQTELYEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKY  61

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TME  476
             WGGA   +PIF + G E  I+   +  GF+ D AP F+ALLV+IEHR+YGKSIPFG    
Sbjct  62    WGGADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTN  121

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
              A +N +T GY +S QALADYA +++ LK    A +SP++VFGGSYGGMLA+WFRLKYPH
Sbjct  122   VAYSNASTLGYLSSTQALADYATLIIDLKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPH  181

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VA+GALASSAPIL F+NIT    + +++T+DF+  SENCY+ I+ SW  I++ A K  GL
Sbjct  182   VAIGALASSAPILNFENITSPYTFNNIITQDFRSESENCYKVIKGSWEQIEETAMKNGGL  241

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGA  989
              +L K F++CK   S G ++++L + Y   A  D P         P YPV ++C  ID  
Sbjct  242   EVLRKSFRICKNYISGGAIENWLSTAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDP  301

Query  990   PKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDR  1160
              +G D   +++          G   C+D    + P    +  W WQ C+EM MP+   + 
Sbjct  302   AQGNDTFAKLYGAANVYYNYTGTAACFDLADDSDP--HGLGEWTWQACTEMIMPVNANNE  359

Query  1161  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
             +++F  + ++    +  C   + + PRP+WITT +GGHDIK VL +FGSNIIF NGLRDP
Sbjct  360   ESIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDP  419

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             +S  GVLE IS +++A+  ++G+H +D+  A+  DP+WL + RK+EV+II  W ++YY +
Sbjct  420   WSGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYHD  479

Query  1521  L  1523
             L
Sbjct  480   L  480



>gb|KHN29944.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=348

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 247/309 (80%), Gaps = 6/309 (2%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             E +T+Y+ Q LDHFNYRP+SY TF+QRY+V+ KYWGGA S++PIFA+ GAESPID+ P  
Sbjct  22    EVKTFYFKQVLDHFNYRPESYTTFQQRYLVNFKYWGGANSSAPIFAYFGAESPIDNSPNG  81

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             IGFLTDNA  F ALLVYIEHRYYGKS+PFG+ EEA+ N +T GYFNSAQALADYA +L +
Sbjct  82    IGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYAAILEH  141

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             +K    AQ+SP+IV GGSYGGMLASWFRLKYPH+ +GALAS+APILYFD ITP+NGYYS+
Sbjct  142   IKKTLHAQNSPVIVIGGSYGGMLASWFRLKYPHLTVGALASAAPILYFDKITPQNGYYSV  201

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VT+D+++ SE CY+TI KSWS I ++AS+PNGL  LS +F  C  +    EL DYL STY
Sbjct  202   VTRDYRDASETCYETILKSWSEIHRVASQPNGLVTLSHRFNTCHTVNQSYELIDYLRSTY  261

Query  918   CTAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--S  1091
               AAQY+QPP+YPV+E+CGGIDGA  G+DIL +I+AGVV L GN TC      N PT  S
Sbjct  262   VYAAQYNQPPRYPVSEICGGIDGASLGSDILSKIYAGVVALWGNNTCK----VNGPTNVS  317

Query  1092  ETIVGWRWQ  1118
             ET VGWRWQ
Sbjct  318   ETSVGWRWQ  326



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   438 bits (1126),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 299/454 (66%), Gaps = 16/454 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             ++T Y+ Q LDHFNY PQSY TF+QRY+++  +WGG+++N+PIF + G E  I+   +  
Sbjct  53    YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GF+ D AP+FKALLV+IEHRYYGKS+P+G  +E A  N +T GY +S QALADYA +++ 
Sbjct  113   GFMYDVAPKFKALLVFIEHRYYGKSMPYGGNKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FDNI     + ++
Sbjct  173   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNI  232

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T+DF+ VSENCY+ I+ SW  I++ A KP GL  L K F++CK  K+   ++ +L + +
Sbjct  233   ITQDFRSVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNLA-IESWLSTAF  291

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1061
                A  D P         P +PV E+C  ID    G D+  +++          G   C+
Sbjct  292   VYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAKCF  351

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D    + P    +  W WQ C+EM M  G  ++D++F  +       +R C + YGV PR
Sbjct  352   DLNGDSDP--HGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPR  409

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             P+WITT +GGH I LVL +F SNIIF NGLRDP+S  GVL++IS TVLA+  + G+H +D
Sbjct  410   PNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVD  469

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             +  ++K DP WL + R++EVEII  WI++Y+ +L
Sbjct  470   LRFSTKEDPQWLKDVRRREVEIIGKWISQYFQDL  503



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   437 bits (1125),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/476 (45%), Positives = 308/476 (65%), Gaps = 15/476 (3%)
 Frame = +3

Query  144   YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNS  323
             + S+L  PE  S+      +RT Y+ Q LDHFN+ P+SY TF+QRY+++  +WGGA++N+
Sbjct  30    FPSSLITPEKVSASTQNKLYRTKYFTQILDHFNFYPKSYQTFQQRYLINDTFWGGAKNNA  89

Query  324   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETT  500
             PIF + G E  I+   + +GFL + AP FK+L+V+IEHR+YGKSIP+G  +  A +N +T
Sbjct  90    PIFVYTGNEGNIEWFAQNLGFLYETAPHFKSLVVFIEHRFYGKSIPYGGKKSVAYSNAST  149

Query  501   RGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALAS  680
              G+ +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALAS
Sbjct  150   LGHLSSTQALADYASLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALAS  209

Query  681   SAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFK  860
             S+PIL F+NIT    + ++VT+DFK VSENCY+ I+ SW  I+  A++P GL +L K FK
Sbjct  210   SSPILNFENITSSYSFRNIVTQDFKSVSENCYKVIKGSWEQIENTANQPGGLELLRKSFK  269

Query  861   LCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILD  1013
             LCK       L+D+L + Y   A  D P         P +PV ++C  ID    G D   
Sbjct  270   LCKNGADLDYLEDWLSTAYAYTAMTDYPTPSNFLCPLPAFPVKKMCEAIDDPTTGNDTFA  329

Query  1014  RIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAP  1184
             +++          G  TC++    + P    + GW WQ C+EM MP G  + D++F  + 
Sbjct  330   KLYGAANVYYNYSGTVTCFELDDNSDP--HDLGGWYWQACTEMIMPTGGNNEDSIFPASD  387

Query  1185  FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLE  1364
             +  +  +  C   +G+ PRP WITT +GGH I+ VL ++GSNIIF NGLRDP+S  GVL+
Sbjct  388   WDYKDQASVCKSRFGIEPRPLWITTEFGGHAIERVLKRYGSNIIFFNGLRDPWSGGGVLK  447

Query  1365  DISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             +IS +++A+  + G+H +D+   S  DP+WL + RK+E++II  WI++YY +L  L
Sbjct  448   NISKSIVAIVAKEGAHHVDLMFKSSEDPEWLQDVRKQEIKIIAKWISQYYHDLAQL  503



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   437 bits (1124),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/476 (45%), Positives = 306/476 (64%), Gaps = 15/476 (3%)
 Frame = +3

Query  138   PFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS  317
             P + S++ + E  S       +   ++ Q LDH+ +RPQSY TF+QRY+++ KYWGGA+ 
Sbjct  28    PSFPSSIIQAEKISLSTPHELYHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEK  87

Query  318   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNE  494
             N+PIF + G E  I+   +  GF+ D AP FK L+V+IEHR+YGKS+PFG  +E A +N 
Sbjct  88    NAPIFLYTGNEGDIEWFAQNTGFIFDIAPHFKPLVVFIEHRFYGKSMPFGGNKEVAYSNS  147

Query  495   TTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGAL  674
             +T GY  S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GAL
Sbjct  148   STLGYLTSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGAL  207

Query  675   ASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  854
             ASS+PIL F+NIT    + +++T+DF+  SENCY+ I++SW  I+  AS+P GL IL + 
Sbjct  208   ASSSPILNFENITSPYSFNNIITQDFRGESENCYKVIKRSWQEIENTASQPGGLEILRRS  267

Query  855   FKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADI  1007
             F++C+   S   L+ +L +     A  D P         P YPV E+C  ID    G + 
Sbjct  268   FRICRNSISASSLQSWLYTALVYTAMTDYPTPSNFLSPMPAYPVKEMCKAIDDPKTGNNT  327

Query  1008  LDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
               +++          G  TC++    + P    + GW WQ C+EM +P    ++D++F  
Sbjct  328   FAKLYGAASVYYNYSGTATCFNLDDDSDP--HGLGGWSWQACTEMILPTSGNNKDSIFTA  385

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
             + ++    +  C  Y+GV PRP+WITT +GGHDIK VL +FGSNIIF NGLRDP+S  GV
Sbjct  386   SEWNYDDRATFCKAYFGVEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGV  445

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             LE+IS +++A+  + G+H +D+  A+  DP WL + RK+EV II  W++KYY +L+
Sbjct  446   LENISSSIVAIVAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSKYYDDLD  501



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/471 (46%), Positives = 310/471 (66%), Gaps = 20/471 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+   SS       F T Y+ Q LDHF++RP+SY  F Q+Y+++S++W   +   PI
Sbjct  29    SSLRQNRKSSKSKSELPFETRYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPI  85

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY
Sbjct  86    FVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGY  143

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  144   LNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  203

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  +++DFK+ S NC++ I++SW  ++ +++  +GL  LSKKF+ CK
Sbjct  204   ILHFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELEAVSNMKHGLPELSKKFRTCK  263

Query  870   GLKSPGELKDYLDST--------YCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL S    +D+L           Y TAA +  P P YPV ++C  IDG P+G+  LDR  
Sbjct  264   GLHSIYSARDWLMGAFVYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  323

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C+  ++  P     + GW +Q C+EM MP+   ++ +MF P     
Sbjct  324   AAASLYYNYSGSEKCF--ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDY  380

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS
Sbjct  381   EAFEEQCMSKYGVKPRPHWITTEFGGKRIESVLKRFGSNIIFSNGMQDPWSRGGVLKNIS  440

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +++
Sbjct  441   SSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYYRDMK  491



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 314/472 (67%), Gaps = 17/472 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             + L++   SS + L   +RT ++ Q LDHFN+ PQS  TF+QRY+++  +WGGA++N+PI
Sbjct  38    AELKQRSHSSQNGL---YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPI  94

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRG  506
             F + G E  I+   +  GF+ +NAP F+ALLV+IEHR+YGKSIPFG  +  A  N +T G
Sbjct  95    FVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLG  154

Query  507   YFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSA  686
             Y +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+KYPHVA+GALASSA
Sbjct  155   YLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSA  214

Query  687   PILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLC  866
             PIL+F  +   + + S++T+DF+  SENCY+ I+ SW +ID  A+KP G+ +L K F++C
Sbjct  215   PILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDLIDDTANKPGGMELLRKTFRIC  274

Query  867   KGLK-SPGELKDYLDSTYCTAAQYDQP-------PKYPVTEVCGGIDGAPKGADILDRIH  1022
             K     P  L+ +L + +   A  D P       P YPV ++C  ID +  G + L +++
Sbjct  275   KSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFLLPAYPVKKMCEAIDSSVTGNNRLAKLY  334

Query  1023  AGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G  TC+D    + P    + GW+WQ C+EM MP+G  +++++F    +S 
Sbjct  335   AAANVYYNYTGKATCFDLDDNSDP--HDLGGWQWQACTEMIMPVGGSNKESIFPEYEWSY  392

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             +  +  CD +Y V PRPHWITT +GGH I+ VL +  SNIIF NGLRDP+S+ GVL+ IS
Sbjct  393   EARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSAGGVLKTIS  452

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
              T++A+  + G+H +D+  +SK DP WL + RK+EV II SWI++Y+ +L++
Sbjct  453   KTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQDLQS  504



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 305/484 (63%), Gaps = 26/484 (5%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLRRPESSSSDILPPE--FRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             H IP+L     S+   PE     I      +RT ++ Q LDHFNY PQSY TF+QRY+++
Sbjct  26    HVIPKLP----SSAVSPELQQRSISAQNGLYRTKFFTQILDHFNYNPQSYQTFQQRYLIN  81

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
               YWGGA+  +PIF ++G E  I    +  GF+ + AP F A+LV+IEHRYYGKSIPFG 
Sbjct  82    DTYWGGAKKKAPIFVYMGNEGDIQWFAQNTGFMFEIAPYFNAILVFIEHRYYGKSIPFGG  141

Query  471   MEEAMN-NETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              +E  N   +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+K
Sbjct  142   NDEVANKTSSTLGYMSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMK  201

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHVA+GALASSAPIL F ++     + ++VT+D+K  SENCY+ I+ SW  ID  A+ P
Sbjct  202   YPHVAIGALASSAPILQFLDLVSPYTFTNIVTQDYKSESENCYKVIKGSWKEIDDTANTP  261

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  980
              G+  L K F+LC    S G+LK++L +     A  D P         P YPV ++C  I
Sbjct  262   GGIEQLQKSFRLCNNNISAGDLKNWLQTALMYTAMTDYPTPSNFVTPLPAYPVKKMCEAI  321

Query  981   DGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR  1151
             D    G +   +++A         G+  C+D        S    GW WQ+C+EM MP+G 
Sbjct  322   DSKSSGNETFTKLYAAANIFYNYSGSVICFD-------ISNDSGGWDWQSCTEMIMPLGG  374

Query  1152  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1331
              + +++F    + +++    C   Y + PRPHWITT +GGHDI  VL ++GSNIIF NGL
Sbjct  375   NNEESIFPAHKWELEETLSYCKQTYHIDPRPHWITTEFGGHDIGRVLKRYGSNIIFFNGL  434

Query  1332  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1511
             RDP+S  GVL++IS T++A+  + G+H +D+  ++K DP+WL + RK+EV+II SWI++Y
Sbjct  435   RDPWSGGGVLKNISKTLIAIVAKEGAHHVDLRFSTKEDPEWLKDVRKQEVKIITSWISQY  494

Query  1512  YVEL  1523
             Y +L
Sbjct  495   YQDL  498



>ref|XP_008344905.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=381

 Score =   432 bits (1110),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 224/375 (60%), Positives = 278/375 (74%), Gaps = 11/375 (3%)
 Frame = +3

Query  45    FITLVIQCfsllilfsttslsETPHTIPRLTP----FYRSNL---RRPESSSSDILPPEF  203
             FI+L++    ++ LF TTS+S +P  IPRL+P    F   N     +P++ S+ +   +F
Sbjct  4     FISLLLFLLPIISLFITTSVSGSPLKIPRLSPTGGTFVHGNYFANDQPKALSA-LDQNDF  62

Query  204   RTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIG  383
              T+YY QTLDHFN+R  S+ TF+QRY+++SKYWGG+  ++PI A+LGAE  ID D   IG
Sbjct  63    ETFYYTQTLDHFNFRXDSFTTFQQRYLINSKYWGGSNVSAPILAYLGAEESIDTDLAIIG  122

Query  384   FLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLK  563
             FL++NA +F+AL ++IEHRYYGKSIPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K
Sbjct  123   FLSENANQFQALQIFIEHRYYGKSIPFGSREEAFKNASTIGYFNSAQAIADYAEILIHVK  182

Query  564   NKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLV  740
              +  A+ SP+IV GGSYGGMLASWFRLKYPHVA+GALASSAPILYFDNI  PE GYY +V
Sbjct  183   KQLHAEDSPVIVIGGSYGGMLASWFRLKYPHVAVGALASSAPILYFDNIIPPEKGYYFIV  242

Query  741   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  920
             TKDF+E SE CYQTI+KSWSVID+IASK  GLSILSKKF  C  L +  ELKDYL S Y 
Sbjct  243   TKDFQEASETCYQTIKKSWSVIDEIASKDGGLSILSKKFHTCSLLNNSSELKDYLKSVYA  302

Query  921   TAAQYDQPPKYPVTEVCGGIDGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETI  1100
              AAQYD PP+YPVT VCGGIDGA  G D L +I  G+V   GNR+CY  Q  N   SET 
Sbjct  303   XAAQYDSPPRYPVTVVCGGIDGASSGNDTLSKIFXGLVAYRGNRSCYVNQPGN--LSETD  360

Query  1101  VGWRWQTCSEMAMPI  1145
             +GW WQ  S + + I
Sbjct  361   IGWGWQVISYIXLVI  375



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 314/474 (66%), Gaps = 19/474 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             + L++   SS + L   +RT ++ Q LDHFN+ PQS  TF+QRY+++  +WGGA++N+PI
Sbjct  38    AELKQRSHSSQNGL---YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPI  94

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRG  506
             F + G E  I+   +  GF+ +NAP F+ALLV+IEHR+YGKSIPFG  +  A  N +T G
Sbjct  95    FVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLG  154

Query  507   YFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSA  686
             Y +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+KYPHVA+GALASSA
Sbjct  155   YLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSA  214

Query  687   PILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLC  866
             PIL+F  +   + + S++T+DF+  SENCY+ I+ SW +ID  A+KP G+ +L K F++C
Sbjct  215   PILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDLIDDTANKPGGMELLRKTFRIC  274

Query  867   KGLK-SPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             K     P  L+ +L + +   A  D P         P YPV ++C  ID +  G + L +
Sbjct  275   KSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAK  334

Query  1017  IHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             ++A         G  TC+D    + P    + GW+WQ C+EM MP+G  +++++F    +
Sbjct  335   LYAAANVYYNYTGKATCFDLDDNSDP--HDLGGWQWQACTEMIMPVGGSNKESIFPEYEW  392

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S +  +  CD +Y V PRPHWITT +GGH I+ VL +  SNIIF NGLRDP+S+ GVL+ 
Sbjct  393   SYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSAGGVLKT  452

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             IS T++A+  + G+H +D+  +SK DP WL + RK+EV II SWI++Y+ +L++
Sbjct  453   ISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQDLQS  506



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   436 bits (1121),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 207/451 (46%), Positives = 295/451 (65%), Gaps = 16/451 (4%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             E+ T Y+ Q LDHF+++    +TF+QRY+++ KYW GA+   PIF + G E  ID     
Sbjct  53    EYETKYFTQRLDHFSFKNHKNSTFQQRYLINDKYWLGAERMGPIFYYCGNEGYIDWFAVN  112

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GF+ D AP+F ALLV+ EHRYYG+S+P+G+   A  +  +  Y  + QALAD+A +++ 
Sbjct  113   TGFMWDIAPQFGALLVFPEHRYYGESMPYGSQSMAYKDGDSLSYLTAEQALADFATLIVD  172

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A+  P+++FGGSYGGMLA+W RLKYPH+A+GALASSAPIL F++I P + +Y+L
Sbjct  173   LKKNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPSDTFYNL  232

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             V+ DFK  SENC++ I++SW  ++    +  GL  LSKKF++C+ L S  E++D+L+S Y
Sbjct  233   VSNDFKRESENCFKVIQQSWKALETYGERDEGLQNLSKKFRMCRDLNSTDEIEDWLNSAY  292

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1061
                A  D P         P YP+ EVC  ID    G D+LDRI AGV       G   C+
Sbjct  293   SNLAMVDYPYPASFLMPLPAYPIKEVCKVIDSFSNGTDVLDRIFAGVSVYYNYTGEEKCF  352

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D  + + P  E   GW WQ C+EM MP+      ++F    F ++ ++++C + +GV PR
Sbjct  353   D--VNDDPHGEN--GWNWQACTEMVMPMSSNPESSIFPQFTFDIESYTKNCLNMFGVEPR  408

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             PHWITT +GG DIK VL  +GSNIIFSNGL DP+S  GVL++IS++++A+ T  G+H LD
Sbjct  409   PHWITTEFGGQDIKRVLKNYGSNIIFSNGLLDPWSGGGVLQNISNSIVALVTELGAHHLD  468

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             +  A++ DP WL EQR  E++II  W+ +YY
Sbjct  469   LRAATENDPLWLVEQRNAEMKIINKWMNEYY  499



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   436 bits (1120),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 312/474 (66%), Gaps = 19/474 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             + L++   SS + L   +RT ++ Q LDHFN+ PQS  TF+QRY+++  +WGGA++N+PI
Sbjct  39    AELKQRSHSSQNGL---YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPI  95

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRG  506
             F + G E  I+   +  GF+ +NAP F+ALLV+IEHR+YGKSIPFG  +  A  N +T G
Sbjct  96    FVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLG  155

Query  507   YFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSA  686
             Y +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+KYPHVA+GALASSA
Sbjct  156   YLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSA  215

Query  687   PILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLC  866
             PIL+F  +   + + +++T+DF+  SENCY+ I+ SW +ID  A+KP G+ +L K F++C
Sbjct  216   PILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDLIDDTANKPGGMELLRKTFRIC  275

Query  867   KGLK-SPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             K     PG L+ +L + +   A  D P         P YPV ++C  ID +  G + L +
Sbjct  276   KSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAK  335

Query  1017  IHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +HA         G   C+D    + P    + GW+WQ C+EM MP+G  +++++F    +
Sbjct  336   LHAAASVYYNYTGKARCFDLDDNSDP--HDLGGWQWQACTEMIMPVGGSNKESIFPEYEW  393

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S +  +  CD +Y V PRPHWITT +GGH I+ VL +  SNIIF NGLRDP+S  GVL+ 
Sbjct  394   SYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSGGGVLKT  453

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             IS T++A+  + G+H +D+  +SK DP WL + RK EV II SWI++Y+ +L++
Sbjct  454   ISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQDLQS  507



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   436 bits (1121),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 302/469 (64%), Gaps = 33/469 (7%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             + T YY Q LDHF + PQSY TF+QRY++S K+WGGA+ N+PIF + G E  I+   +  
Sbjct  49    YETKYYTQILDHFTFTPQSYQTFQQRYLISYKHWGGAKKNAPIFVYTGNEGDIEWFTQNT  108

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GF+ +NAP FKALLV+IEHR+YGKSIPFG  ++ A  N +T GY +S QALADYA +++ 
Sbjct  109   GFMFENAPHFKALLVFIEHRFYGKSIPFGGNKDVAYANSSTLGYLSSTQALADYATLIID  168

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPILYFDNIT E  ++S 
Sbjct  169   LKKNLSAVDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDNITSEYSFHST  228

Query  738   VTKDFKEV------------------SENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  863
             V  DF+                    SENCY+ I+ SW +I+  A +  GL  L K F++
Sbjct  229   VGNDFRAFVHMHVSLFDTGKCWRRSESENCYKVIKGSWQLIEDTAEQSGGLDTLRKSFRI  288

Query  864   CKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             CK   S G L  +L + +   A  D P         P YPV ++C  ID    G + L++
Sbjct  289   CKNYISAGALVSWLSTAFIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDRKAGNNTLEK  348

Query  1017  IHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +++         G  TC++    + P    +  W WQ C+EM +PIG  + D +F P+ +
Sbjct  349   LYSAANVYYNSTGRATCFNLNDDSDP--HGLDEWSWQACTEMILPIGGNNADGIFPPSEW  406

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
                  ++ C+D +GV PRP+WITT +GGH+I+ VL +FGSNIIF NGLRDP+S  GVL+D
Sbjct  407   DYAGRAQSCEDAFGVQPRPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRDPWSGGGVLKD  466

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             IS +++A+  + G+H +D+  ++  DP+WL   R++EV+II++W+++YY
Sbjct  467   ISKSLVAIVAKEGAHHVDLRFSTPEDPEWLKHARRREVKIIENWLSQYY  515



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   435 bits (1118),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 213/476 (45%), Positives = 304/476 (64%), Gaps = 15/476 (3%)
 Frame = +3

Query  138   PFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS  317
             P + S++ + E  S       +   ++ Q LDH+ +RPQSY TF+QRY+++ KYWGGA+ 
Sbjct  28    PSFPSSIIQAEKISLSTPNELYHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEK  87

Query  318   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNE  494
             N+PIF + G E  I+   +  GF+ D AP FK LLV+IEHR+YGKS+PFG  +E A +N 
Sbjct  88    NAPIFLYTGNEGDIEWFAQNTGFIFDIAPHFKPLLVFIEHRFYGKSMPFGGNKEVAYSNS  147

Query  495   TTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGAL  674
             +T GY  S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPHVA+GAL
Sbjct  148   STLGYLTSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGAL  207

Query  675   ASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  854
             ASS+PIL F+NIT    + +++T+DF+  SENCY+ I++SW  I+  AS+P GL IL   
Sbjct  208   ASSSPILNFENITSPYSFNNIITQDFRGESENCYKVIKRSWQEIEDTASQPGGLEILRSS  267

Query  855   FKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADI  1007
             F++C+   S   L+ +L +     A  D P         P YPV E+C  ID    G   
Sbjct  268   FRICRNSMSASSLQSWLYTALVYTAMTDYPTPSNFLNPMPAYPVKEMCKAIDDPKTGNKT  327

Query  1008  LDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
               +++          GN TC++    + P    + GW WQ C+EM +P    ++D++F  
Sbjct  328   FAKLYGAASVYYNYSGNATCFNHDDDSDP--HGLGGWSWQACTEMILPTSGNNKDSIFPA  385

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
             + ++    +  C  Y+GV PRP+WIT  +GGHDIK VL +FGSNIIF NGLRDP+S  GV
Sbjct  386   SEWNYDDRASFCKAYFGVEPRPNWITAEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGV  445

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             LE+IS +++A+  + G+H +D+  A+  DP WL + RK+EV II  W+++YY +L+
Sbjct  446   LENISSSIVAIIAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSEYYDDLD  501



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 312/474 (66%), Gaps = 19/474 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             + L++   SS + L   +RT ++ Q LDHFN+ PQS  TF+QRY+++  +WGGA++N+PI
Sbjct  39    AELKQRSHSSQNGL---YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPI  95

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRG  506
             F + G E  I+   +  GF+ +NAP F+ALLV+IEHR+YGKSIPFG  +  A  N +T G
Sbjct  96    FVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLG  155

Query  507   YFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSA  686
             Y +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+KYPHVA+GALASSA
Sbjct  156   YLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSA  215

Query  687   PILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLC  866
             PIL+F  +   + + +++T+DF+  SENCY+ I+ SW +ID  A+KP G+ +L K F++C
Sbjct  216   PILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDLIDDTANKPGGMELLRKTFRIC  275

Query  867   KGLK-SPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             K     PG L+ +L + +   A  D P         P YPV ++C  ID +  G + L +
Sbjct  276   KSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAK  335

Query  1017  IHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
             +HA         G   C+D    + P    + GW+WQ C+EM MP+G  +++++F    +
Sbjct  336   LHAAASVYYNYTGKARCFDLDDNSDP--HDLGGWQWQACTEMIMPVGGSNKESIFPEYEW  393

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S +  +  CD +Y V PRPHWITT +GGH ++ VL +  SNIIF NGLRDP+S  GVL+ 
Sbjct  394   SYEARASWCDFFYNVQPRPHWITTEFGGHAVERVLKRSASNIIFFNGLRDPWSGGGVLKT  453

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
             IS T++A+  + G+H +D+  +SK DP WL + RK EV II SWI++Y+ +L++
Sbjct  454   ISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQDLQS  507



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   434 bits (1117),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 292/460 (63%), Gaps = 26/460 (6%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             ++  ++ Q LDHFNY PQSY TF+QRY+++ +YWGG  +NSPIF + G E  ID   +  
Sbjct  38    YKEKFFTQILDHFNYNPQSYHTFQQRYLINDEYWGGPTTNSPIFVYTGNEGRIDWFAQNT  97

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLY  557
             GF+ + APRF ALLV+IEHRYYGKS+PFG   E A  N +T GY +SAQALADYA V+L 
Sbjct  98    GFMFETAPRFNALLVFIEHRYYGKSVPFGGNKETAYANSSTLGYLSSAQALADYAAVILD  157

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LKN   A  SP++VFGGSYGGMLA+W RLKYPHVA+GALASSAPIL FDNIT    + ++
Sbjct  158   LKNNLTAADSPVVVFGGSYGGMLAAWLRLKYPHVAIGALASSAPILNFDNITSSFTFNNI  217

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T+DF+  SENCY+ I++SW  I++ A+KP GL IL K FK+CK   S   L+ +L + Y
Sbjct  218   ITQDFRSESENCYKVIKRSWQEIEETAAKPGGLEILRKSFKICKNYMSTDYLEGWLGTAY  277

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1061
                A  D P         P YPV ++C  ID    G +  ++++A         GN  C+
Sbjct  278   TYTAMTDYPTPTNFLNPMPAYPVKQMCKAIDDPKSGNNTFEKLYAAASIYYNYTGNAKCF  337

Query  1062  ------DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDY  1223
                   DP    P       GW WQ C+EM +       D++F  + +S     + C   
Sbjct  338   NLIDRSDPHGIRP-------GWNWQACTEMILLTDGNTEDSIFPASNYSYNDRLQYCKSN  390

Query  1224  YGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRN  1403
             Y + PRP WI T +G   I  VL +FGSNIIF NGLRDP+S  GVL+DIS +V+A+  + 
Sbjct  391   YDIDPRPTWIPTEFGARHIHRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSVVAIVAKE  450

Query  1404  GSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             G+H +D+  +++ DP+WL E RK+EV II +W+++YY  L
Sbjct  451   GAHHVDLRFSTREDPEWLREVRKREVHIISNWLSQYYHTL  490



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/470 (45%), Positives = 306/470 (65%), Gaps = 20/470 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++ P SY  F Q+Y+++S +W   +   PI
Sbjct  30    SSLRQRKKASKSKSEFPFETRYFPQNLDHFSFTPDSYKVFHQKYLINSHFW---RKGGPI  86

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY
Sbjct  87    FVYTGNEGDIDWFATNTGFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGY  144

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  145   LNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  204

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  V++DFK+ S NC++ I++SW  +D +++  NGL  LSKKF+ CK
Sbjct  205   ILHFDNIVPLTSFYDAVSQDFKDASINCFKVIKRSWEELDALSTMKNGLQELSKKFRTCK  264

Query  870   GLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL S    +D+L   +   A  + P         P YPV ++C  IDG P+G+  LDR  
Sbjct  265   GLHSIYSARDWLSGAFVYTAMVNYPTAANFMASLPGYPVEQMCKIIDGFPRGSSNLDRAF  324

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G++ C++ +         + GW++Q C+EM MP+   ++ +M  P     
Sbjct  325   AAASLYYNYSGSKKCFEME--QQSDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYENDY  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS
Sbjct  382   EAFKEQCMSRYGVKPRPHWITTEFGGKSIETVLKRFGSNIIFSNGLQDPWSRGGVLKNIS  441

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
              +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II++WI++YY +L
Sbjct  442   SSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIENWISEYYRDL  491



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   434 bits (1115),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 310/471 (66%), Gaps = 20/471 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++RP+SY  F+Q+Y+++ ++W   +   PI
Sbjct  29    SSLRQNKKTSKSKSESPFETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPI  85

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++     T GY
Sbjct  86    FVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGY  143

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  144   LSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  203

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  +++DFK+ S NC++ I++SW  +D +++  +GL  LSKKF+ CK
Sbjct  204   ILHFDNIVPLASFYDAISQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCK  263

Query  870   GLKSPGELKDYLDST--------YCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL S    +D+L           Y TAA +  P P YPV ++C  IDG P+G+  LDR  
Sbjct  264   GLHSIYSARDWLMEAFVYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  323

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C+  ++  P     + GW +Q C+EM MP+   ++ +MF P     
Sbjct  324   AAASLYYNYSGSEKCF--ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDY  380

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS
Sbjct  381   EAFEEQCMSKYGVKPRPHWITTEFGGKKIETVLKRFGSNIIFSNGMQDPWSRGGVLKNIS  440

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +L+
Sbjct  441   SSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYYRDLK  491



>ref|XP_010493392.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=353

 Score =   428 bits (1100),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 256/353 (73%), Gaps = 5/353 (1%)
 Frame = +3

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             M N +T GY N+AQALADYA +LL++K KY  +HSPIIV GGSYGGMLA+WFRLKYPH+A
Sbjct  1     MKNASTLGYLNTAQALADYAAILLHIKEKYSTKHSPIIVVGGSYGGMLAAWFRLKYPHIA  60

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             LGALASSAP+LYF++  P+ GYY ++TK FKE +  CY TIRKSW  IDK+A+KPNGL I
Sbjct  61    LGALASSAPLLYFEDTRPKFGYYYIITKVFKETNMRCYNTIRKSWKEIDKVAAKPNGLLI  120

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAP--KGADILDR  1016
             L KKFK C  L    +LKD+LD+ Y  A QY++     V+ VC  I+  P  +  DILDR
Sbjct  121   LGKKFKTCAPLNRSFDLKDFLDTIYAEAVQYNE--GILVSNVCNAINANPPNRKIDILDR  178

Query  1017  IHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQ  1196
             I AGVV L GN++CYD   Y+   +   + WRWQ CSE+ +P+G   +DTMF  +PF+M 
Sbjct  179   IFAGVVALTGNQSCYDTN-YSVLVANDDMAWRWQGCSEIVIPVGHDKQDTMFPTSPFNMT  237

Query  1197  QFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISD  1376
              F   C+  YGV PRPHWITTYYG  DIKL+L +FGSNIIFSNGL DPYS  GVLED+SD
Sbjct  238   SFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVGGVLEDLSD  297

Query  1377  TVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALK  1535
             +V+A+ T NGSHC DI   SK DP+WL  QR++E++II SW++ Y  ++  L 
Sbjct  298   SVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSWLSTYQKDIRDLN  350



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   434 bits (1115),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 309/493 (63%), Gaps = 32/493 (6%)
 Frame = +3

Query  135   TPFYRSNLRRPESSSSDILPPE-------------FRTYYYHQTLDHFNYRPQSYATFKQ  275
             T F R+ L  P    S ++ PE             +RT Y+ Q LDHFN+ P+SY TF+Q
Sbjct  26    TSFARTTL--PARFPSSLVSPEKLSSLSSSGKNQIYRTRYFTQILDHFNFYPKSYQTFQQ  83

Query  276   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  455
             RY+++  +WGGA+SN+PIF + G E  ID   +  GFL + AP FKAL+V+IEHR+YGKS
Sbjct  84    RYLINDTHWGGAKSNAPIFVYTGNEGNIDWFAQNTGFLYETAPHFKALIVFIEHRFYGKS  143

Query  456   IPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  632
             IP+G  +E A  N TT GY +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+
Sbjct  144   IPYGGNKEVAYGNATTLGYLSSTQALADYASLIIDLKKNLSATDSPVVVFGGSYGGMLAA  203

Query  633   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  812
             WFRLKYPHV +GALASSAPIL F+NIT    + ++VT+DF+  SENCY+ I+ SW  I+ 
Sbjct  204   WFRLKYPHVTIGALASSAPILNFENITSPYSFSNIVTQDFRSESENCYKVIKGSWEQIES  263

Query  813   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTE  965
              A +P GL +L   FK+CK   S  +L+ +L + +   A  D P         P +PV +
Sbjct  264   TADEPGGLELLRNSFKICKNYISADDLEGWLRTAFTYTAMTDYPTPSNFLSPMPAFPVKQ  323

Query  966   VCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMA  1136
             +C  ID    G D   +++          G  TC+D    +      + GW WQ C+EM 
Sbjct  324   MCAAIDDPTTGNDTFKKLYGAASVYYNYSGKATCFDLDDDS--DPHDLGGWSWQACTEMI  381

Query  1137  MPIGRGDRDTMFFPAP-FSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNI  1313
             MP+G G+ +   FPA  +  +  +  C   +G+ PRP WITT +GGHDIK VL ++GSNI
Sbjct  382   MPMG-GNTEVSIFPASEWKYKYRAASCMRNFGIEPRPLWITTEFGGHDIKRVLKRYGSNI  440

Query  1314  IFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQ  1493
             IF NGLRDP+S  GVL++IS +++A+  + G+H +D+   +  DP+WL E RK+E+ II 
Sbjct  441   IFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPEWLKEVRKQEINIIG  500

Query  1494  SWITKYYVELEAL  1532
             +WI++YY +L  L
Sbjct  501   NWISQYYHDLAQL  513



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   432 bits (1112),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 213/472 (45%), Positives = 306/472 (65%), Gaps = 20/472 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++ P+SY  F Q+Y+++S++W   +   PI
Sbjct  30    SSLRQKKKASKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RKGGPI  86

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S P    +++  +  T GY
Sbjct  87    FVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPI--RKKSHKSAETLGY  144

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  145   LNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  204

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  V++DFK+ S NC++ I++SW  +D +++K NGL  LSKKF+ CK
Sbjct  205   ILHFDNIVPLTSFYDAVSQDFKDASMNCFKVIKRSWEELDAVSTKKNGLQELSKKFRTCK  264

Query  870   GLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL+S     ++L   +         TAA +  P P YPV E+C  IDG P+G+  LDR  
Sbjct  265   GLQSRYSASNWLSGAFVYTAMVNYPTAANFMAPLPGYPVEEMCKIIDGFPRGSSNLDRAF  324

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C+  ++        + GW++Q C+EM MP+   ++ +M  P     
Sbjct  325   AAASLYYNYSGSEKCF--EMEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDY  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS
Sbjct  382   EAFEEQCKSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNIS  441

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
              +++A+ T+ G+H  D+  A+K DP+WL EQR +EV II+ WI++YY +L  
Sbjct  442   SSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYYRDLRG  493



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 310/484 (64%), Gaps = 24/484 (5%)
 Frame = +3

Query  114   PHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             P   PR T  ++S+  + + +  + +P  F+T ++ Q LDHF Y P+SY  F Q+Y+++S
Sbjct  31    PIFFPRAT--HQSSSLKQDDTLKEKIP--FKTQFFPQILDHFTYNPKSYIIFYQKYLINS  86

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             ++W      +PIF + G E  I+      GFL D AP+F+ALLV+IEHRYYG+S+PFG  
Sbjct  87    QFW---HHGAPIFVYTGNEGNIEWFAANTGFLLDIAPKFRALLVFIEHRYYGESLPFG--  141

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             +++ N+  T GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYP
Sbjct  142   KDSYNSAETVGYLNSQQALADYAVLIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYP  201

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+A+GALASSAPIL+FD+I P+  +Y  V++DFK VS NCYQ I+ SW+ +   +S+  G
Sbjct  202   HIAIGALASSAPILHFDDIIPQTSFYDAVSQDFKSVSLNCYQVIKGSWAELAAFSSQGQG  261

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDG  986
             L+ LSK FK CKGL S    +++L + +   A  + P         P YPV E+C  ID 
Sbjct  262   LAELSKNFKSCKGLHSVDAAQNWLWAAFVYTAMVNYPTEANFMMHLPAYPVKEMCKIIDA  321

Query  987   APKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1157
              P G   L +  A             C+D  I +   +  + GW WQ C+EM MP+    
Sbjct  322   LPPGETKLSKAFAAASLYYNYSQTEKCFD--IEHGSDAHGLHGWDWQACTEMVMPMS-CS  378

Query  1158  RDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRD  1337
              ++MF P  ++   F+  C   YGV PRPHWI T +GG  I+ +L +FGSNIIFSNG++D
Sbjct  379   SESMFTPYSYNYSAFAEQCMKNYGVTPRPHWIATEFGGKQIEKILKRFGSNIIFSNGMQD  438

Query  1338  PYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYV  1517
             P+S  GVL++IS +++A+ T  G+H +D   A+K DP+WL EQRK+EV+IIQSWI +YY 
Sbjct  439   PWSRGGVLKNISASIVALVTEEGAHHVDFRFATKDDPNWLVEQRKQEVDIIQSWIDEYYA  498

Query  1518  ELEA  1529
             +L +
Sbjct  499   DLRS  502



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/492 (44%), Positives = 319/492 (65%), Gaps = 30/492 (6%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPE----FRTYYYHQTLDHFNYR-PQSYATFKQ  275
             +P ++ ++TP +        SS  D LP +    + T Y+ Q LDHFN+  PQ   TF+Q
Sbjct  14    SPISLAKITPKF-------PSSFDDHLPSKGKFNYDTKYFTQILDHFNFNNPQ---TFQQ  63

Query  276   RYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKS  455
             RY+++ KYWGG+++N+PIF + G E  I+   +  GF+ + AP F ALLV+IEHRYYGKS
Sbjct  64    RYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNTGFMFEIAPHFNALLVFIEHRYYGKS  123

Query  456   IPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLAS  632
             IP+G  +  A +N+TT GY +S QALADYA +++ LKN   A  SP++VFGGSYGGMLA+
Sbjct  124   IPYGGDKTIAYSNKTTLGYLSSTQALADYATLIIDLKNNLTAIDSPVVVFGGSYGGMLAA  183

Query  633   WFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDK  812
             WFRLKYPHV +GALASSAPIL F NIT    + +++T+DFK  S+NCY+ I+ SW  I+ 
Sbjct  184   WFRLKYPHVTIGALASSAPILNFGNITSPYSFNNIITQDFKGESDNCYKVIKGSWKQIED  243

Query  813   IASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTE  965
             +A    GL  L K F++CK   S G L+++L + +   A  D P         P YPV +
Sbjct  244   MAKTKGGLEKLRKSFRICKNYISQGALENWLYTAFVYTAMTDYPTPSNFLNPLPAYPVKQ  303

Query  966   VCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMA  1136
             +C  ID    G D  ++I+          GN TC+D   ++ P    + GW WQ+C+EM 
Sbjct  304   MCKAIDDPKGGKDTFEKIYEAANIYYNYTGNATCFDLNDHSDP--HGLAGWTWQSCTEMV  361

Query  1137  MPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNII  1316
             MP    +++++F P+ +   + ++ C   +GV PRP+W+TT +GG++I+ VL +FGSNII
Sbjct  362   MPTDGNNKESIFPPSKWDYNERAQFCKSIFGVEPRPNWVTTEFGGYNIERVLKRFGSNII  421

Query  1317  FSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQS  1496
             F NGLRDP+S AGVL+DIS +++A+  + G+H +D+  +SK DP WL + R++EV II +
Sbjct  422   FFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLQQVREREVNIISN  481

Query  1497  WITKYYVELEAL  1532
             W+++YY  L  +
Sbjct  482   WLSQYYQSLNEI  493



>ref|XP_004306148.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=795

 Score =   441 bits (1135),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 303/454 (67%), Gaps = 17/454 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             +RT Y+ Q LDHFNY P+SY TF+QRY+++  +WGGA+SN+PIF + G E  I+   +  
Sbjct  340   YRTKYFTQILDHFNYYPKSYDTFQQRYLINDTFWGGAKSNAPIFVYTGNEGIIEWFAQNT  399

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GFL + AP FKAL+++IEHR+YGKSIPFG  ++ A +N TT GY +S QALADYA +++ 
Sbjct  400   GFLYETAPHFKALIIFIEHRFYGKSIPFGGKKDVAYSNATTLGYLSSTQALADYASLIID  459

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASS+PIL F+NIT    + ++
Sbjct  460   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSSPILNFENITSPYSFNNI  519

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             VTKDF+  SE+CY+ I+ SW  I++ A++P G+ +L K F++CK   +  +L+ +L++ Y
Sbjct  520   VTKDFR--SESCYKVIKGSWQQIEETANQPGGIELLRKSFRICKNHFTGYDLEGWLETAY  577

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1061
                A  D P         P YPV ++C  ID    G D   ++           G  TC+
Sbjct  578   IYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPATGNDTFAKLFGAATVYYNYTGTATCF  637

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             DP   + P    + GW+WQ C+EM MP    + ++MF P+ +  Q     C+  YGV PR
Sbjct  638   DPNDNSDP--HDLGGWQWQACTEMIMPTSGNNEESMFPPSEWRYQGRVSYCEGAYGVEPR  695

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             P+WITT +GGHDIK VL ++GSNIIF NGLRDP+S  GVL +IS++++A+  + G+H +D
Sbjct  696   PNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISESIVAIVAKEGAHHVD  755

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             +   +  DP+WL + RK+E+ II  WI++YY +L
Sbjct  756   LRFKTSEDPEWLKDVRKQEIGIIAKWISEYYHDL  789



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 295/454 (65%), Gaps = 16/454 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             + T Y+ Q LDHFNY P+SY TF+ RY+++  YWGGA+SNSPIF + G E  I+   +  
Sbjct  58    YTTKYFTQVLDHFNY-PKSYETFQHRYLINDTYWGGAKSNSPIFVYTGNEGNIEWFAENT  116

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GFL + AP FKAL+++IEHR+YGKS+PFG  ++ A +N TT GY +S QALADYA +++ 
Sbjct  117   GFLYETAPHFKALIIFIEHRFYGKSLPFGGKKDVAYSNATTLGYLSSTQALADYASLIID  176

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++V GGS+G MLA+WFRLKYPHV +GALASS+PIL F+NIT    + ++
Sbjct  177   LKKNLTATDSPVVVLGGSHGEMLAAWFRLKYPHVTIGALASSSPILNFNNITSPESFNNI  236

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +TKDF   SE+CY+ I+ SW  I   A +  GL +L K FKLCK + S  +L+++L+S +
Sbjct  237   ITKDFMSESESCYKVIKGSWQQIKDTAKQHGGLELLQKSFKLCKNIISVDDLQNWLESAF  296

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1061
                A  D P         P YPV ++C  ID    G D   +++  V       G  TC+
Sbjct  297   IYTAMTDYPTPSNFMTPVPAYPVKQMCKAIDNPATGNDTFAKLYGAVTVYYNYSGTTTCF  356

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             DP   + P    + GW WQ C+EM M     D++++F P+    +     C + YGV PR
Sbjct  357   DPDDNSDP--HDLGGWDWQACTEMIMQTNGNDKESIFPPSESQYKDQVSYCKEAYGVEPR  414

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             P+WITT +GGHDIK VL ++GSNIIF NGLRDP+S  GVL +IS  ++A+  + G+H +D
Sbjct  415   PNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISKRIVAIVAKEGAHHVD  474

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             +   +  DP+WL + RK+EV+II  WI++YY +L
Sbjct  475   LRFKTNEDPEWLKDVRKQEVKIIAKWISEYYHDL  508



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   432 bits (1111),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 309/471 (66%), Gaps = 20/471 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++RP+SY  F+Q+Y+++ ++W   +   PI
Sbjct  61    SSLRQNKKTSKSKSESPFETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPI  117

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++     T GY
Sbjct  118   FVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGY  175

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  176   LSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  235

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  +++DFK+ S NC++ I++SW  +D +++  +GL  LSKKF+ CK
Sbjct  236   ILHFDNIVPLASFYDAISQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCK  295

Query  870   GLKSPGELKDYLDST--------YCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL S    +D+L           Y T A +  P P YPV ++C  IDG P+G+  LDR  
Sbjct  296   GLHSIYSARDWLMGAFVYTAMVNYATTANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  355

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C+  ++  P     + GW +Q C+EM MP+   ++ +MF P     
Sbjct  356   AAASLYYNYSGSEKCF--ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDY  412

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS
Sbjct  413   EAFEEQCMSKYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNIS  472

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              +++A+ T+ G+H  D+  A+K DP+WL EQR++EV I++ WI++YY +L+
Sbjct  473   SSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIVEKWISEYYRDLK  523



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 306/470 (65%), Gaps = 20/470 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF + P+SY  F Q+Y+++S++W   +   PI
Sbjct  29    SSLRQQKKASKSKQELPFETRYFPQNLDHFGFTPESYTVFHQKYLINSRFW---RKGGPI  85

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY
Sbjct  86    FVYTGNEGDIDWFASNTGFMSDIAPKFQALLVFIEHRFYGESTPFG--KKSHKSAETLGY  143

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAP
Sbjct  144   LSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  203

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  +++DFK+ S NC+  I++SW  ++ +++  NGL  LSKKF+ CK
Sbjct  204   ILHFDNIVPLTSFYDAISQDFKDASINCFTVIKRSWEELEAVSTMKNGLQELSKKFRTCK  263

Query  870   GLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL+S    +D+L   +         TAA +  P P YPV ++C  IDG P+G+  LDR  
Sbjct  264   GLQSKYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  323

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C++ +         + GW++Q C+EM MP+   ++ +M  P     
Sbjct  324   AAASLYYNYSGSEKCFEME--QQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDY  380

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS
Sbjct  381   EAFQEQCMSTYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNIS  440

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
              +++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +L
Sbjct  441   SSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVSIIEKWISEYYRDL  490



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/486 (44%), Positives = 305/486 (63%), Gaps = 24/486 (5%)
 Frame = +3

Query  129   RLTPFYRSNLRRPESSSSDILPPE-------FRTYYYHQTLDHFNYRPQSYATFKQRYIV  287
             ++ P + S +  PESS    +  +       + T Y+ Q LDHF +RP+SY TF+QRY++
Sbjct  29    KIVPRFPSPVIHPESSQRPSISNDHSGSNGLYETRYFTQVLDHFGFRPESYQTFQQRYLI  88

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +S +WGG Q N+PIF + G E  I+   +  GF+ + APRF ALLV+IEHR+YGKSIPFG
Sbjct  89    NSTFWGGPQRNAPIFVYTGNEGDIEWFTQNTGFMFETAPRFNALLVFIEHRFYGKSIPFG  148

Query  468   TMEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRL  644
               +E A +N +T GY +S QALADYA ++  LK  + A+ SP++VFGGSYGGMLA+WFRL
Sbjct  149   GNKEVAYSNSSTLGYLSSTQALADYATLITDLKKNWTAEDSPVVVFGGSYGGMLAAWFRL  208

Query  645   KYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASK  824
             KYPH+A+GAL+SS+PIL FDNIT    +  ++T+DF+  SENCYQ I++SW  I+ +A +
Sbjct  209   KYPHIAIGALSSSSPILNFDNITSPYSFNDIITRDFRSESENCYQVIKQSWQKIEDMAEQ  268

Query  825   PNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGG  977
               GL IL K F LCK     G L+ +L +     A  D P         P YPV ++C  
Sbjct  269   HGGLKILGKSFGLCKNSMDAGYLQGWLQTALIYTAMTDYPTPSNFLNPLPAYPVKQMCKA  328

Query  978   IDGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIG  1148
             ID   KG D   +++          G  +C+D  + +      +  W WQ C+EM +P G
Sbjct  329   IDDPSKGDDDFAKLYGAANIYYNYSGGVSCFD--LLDDSDPHGLGEWAWQACTEMILPTG  386

Query  1149  RGDRDTMFFPA-PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSN  1325
              G+R+T  FPA  ++       C   +GV PRP WI   +GGHDI+  L +FGSNIIF N
Sbjct  387   -GNRETSIFPAHEYNYNDRVATCTSLFGVVPRPTWIPIEFGGHDIRRTLRRFGSNIIFFN  445

Query  1326  GLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWIT  1505
             GLRDP+S  GVL+ IS +++A+    G+H +D+  ++  DP+WL + RKKE++II  WI+
Sbjct  446   GLRDPWSGGGVLKSISKSIVAIVAEKGAHHVDLRYSTNEDPEWLQDVRKKEIKIISGWIS  505

Query  1506  KYYVEL  1523
             +YY +L
Sbjct  506   QYYRDL  511



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 313/483 (65%), Gaps = 25/483 (5%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYR-PQSYATFKQRYIVSSKYW  302
             PRL P   S+L    SS   +    + T Y+ Q LDHFNY  PQ   TF+QRY+++ KYW
Sbjct  21    PRLFP---SSLDDQLSSKGKL---SYETNYFTQILDHFNYNNPQ---TFQQRYLLNDKYW  71

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-  479
             GG+++N+PIF + G E  I+   +  GF+ + AP F ALLV+IEHR+YGKSIP+G  +  
Sbjct  72    GGSKNNAPIFVYTGNEGNIEWFTQNTGFMFEIAPHFNALLVFIEHRFYGKSIPYGGDKTI  131

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A +N+TT GY +S QALADYA +++ LKN   A  SP++VFGGSYGGMLA+WFRLKYPHV
Sbjct  132   AYSNKTTLGYLSSTQALADYATLIIDLKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHV  191

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
              +GALASSAPIL F NIT    + +++T+DFK  SENCY+ I+ SW  I+ +A    GL 
Sbjct  192   TIGALASSAPILNFGNITSPYSFNNIITQDFKGESENCYKVIKGSWKQIEDMAKTKGGLE  251

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAP  992
              L K F++CK   S G L+++L + +   A  D P         P YPV ++C  ID   
Sbjct  252   KLRKSFRICKNYISQGALENWLYTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPK  311

Query  993   KGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1163
              G D  ++I+          GN TC++   ++ P    + GW WQ C+EM MP    +++
Sbjct  312   SGKDTFEKIYGAANIYYNYTGNATCFNLNDHSDP--HGLAGWTWQACTEMVMPTDGNNKE  369

Query  1164  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1343
             ++F P+ +   + ++ C   +GV PRP+W+TT +GG++I+ VL +FGSNIIF NGLRDP+
Sbjct  370   SIFPPSKWDYNERAQFCKSNFGVEPRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPW  429

Query  1344  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             S AGVL+DIS +++A+  + G+H +D+  +SK DP WL + R++EV II +W+++YY  L
Sbjct  430   SGAGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLKQVREREVNIISNWLSQYYQSL  489

Query  1524  EAL  1532
               +
Sbjct  490   NEI  492



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   430 bits (1105),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 210/453 (46%), Positives = 297/453 (66%), Gaps = 20/453 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             F T Y+ Q LDHF+++P+SY  F Q+Y+++  +W   +   PIF + G E  ID      
Sbjct  48    FETRYFPQNLDHFSFKPESYKVFHQKYLINGSFW---RKGGPIFVYTGNEGDIDWFASNT  104

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  560
             GF++D AP+FKALLV+IEHR+YG+S P G  +++     T GY NS QALADYA ++  L
Sbjct  105   GFMSDIAPKFKALLVFIEHRFYGESTPLG--KKSPKTAETLGYLNSQQALADYAILIRSL  162

Query  561   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  740
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL+FDNI P   +Y  +
Sbjct  163   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSFYDAI  222

Query  741   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDST--  914
             ++DFK+ S NC + I++SW  ++ +++   GL  LSKKF+ CKGL+S    +D+L S   
Sbjct  223   SQDFKDASVNCVKVIKRSWEELEAVSTMKTGLPELSKKFRTCKGLQSIYSARDWLMSAFV  282

Query  915   ------YCTAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1064
                   Y TAA +  P P YPV ++C  +DG P+G+  LDR  A         G++ C++
Sbjct  283   YTAMVNYATAANFMAPLPAYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSKKCFE  342

Query  1065  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1244
              +   P     + GW WQ C+EM MP+   ++ +MF P     + F   C   YGV PRP
Sbjct  343   ME--QPTDDHGLDGWGWQACTEMVMPMSISNQ-SMFPPYDNDYEAFQDQCMGRYGVKPRP  399

Query  1245  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1424
             HWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H  D+
Sbjct  400   HWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADL  459

Query  1425  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
               A+K DP+WL EQR +EV II+ WIT+YY +L
Sbjct  460   RAATKDDPEWLKEQRMQEVTIIEQWITQYYKDL  492



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 290/451 (64%), Gaps = 15/451 (3%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             + T Y+ Q LDHFNY P SY TF+QRY+ + K WGGA++N+PIF + G E  I+   +  
Sbjct  52    YETKYFTQILDHFNYNPDSYQTFQQRYLFNDKNWGGAKTNAPIFVYTGNEGDIEWFTQNT  111

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GF+ + AP FKALLV+IEHR+YGKSIP+G  +E A +N +T GY +S QALADYA +++ 
Sbjct  112   GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKEIAYSNTSTLGYLSSTQALADYATLIID  171

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F NIT    + ++
Sbjct  172   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFQNITSPYSFNNI  231

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T+DF+  SENCY+ I+ SW  I+ +A    GL  L K F++CK   SP  L ++L + +
Sbjct  232   ITQDFRGESENCYKVIKGSWKKIEDMAKTTGGLKKLRKSFRICKNYISPDSLVNWLSTAF  291

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1061
                A  D P         P YPV E+C  ID    G D  ++++          G  TC 
Sbjct  292   TYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANIYYNYTGKATCL  351

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             +    + P    + GW WQ C+EM MP    +++++F P+ +   +  R C     V PR
Sbjct  352   NLNDNSDP--HGLGGWTWQACTEMVMPTNGNNKESIFPPSEWDYNERVRFCKLILDVKPR  409

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             P WITT +GGHDI+ VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D
Sbjct  410   PDWITTEFGGHDIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHVD  469

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             +  +SK DP+WL E R +E+ II  WI++YY
Sbjct  470   LRWSSKEDPEWLREVRAREINIISKWISQYY  500



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   429 bits (1103),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/468 (45%), Positives = 304/468 (65%), Gaps = 22/468 (5%)
 Frame = +3

Query  156   LRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFA  335
             L++  S S   LP  F T Y+ Q LDHF++ P SY  F Q+Y++++++W   +   PIF 
Sbjct  33    LKKKVSKSKHELP--FETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFV  87

Query  336   WLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFN  515
             + G E  ID      GF+ D AP+F+ALLV+IEHR+YG+S PFG  +++  +  T GY N
Sbjct  88    YTGNEGDIDWFASNTGFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLN  145

Query  516   SAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPIL  695
             S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL
Sbjct  146   SQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPIL  205

Query  696   YFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGL  875
             +FDNI P   +Y  +++DFK+ S NC++ I++SW  ++ +++  NGL  LSKKF+ CKGL
Sbjct  206   HFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELEAVSTMKNGLQELSKKFRTCKGL  265

Query  876   KSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAG  1028
              S    +D+L   +         TAA +  P P YPV ++C  IDG P+G+  LDR  A 
Sbjct  266   HSQYSARDWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAA  325

Query  1029  VV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
                     G+  C++ +         + GW++Q C+EM MP+   ++ +M  P     + 
Sbjct  326   ASLYYNYSGSEKCFEME--QQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDSEA  382

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +
Sbjct  383   FQEQCMTRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSS  442

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ++A+ T+ G+H  D+  A+K DP+WL EQR++EV II+ WI++YY +L
Sbjct  443   IVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDL  490



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/453 (46%), Positives = 296/453 (65%), Gaps = 20/453 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             F+ +Y+ QTLDHF ++P+S   F Q+Y+++S YW      +PIF + G E  I+      
Sbjct  51    FKVHYFPQTLDHFTFQPKSSKIFYQKYLINSHYW---HKGAPIFVYTGNEGDIEWFAANT  107

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  560
             GF+ D AP+FKALLV+IEHR+YG+S PFG  +E+  +  T GY NS QALAD+A ++  L
Sbjct  108   GFMLDIAPKFKALLVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALADFAVLIRNL  165

Query  561   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  740
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL FD I P + +Y  V
Sbjct  166   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIIPWSSFYDAV  225

Query  741   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  920
             ++DFK+VS NCY+ I+ SW  ++ ++++   L+ LSK F+ CK L S    +D+L + + 
Sbjct  226   SQDFKDVSWNCYEVIKGSWEELEAMSTQKEALAELSKAFRTCKSLHSTASARDWLWTAFV  285

Query  921   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1064
               A  + P         P YPV E+C  ID  P GA  L R  A             C++
Sbjct  286   YTAMVNYPTEANFLKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYSRAENCFE  345

Query  1065  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1244
               I +   +  + GW WQTC+EM MP+    +++MF P+ F  ++F+  C   Y V PRP
Sbjct  346   --IEHEVDTHGLHGWDWQTCTEMVMPM-TCSKESMFPPSGFDYEEFAEQCQMKYEVLPRP  402

Query  1245  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1424
             HWITT +GG  I+ VL KFGSNIIFSNG++DP+S  GVL++IS +++A+ T+ G+H +D 
Sbjct  403   HWITTEFGGERIQKVLKKFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDF  462

Query  1425  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
               A+K DPDWL EQR++EVEIIQ W+ +YY +L
Sbjct  463   RSATKDDPDWLVEQRRQEVEIIQKWLNEYYADL  495



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/480 (44%), Positives = 311/480 (65%), Gaps = 24/480 (5%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             IPR    Y++  ++P+ +   I    ++T Y+ Q LDHF ++P  Y  F Q+Y++SS+YW
Sbjct  28    IPRAAN-YQTLTKQPKVTKPKI---PYKTRYFPQLLDHFTFQPNGYKIFYQKYLISSQYW  83

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEA  482
                   +PIF + G E  I+      GFL D AP+F+ALLV+IEHR+YG+S+PFG  +++
Sbjct  84    ---HKEAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFG--KDS  138

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
               +  T GY NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A
Sbjct  139   YKSAETLGYLNSQQALADFAVLIRSLKQNLSSEASPVVVFGGSYGGMLATWFRLKYPHIA  198

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPIL FD+ITP + +Y  V++DF+E S NCY+ I+ SW+ ++ ++S+  GL  
Sbjct  199   IGALASSAPILQFDDITPWSSFYDAVSQDFREASLNCYEVIKGSWAELETLSSQKEGLIE  258

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPK  995
             LS+ F+ CK L S   + D+L S Y  +A  + P         P YPV E+C  IDG P 
Sbjct  259   LSRTFRTCKDLHSLDSVWDWLWSAYVYSAMVNYPTEANFMKPLPAYPVKEMCKIIDGFPA  318

Query  996   GADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDT  1166
             GA  + R+ A             C+  Q+ N P +  + GW WQ C+EM MP+    +++
Sbjct  319   GASKVSRVFAAASLYYNYSRGEKCF--QLENVPDAHGLHGWNWQACTEMVMPM-TCSKES  375

Query  1167  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1346
             MF P+ +  ++F+ +C   +GV PR HWITT +GG  I  VL +FGSNIIFSNG+ DP+S
Sbjct  376   MFPPSGYDYKEFAEECKKKFGVMPRQHWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWS  435

Query  1347  SAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
               GVL++IS +++A+ T+ G+H +D   A+K DP+WL E RK+E++II  WI +YY +L+
Sbjct  436   RGGVLKNISSSIIAIVTKKGAHHVDFRSATKDDPNWLKEMRKQEIQIIGRWIDEYYADLK  495



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   428 bits (1101),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 306/473 (65%), Gaps = 24/473 (5%)
 Frame = +3

Query  144   YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNS  323
             Y+S+L++    S   +P  F+ +Y+ Q LDHF + P+S   FKQ+Y+++ KYW   Q   
Sbjct  35    YQSSLKKQHVKSK--IP--FKAHYFPQILDHFTFLPKSSKVFKQKYLINDKYW---QKGG  87

Query  324   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  503
             PIF + G E  ID      GF+ D AP+F ALLV+IEHR+YG S+PFG  +++  +  T 
Sbjct  88    PIFVYTGNEGNIDWFAANTGFMLDIAPKFHALLVFIEHRFYGNSMPFG--KKSYKSPKTL  145

Query  504   GYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASS  683
             GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLASWFRLKYPH+A+GA+ASS
Sbjct  146   GYLNSQQALADYAVLIRSLKQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGAVASS  205

Query  684   APILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  863
             APIL FD ITP + +Y  V++DFKE S NCY+ I+ SW+ ++ ++    GL+ +S  F+ 
Sbjct  206   APILQFDKITPWSSFYDAVSQDFKESSLNCYEVIKGSWTELNALSKHEEGLTKVSTLFRT  265

Query  864   CKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             CKGL S    +D+L   +   A  + P         P YPV E+C  IDG PKGA  + R
Sbjct  266   CKGLHSVYSARDWLWEAFVYTAMVNYPTEANFMMPLPAYPVKEMCRIIDGFPKGASKISR  325

Query  1017  IHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
               A             C++ +  N   +  + GW WQ C+EM MP+   + ++MF P+ +
Sbjct  326   AFAAASLYYNYTQTEKCFNLEGGN--DAHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSY  382

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S ++F  DC   YGV PRPHWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  GVL++
Sbjct  383   SYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKN  442

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             IS +++A+ T+ G+H +D    +K DPDWL  QRK+E+ IIQ W+ +YY++L+
Sbjct  443   ISASIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEMAIIQKWLEEYYIDLK  495



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 294/457 (64%), Gaps = 15/457 (3%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             +RT Y+ Q LDHFN+ P+SY TF+QRY+++  +WGGA+SN+PIF + G E  I+   +  
Sbjct  59    YRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIEWFAQNT  118

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GFL + AP FKAL+V+IEHR+YGKSIP+G  +E A +N TT GY +S QALADYA +++ 
Sbjct  119   GFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYSNATTLGYLSSTQALADYASLIID  178

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F+NIT    + ++
Sbjct  179   LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSFTNI  238

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T+DF+  SENCY+ I+ SW  I+  A +P GL +L   FK+CK   S   L+ +L + +
Sbjct  239   ITQDFRSESENCYKVIKGSWEQIESTADQPGGLELLRNSFKICKNYISADYLEGWLRTAF  298

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1061
                A  D P         P +PV ++C  ID    G D   +++          G  TC+
Sbjct  299   TYTAMTDYPTPSNFLSPLPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGTATCF  358

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D    +      + GW WQ C+EM MP      +++F  + +     +  C   +G+ PR
Sbjct  359   DLDDDS--DPHDLGGWSWQACTEMIMPTSGNTEESIFPASEWKYXYRAASCKRSFGIEPR  416

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             P WITT +GGHDI+ VL ++GSNIIF NGLRDP+S  GVL++IS +++A+  + G+H +D
Sbjct  417   PLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVD  476

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             +   +  DPDWL E RK+E+ II +WI++YY +L  L
Sbjct  477   LRFKNSEDPDWLKEVRKQEINIIGNWISQYYHDLAQL  513



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   428 bits (1100),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/480 (44%), Positives = 304/480 (63%), Gaps = 19/480 (4%)
 Frame = +3

Query  126   PRL-TPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             PR  +P  +S      SS+S+ L   ++  ++ Q LDHFN+ P+SY TF++RY+++  +W
Sbjct  20    PRFPSPSIQSQKTSLSSSTSNGL---YKEKFFTQVLDHFNFNPESYHTFQERYLINDTFW  76

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-  479
             GG + N+PIF + G E  I+   +  GF+ D AP F ALLV+IEHR+YGKSIPFG  ++ 
Sbjct  77    GGPKKNAPIFLYTGNEGDIEWFAQNTGFMFDIAPHFNALLVFIEHRFYGKSIPFGGDKKV  136

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A +N +T GY  S QALADYA ++  LKN   A  SP++VFGGSYGGMLA+WFRLKYPH+
Sbjct  137   AYSNASTLGYLTSTQALADYATLMTDLKNNLSATESPVVVFGGSYGGMLAAWFRLKYPHI  196

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
              +GALASSAPIL F NIT    + S++T DF+  SENCY+ I+ SW  I+  AS+P GL 
Sbjct  197   TIGALASSAPILGFVNITSPYSFNSIITNDFRNESENCYKVIKGSWQKIEDTASQPGGLE  256

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAP  992
              L K FK+CK   S G L+ +L + +   A  D P         P +PV ++C  ID   
Sbjct  257   KLRKAFKICKNYISAGSLESWLYTAWTYTAMTDYPTSSNFLNPLPPHPVKQMCKAIDDPT  316

Query  993   KGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1163
              G D   +++          G  TC+D  + N      + GW WQ C+EM +P G  +++
Sbjct  317   TGNDTFAKLYGAASVYYNHSGTATCFD--LDNNSDPHGLGGWSWQACTEMILPTGGNNKE  374

Query  1164  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1343
             +MF  + +S+   +  C   + + PRP+W+   +GGH+IK VL +FGSNIIF NGLRDP+
Sbjct  375   SMFPASSWSLNDRATYCQYAFHIQPRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRDPW  434

Query  1344  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             S  GVLEDIS +++A+  + G+H +D+  AS  DP WL   RK+E++II  W+++YY++L
Sbjct  435   SGGGVLEDISKSIIAIVAKKGAHHVDLRYASSEDPKWLQHVRKREIKIIAKWLSEYYLDL  494



>ref|XP_006388622.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
 gb|ERP47536.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
Length=357

 Score =   422 bits (1086),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 257/337 (76%), Gaps = 3/337 (1%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             T + IP+L  F ++  R    +SS     +   +YY QTLDHFNY+P+SY TF+QRY++ 
Sbjct  23    TQYKIPKLGAFQKNIHRTEPQTSSKSSSKDLVMFYYTQTLDHFNYKPESYTTFRQRYVID  82

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
              +YWGGA +++PIF + GAE  +DDD   IGFL+DNAP FKALL+YIEHRYYG+SIPFG+
Sbjct  83    FRYWGGANTSAPIFVFFGAEEDLDDDLDAIGFLSDNAPHFKALLIYIEHRYYGRSIPFGS  142

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
              +EA+ N  T GY NSAQA+ADYA V+++LK KY A++SP+IV GGSYGGML SWFRLKY
Sbjct  143   RKEALKNAETLGYLNSAQAMADYAAVIMHLKKKYSAKNSPVIVIGGSYGGMLTSWFRLKY  202

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+ALGALASSAPILYFD+I+P+ GYYS+VTKDFKE SE+CY TIRKSW  I+KIASKPN
Sbjct  203   PHIALGALASSAPILYFDDISPQEGYYSIVTKDFKETSESCYNTIRKSWGEIEKIASKPN  262

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKG-ADI  1007
             GLSILSKKFK C  L    EL+D+LDS Y  AAQYD PP++PV+ VCGGI+ A     DI
Sbjct  263   GLSILSKKFKTCFPLNRTFELEDFLDSIYFEAAQYDYPPEFPVSIVCGGINKASAARTDI  322

Query  1008  LDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQ  1118
             LDRI A VV   GNR+C+D   +N P  + I  WRWQ
Sbjct  323   LDRILAVVVAYMGNRSCHDMNAFNYP--DAIYEWRWQ  357



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   427 bits (1099),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 304/472 (64%), Gaps = 20/472 (4%)
 Frame = +3

Query  150   SNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPI  329
             S+LR+ + +S       F T Y+ Q LDHF++ P+SY  F Q+Y+++++ W   +   PI
Sbjct  30    SSLRQKKKASKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLINNRSW---RKGGPI  86

Query  330   FAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGY  509
             F + G E  ID      GF++D AP+F+ALLV+IEHR+YG+S P G  +++  +  T GY
Sbjct  87    FVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGY  144

Query  510   FNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAP  689
              NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAP
Sbjct  145   LNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  204

Query  690   ILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCK  869
             IL+FDNI P   +Y  V++DFK+ S NC++ I++SW  +D +++K NGL  LSKKF+ CK
Sbjct  205   ILHFDNIVPLTSFYDAVSQDFKDASINCFKVIKRSWEELDAVSTKKNGLQELSKKFRTCK  264

Query  870   GLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIH  1022
             GL+S     ++L   +   A  + P         P YPV ++C  IDG P+G+  LDR  
Sbjct  265   GLQSIYSASNWLSGAFVYTAMVNYPTPANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAF  324

Query  1023  AGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSM  1193
             A         G+  C++  +        + GW++Q C+EM MP+   ++ +M  P     
Sbjct  325   AAASLYYNYSGSEKCFE--MEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDY  381

Query  1194  QQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDIS  1373
             + F   C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNGL+DP+S  GVL++IS
Sbjct  382   EAFKEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNIS  441

Query  1374  DTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEA  1529
              +++A+ T+ G+H  D+  A+K DP+WL EQR +EV II+ WI++YY +L  
Sbjct  442   SSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYYRDLRG  493



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   427 bits (1099),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 212/480 (44%), Positives = 303/480 (63%), Gaps = 17/480 (4%)
 Frame = +3

Query  129   RLTPFYRSNLRRPE--SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             ++ P + S++ RPE  S ++      ++  Y+ Q LDHFN+ P+SY TF+ RY+++  YW
Sbjct  27    KVPPRFPSSVIRPEQLSLATKRGTKLYKARYFTQILDHFNFNPKSYQTFQHRYLINDTYW  86

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-  479
              G + NSPIF + G E  I+   +  GF+ D AP FKALLV+IEHR+YGKSIPFG  ++ 
Sbjct  87    SGPEKNSPIFVYTGNEGDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDI  146

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A +N +T GY  S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFRLKYPH+
Sbjct  147   AYSNASTLGYLTSTQALADYATLIIDLKKNLTADDSPVVVFGGSYGGMLATWFRLKYPHI  206

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
              +GALASSAPIL F+NIT    + +++T+DF+  SENCY+ I+ SW  I+   S+  GL 
Sbjct  207   VIGALASSAPILNFENITSPYSFNNIITQDFRSESENCYKVIKGSWEQIEDTGSRSGGLE  266

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAP  992
             +L K F++CK       L+ +L + +   A  D P         P YPV ++C  ID   
Sbjct  267   LLRKSFRICKNYIDADALESWLTTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKSIDDPT  326

Query  993   KGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1163
              G D   +++          G  TC++  +   P    +  W WQ C+EM MP    ++D
Sbjct  327   TGNDSFAKLYGAANVYYNHTGTTTCFN--LAYSPDPHGLDMWSWQACTEMIMPTDGNNQD  384

Query  1164  TMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPY  1343
             ++F  + +S  Q +  C  YYGV PRP+WITT +GGHDI   L +FGSNIIF NGLRDP+
Sbjct  385   SIFPESQWSYSQRAAVCKGYYGVDPRPNWITTEFGGHDISRALKRFGSNIIFYNGLRDPW  444

Query  1344  SSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             S  GVL++IS T++A+    G+H +D+  A+  DP WL + R++EV+II +WI++YY +L
Sbjct  445   SGGGVLKNISKTIVAIVAEQGAHHVDLRFATSQDPKWLQQVREREVKIISNWISQYYHDL  504



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/484 (44%), Positives = 313/484 (65%), Gaps = 21/484 (4%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLRRPES--SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             H IPR  P+   ++  PE   +S  +    +RT ++ Q LDHFNY PQSY  F+QRY+++
Sbjct  21    HIIPRF-PY---SVISPEQQLNSGSVQNGLYRTKFFTQILDHFNYNPQSYQKFQQRYLIN  76

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
               YWGGA+  +PIF + G E  I+   +  GF+ + AP F ALLV+IEHR+YGKSIPFG 
Sbjct  77    DTYWGGAKKKAPIFVYTGNEGNIEWFTQNTGFMFEQAPYFNALLVFIEHRFYGKSIPFGG  136

Query  471   MEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              ++ A  N +T GY +SAQALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+K
Sbjct  137   KKKVAYANSSTLGYLSSAQALADYATLIIDLKKNLSATESPVVVFGGSYGGMLAAWFRMK  196

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHVA+GALASSAPIL FD++     + +++T+DF+  SENCY+ I+ SW++I++ A K 
Sbjct  197   YPHVAIGALASSAPILQFDDLVSPYAFDNIITQDFRSESENCYKVIKGSWNLIEETAKKH  256

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  980
              GL +L K FK+C        L+ +L   +   A  D P         P YPV ++C  I
Sbjct  257   GGLELLRKSFKICNNYIGVDALEGWLGQAWIYTAMTDYPTPTNFLSPLPAYPVRKMCEAI  316

Query  981   DGAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR  1151
             D +  G + L++++          G   C+D   ++ P    + GW+WQ CSEM MP G 
Sbjct  317   DSSVTGKNTLEKLYDAASIYYNYSGTSKCFDLNDHSDP--HDLGGWQWQACSEMIMPEGA  374

Query  1152  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1331
               ++++F  + +S++  +  C   Y V PRP+WIT+ +GGH+I++VL +   NIIF NGL
Sbjct  375   SSKESIFPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRSVGNIIFFNGL  434

Query  1332  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1511
             RDP+S  GVL++IS T++A+  + G+H +D+  ++K DP WL + RK+EV+II+SWI++Y
Sbjct  435   RDPWSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWISQY  494

Query  1512  YVEL  1523
             + +L
Sbjct  495   HQDL  498



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/481 (44%), Positives = 300/481 (62%), Gaps = 16/481 (3%)
 Frame = +3

Query  123   IPRLTPFYRSNLRRPESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             +PR +    +     + +S    P + ++  ++ QTLDHFN+ P+SY TF+QRY+++  Y
Sbjct  25    LPRFSSSINTQPADQKKTSLSTTPNKLYKEKFFTQTLDHFNFNPKSYQTFQQRYLINDTY  84

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             W G ++N+PIF + G E  I+   +  GF+ DNAP+F ALLV++EHR+YGKSIPFG  +E
Sbjct  85    WAGPKNNAPIFMYTGNEGEIEWFAQNTGFMFDNAPKFNALLVFVEHRFYGKSIPFGGNKE  144

Query  480   -AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
              A +N +T GY  S Q+LADYA ++  LKN   A  SP++VFGGSYGGMLA+WFRLKYPH
Sbjct  145   VAYSNASTLGYLTSTQSLADYATLITDLKNNLSATDSPVVVFGGSYGGMLAAWFRLKYPH  204

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             V +GALASSAPIL F NIT    + +++T DF+  SENCY+ I+ SW  I+  A++  GL
Sbjct  205   VTIGALASSAPILGFVNITSPYSFNNIITHDFRSESENCYKVIKGSWQQIEDTANQHGGL  264

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGA  989
               L K FK+CK   S G L+++L + +  +A  D P         P +PV ++C  ID  
Sbjct  265   EKLRKSFKICKNYISAGSLENWLSTAWVYSAMTDYPTPSNFLNPLPAFPVKQMCKAIDDP  324

Query  990   PKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDR  1160
               G D   + HA         G  TC+D    + P    + GW WQ C+EM +P G    
Sbjct  325   TAGNDTFAKFHAAASVYYNYSGTATCFDLDDDSDP--HGLGGWDWQACTEMILPTGGSTA  382

Query  1161  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
             +++F  + +        C   + + PRP+WITT +GGH+IK+ L +F SNIIF NGLRDP
Sbjct  383   ESIFPASEWDYNDRVTYCKLRFDIDPRPNWITTEFGGHNIKMALKRFASNIIFFNGLRDP  442

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             +S  GVLEDIS +++A+    G+H +D+  A+  DP WL E R+KEV+II  W++ YY +
Sbjct  443   WSGGGVLEDISKSLVALVEEKGAHHVDLRFATSEDPKWLQEVRQKEVKIIAKWLSDYYQD  502

Query  1521  L  1523
             L
Sbjct  503   L  503



>ref|XP_008344907.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Malus 
domestica]
Length=355

 Score =   419 bits (1078),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 251/328 (77%), Gaps = 9/328 (3%)
 Frame = +3

Query  111   TPHTIPRLTP----FYRSNL---RRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATF  269
             +P  IPRL+P    F   N     +P++ S+ +   +F T+YY QTLDHFN+R  S+ TF
Sbjct  26    SPLKIPRLSPTGGTFVHGNYFANDQPKALSA-LDQNDFETFYYTQTLDHFNFRXDSFTTF  84

Query  270   KQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYG  449
             +QRY+++SKYWGG+  ++PI A+LGAE  ID D   IGFL++NA +F+AL ++IEHRYYG
Sbjct  85    QQRYLINSKYWGGSNVSAPILAYLGAEESIDTDLAIIGFLSENANQFQALQIFIEHRYYG  144

Query  450   KSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLA  629
             KSIPFG+ EEA  N +T GYFNSAQA+ADYAE+L+++K +  A+ SP+IV GGSYGGMLA
Sbjct  145   KSIPFGSREEAFKNASTIGYFNSAQAIADYAEILIHVKKQLHAEDSPVIVIGGSYGGMLA  204

Query  630   SWFRLKYPHVALGALASSAPILYFDNIT-PENGYYSLVTKDFKEVSENCYQTIRKSWSVI  806
             SWFRLKYPHVA+GALASSAPILYFDNI  PE GYY +VTKDF+E SE CYQTI+KSWSVI
Sbjct  205   SWFRLKYPHVAVGALASSAPILYFDNIIPPEKGYYFIVTKDFQEASETCYQTIKKSWSVI  264

Query  807   DKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDG  986
             D+IASK  GLSILSKKF  C  L +  ELKDYL S Y  AAQYD PP+YPVT VCGGIDG
Sbjct  265   DEIASKDGGLSILSKKFHTCSLLNNSSELKDYLKSVYARAAQYDSPPRYPVTVVCGGIDG  324

Query  987   APKGADILDRIHAGVVGLEGNRTCYDPQ  1070
             A  G D L +I AG+V   GNR+CY  Q
Sbjct  325   ASSGNDTLSKIFAGLVAYRGNRSCYVNQ  352



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   426 bits (1095),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 311/479 (65%), Gaps = 20/479 (4%)
 Frame = +3

Query  135   TPFYRSNLRRPESSSSDILPPE--FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG-  305
             T F R+ L+     +  +  P+  F T+++ Q LDHF ++P++Y  F Q+Y+++S YW  
Sbjct  51    TFFQRAPLQSLAQRAHTVKDPKLPFTTHFFPQQLDHFTFQPKAYKVFYQKYLMNSTYWDQ  110

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAM  485
             G    +PIF + G E  I+   +  GF+ D AP+F ALLV+IEHR+YG+S+PFG  +E+ 
Sbjct  111   GPNHTAPIFVYTGNEGNIEWFAENTGFMLDIAPKFNALLVFIEHRFYGESMPFG--KESY  168

Query  486   NNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVAL  665
              + +T GY  S QALADYA ++  LK    A+ SP++VFGGSYGGMLA+WFRLKYPH+ +
Sbjct  169   KSASTLGYLTSTQALADYAVLIRSLKQNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITI  228

Query  666   GALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSIL  845
             GALASSAPIL FD ITP + +Y  V++D+K+ S NC++ I+ SW  +  +A++  G+  L
Sbjct  229   GALASSAPILEFDYITPWSSFYDAVSEDYKDESINCFEVIKGSWDELMVVAAQKGGMLEL  288

Query  846   SKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKG  998
             SK F+ CK L+S   ++D+L + +   A  D P         P YP+ E+C  IDG P+G
Sbjct  289   SKTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPAYPIKEMCRIIDGFPQG  348

Query  999   ADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTM  1169
             A  L ++ +         G+++C+D  I N      + GW WQ C+EM MP+     ++M
Sbjct  349   ASKLTKVFSAASLYYNYSGDQSCFD--IENGTDPHGLHGWDWQACTEMVMPM-ICSNESM  405

Query  1170  FFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSS  1349
             F  + +   +F  +C   YGV PRPHWITT YGG+ I  VL +FGSNIIFSNG+RDP+S 
Sbjct  406   FPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWSR  465

Query  1350  AGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              GVL +IS +++A+ T  G+H LD+  A+K DP WL EQRK+E++IIQSWI +Y+++ +
Sbjct  466   GGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYHIDFK  524



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   425 bits (1093),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 293/457 (64%), Gaps = 15/457 (3%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             ++T Y+ Q LDHFNY P SY TF+QRY+ + K+WGGA++N+PIF + G E  I+   +  
Sbjct  52    YKTNYFTQILDHFNYNPDSYQTFQQRYLFNDKHWGGAKNNAPIFVYTGNEGDIEWFTQNT  111

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE-AMNNETTRGYFNSAQALADYAEVLLY  557
             GF+ + AP FKALLV+IEHR+YGKSIP+G  +  A +N +T GY +S QALADYA +++ 
Sbjct  112   GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKVIAYSNTSTLGYLSSTQALADYATLIID  171

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    A  SP++VFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F+NIT    + ++
Sbjct  172   LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSFNNI  231

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             +T+DF+  SENCY  I+ SW  I+  A    GL  L K F++CK   SP  L ++L + +
Sbjct  232   ITQDFRGESENCYNVIKGSWKKIEDTAKTTGGLKKLRKSFRICKNYISPDFLVNWLSTAF  291

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCY  1061
                A  D P         P YPV E+C  ID    G D  ++++          G  TC+
Sbjct  292   TYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANMYYNYSGKATCF  351

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D    + P    + GW WQ C+EM MP    +++++F P+ +   +  R C     V PR
Sbjct  352   DLNDNSDP--HGLGGWTWQACTEMVMPTDGNNKESIFPPSEWDYNERVRFCQLILDVKPR  409

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
               WITT +GG++I+ VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D
Sbjct  410   SDWITTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHVD  469

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEAL  1532
             +  +SK DP+WL E R +EV II +WI++YY  L  L
Sbjct  470   LRWSSKEDPEWLREVRGREVNIISNWISQYYQTLTDL  506



>ref|XP_006424415.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37655.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=303

 Score =   416 bits (1070),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 242/308 (79%), Gaps = 8/308 (3%)
 Frame = +3

Query  621   MLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWS  800
             MLA+WFRLKYPHVALGALASSAPILYFD+ITP+NGYYS+VTKDF+E SE CY+TI  SWS
Sbjct  1     MLAAWFRLKYPHVALGALASSAPILYFDDITPQNGYYSVVTKDFREASETCYETILNSWS  60

Query  801   VIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGI  980
              ID++AS+P+GL+ILS KF+ C+ L    ELK YL   Y  AAQY+ PP YPV+ VCGGI
Sbjct  61    QIDEVASQPDGLAILSNKFRTCRPLGDSYELKGYLRLMYAHAAQYNHPPDYPVSMVCGGI  120

Query  981   DGAPKGADILDRIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQTCSEMAMPIGRG  1154
             DGA  G DI+ +I AGVV  +GN +CY     NPPT  +ET VGWRWQ CSEM +PIG  
Sbjct  121   DGAAFGNDIISKIFAGVVAYKGNMSCY----VNPPTNETETTVGWRWQRCSEMVIPIGTV  176

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
             +  TMF P PF++  F   C+  YGV PRPHW+TTYYGG+DIKL+L +F SNIIFSNGLR
Sbjct  177   NT-TMFQPTPFNLSSFIDRCESLYGVSPRPHWVTTYYGGYDIKLILQRFASNIIFSNGLR  235

Query  1335  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASK-TDPDWLTEQRKKEVEIIQSWITKY  1511
             DPYSS GVLE+ISD+V+A+ T NGSHCLDI  A++ +DPDWL  QR+ E+EII+ WI+KY
Sbjct  236   DPYSSGGVLENISDSVVAIATINGSHCLDILRANQSSDPDWLVTQRETEIEIIEGWISKY  295

Query  1512  YVELEALK  1535
             Y +L+A+K
Sbjct  296   YADLKAIK  303



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/475 (44%), Positives = 305/475 (64%), Gaps = 17/475 (4%)
 Frame = +3

Query  138   PFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS  317
             PF+ S L RP++   D L P ++T ++ Q LDHFN+ PQSY  F+QRY+++  YWGGA  
Sbjct  29    PFHSSLLLRPQTPPIDPLLP-YQTGFFTQILDHFNFNPQSYQYFQQRYLINDTYWGGAAH  87

Query  318   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMN-NE  494
             NSPIF + G E  I+   +  GFL  +APRF+AL+V+IEHR+YGKSIPFG  E+  N N 
Sbjct  88    NSPIFVYTGNEGNIEWFAQNTGFLLQSAPRFRALVVFIEHRFYGKSIPFGGDEDVANSNS  147

Query  495   TTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGAL  674
             +T G+ +S QALADYA ++  LK    A  SP++VFGGSYGGMLA+WFRLKYPH+A+GAL
Sbjct  148   STLGFLSSTQALADYATLITDLKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIAMGAL  207

Query  675   ASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKK  854
             ASSAPIL F+NIT    + ++VT+DFK  S+NCY+ I++SW +ID  ++ P G  +L K 
Sbjct  208   ASSAPILQFENITSPYAFSNIVTQDFKSESQNCYRVIKESWHLIDITSTHPQGPQLLRKS  267

Query  855   FKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADI  1007
             FK CK  ++   +K++L +     A  D P         P YPV ++C  ID +  G D 
Sbjct  268   FKFCKEAEAE-SIKNWLSTAILYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDSRTGNDT  326

Query  1008  LDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFP  1178
               +++          G  TC+D    +      +  W WQ C+EM +P G   ++++F  
Sbjct  327   FAKLYGAANVYYNYTGTATCFDLDDDS--DPHDLGDWTWQACTEMILPTGGNTKESIFPA  384

Query  1179  APFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGV  1358
             + +        C  ++ V PR  WI T++GGH+I+ VL +FGSNIIF NGLRDP+S  GV
Sbjct  385   STWHFADRLHFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGV  444

Query  1359  LEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             L++IS T++A+  + G+H +D+  +S  DP WL + R++E+ II+ W+++YY++L
Sbjct  445   LKNISSTIIAIVAKEGAHHVDLRFSSAEDPKWLKDVRQQELSIIEDWLSQYYLDL  499



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   423 bits (1088),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 211/478 (44%), Positives = 312/478 (65%), Gaps = 18/478 (4%)
 Frame = +3

Query  120   TIPRLTP-FYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSK  296
             +IP   P  Y+S+L + +  S+    P +  +Y+ Q LDHF +RP+SY  F Q+Y+++S+
Sbjct  22    SIPVFVPGAYKSSLLKKQVKSAKPEIP-YEAHYFPQVLDHFTFRPRSYKIFYQKYLMNSQ  80

Query  297   YWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTME  476
             YW      +PIF + G E  I+      GF+ D AP+F+ALLV+IEHR+YG+S+PF   +
Sbjct  81    YW---HEGAPIFVYTGNEGDIEWFAANTGFMLDIAPKFRALLVFIEHRFYGESLPF--HK  135

Query  477   EAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
             + +N+  T GY +S QALADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH
Sbjct  136   KDLNSAKTLGYLSSQQALADYAVLIRSLKRNLSSEASPVVVFGGSYGGMLAAWFRLKYPH  195

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VA+GALASSAPIL FD+ITP + +Y  V++DFKE S NCY+ I+ +W+ +D    + +GL
Sbjct  196   VAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASLNCYEVIKGAWTELDAFGKRKDGL  255

Query  837   SILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDG-  986
               LSK F+ CK L S    +++L S +   A  + P         P YPV E+C  IDG 
Sbjct  256   EKLSKMFRACKKLSSVDYARNWLWSAFTYTAMVNYPMEANFMKHLPAYPVEEMCKIIDGH  315

Query  987   APKGADILDRIHAGVVGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDT  1166
             +P+   +   + A  +    ++T    ++ +      + GW WQ C+EM MP+   +  +
Sbjct  316   SPRATKLSRAVAAASLYYNYSKTEKCFKLEDEDNDHGLQGWNWQACTEMVMPMTCSN-GS  374

Query  1167  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1346
             MF P+P+S ++F+ DC+  +GV PR HWITT +GG  I LVL +FGSNIIFSNG++DP+S
Sbjct  375   MFPPSPYSYKEFADDCNRQFGVWPREHWITTEFGGMRINLVLKRFGSNIIFSNGMQDPWS  434

Query  1347  SAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
               GVL++IS +++A+ T  G+H +D   A+  DP+WL +QR++EVEIIQ W+ +YY +
Sbjct  435   RGGVLKNISSSIVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKWLQEYYAD  492



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   423 bits (1088),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/473 (45%), Positives = 302/473 (64%), Gaps = 20/473 (4%)
 Frame = +3

Query  144   YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNS  323
             Y+S+L   +      +P  F+T+Y+ Q LDHF + P+S   F Q+Y+++ +YW   +   
Sbjct  32    YQSSLLVKKHDEKTKIP--FKTHYFPQILDHFTFLPKSSKVFYQKYLINDQYWH-KEGGG  88

Query  324   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  503
             PIF + G E  ID      GF+ D AP+F ALLV+IEHR+YG S+PFG    +  +  T 
Sbjct  89    PIFVYTGNEGNIDWFAVNTGFMVDIAPKFNALLVFIEHRFYGDSMPFGN--NSYKSAKTL  146

Query  504   GYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASS  683
             GY NS QALADYA ++  LK    +  SP++VFGGSYGGMLA+WFRLKYPH+A+GA+ASS
Sbjct  147   GYLNSQQALADYAVLIRSLKQNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASS  206

Query  684   APILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  863
             APIL FD ITP + +Y  V++DFK+ S NCY+ I+ SW+ +D +++  +GL  +SK F+ 
Sbjct  207   APILQFDKITPWSSFYDAVSQDFKDASLNCYKVIKGSWAELDALSTHDDGLIEVSKLFRT  266

Query  864   CKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             CK L S    +D+L   +   A  + P         P YPV E+C  IDG PKGA  L +
Sbjct  267   CKALHSVYSARDWLWEAFVYTAMVNYPTEANFMMPLPAYPVEEMCKIIDGLPKGASKLSK  326

Query  1017  IHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
               A             C++  +     S  + GW WQ C+EM MP+   + ++MF P+ F
Sbjct  327   AFAAASLYYNYTQTEKCFN--LEGGTDSHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSF  383

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S ++FS+DC   YGV PRPHWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  GVL++
Sbjct  384   SYKEFSQDCKKQYGVKPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKN  443

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             IS +++A+ T+ G+H +D    +K DPDWL  QRK+EV II+ W+ +YY +L+
Sbjct  444   ISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKWLEEYYKDLK  496



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/483 (44%), Positives = 310/483 (64%), Gaps = 19/483 (4%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPE-FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW  302
             P L  F  S +      SS+  P   +RT ++ Q LDHFN+ PQS   F+QRY+++  +W
Sbjct  26    PILPRFPSSAVSAELKQSSNSAPNSLYRTKFFTQILDHFNFNPQSNHVFQQRYLINDTFW  85

Query  303   GGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEE  479
             GGA++N+PIF + G E  I+   +  GF+ +NAP F ALLV+IEHR+YGKSIPFG   + 
Sbjct  86    GGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFHALLVFIEHRFYGKSIPFGGNRKV  145

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
             A  N +T GY +S QALADYA +++ LK    A  SP++VFGGSYGGMLA+WFR+KYPHV
Sbjct  146   AYANASTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHV  205

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             A+GALASSAPIL+F ++   + + +++++DF+  SENCY+ ++ SW +ID  A+KP GL 
Sbjct  206   AIGALASSAPILHFMDLVSPDIFNNIISQDFRSESENCYKVLKGSWKLIDDTANKPGGLQ  265

Query  840   ILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGA  989
             +L K F++CK     PG L+++L + +   A  D P         P YP+ ++C  ID  
Sbjct  266   LLQKSFRICKSNDFGPGFLENWLRTAWVYTAMTDYPTPSNFLSPLPAYPIKKMCEAIDRE  325

Query  990   PKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDR  1160
                 D L +++A         G  TC+D    +      + GW+WQ C+EM MP+G  ++
Sbjct  326   KN--DGLGKLYAAASVYYNYTGTATCFDLDDDS--DPHDLGGWQWQACTEMIMPVGGSNK  381

Query  1161  DTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
              ++F    +S Q  +  C  +Y V PRPHWITT +GGH I+ VL +  SNIIF NGLRDP
Sbjct  382   HSIFPEYVWSYQDRASACQFFYNVTPRPHWITTEFGGHAIQTVLKRSASNIIFFNGLRDP  441

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             +S  GVL++IS T++A+  + G+H +D+  ++K DP WL + R++EV II SWI++YY +
Sbjct  442   WSGGGVLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWLKDVRRQEVNIIASWISQYYQD  501

Query  1521  LEA  1529
             L +
Sbjct  502   LHS  504



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 306/482 (63%), Gaps = 27/482 (6%)
 Frame = +3

Query  123   IPRLTP-FYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             IPR +     S   R  S S+  LP  F T Y+ Q LDHF+++P+SY  F Q+Y+++S++
Sbjct  30    IPRRSHHLLSSRQNRKTSKSNTELPSHFETRYFPQNLDHFSFQPESYQVFHQKYLINSRF  89

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             W   +   PIF + G E  I+      GF+ D AP+FKALLV+IEHR+YG+S P      
Sbjct  90    W---RKGGPIFVYTGNEGDIEWFASNTGFMLDIAPKFKALLVFIEHRFYGESKPHKLA--  144

Query  480   AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHV  659
                   T G+ NS QALADYA ++  LK    ++ SP+IVFGGSYGGMLA+WFRLKYPH+
Sbjct  145   -----NTLGFLNSQQALADYAILIRSLKQNLTSEASPVIVFGGSYGGMLAAWFRLKYPHI  199

Query  660   ALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLS  839
             A+GALASSAPIL FDNI P + +Y  V++DFKEVS NC++ I++SW  ++  ++  +GL 
Sbjct  200   AIGALASSAPILNFDNIVPSSSFYDTVSQDFKEVSVNCFEVIKRSWGEMEVFSTIKDGLQ  259

Query  840   ILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAP  992
              LSK F+ CK L S      +L++ +   A  + P         P YPV ++C  +D  P
Sbjct  260   ELSKMFRTCKTLHSVDSASGWLETAFIETAMVNYPTPANFMAPLPAYPVGQMCKIMDELP  319

Query  993   KGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRD  1163
               A  L+R  A         G+ TC+D  + N   S  + GW WQ C+EM MP+   ++ 
Sbjct  320   LEASNLERAFAAASLYYNYSGSVTCFD--MENHTDSHGLNGWGWQACTEMVMPMSCSNQ-  376

Query  1164  TMFFPAPFSMQQFSRD-CDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDP  1340
             TMF P     ++ +++ C   YGV PRP+WITT +GG  I++VL +FGSNIIFSNGL+DP
Sbjct  377   TMFRPFESDDEKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDP  436

Query  1341  YSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVE  1520
             +S  GVL++IS +++A+ TR G+H  D+  A+K DP+WL +QR++EV II+ WI++YY +
Sbjct  437   WSGGGVLKNISSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYND  496

Query  1521  LE  1526
             LE
Sbjct  497   LE  498



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   423 bits (1087),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/484 (44%), Positives = 312/484 (64%), Gaps = 24/484 (5%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
              P   PR  P Y  +L +   +S   +P  ++T+Y+ Q LDHF ++P+S   F Q+Y+V+
Sbjct  24    VPTFFPR--PSYDQSLAKQPKASKPKIP--YKTHYFPQVLDHFTFQPKSSKIFYQKYLVN  79

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             S YW      +PIF + G E  I+      GFL D AP+F+ALLV+IEHR+YG+S+PFG 
Sbjct  80    SHYW---HRGAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGN  136

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
               ++  +  T GY NS QALAD+A ++  LK+   ++ SP++VFGGSYGGMLA+WFRLKY
Sbjct  137   --KSYKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFRLKY  194

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+A+GALASSAPIL FD+ITP + +Y  V++DFKE S NCY+ I+ SW+ ++ ++++  
Sbjct  195   PHIAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASLNCYEVIKGSWAELEALSAQNE  254

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGID  983
             GL+ LS+ F+ C+ L S   + ++L S +   A  + P         P YPV  +C  ID
Sbjct  255   GLAELSRTFRACQDLHSLDSVWEWLWSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIID  314

Query  984   GAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1154
             G P GA  + R+ A             C+  ++ + P +  + GW WQ C+EM MP+   
Sbjct  315   GFPSGASKITRVFAAASLYYNYSRAEKCF--KLEHGPDAHGLHGWNWQACTEMVMPMTCS  372

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
             + ++MF  + FS ++F+ DC   +GV PRPHWITT +GG  I LVL + G NIIFSNG++
Sbjct  373   E-ESMFPTSSFSYKEFAEDCMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQ  431

Query  1335  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             DP+S  GVL++IS +++A+ T  G+H +D   A+K DP+WL E R++EVEIIQ WI +YY
Sbjct  432   DPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491

Query  1515  VELE  1526
              +L+
Sbjct  492   PDLK  495



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   422 bits (1086),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 302/473 (64%), Gaps = 24/473 (5%)
 Frame = +3

Query  144   YRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNS  323
             Y+S+L +    S   +P  F+ +Y+ Q LDHF + P+S   FKQ+Y+++  YW   +   
Sbjct  35    YQSSLEKQHVKSK--IP--FKVHYFPQILDHFTFLPKSSKVFKQKYLINDNYW---KQGG  87

Query  324   PIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTR  503
             PIF + G E  ID      GF+ D AP+F ALLV+IEHR+YG S+PFG  +++  +  T 
Sbjct  88    PIFVYTGNEGNIDWFAANTGFMLDIAPKFHALLVFIEHRFYGDSMPFG--KKSYKSPKTL  145

Query  504   GYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASS  683
             GY NS QALADYA ++  LK    ++ SP++VFGGSYGGMLASWFRLKYPH+A+GA+ASS
Sbjct  146   GYLNSQQALADYAVLIRSLKQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGAVASS  205

Query  684   APILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKL  863
             APIL FD ITP + +Y  V++DFKEVS NCY+ I+ SW+ +D ++    GL+ +SK F+ 
Sbjct  206   APILQFDKITPWSSFYDAVSQDFKEVSLNCYRVIKGSWTELDALSKHEEGLTEVSKLFRT  265

Query  864   CKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDR  1016
             CKGL S    +D+L   +   A  + P         P YPV E+C  IDG PKGA  + R
Sbjct  266   CKGLHSVYSARDWLWEAFVYTAMVNYPTKANFMMPLPAYPVQEMCKIIDGLPKGASKISR  325

Query  1017  IHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPF  1187
               A             C++  +     +  + GW WQ C+EM MP+   + ++MF P+ +
Sbjct  326   AFAAASLYYNYTKREKCFN--LEGGDDAHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSY  382

Query  1188  SMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLED  1367
             S ++F  DC   YGV PRPHWITT +GG+ I+ VL +FGSN+IFSNG++DP+S  GVL++
Sbjct  383   SYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKN  442

Query  1368  ISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
             IS +++A+ T+ G+H +D    +K DP WL  QRK+E  IIQ W+ +YY +L+
Sbjct  443   ISASIVALVTQKGAHHVDFRSETKNDPGWLIMQRKQEAAIIQKWLEEYYRDLK  495



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   422 bits (1085),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 206/453 (45%), Positives = 296/453 (65%), Gaps = 20/453 (4%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             F+T+Y+ QTLDHF ++P+S   F Q+Y+++S YW   +  +PIF + G E  I+      
Sbjct  48    FKTHYFPQTLDHFTFQPKSSKLFYQKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANT  104

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  560
             GF+ D AP+FKALLV+IEHR+YGKS+PFG  +++  +  T GY NS QALAD+A ++  L
Sbjct  105   GFMLDIAPKFKALLVFIEHRFYGKSMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSL  162

Query  561   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  740
             K    ++ SP++VFGGSYGGMLA+WFRLKYPH+A+GALASSAPIL FD + P + +Y  V
Sbjct  163   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKLIPWSSFYDAV  222

Query  741   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  920
             ++DFK+VS NCYQ I+ SW+ ++ ++++   L+ LSK F+ CK L S    +D+L + + 
Sbjct  223   SQDFKDVSLNCYQVIKGSWAELEAMSTQKQALAELSKTFRTCKSLHSTASARDWLWTAFV  282

Query  921   TAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1064
               A  + P         P YPV ++C  ID  P  A  L R  A          +  C+ 
Sbjct  283   YTAMVNYPTKADFMKPLPAYPVQKMCKIIDKIPSRATKLSRAFAAASLYYNYSRSENCF-  341

Query  1065  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1244
              +I +      + GW WQTC+EM MP+    +++MF P+ F  ++F+  C   Y V PRP
Sbjct  342   -KIEHEVDGHGLHGWDWQTCTEMVMPM-TCSKESMFPPSGFDYEEFAEQCRMKYCVSPRP  399

Query  1245  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1424
             HWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL++IS +++A+ T  G+H +D 
Sbjct  400   HWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDF  459

Query  1425  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
               A+K DP WL + RK+EVEIIQ W+ +YY +L
Sbjct  460   RSATKKDPKWLIQLRKQEVEIIQKWLNEYYADL  492



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 295/459 (64%), Gaps = 19/459 (4%)
 Frame = +3

Query  198   EFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKY  377
             +++ +++ Q LDHF + PQS   F Q+Y+++S+YW G +  +PIF + G E  I+     
Sbjct  43    DYKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEYWDGPKKRAPIFVYTGNEGDIEWFAAN  102

Query  378   IGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLY  557
              GFL D AP+F+ALLV+IEHR+YG+S+PFG  + A  + TT GY  S QALADYA ++  
Sbjct  103   TGFLLDIAPKFRALLVFIEHRFYGESMPFG--KGAYKSATTLGYLTSQQALADYATLITS  160

Query  558   LKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSL  737
             LK    AQ  P++VFGGSYGGMLA+WFRLKYPH+A+GA+ASSAPIL FD+I     +Y  
Sbjct  161   LKQNLSAQACPVVVFGGSYGGMLAAWFRLKYPHIAMGAVASSAPILQFDDIASWTSFYDG  220

Query  738   VTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTY  917
             V+KDFK+ S NC+  IR SW  +  I+++  GL  L++ F+ C+ +KS   ++D+L S +
Sbjct  221   VSKDFKDASLNCFNVIRASWDKLQVISTQEKGLQKLNRVFRTCEDIKSVYSVRDWLWSAF  280

Query  918   CTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCY  1061
                A  + P         P YP+ E+C  IDG P   D L ++ A           + C+
Sbjct  281   VYTAMVNYPTPANFMRPLPAYPINEMCRNIDGLPSETDTLVKVFAAASVYYNYSSTKKCF  340

Query  1062  DPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPR  1241
             D +  N   +  + GW WQ C+EM MP+    +  MF P+ FS ++   DC   YGV  R
Sbjct  341   DME--NASDAHGLHGWNWQACTEMVMPMS-CSQQGMFPPSTFSYKEIEDDCMKKYGVKAR  397

Query  1242  PHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLD  1421
             PHWITT +GGH+I+ VL +FGSNIIFSNG+ DP+S  GVL++IS +++A+ T  G+H LD
Sbjct  398   PHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSRGGVLKNISSSIVALVTEKGAHHLD  457

Query  1422  IYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
                A++ DP WL EQR++E+E+IQ WI +Y   ++ +KR
Sbjct  458   FRFATRQDPRWLVEQRRQEIELIQGWIHEY--NMDFMKR  494



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   422 bits (1084),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 296/479 (62%), Gaps = 17/479 (4%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P + P   + LRR   ++ D  P  +   +  Q LDHFNY PQSY TF+QRY+V+  +WG
Sbjct  16    PPVFPSTLAQLRR--GAAGDGGPSLYTEKFCTQILDHFNYNPQSYRTFQQRYLVNDTHWG  73

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA + SPIF + G E  I+   K  GF+ + AP FKAL+V+IEHR+YGKSIP+G     A
Sbjct  74    GAAAGSPIFVYTGNEGDIEWFAKNTGFMYEIAPIFKALIVFIEHRFYGKSIPYGGNRTVA  133

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
              +N +T GY  + QALADYA V+L LK    +++SP+IVFGGSYGGMLA+WFRLKYPHVA
Sbjct  134   YSNSSTLGYLTATQALADYATVILSLKKNLTSENSPVIVFGGSYGGMLAAWFRLKYPHVA  193

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
              GAL+SSAPIL FDNIT +  +  +VT+DF+  SENCY+ I+KSW  ID  A KP GL I
Sbjct  194   AGALSSSAPILNFDNITSQFSFNDIVTQDFRSESENCYKVIKKSWQEIDDTAVKPGGLEI  253

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPK  995
             L K F++CK   S   L  +L +     A  D P         P +PV ++C  ID    
Sbjct  254   LRKHFRICKNHISAASLHSWLSTALIYTAMTDYPTPSDFLAPLPAHPVKQMCEAIDDPTT  313

Query  996   GADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDT  1166
             G     +++          GN TC+D    + P    + GW WQ C+EM +       ++
Sbjct  314   GNSTFAKMYGAANVYYNYSGNATCFDLADDSDP--HGVNGWYWQACTEMILITDGNREES  371

Query  1167  MFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYS  1346
             +F  + +S       C D YGV PRP+W  T +G H+IK  L  FGS+IIF NGLRDP+S
Sbjct  372   IFTASNYSYNDRREYCKDKYGVEPRPNWAPTEFGAHNIKRALKNFGSSIIFFNGLRDPWS  431

Query  1347  SAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
               GVL+++S++++A+  + G+H +D+  ++K DP WL + RK+E EII +W++ Y+ ++
Sbjct  432   GGGVLKNLSESLVAIVAKEGAHHVDLRFSTKEDPKWLVDVRKRETEIISTWLSHYHSDI  490



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   422 bits (1086),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 308/486 (63%), Gaps = 25/486 (5%)
 Frame = +3

Query  129   RLTPFYRSNLRRPESSSSDILPPE---FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKY  299
             ++ P + S+  RPE  +  +   E   ++T YY Q LDHFNY PQ Y TF+QRY+++  Y
Sbjct  25    KIFPRFPSSNVRPEQLAQILKDDEVKPYKTKYYTQILDHFNYNPQGYQTFQQRYLINDTY  84

Query  300   WGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEE  479
             WGGA++NSPIF ++G E  I+   +  GF+ +NAP FKALLV++EHR+YGKSIP+G  +E
Sbjct  85    WGGAKNNSPIFVYMGNEGDIEWFAQNTGFMFENAPHFKALLVFVEHRFYGKSIPYGGDKE  144

Query  480   -AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPH  656
              A  N TT+GY +S QALADYA ++L LK    A  SP++VFGGSYGGMLA+WFRLKYPH
Sbjct  145   VAYKNATTQGYLSSTQALADYATIILDLKKNLTATESPVVVFGGSYGGMLAAWFRLKYPH  204

Query  657   VALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGL  836
             VA+GALASS+PIL F N+T    + ++VT+DFK  SENCY+ I+ SW+ I++ A +  GL
Sbjct  205   VAIGALASSSPILNFGNLTSPFSFNNIVTQDFKSESENCYKVIKGSWAQIEETAQQKGGL  264

Query  837   SILSKKFKLCKGLKSPGE-LKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDG  986
               L   F +CK +    E ++ +L   Y   A  D P         P +PV ++C  ID 
Sbjct  265   EKLRSSFNICKNITISTEYVESWLSMAYIYTAMTDYPTPSNFLNPLPAFPVRQMCKAIDN  324

Query  987   APKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGD  1157
                G D   +++          GN  C+D  I N      +  W WQ C+EM +P    +
Sbjct  325   PELGNDTFAKLYGAANIYYNYTGNVDCFD--ITNDSDKHGLDEWTWQACTEMILPTDGNN  382

Query  1158  RDTMFFPAPFSMQQFS-RD--CDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNG  1328
             ++++F   P S   ++ RD  C   YGV PRPHWITT +GG DI  VL ++ SNI+F NG
Sbjct  383   KESIF---PTSNDDYNDRDLYCTSIYGVQPRPHWITTEFGGFDIHRVLRRYASNILFFNG  439

Query  1329  LRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITK  1508
              RDP+S  GVL++IS +++A+  + G+H +D+  +++ DP+WL E RK E+  I+ W+++
Sbjct  440   RRDPWSGGGVLKNISSSLVAIVAKEGAHHVDLRYSTEEDPNWLKEIRKTEIHHIKKWLSR  499

Query  1509  YYVELE  1526
             YY +L+
Sbjct  500   YYHDLD  505



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   422 bits (1086),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 286/451 (63%), Gaps = 16/451 (4%)
 Frame = +3

Query  213   YYHQTLDHFNYRPQSYATFKQRYIVSSKYWGG-AQSNSPIFAWLGAESPIDDDPKYIGFL  389
             ++ Q LDHFNY PQSY TF+QRY+++  YWGG A  N+PIF + G E  I+   +  GF+
Sbjct  53    FFTQILDHFNYNPQSYETFQQRYLINDNYWGGGADKNAPIFVYTGNEGDIEWFAQNTGFM  112

Query  390   TDNAPRFKALLVYIEHRYYGKSIPFG-TMEEAMNNETTRGYFNSAQALADYAEVLLYLKN  566
              + AP FKALL++IEHRYYGKS+PFG + E A  N +T GY ++ QALADYA ++L LK 
Sbjct  113   FETAPIFKALLLFIEHRYYGKSMPFGGSKERAYANSSTLGYLSATQALADYATLILDLKK  172

Query  567   KYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLVTK  746
                A  SP++VFGGSYGGMLA+WFRLKYPHVA+GALASSAPIL FDNIT    + +++T 
Sbjct  173   NLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVAVGALASSAPILNFDNITSPFSFNNIITH  232

Query  747   DFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYCTA  926
             DF+  SENCY+ I++SW  ID  A+KP GL IL K F++CK   S   LK +L + Y   
Sbjct  233   DFRSESENCYKVIKRSWQEIDDTAAKPGGLEILRKSFRICKNYISGEALKGWLGTAYTYT  292

Query  927   AQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGV---VGLEGNRTCYDPQ  1070
             A  D P         P YPV ++C  ID    G +  ++++          G+ TC+D  
Sbjct  293   AMTDYPTPTNFLAPLPAYPVKQMCKAIDDPKTGNNTFEKLYGAANVYYNYTGDATCFDLA  352

Query  1071  IYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHW  1250
               + P    + GW WQ C+EM +       D++F P  +S       C D Y + PRP W
Sbjct  353   DDSDP--HGLGGWTWQACTEMILLTDGNTEDSIFPPNNYSYNDRFVFCKDNYNIEPRPTW  410

Query  1251  ITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYG  1430
             I T +G H+I  VL +FGSNIIF NGLRDP+S  GVL+DIS +++A+  + G+H +D+  
Sbjct  411   IPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSLVAIVAKEGAHHVDLRF  470

Query  1431  ASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ++  DP WL + R +EV II  W+++YY  L
Sbjct  471   STSEDPKWLEDVRNREVRIISKWLSQYYRTL  501



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   422 bits (1085),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/484 (44%), Positives = 307/484 (63%), Gaps = 20/484 (4%)
 Frame = +3

Query  120   TIPRLTPFYRSNLRRPESSSSDILPPEFRTYY----YHQTLDHFNYRPQSYATFKQRYIV  287
             +I R +P + S+L +PE     I     + YY    + QTLDHFNY P  Y TF+QRY++
Sbjct  37    SIGRPSPPFPSSLIKPELLKPTISYSSEKVYYEIKYFTQTLDHFNYVPWGYETFQQRYLI  96

Query  288   SSKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG  467
             +SKYWGG    +PIF + G E  ++   +  GF+ +NAP FKALLV+IEHRYYG+SIP+G
Sbjct  97    NSKYWGGPIDKAPIFVYTGNEGDVEWFAQNTGFMFENAPYFKALLVFIEHRYYGESIPYG  156

Query  468   TMEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
             + E A  N +T GY +SAQALADYA +++ LK    A+ SP++V GGSYGGMLA+WFRLK
Sbjct  157   SEEIAYKNASTHGYLSSAQALADYAMLIIDLKKNLSAEDSPVVVMGGSYGGMLATWFRLK  216

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             YPHV +GALASSAPIL F +IT    + ++VT+DF+  SENCY+ I+ SW  I + A +P
Sbjct  217   YPHVCIGALASSAPILNFADITSPYSFNNIVTEDFRSESENCYKVIKNSWQKIHETAQQP  276

Query  828   NGLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGI  980
              GL  L K F++C    S   L ++L+  +   A  D P         P +P+ ++C  +
Sbjct  277   GGLEELRKSFRICPNYISEDSLTNWLERAFIYTAMTDYPVPSSFLAPLPAFPIEQMCKAV  336

Query  981   DGAPKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGR  1151
             D A  G +    I+          G+  C++  + +      + GW +Q C+EM +  G 
Sbjct  337   DDA--GDEQFKGIYEAANIFYNYTGDSMCFN--LSDNSDRHGLNGWGFQACTEMLLATGG  392

Query  1152  GDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGL  1331
               ++++F P  ++  Q    C   YG+ PRPHWITT++GGHDIK VL +FGSNIIF NGL
Sbjct  393   RTQESIFPPYTYNYTQTQEYCQQSYGINPRPHWITTHFGGHDIKRVLKRFGSNIIFFNGL  452

Query  1332  RDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKY  1511
             RDP+S  GVLE++SD+++A+  + G+H +D+  +++ DP WL+E RK+E+ I+  W+ +Y
Sbjct  453   RDPWSGGGVLENLSDSIVALVAKEGAHHIDLRFSTEGDPMWLSEVRKREIHILSMWLEQY  512

Query  1512  YVEL  1523
             Y ++
Sbjct  513   YKDI  516



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   422 bits (1084),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/484 (44%), Positives = 311/484 (64%), Gaps = 24/484 (5%)
 Frame = +3

Query  111   TPHTIPRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
              P   PR  P Y  +L +   +S   +P  ++T+Y+ Q LDHF ++P+S   F Q+Y+V+
Sbjct  24    VPTFFPR--PSYGQSLAKQPKASKPKIP--YKTHYFPQVLDHFTFQPKSSKIFYQKYLVN  79

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
             S YW      +PIF + G E  I+      GFL D AP+F+ALLV+IEHR+YG+S+PFG 
Sbjct  80    SHYW---HRGAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGN  136

Query  471   MEEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKY  650
               ++  +  T GY NS QALAD+A ++  LK+   ++ SP++VFGGSYGGMLA+WFRLKY
Sbjct  137   --KSYKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFRLKY  194

Query  651   PHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPN  830
             PH+A+GALASSAPIL FD+ITP + +Y  V++DFKE S NCY+ I+ SW+ ++ ++++  
Sbjct  195   PHIAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASSNCYEVIKGSWAELEALSAQKE  254

Query  831   GLSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGID  983
             GL+ LS+ F+ C+ L S   + ++L S +   A  + P         P YPV  +C  ID
Sbjct  255   GLAELSRTFRACQDLHSLDSVWEWLWSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIID  314

Query  984   GAPKGADILDRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRG  1154
             G P GA  + R+ A             C+  ++ + P +  + GW WQ C+EM MP+   
Sbjct  315   GFPSGASKITRVFAAASLYYNYSRAEKCF--KLEHGPDAHGLHGWNWQACTEMVMPMTCS  372

Query  1155  DRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLR  1334
             + ++MF  + FS ++F+ DC   +GV PR HWITT +GG  I LVL + G NIIFSNG++
Sbjct  373   E-ESMFPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQ  431

Query  1335  DPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             DP+S  GVL++IS +V+A+ T  G+H +D   A+K DP+WL E R++EVEIIQ WI +YY
Sbjct  432   DPWSRGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491

Query  1515  VELE  1526
              +L+
Sbjct  492   PDLK  495



>ref|XP_006378927.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|ERP56724.1| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=364

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/338 (62%), Positives = 261/338 (77%), Gaps = 7/338 (2%)
 Frame = +3

Query  117   HTIPRLTPFY-RSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSS  293
             HTIPRL+P   R  L  P+    + +  +F T++Y+QTLDHFNYRP+SY TF QRY+++S
Sbjct  26    HTIPRLSPIGPRVWLDHPDQILGESVREDFETFFYNQTLDHFNYRPESYDTFLQRYLINS  85

Query  294   KYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTM  473
             KYWGGA +++PI  +LGAE+PID D   +GFL D A  F +LLVY+EHRYYGKSIPFG+ 
Sbjct  86    KYWGGANASAPILVYLGAEAPIDGDLDAVGFLVDTAVEFNSLLVYVEHRYYGKSIPFGSR  145

Query  474   EEAMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYP  653
             EEA+ N +T GYFNSAQA+ADYA +++++K    A+ SP+IV GGSYGGMLASWFRLKYP
Sbjct  146   EEALKNASTLGYFNSAQAIADYAAIIIHIKKTLQAKDSPVIVIGGSYGGMLASWFRLKYP  205

Query  654   HVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNG  833
             H+ALGALASSAP+LYFD+ITP+ GYY+LV+KDF+  SE CYQTIR+SW  ID++ASKP+G
Sbjct  206   HIALGALASSAPVLYFDDITPQYGYYALVSKDFRGASETCYQTIRESWEEIDEVASKPDG  265

Query  834   LSILSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGADILD  1013
             LSILSKKFK C  L    ELK++LDS Y  AAQY++PP YPV +VCGGIDG   G D+L 
Sbjct  266   LSILSKKFKTCNPLTDASELKNHLDSMYANAAQYNKPPTYPVNKVCGGIDGCGFGDDLLG  325

Query  1014  RIHAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQT  1121
             R+  G+V  +GNR+CY     N PT  SET VGWRWQ 
Sbjct  326   RVFGGLVAYKGNRSCY----VNEPTNQSETSVGWRWQV  359



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/471 (44%), Positives = 302/471 (64%), Gaps = 21/471 (4%)
 Frame = +3

Query  141   FYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSN  320
             ++ S+LR+    S    P   +T Y+ Q LDHF++RP SY TF Q+Y+++S +W      
Sbjct  35    YHLSSLRQDRKISKPEFPLPLQTRYFPQILDHFSFRPDSYRTFHQKYLINSHFW---HIG  91

Query  321   SPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETT  500
              PIF + G E  I+      GF+ D AP+F+ALLV+IEHR+YG+S+PFG  +++  +  T
Sbjct  92    GPIFVYTGNEGDIEWFASNTGFMFDIAPKFRALLVFIEHRFYGESLPFG--KKSYKSAET  149

Query  501   RGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALAS  680
              GY NS QALAD+A ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH++LGALAS
Sbjct  150   LGYLNSQQALADFAVLIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHISLGALAS  209

Query  681   SAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFK  860
             SAPIL FDNI P   +Y  V++DFK+ S +C++ I++SW+ ++  ++   GL+ LSK F+
Sbjct  210   SAPILQFDNIVPSTSFYDAVSQDFKDASSDCFEVIKRSWAEMEAFSTMNAGLTKLSKIFR  269

Query  861   LCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDG-APKGADIL  1010
              CK L+S      +L + +   A  + P         P YPV ++C  IDG A +GA  L
Sbjct  270   TCKDLRSVSSAIGWLQTAFVYTAMVNYPTEANFMAPLPAYPVDKMCKIIDGSAARGASDL  329

Query  1011  DRIHAGVV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
             +R+ A         G+  C+D  I +   +  + GW WQ C+EM MP+   D + MF P 
Sbjct  330   ERVFAAASLYYNYSGSEKCFD--IGHEEDAHGLSGWGWQACTEMVMPMSCSD-ECMFQPF  386

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
                 + F  +C   +GV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL
Sbjct  387   EEDYKGFEENCVFRFGVKPRPHWITTEFGGQRIEKVLKRFGSNIIFSNGMQDPWSRGGVL  446

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYY  1514
             ++IS +++A+ T+ G+H  D+   ++ DPDWL EQR++EV IIQ WI +YY
Sbjct  447   KNISSSIIALVTKQGAHHADLRRETEEDPDWLKEQRRQEVAIIQKWIDEYY  497



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/475 (44%), Positives = 307/475 (65%), Gaps = 23/475 (5%)
 Frame = +3

Query  138   PFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQS  317
             P Y+S ++  ++    +    F+T Y+ QTLDHF++ P+S   F Q+Y+++++YW     
Sbjct  36    PAYQSLIKHAKTPKPKL---PFKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYW---HK  89

Query  318   NSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNET  497
              SPIF + G E  I+      GF+ D AP+F+ALL++IEHR+YG+S+PFG  +++  +  
Sbjct  90    GSPIFVYTGNEGDIEWFAANTGFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSYQSAK  147

Query  498   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  677
             T GY NS QALAD A ++  LK    ++ SP++VFGGSYGG+LA+WFRLKYPH+A+GALA
Sbjct  148   TLGYLNSQQALADLAVLIRSLKQNLSSEASPVVVFGGSYGGLLAAWFRLKYPHIAIGALA  207

Query  678   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  857
             SSAPIL FD I P + +Y  V+ DFK+VS+NCY+ I+ SW+ +  I+++   L+ LSK F
Sbjct  208   SSAPILQFDKIIPWSSFYDAVSLDFKDVSQNCYEVIKGSWAELVAISTRKQALAELSKAF  267

Query  858   KLCKGLKSPGELKDYLDSTYC--------TAAQYDQP-PKYPVTEVCGGIDGAPKGADIL  1010
             + CK L S   + ++L + +         T A + +P P YPV ++C  ID +P G   L
Sbjct  268   RTCKSLHSTASVLEWLWTAFVYTAIVNYPTEANFLKPLPAYPVQQMCKIIDKSPSGETKL  327

Query  1011  DRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              R  A             C++ +    P    + GW WQTC+EM MP+   + ++MF P+
Sbjct  328   SRAFAAASLYYNYSQTENCFEVEYEVDP--HGLHGWHWQTCTEMVMPMTCSN-ESMFPPS  384

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
              F  ++F+  C   YGV PRPHWITT +GG  I+ VL +FGSNIIFSNG++DP+S  GVL
Sbjct  385   GFDYKRFAEQCRMKYGVLPRPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSRGGVL  444

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELE  1526
              +IS T++A+ T  G+H +D   A+K DPDWL +QR++EVEIIQ W+ +YYV+L 
Sbjct  445   RNISATIIALVTEKGAHHVDFRAATKDDPDWLIQQRRQEVEIIQRWLDEYYVDLR  499



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/458 (45%), Positives = 298/458 (65%), Gaps = 21/458 (5%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAESPIDDDPKYI  380
             F T +Y Q LDHF + P+S   F Q+Y+++ +YW   ++ +PIF + G E  I+      
Sbjct  49    FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFTANT  105

Query  381   GFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALADYAEVLLYL  560
             GFL D AP+F ALLV+IEHR+YG+S+PFG   ++ N+  T GY  S QALADYA ++  L
Sbjct  106   GFLPDIAPKFHALLVFIEHRFYGESMPFGN--DSYNSAETLGYLTSQQALADYAVLIRSL  163

Query  561   KNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITPENGYYSLV  740
             K    ++ SP++ FGGSYGGMLA+WFRLKYPH+ +GALASSAPIL+FDNI P + +Y  V
Sbjct  164   KQNLSSEASPVVAFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPWSSFYDAV  223

Query  741   TKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELKDYLDSTYC  920
             ++DFK+ S NC++ I++SW+ +++  S+  GL+ LSK F+ CK L S   ++D+L S + 
Sbjct  224   SQDFKDASLNCFKVIKESWTELEQEFSE-EGLAELSKTFRTCKNLHSVSSVRDWLWSAFV  282

Query  921   --------TAAQYDQP-PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GLEGNRTCYD  1064
                     T A + +P P YPV E+C  ID        LD++ A             C++
Sbjct  283   YTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLDKVFAAASLYYNYSHGEKCFN  342

Query  1065  PQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRP  1244
               + N P    + GW WQ C+EM MP+   ++ +MF P+ F  ++F+ DC   YGV PRP
Sbjct  343   --VENGPDLHGLSGWDWQACTEMVMPMTCSNQ-SMFPPSEFDYEEFATDCKKKYGVSPRP  399

Query  1245  HWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDI  1424
             HWITT +GG  I+ VL +FGSN+IFSNG++DP+S  GVL +IS +++A+ T  G+H +D 
Sbjct  400   HWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGVLRNISTSIIAIVTEKGAHHVDF  459

Query  1425  YGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
               A+K DPDWL EQRK+EVEII  WI +YY +++  K+
Sbjct  460   RSATKDDPDWLVEQRKQEVEIIHQWINEYYADMKQDKK  497



>gb|KCW50729.1| hypothetical protein EUGRSUZ_J00403 [Eucalyptus grandis]
Length=365

 Score =   415 bits (1067),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 253/336 (75%), Gaps = 8/336 (2%)
 Frame = +3

Query  126   PRLTPFYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG  305
             P L+      LR PE + S  +  +F T++++QTLDHFNYRP+SY TF+QRY++ S++WG
Sbjct  27    PTLSLQREGVLRDPERAVSASIADDFETFFFNQTLDHFNYRPESYTTFQQRYLIDSRHWG  86

Query  306   GAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFG-TMEEA  482
             GA S++PIF +LGAESPID  P  IGFL DNA +F+ALLVYIEHRYYG+SIP G + EEA
Sbjct  87    GANSSAPIFVYLGAESPIDGSPTVIGFLRDNAAQFQALLVYIEHRYYGESIPLGMSFEEA  146

Query  483   MNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVA  662
             ++    RGYF+SAQALADYA +++++K    A+ SP+IV GGSYGG LASWFRLKYPH+ 
Sbjct  147   LHETNIRGYFSSAQALADYAAIIIHVKQNLKARDSPVIVVGGSYGGKLASWFRLKYPHLT  206

Query  663   LGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSI  842
             +GALASSAPILYFD+ITP++ YYS+VTKDFKE SE CYQTI  SWS ID++A +PNG S 
Sbjct  207   VGALASSAPILYFDDITPQDAYYSVVTKDFKEASETCYQTIGDSWSEIDRVAQEPNGTSN  266

Query  843   LSKKFKLCKGLKSPGELKDYLDSTYCTAAQYDQPPKYPVTEVCGGIDGAPKGAD-ILDRI  1019
             LS+ FK CK L+S  ELK+YL S Y  AAQYD PP+YPVT +C GIDGA    + IL +I
Sbjct  267   LSEMFKTCKPLESGDELKNYLMSLYAYAAQYDDPPRYPVTVICNGIDGANTTENGILGKI  326

Query  1020  HAGVVGLEGNRTCYDPQIYNPPT--SETIVGWRWQT  1121
              AGVV  +GN  CY     NPPT  S+T +GW WQ 
Sbjct  327   FAGVVAYKGNSACY----VNPPTNVSQTDLGWGWQV  358



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   419 bits (1077),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/463 (46%), Positives = 294/463 (63%), Gaps = 25/463 (5%)
 Frame = +3

Query  171   SSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSNSPIFAWLGAE  350
             S S   LP  F+T Y+ Q LDHF+++P+SY  F Q+Y++SS +W   +   PIF + G E
Sbjct  41    SKSKAELPFHFQTRYFPQNLDHFSFQPESYRIFHQKYLISSHFW---RKGGPIFVYTGNE  97

Query  351   SPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQAL  530
               I+      GF+ D AP+F+ALLV+IEHR+YG+S P        N   T GY NS QAL
Sbjct  98    GDIEWFASNTGFMLDIAPKFQALLVFIEHRFYGESKP-------HNLAKTLGYLNSQQAL  150

Query  531   ADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNI  710
             ADYA ++  LK    ++ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL FD I
Sbjct  151   ADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILQFDKI  210

Query  711   TPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGE  890
              P + +Y++V++DFK+ S NC++ I+KSW  ++  ++  +GL  LSKKF+ CK L +   
Sbjct  211   VPSSSFYNVVSQDFKDASLNCFEVIKKSWRELEVFSTMKDGLQELSKKFRTCKDLHAVYL  270

Query  891   LKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---  1034
                +L++ +   A  + P         P YPV E+C  ID  P  A  LDR  A      
Sbjct  271   ASRWLETAFTDTAMVNYPTPANFMAPLPAYPVEEMCKIIDWFPLEASNLDRAFAAASLYY  330

Query  1035  GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDC  1214
                G+  C+D  I N      + GW WQ C+EM MPI   ++ +MF P  +  +    DC
Sbjct  331   NYSGSENCFD--IENQTDPHGLNGWYWQACTEMVMPISCSNQ-SMFQPFEYDEKVDQEDC  387

Query  1215  DDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVY  1394
                YGV PRPHWITT +GGH I++VL +FGSNIIFSNG++DP+S  GVL++IS +++A  
Sbjct  388   LKEYGVKPRPHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNISSSIIAFV  447

Query  1395  TRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             T+ G+H  D+  A+K DP+WL EQR++EV  I+ WI++YY +L
Sbjct  448   TKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKWISEYYSDL  490



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 300/468 (64%), Gaps = 22/468 (5%)
 Frame = +3

Query  159   RRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWG-GAQSNSPIFA  335
             R+P   S   LP  F  +++ Q LDHF +RP++Y  F Q+Y+++S YW  G    +PIF 
Sbjct  46    RKPAMDSE--LP--FTAHFFPQQLDHFTFRPKAYHVFYQKYLINSTYWDQGPVHTAPIFV  101

Query  336   WLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFN  515
             + G E  I+      GF+ D AP+FKALLV+IEHR+YG+S+PFG   ++  +    GY  
Sbjct  102   YTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGESMPFGN--DSYESAEELGYLT  159

Query  516   SAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPIL  695
             S QA+ADYA ++  LK    A+ SP++VFGGSYGGMLA+WFRLKYPH+ +GALASSAPIL
Sbjct  160   STQAMADYAILIRSLKKNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPIL  219

Query  696   YFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGL  875
              FD+I P + +Y  V++DFK+ S NC++ I+ SW  +  + +K  G+  L+K F+ CK L
Sbjct  220   QFDHIVPWSSFYDGVSQDFKDESINCFEVIKDSWDELMVVGAKKGGMLELTKTFRACKKL  279

Query  876   KSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAG  1028
             +S   ++D+L + +   A  D P         P YPV E+C  IDG P G DIL ++ + 
Sbjct  280   QSVYSVRDWLWTAFVYTAMIDYPTPANFLMPLPAYPVKEMCRIIDGFPAGEDILIKVFSA  339

Query  1029  VV---GLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQ  1199
                        +C+D  I N      + GW WQ C+EM MP+   + ++MF P+ +  ++
Sbjct  340   ASLYYNYSSTNSCFD--IENGSDPHGLHGWDWQACTEMVMPMTSSN-ESMFPPSTYDYKE  396

Query  1200  FSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDT  1379
             F   C   Y V PRPHWITT YGG+ I+LVL +FGSNIIFSNG+RDP+S  GVL++IS +
Sbjct  397   FGDQCMTKYEVRPRPHWITTEYGGNKIELVLKRFGSNIIFSNGMRDPWSRGGVLKNISSS  456

Query  1380  VLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ++A+ T  G+H LD   A+K DP WL EQR+ EV+IIQ+WI +YY +L
Sbjct  457   IIALVTPLGAHHLDFRAATKDDPKWLKEQRETEVKIIQAWIDQYYEDL  504



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/489 (43%), Positives = 315/489 (64%), Gaps = 23/489 (5%)
 Frame = +3

Query  117   HTIPRLTPFYRSNLRRPES--SSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVS  290
             H IP+    + S L RPE   +S+ +    +RT +Y Q LDHFNY PQSY TF+QRY+++
Sbjct  28    HIIPK----FPSPLIRPEQQLNSASVKNKLYRTKFYTQILDHFNYNPQSYQTFQQRYLIN  83

Query  291   SKYWGGAQSNSPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGT  470
               YWGGA+  +PIF + G E  I+   +  GF+ + AP F ALLV+IEHR+YGKS+PFG 
Sbjct  84    DTYWGGAKKKAPIFVYTGNEGNIEWFTQNTGFMFEKAPYFNALLVFIEHRFYGKSMPFGG  143

Query  471   MEE-AMNNETTRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLK  647
              ++ A  N +T GY +S QALADYA +++ LKN   A  SP++VFGGSYGGMLA+WFR+K
Sbjct  144   NKKVAYANSSTLGYLSSTQALADYATLIIDLKNNLSATDSPVVVFGGSYGGMLAAWFRMK  203

Query  648   YPHVALGALASSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKP  827
             Y HVA+GALASSAPIL+F ++     + ++VT+DF+  SE+CY  I+ SW +I++ A K 
Sbjct  204   YSHVAIGALASSAPILHFMDLVSPYVFTNIVTQDFRSESEHCYNVIKGSWKLIEETAKKH  263

Query  828   NGLSILSKKFKLCKGLK-SPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGG  977
              GL +L K F++C       G L+ +L + +   A  D P         P YPV ++C  
Sbjct  264   GGLELLKKSFRICNNNDIGAGALEGWLQTAWIYTAMTDYPTPSNFLSPMPAYPVKKMCEA  323

Query  978   IDGA-PKGADILDRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPI  1145
             ID +  +    L +++A         G   C+D  +Y+      + GW+WQ C+EM MP+
Sbjct  324   IDNSVTENNHTLGKLYAAANIYYNYTGTAKCFD--LYDNSDPHDLGGWQWQACTEMIMPL  381

Query  1146  GRGDRDTMFFPAPFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSN  1325
                +++++F  + +S +  S  C   Y V PRP+WIT+ +GGHDI++VL +  SNIIF N
Sbjct  382   DSNNKESIFPESEWSYKDRSSYCKFEYNVVPRPNWITSEFGGHDIEIVLKRSASNIIFFN  441

Query  1326  GLRDPYSSAGVLEDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWIT  1505
             GLRDP+S  GVL++IS +++A+  + G+H +D+  ++K DP WL + R++EV+II+SWI+
Sbjct  442   GLRDPWSGGGVLKNISKSIVALVEKEGAHHVDLRFSTKEDPKWLKDVRRQEVKIIESWIS  501

Query  1506  KYYVELEAL  1532
             +Y+ +L  +
Sbjct  502   QYHQDLATI  510



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 214/466 (46%), Positives = 293/466 (63%), Gaps = 25/466 (5%)
 Frame = +3

Query  201   FRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYW--------GGAQSNSPIFAWLGAESP  356
             FR +Y+ Q LDHF + P +   F Q+Y+V+  +W        G A +  P+F + G E  
Sbjct  76    FRAHYFPQELDHFTFTPNASRIFYQKYLVNDTFWRKPTGKGRGAAAAPGPVFVYTGNEGD  135

Query  357   IDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMNNETTRGYFNSAQALAD  536
             I+      GFL D AP+F ALLV+IEHR+YG+S PFG   E+  +  T GY  S QALAD
Sbjct  136   IEWFATNSGFLFDIAPKFSALLVFIEHRFYGESKPFGN--ESYGSAATLGYLTSTQALAD  193

Query  537   YAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNITP  716
             +A ++  LK+   A  +P++VFGGSYGGMLASWFRLKYPHVA+GALASSAPIL FD+ITP
Sbjct  194   FAVLITSLKHNLSAPVAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAPILQFDDITP  253

Query  717   ENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKFKLCKGLKSPGELK  896
              + +Y   ++DFK  S+NC+  I+  W V+D+  S   GL  LSK F+ CK +K    L 
Sbjct  254   WSSFYDAASQDFKSESKNCFSVIKAVWDVLDERGSNDKGLLQLSKTFRACKTVKYVDSLS  313

Query  897   DYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADILDRIHAGVV---GL  1040
             ++L + +   A  D P         P YPV E+C  ID  P GADI+D+  +        
Sbjct  314   NWLWTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKIIDAFPPGADIVDKAFSAASLYYNY  373

Query  1041  EGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPAPFSMQQFSRDCDD  1220
              G++ C+D +  + P    + GW WQ C+EM MP+   ++ +MF P+ FS ++ S  C  
Sbjct  374   TGDQKCFDVEGGDDP--HGLSGWGWQACTEMVMPMTVSNK-SMFPPSSFSYEEKSEGCLA  430

Query  1221  YYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVLEDISDTVLAVYTR  1400
              YGV PR HWITT YGGH I  VL +FGSNIIFSNG+RDP+S  GVL++IS +++A+ T 
Sbjct  431   SYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTE  490

Query  1401  NGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVELEALKR  1538
              G+H LD   A+K DPDW+ EQR++EVEIIQ WI +Y  ++  + +
Sbjct  491   KGAHHLDFRTATKDDPDWVIEQRRQEVEIIQGWIDQYNKDIAHMSQ  536



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/474 (45%), Positives = 300/474 (63%), Gaps = 17/474 (4%)
 Frame = +3

Query  141   FYRSNLRRPESSSSDILPPEFRTYYYHQTLDHFNYRPQSYATFKQRYIVSSKYWGGAQSN  320
             F  S L RP+SS  D L P ++T ++ Q LDHFN+ PQSY +F+QRY+++  YWGGA  N
Sbjct  30    FPSSLLLRPQSSPIDPLLP-YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHN  88

Query  321   SPIFAWLGAESPIDDDPKYIGFLTDNAPRFKALLVYIEHRYYGKSIPFGTMEEAMN-NET  497
             SPIF + G E  I+   +  GFL   AP F+AL+V+IEHR+YGKSIPFG  E+  N N +
Sbjct  89    SPIFVYTGNEGNIEWFAQNTGFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSS  148

Query  498   TRGYFNSAQALADYAEVLLYLKNKYLAQHSPIIVFGGSYGGMLASWFRLKYPHVALGALA  677
               GY +S QALADYA ++  LK    A  SP++VFGGSYGGMLA+WFRLKYPH+ALGALA
Sbjct  149   MLGYLSSTQALADYATLITDLKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIALGALA  208

Query  678   SSAPILYFDNITPENGYYSLVTKDFKEVSENCYQTIRKSWSVIDKIASKPNGLSILSKKF  857
             SSAPIL  +NIT    + ++VT+DFK  S+NCY  I++SW +ID  ++ P G  +L K F
Sbjct  209   SSAPILQLENITSPYAFNNIVTQDFKSESQNCYSVIKESWHLIDITSTHPQGPQLLRKSF  268

Query  858   KLCKGLKSPGELKDYLDSTYCTAAQYDQP---------PKYPVTEVCGGIDGAPKGADIL  1010
             K CK  ++   +K++L +     A  D P         P YPV ++C  ID    G D  
Sbjct  269   KFCKEAEAE-SIKNWLSTAIIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPRSGNDSF  327

Query  1011  DRIHAGV---VGLEGNRTCYDPQIYNPPTSETIVGWRWQTCSEMAMPIGRGDRDTMFFPA  1181
              +++          G  TC+D    +      +  W WQ C+EM +P G   ++++F  +
Sbjct  328   TKLYGAANIYYNFTGTVTCFDLDDDS--DPHDLGDWSWQACTEMILPTGGNTKESIFPAS  385

Query  1182  PFSMQQFSRDCDDYYGVPPRPHWITTYYGGHDIKLVLHKFGSNIIFSNGLRDPYSSAGVL  1361
              +      + C  ++ V PR  WI T++GGH+I+ VL +FGSNIIF NGLRDP+S  GVL
Sbjct  386   TWHFADRFQFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVL  445

Query  1362  EDISDTVLAVYTRNGSHCLDIYGASKTDPDWLTEQRKKEVEIIQSWITKYYVEL  1523
             ++IS T++A+  + G+H +D+  ++  DP WL + RK+EV II+ W+++YY++L
Sbjct  446   KNISSTIIAIVAKEGAHHVDLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYYLDL  499



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5157028357756