BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22050_g4_i1 len=593 path=[6857:0-324 7182:325-348 7206:349-592]

Length=593
                                                                      Score     E

ref|XP_009591885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   6e-35   
ref|XP_009783584.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   5e-33   
dbj|BAC22609.1|  41 kD chloroplast nucleoid DNA binding protein (...    133   5e-33   Nicotiana sylvestris
gb|KDP33485.1|  hypothetical protein JCGZ_07056                         129   2e-31   
ref|XP_006483727.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   2e-31   
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg                128   3e-31   
gb|KDO67375.1|  hypothetical protein CISIN_1g017894mg                   127   3e-31   
ref|XP_006450237.1|  hypothetical protein CICLE_v10008143mg             128   3e-31   
ref|XP_006483511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   3e-31   
emb|CDP19504.1|  unnamed protein product                                127   4e-31   
ref|XP_007011665.1|  Eukaryotic aspartyl protease family protein,...    127   4e-31   
gb|KDO67377.1|  hypothetical protein CISIN_1g011600mg                   127   4e-31   
ref|XP_007011662.1|  Eukaryotic aspartyl protease family protein,...    127   4e-31   
emb|CDP11359.1|  unnamed protein product                                127   6e-31   
ref|XP_011019525.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   3e-30   
ref|XP_011019522.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   3e-30   
ref|XP_004245197.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   4e-30   
ref|XP_006364268.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   5e-30   
ref|XP_006382029.1|  hypothetical protein POPTR_0006s24860g             123   2e-29   
ref|XP_002309514.1|  nucleoid DNA-binding family protein                123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006287688.1|  hypothetical protein CARUB_v10000896mg             122   4e-29   
ref|XP_008379433.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   7e-29   
ref|XP_008223730.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   7e-29   
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   8e-29   
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                     120   1e-28   
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   
ref|XP_008386743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-28   
ref|XP_002285593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   Vitis vinifera
ref|XP_007226774.1|  hypothetical protein PRUPE_ppa018129mg             119   5e-28   
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                     118   5e-28   
ref|XP_007011661.1|  Eukaryotic aspartyl protease family protein,...    119   5e-28   
ref|XP_009363292.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-28   
gb|KDP33483.1|  hypothetical protein JCGZ_07054                         118   7e-28   
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                     118   7e-28   
ref|XP_006294147.1|  hypothetical protein CARUB_v10023140mg             117   1e-27   
ref|XP_006287706.1|  hypothetical protein CARUB_v10000913mg             117   2e-27   
ref|XP_008386742.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   2e-27   
gb|KFK25359.1|  hypothetical protein AALP_AA8G103100                    117   2e-27   
ref|XP_009359069.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   3e-27   
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-27   
ref|XP_006399574.1|  hypothetical protein EUTSA_v10013429mg             117   3e-27   
ref|XP_008377499.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   3e-27   
ref|XP_009359073.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    117   3e-27   
ref|XP_010049847.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   3e-27   
ref|XP_011036733.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   4e-27   
gb|KHG10166.1|  Asparticase nepenthesin-2                               116   5e-27   
ref|XP_010419657.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   5e-27   
ref|XP_002515387.1|  Aspartic proteinase nepenthesin-2 precursor,...    115   6e-27   Ricinus communis
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   9e-27   
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                     115   1e-26   
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-26   
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                     114   2e-26   
ref|XP_010555463.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   2e-26   
emb|CDX85747.1|  BnaA02g00660D                                          114   2e-26   
ref|XP_010422810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   2e-26   
ref|XP_009125279.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   2e-26   
ref|XP_009125278.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   2e-26   
ref|XP_009359074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   2e-26   
dbj|BAF01928.1|  nucleoid DNA-binding protein cnd41 - like protein      110   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491754.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   3e-26   
ref|XP_010068510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   3e-26   
gb|AAM74221.1|AF518565_1  putative chloroplast nucleoid DNA-bindi...    109   3e-26   Brassica oleracea
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   5e-26   
ref|NP_196637.1|  aspartyl protease family protein                      113   6e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40116.1|  BnaC02g00140D                                          112   7e-26   
emb|CDX85746.1|  BnaA02g00670D                                          112   9e-26   
gb|KCW63886.1|  hypothetical protein EUGRSUZ_G01558                     112   9e-26   
ref|XP_009125277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   
gb|AAN60226.1|  unknown                                                 112   1e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40117.1|  BnaC02g00130D                                          112   1e-25   
ref|XP_009122025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   2e-25   
ref|XP_009122023.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   2e-25   
ref|XP_002324349.1|  nucleoid DNA-binding family protein                112   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008357233.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25   
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g             111   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002324351.1|  nucleoid DNA-binding family protein                111   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011036735.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   2e-25   
ref|XP_010422811.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   2e-25   
ref|XP_003532147.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   3e-25   
ref|XP_010491756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-25   
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg             110   4e-25   
ref|XP_006289171.1|  hypothetical protein CARUB_v10002609mg             110   4e-25   
ref|XP_010424699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   5e-25   
ref|XP_010491755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   5e-25   
ref|XP_010491757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   5e-25   
ref|XP_002309515.1|  nucleoid DNA-binding family protein                110   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg             110   6e-25   
ref|XP_008379455.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   6e-25   
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   6e-25   
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   6e-25   
ref|XP_008379443.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   7e-25   
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615             110   8e-25   
emb|CDX69805.1|  BnaA10g21540D                                          111   8e-25   
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   9e-25   
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein        109   9e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   1e-24   
emb|CDX97061.1|  BnaC09g45640D                                          105   1e-24   
emb|CDX97055.1|  BnaC09g45700D                                          108   1e-24   
ref|NP_196638.2|  aspartyl protease family protein                      109   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010050793.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   1e-24   
gb|KCW80527.1|  hypothetical protein EUGRSUZ_C01881                     108   1e-24   
ref|XP_009122022.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                   108   2e-24   
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   2e-24   
ref|XP_011082009.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   
ref|XP_007225640.1|  hypothetical protein PRUPE_ppa004762mg             108   3e-24   
emb|CDX97058.1|  BnaC09g45670D                                          108   3e-24   
emb|CDX97054.1|  BnaC09g45710D                                          108   3e-24   
ref|XP_008220631.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   
ref|XP_008783095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-24   
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   
ref|XP_007224453.1|  hypothetical protein PRUPE_ppa022256mg             107   4e-24   
ref|XP_007226285.1|  hypothetical protein PRUPE_ppa019577mg             107   5e-24   
gb|KGN55408.1|  hypothetical protein Csa_4G651750                       107   5e-24   
ref|XP_004297874.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-24   
gb|KHG03216.1|  Asparticase nepenthesin-2                               107   5e-24   
gb|KCW44809.1|  hypothetical protein EUGRSUZ_L01628                     107   6e-24   
ref|XP_002452641.1|  hypothetical protein SORBIDRAFT_04g029670          107   8e-24   Sorghum bicolor [broomcorn]
ref|XP_007223563.1|  hypothetical protein PRUPE_ppa014553mg             106   9e-24   
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   9e-24   
gb|KEH33910.1|  eukaryotic aspartyl protease family protein             107   1e-23   
ref|XP_010913305.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   
ref|XP_010040897.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   
ref|XP_008777073.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   
ref|XP_010065985.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   1e-23   
emb|CDX69804.1|  BnaA10g21530D                                          106   2e-23   
gb|KDP33484.1|  hypothetical protein JCGZ_07055                         106   2e-23   
ref|XP_002324933.2|  hypothetical protein POPTR_0018s03000g             106   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007224537.1|  hypothetical protein PRUPE_ppa024411mg             105   4e-23   
gb|KCW63885.1|  hypothetical protein EUGRSUZ_G01557                     104   4e-23   
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   
ref|XP_004295359.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   4e-23   
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-23   
ref|XP_010066087.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   7e-23   
ref|XP_002515388.1|  Aspartic proteinase nepenthesin-2 precursor,...    104   8e-23   Ricinus communis
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   8e-23   
gb|ACF84853.1|  unknown                                                 101   9e-23   Zea mays [maize]
emb|CDY70207.1|  BnaA10g30140D                                          104   9e-23   
gb|KEH33912.1|  eukaryotic aspartyl protease family protein             104   1e-22   
ref|XP_010108295.1|  Aspartic proteinase nepenthesin-2                  103   1e-22   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   
ref|XP_002324355.2|  nucleoid DNA-binding family protein                103   2e-22   Populus trichocarpa [western balsam poplar]
gb|EMS67344.1|  Aspartic proteinase nepenthesin-2                       103   2e-22   
ref|XP_009122891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   2e-22   
ref|XP_008779510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-22   
ref|XP_010050792.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   3e-22   
gb|KFK25358.1|  hypothetical protein AALP_AA8G103000                    103   3e-22   
ref|XP_002454360.1|  hypothetical protein SORBIDRAFT_04g029400          102   3e-22   Sorghum bicolor [broomcorn]
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   
ref|XP_008776819.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.0    4e-22   
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   
gb|EMT32055.1|  Aspartic proteinase nepenthesin-2                     99.8    6e-22   
ref|XP_002515386.1|  Aspartic proteinase nepenthesin-2 precursor,...    101   6e-22   Ricinus communis
ref|XP_008779067.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   7e-22   
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   8e-22   
ref|NP_001150335.1|  aspartic proteinase nepenthesin-2 precursor        101   8e-22   Zea mays [maize]
ref|XP_009409855.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   9e-22   
gb|ACN29145.1|  unknown                                                 100   1e-21   Zea mays [maize]
gb|KCW63890.1|  hypothetical protein EUGRSUZ_G01565                     100   1e-21   
dbj|BAJ89995.1|  predicted protein                                      100   1e-21   
gb|ACF88017.1|  unknown                                                 100   2e-21   Zea mays [maize]
gb|KCW63736.1|  hypothetical protein EUGRSUZ_G01384                     100   2e-21   
gb|EMS67345.1|  Aspartic proteinase nepenthesin-2                     99.4    2e-21   
gb|EMT32054.1|  Aspartic proteinase nepenthesin-2                       100   2e-21   
ref|NP_001140743.1|  uncharacterized protein LOC100272818             99.4    2e-21   Zea mays [maize]
ref|XP_010066094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
gb|KCW63730.1|  hypothetical protein EUGRSUZ_G01376                     100   2e-21   
ref|XP_008220628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
gb|ABR16115.1|  unknown                                                 100   3e-21   Picea sitchensis
ref|XP_004973076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
ref|XP_004953759.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
ref|XP_004953760.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
ref|XP_004966942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
gb|AFW63716.1|  aspartic proteinase nepenthesin-2                       100   3e-21   
ref|XP_010928159.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
gb|AFK48193.1|  unknown                                               95.9    4e-21   
ref|XP_010913226.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    4e-21   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                   99.0    4e-21   
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg              99.8    5e-21   
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    5e-21   
ref|XP_010050794.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    5e-21   
ref|XP_008647512.1|  PREDICTED: uncharacterized protein LOC100272...  99.8    5e-21   
ref|XP_009401063.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    6e-21   
ref|XP_002436936.1|  hypothetical protein SORBIDRAFT_10g011730        99.4    6e-21   Sorghum bicolor [broomcorn]
ref|NP_001047954.1|  Os02g0720600                                     99.0    7e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87323.1|  hypothetical protein OsI_08727                        99.0    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010108293.1|  Aspartic proteinase nepenthesin-2                  100   7e-21   
ref|XP_008679061.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.0    7e-21   
ref|XP_007011660.1|  Eukaryotic aspartyl protease family protein,...  99.0    8e-21   
gb|EMS35741.1|  Aspartic proteinase nepenthesin-2                     94.0    8e-21   
gb|EMS54230.1|  Aspartic proteinase nepenthesin-2                     97.8    8e-21   
ref|XP_002454359.1|  hypothetical protein SORBIDRAFT_04g029390        98.6    1e-20   Sorghum bicolor [broomcorn]
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.4    1e-20   
ref|XP_006647806.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.2    2e-20   
ref|XP_010259084.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    2e-20   
ref|XP_002460430.1|  hypothetical protein SORBIDRAFT_02g027990        98.2    2e-20   Sorghum bicolor [broomcorn]
dbj|BAJ99659.1|  predicted protein                                    98.2    2e-20   
ref|XP_007212799.1|  hypothetical protein PRUPE_ppa020165mg           96.7    2e-20   
ref|XP_006656917.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    2e-20   
gb|EMS57901.1|  Aspartic proteinase nepenthesin-2                     97.1    3e-20   
gb|KDP33482.1|  hypothetical protein JCGZ_07053                       97.4    3e-20   
ref|XP_010108296.1|  Aspartic proteinase nepenthesin-2                97.4    4e-20   
ref|XP_008652856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    5e-20   
ref|XP_010068417.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    5e-20   
gb|KCW80528.1|  hypothetical protein EUGRSUZ_C01882                   96.7    5e-20   
ref|XP_002297678.1|  aspartyl protease family protein                 96.7    6e-20   Populus trichocarpa [western balsam poplar]
gb|KDO37972.1|  hypothetical protein CISIN_1g011746mg                 96.7    6e-20   
ref|XP_011034591.1|  PREDICTED: aspartic proteinase nepenthesin-1     96.7    6e-20   
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                     96.7    6e-20   
gb|EMS59088.1|  Aspartic proteinase nepenthesin-2                     95.9    6e-20   
ref|XP_003573001.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    7e-20   
tpg|DAA61984.1|  TPA: hypothetical protein ZEAMMB73_915310            97.1    7e-20   
ref|XP_002324354.1|  nucleoid DNA-binding family protein              96.3    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    9e-20   
ref|XP_002283470.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    9e-20   Vitis vinifera
gb|KDO67372.1|  hypothetical protein CISIN_1g011649mg                 96.3    9e-20   
gb|KCW80526.1|  hypothetical protein EUGRSUZ_C01880                   95.9    1e-19   
ref|XP_003532146.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    1e-19   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            94.4    1e-19   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            94.4    1e-19   
emb|CDP18858.1|  unnamed protein product                              95.9    1e-19   
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    2e-19   
ref|XP_010266604.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    2e-19   
ref|NP_001063501.1|  Os09g0482200                                     95.5    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561171.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    2e-19   
ref|XP_010266605.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    2e-19   
gb|EAZ09523.1|  hypothetical protein OsI_31798                        95.5    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002873475.1|  hypothetical protein ARALYDRAFT_909036           93.6    2e-19   
gb|EEE65583.1|  hypothetical protein OsJ_21095                        95.1    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71061.1|  hypothetical protein OsI_02803                        95.1    2e-19   Oryza sativa Indica Group [Indian rice]
gb|EMT19686.1|  Aspartic proteinase nepenthesin-1                     94.0    2e-19   
ref|XP_011036745.1|  PREDICTED: aspartic proteinase nepenthesin-2...  92.8    2e-19   
ref|XP_008650536.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    2e-19   
ref|XP_010266613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    2e-19   
gb|AFW77036.1|  hypothetical protein ZEAMMB73_461996                  95.1    2e-19   
gb|EMT03324.1|  Aspartic proteinase nepenthesin-2                     90.5    2e-19   
ref|XP_006483509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    2e-19   
dbj|BAK02683.1|  predicted protein                                    94.7    3e-19   
ref|XP_006483508.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    3e-19   
ref|XP_008811141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    3e-19   
ref|XP_002438291.1|  hypothetical protein SORBIDRAFT_10g011210        94.7    3e-19   Sorghum bicolor [broomcorn]
ref|XP_011012148.1|  PREDICTED: aspartic proteinase nepenthesin-2...  93.2    3e-19   
ref|XP_004964375.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    4e-19   
ref|XP_002268758.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    4e-19   Vitis vinifera
dbj|BAD62401.1|  putative nucleoid DNA-binding protein cnd41          94.7    4e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06293.1|  predicted protein                                    94.4    4e-19   
ref|XP_010692959.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    4e-19   
ref|XP_006644352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    4e-19   
ref|XP_010229859.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    4e-19   
gb|EAZ00664.1|  hypothetical protein OsI_22685                        93.6    7e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_003570261.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    7e-19   
gb|EMT06628.1|  Aspartic proteinase nepenthesin-2                     92.8    7e-19   
ref|NP_001056627.2|  Os06g0118000                                     90.1    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006483507.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    8e-19   
ref|XP_004241673.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    8e-19   
ref|XP_004513891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    8e-19   
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...  93.6    8e-19   
gb|EMS66296.1|  Aspartic proteinase nepenthesin-1                     92.8    9e-19   
ref|XP_009390626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    9e-19   
ref|XP_002438284.1|  hypothetical protein SORBIDRAFT_10g011120        93.6    9e-19   Sorghum bicolor [broomcorn]
ref|XP_004513892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    9e-19   
ref|XP_003576664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    9e-19   
gb|EMT16675.1|  Aspartic proteinase nepenthesin-2                     93.2    1e-18   
gb|EEE65000.1|  hypothetical protein OsJ_19937                        92.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303865.2|  hypothetical protein POPTR_0003s18330g           93.2    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009390625.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    1e-18   
gb|ABP93696.1|  unknown protein isoform 1                             91.7    1e-18   Lemna minor
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210        93.2    1e-18   Sorghum bicolor [broomcorn]
dbj|BAD68338.1|  putative nucleoid DNA-binding protein cnd41, chl...  92.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964374.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    1e-18   
gb|EAZ35653.1|  hypothetical protein OsJ_19940                        92.8    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g           93.2    1e-18   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    1e-18   
dbj|BAD68388.1|  putative nucleoid DNA-binding protein cnd41, chl...  92.4    1e-18   
ref|XP_002453187.1|  hypothetical protein SORBIDRAFT_04g001340        93.2    1e-18   
ref|NP_001056638.1|  Os06g0121500                                     92.4    1e-18   
ref|XP_001784204.1|  predicted protein                                91.3    1e-18   
ref|XP_007021889.1|  Eukaryotic aspartyl protease family protein,...  93.6    2e-18   
gb|ABK24493.1|  unknown                                               92.8    2e-18   
emb|CBI21177.3|  unnamed protein product                              91.3    2e-18   
ref|NP_001056639.2|  Os06g0121800                                     92.8    2e-18   
gb|EEC79895.1|  hypothetical protein OsI_21423                        92.4    2e-18   
ref|XP_003551807.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    2e-18   
ref|XP_002437729.1|  hypothetical protein SORBIDRAFT_10g001440        92.4    2e-18   
dbj|BAJ04354.1|  pollen allergen CPA63                                92.0    2e-18   
ref|XP_003530207.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    2e-18   
gb|KHN04198.1|  Aspartic proteinase nepenthesin-1                     92.0    2e-18   
ref|XP_010096516.1|  Aspartic proteinase nepenthesin-2                91.7    2e-18   
ref|XP_010266612.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    3e-18   
ref|XP_010252879.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    3e-18   
ref|XP_006493458.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    3e-18   
dbj|BAK03499.1|  predicted protein                                    92.0    3e-18   
gb|KDO55402.1|  hypothetical protein CISIN_1g011482mg                 92.0    3e-18   
gb|KDP41942.1|  hypothetical protein JCGZ_26960                       91.7    4e-18   
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    4e-18   
emb|CDX67980.1|  BnaA07g20200D                                        91.7    4e-18   
ref|XP_009104505.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    4e-18   
ref|XP_010266607.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    5e-18   
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    5e-18   
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000        91.3    6e-18   
ref|XP_011012151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    6e-18   
ref|XP_010229951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    6e-18   
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    7e-18   
emb|CDX79338.1|  BnaC06g19650D                                        90.9    7e-18   
ref|XP_009629718.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    7e-18   
emb|CDX87358.1|  BnaA07g35150D                                        90.1    7e-18   
ref|XP_010687331.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    7e-18   
ref|XP_004959561.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    7e-18   
gb|ACN85278.1|  aspartic proteinase nepenthesin-1 precursor           90.9    8e-18   
ref|XP_002436939.1|  hypothetical protein SORBIDRAFT_10g011740        90.5    8e-18   
ref|XP_006366263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    8e-18   
ref|XP_004964380.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    9e-18   
ref|XP_002436940.1|  hypothetical protein SORBIDRAFT_10g011750        90.5    9e-18   
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    1e-17   
ref|XP_004235884.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    1e-17   
ref|NP_001168410.1|  hypothetical protein precursor                   90.1    1e-17   
gb|KHN38061.1|  Aspartic proteinase nepenthesin-1                     90.5    1e-17   
emb|CAJ26370.1|  chloroplast nucleoid binding protein                 90.1    1e-17   
gb|AFW86421.1|  hypothetical protein ZEAMMB73_098827                  90.5    1e-17   
ref|XP_006341422.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    1e-17   
ref|XP_003531753.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    1e-17   
ref|NP_001043485.1|  Os01g0598600                                     90.5    1e-17   
gb|ACF85435.1|  unknown                                               86.7    1e-17   
ref|XP_002262837.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   
ref|XP_008659479.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   
ref|XP_010417641.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    1e-17   
ref|XP_010648782.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   
gb|ACN85284.1|  aspartic proteinase nepenthesin-1 precursor           90.1    1e-17   
ref|XP_004965303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
ref|XP_010034049.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
ref|XP_004964381.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
gb|EMT13758.1|  Aspartic proteinase nepenthesin-2                     88.2    2e-17   
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    2e-17   
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    2e-17   
dbj|BAF01866.1|  chloroplast nucleoid DNA binding protein like        85.5    2e-17   
ref|XP_007147550.1|  hypothetical protein PHAVU_006G134200g           89.4    2e-17   
gb|EEC79892.1|  hypothetical protein OsI_21411                        90.1    2e-17   
gb|EAZ35641.1|  hypothetical protein OsJ_19928                        90.1    2e-17   
gb|KHN12538.1|  Aspartic proteinase nepenthesin-2                     89.4    3e-17   
gb|EMS62120.1|  Aspartic proteinase nepenthesin-1                     89.7    3e-17   
emb|CDX88562.1|  BnaC06g40060D                                        89.4    3e-17   
ref|XP_010472845.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    3e-17   
ref|XP_004959563.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
ref|XP_006302129.1|  hypothetical protein CARUB_v10020134mg           89.4    3e-17   
gb|EMT13228.1|  Aspartic proteinase nepenthesin-1                     89.0    3e-17   
ref|XP_009774796.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
ref|XP_003576537.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
ref|XP_010429875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
ref|XP_008791340.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
gb|ACN85225.1|  aspartic proteinase nepenthesin-1 precursor           89.0    4e-17   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    4e-17   
ref|XP_009759386.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    4e-17   
ref|XP_006389854.1|  hypothetical protein EUTSA_v10018461mg           89.0    4e-17   
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein        88.6    4e-17   
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970        88.6    4e-17   
ref|XP_008659487.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   
gb|AFW86437.1|  hypothetical protein ZEAMMB73_618532                  88.6    4e-17   
ref|XP_006427680.1|  hypothetical protein CICLE_v10025395mg           88.6    5e-17   
gb|EMT28037.1|  Aspartic proteinase nepenthesin-2                     88.2    5e-17   
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g           88.2    5e-17   
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor           88.2    6e-17   
emb|CBI25263.3|  unnamed protein product                              87.0    6e-17   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    6e-17   
gb|EAY99437.1|  hypothetical protein OsI_21406                        87.4    6e-17   
ref|XP_004966945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    6e-17   
ref|XP_009609916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    6e-17   
gb|EMS49734.1|  Aspartic proteinase nepenthesin-1                     86.7    7e-17   
ref|XP_007023525.1|  Eukaryotic aspartyl protease family protein      87.8    8e-17   
gb|EYU24570.1|  hypothetical protein MIMGU_mgv1a005585mg              87.8    8e-17   
gb|KHM99525.1|  Aspartic proteinase nepenthesin-1                     87.8    8e-17   
gb|EMT21644.1|  Aspartic proteinase nepenthesin-2                     85.1    9e-17   
ref|XP_002525244.1|  Aspartic proteinase nepenthesin-2 precursor,...  87.4    9e-17   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    9e-17   
gb|ACG34391.1|  aspartic proteinase nepenthesin-2 precursor           87.8    9e-17   
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    9e-17   
ref|XP_002889266.1|  aspartyl protease family protein                 87.8    9e-17   
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    1e-16   
ref|XP_010906670.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    1e-16   
gb|EMT28036.1|  Aspartic proteinase nepenthesin-1                     87.4    1e-16   
emb|CBI21175.3|  unnamed protein product                              86.7    1e-16   
ref|XP_003570481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    1e-16   
ref|NP_001056633.1|  Os06g0119600                                     87.4    1e-16   
ref|XP_009395291.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    1e-16   
dbj|BAJ86414.1|  predicted protein                                    87.4    1e-16   
ref|XP_009106694.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    1e-16   
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    1e-16   
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   
ref|XP_008228848.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   
gb|EPS61272.1|  hypothetical protein M569_13524                       87.0    1e-16   
ref|NP_001063212.1|  Os09g0423500                                     87.0    1e-16   
ref|NP_001183392.1|  uncharacterized protein LOC100501808             85.5    1e-16   
gb|ACN85339.1|  aspartic proteinase nepenthesin-1 precursor           87.4    1e-16   
ref|XP_009615689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    2e-16   
emb|CDM83204.1|  unnamed protein product                              87.0    2e-16   
ref|XP_008659488.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    2e-16   
ref|XP_010537860.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    2e-16   
gb|EAZ09144.1|  hypothetical protein OsI_31414                        87.0    2e-16   
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                87.0    2e-16   
ref|XP_003594399.1|  Aspartic proteinase nepenthesin-2                86.7    2e-16   
ref|XP_007215297.1|  hypothetical protein PRUPE_ppa005040mg           87.0    2e-16   
gb|AFW86441.1|  hypothetical protein ZEAMMB73_342504                  86.7    2e-16   
gb|KDO67371.1|  hypothetical protein CISIN_1g028157mg                 84.0    2e-16   
ref|NP_001141706.1|  hypothetical protein precursor                   86.7    2e-16   
gb|ACN85323.1|  aspartic proteinase nepenthesin-1 precursor           84.7    2e-16   
emb|CDO98251.1|  unnamed protein product                              86.7    2e-16   
gb|KEH24641.1|  eukaryotic aspartyl protease family protein           86.7    2e-16   
ref|XP_002451310.1|  hypothetical protein SORBIDRAFT_05g027510        87.0    2e-16   
gb|ACJ85595.1|  unknown                                               86.3    2e-16   
ref|NP_001141341.1|  uncharacterized protein LOC100273432 precursor   86.7    2e-16   
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    2e-16   
ref|XP_002302634.2|  aspartyl protease family protein                 86.7    2e-16   
ref|NP_191741.1|  aspartyl protease                                   86.3    3e-16   
gb|ACF79109.1|  unknown                                               82.8    3e-16   
ref|XP_009375476.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    3e-16   
ref|XP_010655139.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    3e-16   
ref|XP_006657126.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    3e-16   
gb|ABP93697.1|  unknown protein isoform 2                             84.7    3e-16   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        86.3    3e-16   
ref|XP_003563922.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    3e-16   
gb|EMT28035.1|  Aspartic proteinase nepenthesin-2                     85.9    4e-16   
ref|XP_002438283.1|  hypothetical protein SORBIDRAFT_10g011110        85.9    4e-16   
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    4e-16   
dbj|BAK00738.1|  predicted protein                                    82.4    4e-16   
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    5e-16   
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358            85.5    5e-16   
ref|XP_002458192.1|  hypothetical protein SORBIDRAFT_03g028480        85.5    5e-16   
gb|KDP28482.1|  hypothetical protein JCGZ_14253                       85.5    5e-16   
gb|EMS47306.1|  Aspartic proteinase nepenthesin-2                     85.5    5e-16   
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    5e-16   
ref|XP_007024419.1|  Eukaryotic aspartyl protease family protein,...  85.5    5e-16   
dbj|BAD12880.1|  putative chloroplast nucleoid DNA-binding protei...  83.6    6e-16   
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...  85.1    6e-16   
ref|XP_002892074.1|  aspartyl protease family protein                 85.5    6e-16   
dbj|BAJ92327.1|  predicted protein                                    85.1    6e-16   
ref|NP_171637.1|  aspartyl protease family protein                    85.1    6e-16   
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    7e-16   
ref|XP_006649000.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    7e-16   
ref|XP_003546907.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    7e-16   
emb|CDP20730.1|  unnamed protein product                              85.1    7e-16   
ref|XP_010266610.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    7e-16   
ref|NP_001047953.1|  Os02g0720500                                     81.6    7e-16   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    7e-16   
gb|KHN14389.1|  Aspartic proteinase nepenthesin-2                     84.3    7e-16   
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    8e-16   
gb|ACN85264.1|  aspartic proteinase nepenthesin-1 precursor           85.1    8e-16   
ref|XP_004507035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    8e-16   
gb|AAF68120.1|AC010793_15  F20B17.14                                  84.7    8e-16   
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                  84.7    8e-16   
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    9e-16   
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    9e-16   
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    9e-16   
ref|XP_011095850.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    9e-16   
ref|NP_565219.1|  eukaryotic aspartyl protease family protein         84.7    1e-15   
gb|ACN35554.1|  unknown                                               80.9    1e-15   
gb|ACN85177.1|  aspartic proteinase nepenthesin-1 precursor           84.7    1e-15   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            84.7    1e-15   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            83.2    1e-15   
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    1e-15   
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g           84.7    1e-15   
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    1e-15   
gb|ACN85210.1|  aspartic proteinase nepenthesin-1 precursor           84.7    1e-15   
ref|NP_001058055.1|  Os06g0610800                                     84.7    1e-15   
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    1e-15   
ref|XP_006483506.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            84.0    1e-15   
gb|KDO67369.1|  hypothetical protein CISIN_1g011804mg                 84.3    1e-15   
gb|AAM66069.1|  putative aspartyl protease                            84.3    1e-15   
ref|XP_006857532.1|  hypothetical protein AMTR_s00061p00034260        79.3    1e-15   
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                   84.3    1e-15   
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
ref|XP_004486405.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   
gb|ACF78986.1|  unknown                                               80.5    1e-15   
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  84.3    2e-15   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369           83.6    2e-15   
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
gb|EPS57666.1|  hypothetical protein M569_17150                       82.0    2e-15   
emb|CDO98452.1|  unnamed protein product                              83.6    2e-15   
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230            83.6    2e-15   
gb|KHN40751.1|  Aspartic proteinase nepenthesin-2                     83.6    2e-15   
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
emb|CAN80962.1|  hypothetical protein VITISV_022007                   80.1    2e-15   
ref|XP_004973134.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_002436941.1|  hypothetical protein SORBIDRAFT_10g011760        83.6    2e-15   
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
dbj|BAJ94237.1|  predicted protein                                    84.0    2e-15   
gb|AFW71023.1|  hypothetical protein ZEAMMB73_589717                  82.0    2e-15   
dbj|BAJ92731.1|  predicted protein                                    84.0    2e-15   
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg           84.0    2e-15   



>ref|XP_009591885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
 dbj|BAA22813.1| CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum]
Length=502

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 88/129 (68%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY +L+ AFKQ M+ YP      P L  L DTCYD +NY + +IP ISF
Sbjct  381  SGTVITRLPSTAYGSLKSAFKQFMSKYPTA----PALS-LLDTCYDLSNYTSISIPKISF  435

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F GN  V LDP G++  + NG S VCLAF+ + D    GIFGN QQQT +VVYDVAGGQ
Sbjct  436  NFNGNANVELDPNGIL--ITNGASQVCLAFAGNGDDDSIGIFGNIQQQTLEVVYDVAGGQ  493

Query  353  LGFASGGCS  379
            LGF   GCS
Sbjct  494  LGFGYKGCS  502



>ref|XP_009783584.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=515

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+  Y +L+  FKQ M+ YP      P L  L DTCYD +NY + +IP ISF
Sbjct  394  SGTVITRLPSTVYGSLKSTFKQFMSKYPTA----PALS-LLDTCYDLSNYTSISIPKISF  448

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F GN  V L+P G++  + NG S VCLAF+ + D    GIFGN QQQT +VVYDVAGGQ
Sbjct  449  NFNGNANVDLEPNGIL--ITNGASQVCLAFAGNGDDDTIGIFGNIQQQTLEVVYDVAGGQ  506

Query  353  LGFASGGCS  379
            LGF   GCS
Sbjct  507  LGFGYKGCS  515



>dbj|BAC22609.1| 41 kD chloroplast nucleoid DNA binding protein (CND41) [Nicotiana 
sylvestris]
Length=502

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+  Y +L+  FKQ M+ YP      P L  L DTCYD +NY + +IP ISF
Sbjct  381  SGTVITRLPSTVYGSLKSTFKQFMSKYPTA----PALS-LLDTCYDLSNYTSISIPKISF  435

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F GN  V L+P G++  + NG S VCLAF+ + D    GIFGN QQQT +VVYDVAGGQ
Sbjct  436  NFNGNANVDLEPNGIL--ITNGASQVCLAFAGNGDDDTIGIFGNIQQQTLEVVYDVAGGQ  493

Query  353  LGFASGGCS  379
            LGF   GCS
Sbjct  494  LGFGYKGCS  502



>gb|KDP33485.1| hypothetical protein JCGZ_07056 [Jatropha curcas]
Length=493

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR  F+Q M+ YP      P L  + DTCYDFTNY   ++P I F
Sbjct  372  SGTVITRLPPAAYSALRSTFRQQMSKYPTA----PALS-ILDTCYDFTNYKTISVPKIGF  426

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G  EV +D  GV     N  S VCLAF   S +TD  IFGN QQQT +VVYDVA G+
Sbjct  427  FFNGGTEVDIDVTGVF--YVNRPSQVCLAFAGNSDATDVAIFGNVQQQTLEVVYDVAAGK  484

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  485  IGFAAGGCS  493



>ref|XP_006483727.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=458

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYT L+ AF+Q M+ YP      P +  + DTCYDF+ +   TIP ISF
Sbjct  337  SGTVITRLPPHAYTVLKTAFRQLMSKYPTA----PAVS-ILDTCYDFSEHETITIPKISF  391

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+M P+    S VCLAF   S  +D GIFGN QQ T +VVYDVA GQ
Sbjct  392  FFNGGVEVDVDVTGIMFPIR--ASQVCLAFAGNSDPSDVGIFGNVQQHTLEVVYDVAHGQ  449

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  450  VGFAAGGCS  458



>gb|EYU29201.1| hypothetical protein MIMGU_mgv1a005225mg [Erythranthe guttata]
Length=492

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 87/128 (68%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+R+P  AY+AL  AFK+ M  Y     ++     + DTCYD + Y + T+P +SF
Sbjct  371  SGTVISRIPPTAYSALSGAFKKMMAKY-----KRAPAYSILDTCYDLSGYTSVTVPTVSF  425

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            TFGGN+ V LDP G++  +  GG+ VCLAF+ ++D    GIFGN QQ+T +VVYDVAGG 
Sbjct  426  TFGGNVRVDLDPSGIIVAV--GGTRVCLAFAGNSDDGDVGIFGNSQQKTLEVVYDVAGGN  483

Query  353  LGFASGGC  376
            LGF S GC
Sbjct  484  LGFGSAGC  491



>gb|KDO67375.1| hypothetical protein CISIN_1g017894mg [Citrus sinensis]
Length=364

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYT L+ AF+Q M+ YP      P +  + DTCYDF+ +   TIP ISF
Sbjct  243  SGTVITRLPPHAYTVLKTAFRQLMSKYPTA----PAVS-ILDTCYDFSEHETITIPKISF  297

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+M P+    S VCLAF   S  +D GIFGN QQ T +VVYDVA GQ
Sbjct  298  FFNGGVEVDVDVTGIMFPIR--ASQVCLAFAGNSDPSDVGIFGNVQQHTLEVVYDVAHGQ  355

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  356  VGFAAGGCS  364



>ref|XP_006450237.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
 gb|ESR63477.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
Length=481

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYT LR AF+Q M+ YP      P L  L DTCYDF+ Y   T+P IS 
Sbjct  360  SGTVITRLPPDAYTPLRTAFRQFMSKYPTA----PALS-LLDTCYDFSKYSTVTLPQISL  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+M   N   S VCLAF   S  TD  IFGN QQ T +VVYDVAGG+
Sbjct  415  FFSGGVEVSVDKTGIMYASNI--SQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVAGGK  472

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  473  VGFAAGGCS  481



>ref|XP_006483511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO67376.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=481

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYT LR AF+Q M+ YP      P L  L DTCYDF+ Y   T+P IS 
Sbjct  360  SGTVITRLPPDAYTPLRTAFRQFMSKYPTA----PALS-LLDTCYDFSKYSTVTLPQISL  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+M   N   S VCLAF   S  TD  IFGN QQ T +VVYDVAGG+
Sbjct  415  FFSGGVEVSVDKTGIMYASNI--SQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVAGGK  472

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  473  VGFAAGGCS  481



>emb|CDP19504.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+Q M+ Y     +      + DTCYDF++     IP IS 
Sbjct  361  SGTVITRLPPAAYSALRSAFRQQMSQY-----KTAPAASILDTCYDFSSQSTVKIPKISI  415

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F GN++V L   G +  L +  S VCLAF   S +TD GI+GN QQQTFDVVYDVAGG+
Sbjct  416  IFSGNVKVDLAIEGTLL-LPSSLSQVCLAFAGNSAATDMGIYGNTQQQTFDVVYDVAGGK  474

Query  353  LGFASGGCS  379
            LGFA GGCS
Sbjct  475  LGFAPGGCS  483



>ref|XP_007011665.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
 gb|EOY29284.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
Length=477

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +F+Q MT YP       Q   + DTCYDF+ Y + +IP ISF
Sbjct  356  SGTVITRLPPTAYAALRSSFRQKMTQYPRA-----QALAILDTCYDFSKYSSVSIPKISF  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D +G++    N  S VCLAF   S  TD GI GN QQ+T  VVYD AGG+
Sbjct  411  FFSGGVEVPIDAKGIL--YANSISQVCLAFAGNSDDTDIGIVGNTQQKTLQVVYDGAGGR  468

Query  353  LGFASGGCS  379
            +GFA+G CS
Sbjct  469  IGFATGACS  477



>gb|KDO67377.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=454

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYT LR AF+Q M+ YP      P L  L DTCYDF+ Y   T+P IS 
Sbjct  333  SGTVITRLPPDAYTPLRTAFRQFMSKYPTA----PALS-LLDTCYDFSKYSTVTLPQISL  387

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+M   N   S VCLAF   S  TD  IFGN QQ T +VVYDVAGG+
Sbjct  388  FFSGGVEVSVDKTGIMYASNI--SQVCLAFAGNSDPTDVSIFGNTQQHTLEVVYDVAGGK  445

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  446  VGFAAGGCS  454



>ref|XP_007011662.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY29281.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
Length=474

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +F+Q MT YP       Q   + DTCYDF+ Y + +IP ISF
Sbjct  353  SGTVITRLPPTAYAALRSSFRQKMTQYPRA-----QALAILDTCYDFSKYSSVSIPKISF  407

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D +G++    N  S VCLAF   S  TD GI GN QQ+T  VVYD AGG+
Sbjct  408  FFSGGVEVPIDAKGIL--YANSISQVCLAFAGNSDDTDIGIVGNTQQKTLQVVYDGAGGR  465

Query  353  LGFASGGCS  379
            +GFA+G CS
Sbjct  466  IGFATGACS  474



>emb|CDP11359.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+Q M+ Y     +      + DTCYDF+     TIP IS 
Sbjct  361  SGTVITRLPPAAYSALRSAFRQQMSQY-----KTAPAATILDTCYDFSGQSTVTIPKISI  415

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F GN++V L   G +  L +  S VCLAF   S +TD GI+GN QQQTF+VVYDVAGG+
Sbjct  416  FFSGNVKVDLGIEGTL--LASSISQVCLAFAGNSAATDVGIYGNTQQQTFEVVYDVAGGK  473

Query  353  LGFASGGCS  379
            LGFA GGCS
Sbjct  474  LGFAPGGCS  482



>ref|XP_011019525.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019527.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019529.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
Length=472

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 88/129 (68%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL++AF + M+ YP+         +L DTCYDF+NY   + P +S 
Sbjct  350  SGTVITRLPPTAYKALKEAFDEKMSNYPKT-----NGDELLDTCYDFSNYTTVSFPMVSV  404

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G +EV +D  G++ P+N G   +CLAF+ + D    GIFGN+QQ+T++VVYD A G 
Sbjct  405  SFKGGVEVDIDASGILYPVN-GVKTMCLAFAANKDDSEIGIFGNHQQKTYEVVYDGAKGM  463

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  464  VGFAAGGCS  472



>ref|XP_011019522.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019526.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019528.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
Length=474

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 88/129 (68%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL++AF + M+ YP+         +L DTCYDF+NY   + P +S 
Sbjct  352  SGTVITRLPPTAYKALKEAFDEKMSNYPKT-----NGDELLDTCYDFSNYTTVSFPMVSV  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G +EV +D  G++ P+N G   +CLAF+ + D    GIFGN+QQ+T++VVYD A G 
Sbjct  407  SFKGGVEVDIDASGILYPVN-GVKTMCLAFAANKDDSEIGIFGNHQQKTYEVVYDGAKGM  465

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  466  VGFAAGGCS  474



>ref|XP_004245197.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=501

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY+ LR  F++ M+ YP      P L  L DTCYD +NY   +IP ISF
Sbjct  380  SGTVITRLPSTAYSNLRATFREFMSKYPRA----PDLS-LLDTCYDLSNYTTISIPKISF  434

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F GN ++ + P G+   + NG S VCLAF+ + D    GIFGN QQQT ++VYDVAG +
Sbjct  435  NFNGNTKMDIVPNGIF--IVNGASQVCLAFAGNGDDDSIGIFGNTQQQTMEIVYDVAGEK  492

Query  353  LGFASGGCS  379
            LGF  GGC+
Sbjct  493  LGFGYGGCT  501



>ref|XP_006364268.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=485

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY  +R  F++ M+ YP      P L  L DTCYD +NY   +IP ISF
Sbjct  364  SGTVITRLPSTAYANMRATFREFMSKYPRA----PDLS-LLDTCYDLSNYTTVSIPKISF  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F GN ++ L P G+     NG S VCLAF+ + D    GIFGN QQQT ++VYDVAG +
Sbjct  419  NFNGNTKMDLVPNGIF--FVNGASQVCLAFASNGDDDSIGIFGNTQQQTMEIVYDVAGEK  476

Query  353  LGFASGGCS  379
            LGF  GGC+
Sbjct  477  LGFGYGGCT  485



>ref|XP_006382029.1| hypothetical protein POPTR_0006s24860g [Populus trichocarpa]
 gb|ERP59826.1| hypothetical protein POPTR_0006s24860g [Populus trichocarpa]
Length=443

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL++AF + M+ YP+         +L DTCYDF+NY   + P +S 
Sbjct  321  SGTVITRLPPTAYKALKEAFDEKMSNYPKT-----NGDELLDTCYDFSNYTTVSFPKVSV  375

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G +EV ++  G++  L NG   VCLAF+ + D    GIFGN+QQ+T++VVYD A G 
Sbjct  376  SFKGGVEVDINASGILY-LVNGLKMVCLAFAANKDDSKIGIFGNHQQKTYEVVYDGAKGM  434

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  435  VGFAAGGCS  443



>ref|XP_002309514.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93037.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=474

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 86/129 (67%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL++AF + M+ YP+         +L DTCYDF+NY   + P +S 
Sbjct  352  SGTVITRLPPTAYKALKEAFDEKMSNYPKT-----NGDELLDTCYDFSNYTTVSFPKVSV  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G +EV +D  G++  L NG   VCLAF+ + D    GIFGN+QQ+T++VVYD A G 
Sbjct  407  SFKGGVEVDIDASGILY-LVNGVKMVCLAFAANKDDSEFGIFGNHQQKTYEVVYDGAKGM  465

Query  353  LGFASGGCS  379
            +GFA+G CS
Sbjct  466  IGFAAGACS  474



>ref|XP_006287688.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
 gb|EOA20586.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
Length=465

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 80/127 (63%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +    + +FDTCYDFT     TIP I+F
Sbjct  346  SGTVITRLPTKVYAELRRVFKEKMSSY-----KATSGRSIFDTCYDFTGVDTMTIPKIAF  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD-GGIFGNYQQQTFDVVYDVAGGQLG  358
            + GG   V L   G++ PL    S VCLAF+   D   IFGN QQ+T ++VYDVAGG++G
Sbjct  401  SLGGGTVVELGRMGILYPLTQ--SQVCLAFAGEDDLPAIFGNVQQKTLEIVYDVAGGRIG  458

Query  359  FASGGCS  379
            FAS GCS
Sbjct  459  FASNGCS  465



>ref|XP_008379433.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=504

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALRDAF+Q M  YP      P L  + DTCYDF+N    T P ISF
Sbjct  383  SGTVITRLPPTAYKALRDAFQQGMKSYPSA----PALS-ILDTCYDFSNADTVTFPKISF  437

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG   + LDP G+    +     VCLAF+ +   +D GIFGN QQ+   VVYDVAGG+
Sbjct  438  EFGGRTTLELDPTGIFYAAS--ADQVCLAFAANGDDSDIGIFGNVQQKRVQVVYDVAGGK  495

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  496  IGFAPAGC  503



>ref|XP_008223730.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=497

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALRDAF+Q M  YP    + P +  + DTCYDF++Y    IP I+F
Sbjct  376  SGTVITRLPPQAYSALRDAFRQGMKSYP----RAPAIS-ILDTCYDFSSYETVNIPKIAF  430

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G L + LD  G++  +    S  CLAFS +   +D  +FGN QQ   +VVYDVA G+
Sbjct  431  SFKGGLTLDLDGTGIIYTVT--ASQACLAFSANKEDSDIAVFGNVQQLKLEVVYDVAKGK  488

Query  353  LGFASGGC  376
            LGFASGGC
Sbjct  489  LGFASGGC  496



>ref|XP_010068511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Eucalyptus 
grandis]
Length=413

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+  M  Y       P    LFDTCYDF+     T+P I+F
Sbjct  292  SGTVITRLPPTAYSALRTAFRSAMANY----TMAPAFS-LFDTCYDFSKESTITVPLITF  346

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LDP G+   +N   S VCLAF+     ++ GI+GN QQ+TF+VVYDVAGG+
Sbjct  347  SFAGGVDADLDPNGIFFIVN--ASEVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVAGGK  404

Query  353  LGFASGGCS  379
            LGF S GCS
Sbjct  405  LGFGSNGCS  413



>gb|KCW63888.1| hypothetical protein EUGRSUZ_G01561 [Eucalyptus grandis]
Length=449

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+  M  Y       P    LFDTCYDF+     T+P I+F
Sbjct  328  SGTVITRLPPTAYSALRTAFRSAMANY----TMAPAFS-LFDTCYDFSKESTITVPLITF  382

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LDP G+   +N   S VCLAF+     ++ GI+GN QQ+TF+VVYDVAGG+
Sbjct  383  SFAGGVDADLDPNGIFFIVN--ASEVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVAGGK  440

Query  353  LGFASGGCS  379
            LGF S GCS
Sbjct  441  LGFGSNGCS  449



>ref|XP_010066088.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63887.1| hypothetical protein EUGRSUZ_G01559 [Eucalyptus grandis]
Length=473

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ALR AF+  M  Y       P L+ + DTCYDF+     T+P I+F
Sbjct  352  SGTVISRLPPTAYSALRTAFRSAMANYT----MAPALR-ILDTCYDFSKESTITVPLITF  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LDP G+   +N   S VCLAF+     ++ GI+GN QQ+TF+VVYDVAGG+
Sbjct  407  SFAGGVDAELDPNGIFFIVN--ASQVCLAFAPNRADSNLGIYGNTQQKTFEVVYDVAGGK  464

Query  353  LGFASGGCS  379
            LGF S GCS
Sbjct  465  LGFGSNGCS  473



>ref|XP_008386743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Malus domestica]
Length=435

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 77/128 (60%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  YP        +  L DTCYDF+ +   T P I F
Sbjct  313  SGTVITRLPATAYTALRDAFREAMKRYPTA----KSISSLLDTCYDFSGFKTITFPTIGF  368

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++ P     S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  369  VFGNGVTVDVDATGIVVP--QSASQFCLAFAGNKDDRNVGIIGNVQQKRLQVVYDVAGGK  426

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  427  VGFAPAGC  434



>ref|XP_002285593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=481

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ LR +F+Q M+ YP+          + DTCYDF+ Y    +P I+ 
Sbjct  360  SGTVISRLPPTAYSDLRASFQQQMSKYPKAAPAS-----ILDTCYDFSQYDTVDVPKINL  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F    E+ LDP G+   LN   S VCLAF   S +TD  I GN QQ+TFDVVYDVAGG+
Sbjct  415  YFSDGAEMDLDPSGIFYILNI--SQVCLAFAGNSDATDIAILGNVQQKTFDVVYDVAGGR  472

Query  353  LGFASGGC  376
            +GFA GGC
Sbjct  473  IGFAPGGC  480



>ref|XP_007226774.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
 gb|EMJ27973.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
Length=461

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+Q M  YP      P +  + DTCYDF++Y   TIP I+ 
Sbjct  340  SGTVITRLPPQAYSALRAAFQQGMKSYPRA----PAIS-ILDTCYDFSSYETVTIPKIAI  394

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G L + LD  G++ P+    S  CLAF+ +   +D  +FGN QQ  F+VVYDV  G+
Sbjct  395  SFKGGLTLDLDGTGIIYPVT--ASQACLAFAANKNDSDIAVFGNVQQLKFEVVYDVDKGK  452

Query  353  LGFASGGC  376
            LGFASGGC
Sbjct  453  LGFASGGC  460



>gb|KCW64008.1| hypothetical protein EUGRSUZ_G01690, partial [Eucalyptus grandis]
Length=413

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP  AY+ALR AF+Q MT Y       P      DTCYD +     T+P I+F
Sbjct  292  SGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASP-----LDTCYDLSGSTMVTVPVITF  346

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++++LDP GV+ P++   S VCLAF+ S+D     I+GN QQ++F+VVYDVAGG+
Sbjct  347  SFKGPIDINLDPSGVLFPVDP--SKVCLAFASSSDDTNLSIYGNIQQRSFEVVYDVAGGR  404

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  405  IGFGAKGCS  413



>ref|XP_007011661.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29280.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=503

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF+Q M+ YP           + DTCYDF+NY +  +P IS 
Sbjct  382  SGTVITRLPPTAYAALRSAFRQRMSQYP-----MTDALSILDTCYDFSNYKSVAVPKISL  436

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F GN+EV + P G M   +   S VCLAF+ + D G   IFGN QQ+T  VV+D AG +
Sbjct  437  FFSGNVEVKITPVGTM--YSETVSQVCLAFAPNDDDGEVAIFGNTQQKTVQVVHDGAGRR  494

Query  353  LGFASGGC  376
            +GF++GGC
Sbjct  495  IGFSAGGC  502



>ref|XP_009363292.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=507

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALRDAF+Q M  YP      P L  + DTCYDF+N    T P ISF
Sbjct  386  SGTVITRLPPTAYKALRDAFQQGMKSYPSA----PALS-ILDTCYDFSNADTVTFPKISF  440

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG   + LDP G+    +     VCLAF+ +   +D GI GN QQ+   VVYDVAGG+
Sbjct  441  AFGGGTTLELDPTGIFYAAS--ADQVCLAFAANGDDSDIGIIGNVQQKRVQVVYDVAGGK  498

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  499  IGFAPAGC  506



>gb|KDP33483.1| hypothetical protein JCGZ_07054 [Jatropha curcas]
Length=464

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF++ M+ YP+      Q     DTCYDF+N+    +P I  
Sbjct  343  SGTVITRLPPAAYSALQSAFQELMSQYPKA-----QPLPTLDTCYDFSNFQTVNVPKIVL  397

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G  +V +   G+   L+NG + VCLAF+ ++D     IFGN QQ T++V+YDV+GG+
Sbjct  398  SFSGATDVEVAQSGIF--LSNGAAQVCLAFAPNSDPRQKAIFGNKQQLTYEVIYDVSGGK  455

Query  353  LGFASGGCS  379
            +GFA+GGCS
Sbjct  456  VGFAAGGCS  464



>gb|KCW63732.1| hypothetical protein EUGRSUZ_G01378, partial [Eucalyptus grandis]
Length=395

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ALR AF++ M  Y       P L  + DTCYDF+     T+P I+F
Sbjct  274  SGTVISRLPPTAYSALRTAFRKAMANYTTA----PALS-ILDTCYDFSKESTVTVPTITF  328

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G  +++LD  G+        S VCLAF+ +   TD GI+GN QQ+TF+VVYDVAGG+
Sbjct  329  SFAGGADINLDHNGIFYVAK--ASQVCLAFAANGADTDLGIYGNVQQKTFEVVYDVAGGK  386

Query  353  LGFASGGCS  379
            LGF S GCS
Sbjct  387  LGFGSKGCS  395



>ref|XP_006294147.1| hypothetical protein CARUB_v10023140mg [Capsella rubella]
 gb|EOA27045.1| hypothetical protein CARUB_v10023140mg [Capsella rubella]
Length=469

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV++RLPT  Y  LR  FK+ M+ Y     +     ++FDTCYDFT     TIP I+F
Sbjct  350  SGTVVSRLPTRIYEELRTVFKEKMSSY-----KATSGYEIFDTCYDFTGVDTMTIPKIAF  404

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG-GIFGNYQQQTFDVVYDVAGGQLG  358
            +FGG   V LD  G++ PL+   S VCLAF+   D   IFGN QQ+T ++VYDVAGG++G
Sbjct  405  SFGGGTVVELDVNGMLYPLSM--SQVCLAFAGDDDSPAIFGNVQQKTMEIVYDVAGGRVG  462

Query  359  FASGGCS  379
            FA  GCS
Sbjct  463  FAPHGCS  469



>ref|XP_006287706.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
 gb|EOA20604.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
Length=461

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 79/127 (62%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +    + + DTCYDFT     T+P I+F
Sbjct  342  SGTVITRLPTKVYAELRSVFKEKMSSY-----KSTPGRSILDTCYDFTGLDTVTLPTIAF  396

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD-GGIFGNYQQQTFDVVYDVAGGQLG  358
            + GG   V LD  G++ PL    S VCLAF+   D   IFGN QQ+T ++VYDVAGG++G
Sbjct  397  SMGGGTVVELDGMGILYPLTQ--SQVCLAFAGEDDIPAIFGNVQQKTMEIVYDVAGGRVG  454

Query  359  FASGGCS  379
            FA  GCS
Sbjct  455  FAPNGCS  461



>ref|XP_008386742.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=496

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  YP        +  L DTCYDF+ +   T P I F
Sbjct  374  SGTVITRLPATAYTALRDAFREXMKRYPTA----KSISSLLDTCYDFSGFKTITFPTIGF  429

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++       S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  430  VFGNGVTVDVDATGIL--FQQSASQFCLAFAGNKDDSSVGIIGNVQQKRLQVVYDVAGGK  487

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  488  VGFAPAGC  495



>gb|KFK25359.1| hypothetical protein AALP_AA8G103100 [Arabis alpina]
Length=475

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK  M+ YP           + DTC++ + Y   TIP ++F
Sbjct  354  SGTVITRLPPKAYAALRSAFKAQMSKYPST-----SAVSILDTCFNLSGYKTVTIPKVAF  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G++ P     S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  409  SFSGGAVVELGSKGILYPFKM--SQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAGGR  466

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  467  VGFAPNGCS  475



>ref|XP_009359069.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 80/128 (63%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  YP     +P +  L DTCYDF+ +   T+P I F
Sbjct  374  SGTVITRLPATAYTALRDAFREAMKRYPTA---KP-ISSLLDTCYDFSGFKTITLPTIGF  429

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++  +    S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  430  VFGNGVTVDVDETGIL--VQQRASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVAGGK  487

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  488  VGFAPAGC  495



>ref|XP_010068575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=709

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP  AY+ALR AF+Q MT Y       P      DTCYD +     T+P I+F
Sbjct  588  SGTTITQLPPTAYSALRSAFRQAMTKYKMSTPASP-----LDTCYDLSGSTMVTVPVITF  642

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++++LDP GV+ P++   S VCLAF+ S+D     I+GN QQ++F+VVYDVAGG+
Sbjct  643  SFKGPIDINLDPSGVLFPVDP--SKVCLAFASSSDDTNLSIYGNIQQRSFEVVYDVAGGR  700

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  701  IGFGAKGCS  709



>ref|XP_006399574.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
 gb|ESQ41027.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
Length=475

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AFK  M+ YP           + DTC+D T +   TIP ++F
Sbjct  354  SGTVISRLPPKAYAALRSAFKAKMSKYPST-----SAVSILDTCFDLTGFKTVTIPKVAF  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G++ P     S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  409  SFSGGAVVELGSKGILYPFKV--SQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAGGR  466

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  467  VGFAPNGCS  475



>ref|XP_008377499.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=497

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  YP        +  L DTCYDF  +   T P I F
Sbjct  375  SGTVITRLPATAYTALRDAFREAMKRYPTA----RSISSLLDTCYDFNGFKTITFPKIGF  430

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++  +    S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  431  VFGNGVTVDVDATGIL--VQQSASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVAGGK  488

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  489  VGFAPAGC  496



>ref|XP_009359073.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Pyrus x bretschneideri]
Length=497

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY ALRDAF+Q M  Y       P L  + DTCYDF+N   PT P ISF
Sbjct  376  SGTVITRLQATAYRALRDAFRQRMKSYTSA----PALS-ILDTCYDFSNVKTPTYPKISF  430

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG + + LD  G+M   +   + VCLAF+ +   +D GIFGN QQ+   VVYDV G +
Sbjct  431  AFGGGMTLDLDETGIMYVAS--ANQVCLAFAGNDDDSDVGIFGNVQQKRLQVVYDVGGRK  488

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  489  IGFAPAGC  496



>ref|XP_010049847.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW82644.1| hypothetical protein EUGRSUZ_C04028 [Eucalyptus grandis]
Length=483

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK+ MT YP      P L  + DTCYD + Y +  IP +SF
Sbjct  362  SGTVITRLPPTAYSALSSAFKKLMTRYPTA----PALS-ILDTCYDLSKYKSVNIPKVSF  416

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LDP G++   +   S VCLAF+ +   TD  I+GN QQQ+F+VVYDVAG +
Sbjct  417  LFSGGTNVDLDPSGILYAAS--ASQVCLAFAGNGDDTDVLIYGNVQQQSFEVVYDVAGLK  474

Query  353  LGFASGGCS  379
            LGF   GC+
Sbjct  475  LGFGPKGCA  483



>ref|XP_011036733.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=490

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP PAY+ALR +F+  M+ YP       +   + DTCYDF+NY   ++P I F
Sbjct  369  SGTVITRLPPPAYSALRASFRNLMSKYP-----MTKALSILDTCYDFSNYTTISVPKIGF  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   +EV +D  G++    +  S VCLAF   S +TD  IFGN QQ+T +V YD + G+
Sbjct  424  SFSSGIEVDIDATGIL--YASSISQVCLAFAGNSDATDVFIFGNVQQKTLEVFYDGSAGK  481

Query  353  LGFASGGCS  379
            +GFA GGCS
Sbjct  482  VGFAPGGCS  490



>gb|KHG10166.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=478

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTAL   F++ M+ YP+    QP    + DTCYDFT + + ++P IS 
Sbjct  357  SGTVITRLPPTAYTALSSEFRKLMSQYPKA---QPL--SILDTCYDFTKFSSVSVPMISI  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +  +G++    N  S VCLAF+ +   TD GIFGN QQ+T  VVYD  GG+
Sbjct  412  FFRGGVEVPIAAKGIL--YVNTISQVCLAFAGNNDDTDVGIFGNTQQKTLQVVYDGVGGK  469

Query  353  LGFASGGCS  379
            LGFA+GGCS
Sbjct  470  LGFATGGCS  478



>ref|XP_010419657.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=469

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 79/128 (62%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +    + +FDTCYDFT     TIP I+F
Sbjct  349  SGTVITRLPTKVYAELRSVFKEKMSSY-----KATSGRDIFDTCYDFTGLDTITIPKIAF  403

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQL  355
            +F G   V L   G++ PL    S VCLAF+   +    IFGN QQ+T ++VYDVAGG++
Sbjct  404  SFAGGTVVDLAGIGILYPLTR--SQVCLAFAGDNEHIPAIFGNVQQKTIEIVYDVAGGRV  461

Query  356  GFASGGCS  379
            GFA  GCS
Sbjct  462  GFAPNGCS  469



>ref|XP_002515387.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46836.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=463

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV+TRLP  AY+ALR AF++ M  YP   + +P    + DTCYDF+ Y    +P I  
Sbjct  342  SGTVVTRLPPAAYSALRSAFRKAMASYP---MGKPL--SILDTCYDFSKYKTIKVPKIVI  396

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYST---DGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++V +D  G+   + NG   VCLAF+ +T   D  IFGN QQ+ F+VVYDV+GG+
Sbjct  397  SFSGGVDVDVDQAGIF--VANGLKQVCLAFAGNTGARDTAIFGNTQQRNFEVVYDVSGGK  454

Query  353  LGFASGGCS  379
            +GFA   CS
Sbjct  455  VGFAPASCS  463



>ref|XP_009359072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 80/128 (63%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  YP     +P +  + DTCYDF+ +   T+P I F
Sbjct  374  SGTVITRLPATAYTALRDAFREAMKRYPTA---KP-IFSVLDTCYDFSGFKTITLPTIGF  429

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++ P     S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  430  VFGNGVTVDVDATGILFP--QSASQFCLAFAGNKDDSSFGIIGNVQQKRLQVVYDVAGGK  487

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  488  VGFAPAGC  495



>gb|KCW63938.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=480

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP  AY+ALR AF+Q MT Y    +  P     FDTCYD +     T+P I+F
Sbjct  359  SGTTITQLPPTAYSALRSAFRQAMTKYK---MSTP--ASSFDTCYDLSGSTMVTVPVITF  413

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++++LDP GV+  ++   S VCLAF+ S D     I+GN QQ++F+VVYDVAGG+
Sbjct  414  SFNGPIDINLDPSGVLILVDP--SKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVAGGR  471

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  472  IGFGAQGCS  480



>ref|XP_010068543.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=417

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP  AY+ALR AF+Q MT Y    +  P     FDTCYD +     T+P I+F
Sbjct  296  SGTTITQLPPTAYSALRSAFRQAMTKYK---MSTP--ASSFDTCYDLSGSTMVTVPVITF  350

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++++LDP GV+  ++   S VCLAF+ S D     I+GN QQ++F+VVYDVAGG+
Sbjct  351  SFNGPIDINLDPSGVLILVDP--SKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVAGGR  408

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  409  IGFGAQGCS  417



>ref|XP_004291984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALRDAF+Q M  YP     Q +   + DTCYD +     + P I+F
Sbjct  371  SGTVITRLPATAYSALRDAFRQGMKSYP-----QAEALSILDTCYDLSGSKTVSYPKIAF  425

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG + + LD  G++   +   S VCLAF   S  +D  IFGN QQ+   VVYDVAGG+
Sbjct  426  AFGGGVTLDLDATGILYVASV--SQVCLAFAGNSDDSDIAIFGNVQQKRLQVVYDVAGGK  483

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  484  VGFAPAGC  491



>gb|KCW63937.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=481

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP  AY+ALR AF+Q MT Y    +  P     FDTCYD +     T+P I+F
Sbjct  360  SGTTITQLPPTAYSALRSAFRQAMTKYK---MSTP--ASSFDTCYDLSGSTMVTVPVITF  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++++LDP GV+  ++   S VCLAF+ S D     I+GN QQ++F+VVYDVAGG+
Sbjct  415  SFNGPIDINLDPSGVLILVDP--SKVCLAFASSGDDRDLSIYGNIQQRSFEVVYDVAGGR  472

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  473  IGFGAQGCS  481



>ref|XP_010555463.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=478

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF+  M+ YP      P +  + DTCYD T Y    IP + F
Sbjct  357  SGTVITRLPPKAYSALKSAFQASMSRYPTA----PAVS-ILDTCYDLTGYRTVAIPKVGF  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G ++V LD  G++  L    S VCL F+ ++D     IFGN QQQT +VVYD  GG+
Sbjct  412  LFSGGVDVELDATGILYALKI--SQVCLGFASNSDDSSVAIFGNVQQQTLEVVYDGRGGR  469

Query  353  LGFASGGC  376
            +GFA GGC
Sbjct  470  VGFAPGGC  477



>emb|CDX85747.1| BnaA02g00660D [Brassica napus]
Length=478

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK++M  Y      +     L DTCYD   +   ++P +SF
Sbjct  357  SGTVITRLPPKAYAALRGAFKENMKNYTTASAVE-----LLDTCYDPKGFDTMSVPKVSF  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +FGG   V L   G++ PLN   S VCLAF+ + + G   IFG++QQ T  VVYD AGG+
Sbjct  412  SFGGGTTVELGLNGILYPLN--ASHVCLAFAGNDNDGDFAIFGSFQQMTLQVVYDTAGGR  469

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  470  IGFAQNGCS  478



>ref|XP_010422810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=469

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +    + +FDTCYDFT      IP I+F
Sbjct  348  SGTVITRLPTKVYAELRTVFKEKMSRY-----KATSGRGIFDTCYDFTGLDTMRIPKIAF  402

Query  182  TFGGNLEVHLDPRG-VMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQ  352
            + GG   V LD  G V+ P     S VCLAF+   D    IFGN QQ+T ++VYDVAGG+
Sbjct  403  SLGGGTVVELDKIGMVLYPFTR--SQVCLAFAGDDDHIPAIFGNVQQKTMEIVYDVAGGR  460

Query  353  LGFASGGCS  379
            LGFA  GCS
Sbjct  461  LGFAPNGCS  469



>ref|XP_009125279.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Brassica rapa]
Length=449

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK++M  Y      +     L DTCYD   +   ++P +SF
Sbjct  328  SGTVITRLPPKAYAALRGAFKENMKNYTTASAVE-----LLDTCYDPKGFDTMSVPKVSF  382

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +FGG   V L   G++ PLN   S VCLAF+ + + G   IFG++QQ T  VVYD AGG+
Sbjct  383  SFGGGTTVELGLNGILYPLN--ASHVCLAFAGNDNDGDLAIFGSFQQMTLQVVYDTAGGR  440

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  441  IGFAQNGCS  449



>ref|XP_009125278.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Brassica rapa]
Length=478

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK++M  Y      +     L DTCYD   +   ++P +SF
Sbjct  357  SGTVITRLPPKAYAALRGAFKENMKNYTTASAVE-----LLDTCYDPKGFDTMSVPKVSF  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +FGG   V L   G++ PLN   S VCLAF+ + + G   IFG++QQ T  VVYD AGG+
Sbjct  412  SFGGGTTVELGLNGILYPLN--ASHVCLAFAGNDNDGDLAIFGSFQQMTLQVVYDTAGGR  469

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  470  IGFAQNGCS  478



>ref|XP_009359074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=497

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALR+AF++ M  YP        +  L DTCYDF+     T P I F
Sbjct  375  SGTVITRLPATAYTALRNAFREAMKRYPTAT----SISSLLDTCYDFSGIKTITFPKIGF  430

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V +D  G++  +    S  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  431  VFGNGVTVDVDATGIL--VQQSASQFCLAFAGNKDDRSVGIIGNVQQKRLQVVYDVAGGK  488

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  489  VGFAPDGC  496



>dbj|BAF01928.1| nucleoid DNA-binding protein cnd41 - like protein [Arabidopsis 
thaliana]
Length=183

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  62   SGTVITRLPPKAYAALRSSFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  116

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  117  SFSGGAVVELGSKGIFYVFKI--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  174

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  175  VGFAPNGCS  183



>ref|XP_010491754.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=468

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK  M+ Y     +    + +FDTCYD T     TIP I+F
Sbjct  347  SGTVITRLPTKVYAELRSVFKAKMSSY-----KATSGRGIFDTCYDLTGLNTMTIPKIAF  401

Query  182  TFGGNLEVHLDPRG-VMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQ  352
            + GG + V LD  G V+ P     S VCLAF+   D    IFGN QQ+T ++VYDVAGG+
Sbjct  402  SLGGGIVVKLDRIGMVLYPFTR--SQVCLAFAGDDDHIPAIFGNVQQKTMEIVYDVAGGR  459

Query  353  LGFASGGCS  379
            LGFA  GCS
Sbjct  460  LGFAPNGCS  468



>ref|XP_010068510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=281

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY AL  AF+  M  Y       P L  L DTCYDF+     T+P I+F
Sbjct  160  SGTVISRLPPTAYGALTTAFRNAMKNYT----MAPALP-LLDTCYDFSKESTITVPLITF  214

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LDP G+   +N   S VCLAF+     ++  I+GN QQ+TF+VVYDVAGG+
Sbjct  215  SFAGGVDADLDPNGIFFIVN--ASEVCLAFAPNQADSNLTIYGNTQQKTFEVVYDVAGGK  272

Query  353  LGFASGGCS  379
            LGF+S GCS
Sbjct  273  LGFSSNGCS  281



>gb|AAM74221.1|AF518565_1 putative chloroplast nucleoid DNA-binding protein [Brassica oleracea]
Length=165

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AFK  M+ Y     +      + DTC+D T +   TIP +SF
Sbjct  44   SGTVISRLPPKAYAALRGAFKAKMSQY-----KNTSAVSILDTCFDLTGFKTVTIPTVSF  98

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L  +GV+       S VCLAF+ ++D     IFGN QQQT +VVYD A G+
Sbjct  99   YFNGGAVVELGSKGVLYAFKM--SQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAAGR  156

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  157  VGFAPNGCS  165



>ref|XP_010065986.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63735.1| hypothetical protein EUGRSUZ_G01382 [Eucalyptus grandis]
Length=473

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+  M  Y       P L  L DTCYDF+     T P I+F
Sbjct  352  SGTVITRLPPTAYSALRTAFRNAMANY----TMAPALP-LLDTCYDFSKESTITFPLITF  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LD  G+   LN   S VCLAF+     +D GI+GN QQ+TF+V YDVAGG+
Sbjct  407  SFAGGVDADLDFYGIFYILNP--SEVCLAFAPNRADSDLGIYGNTQQRTFEVAYDVAGGK  464

Query  353  LGFASGGCS  379
            LGF S GCS
Sbjct  465  LGFGSNGCS  473



>ref|NP_196637.1| aspartyl protease family protein [Arabidopsis thaliana]
 emb|CAB96831.1| nucleoid DNA-binding protein cnd41-like protein [Arabidopsis 
thaliana]
 gb|AAL59990.1| putative nucleoid DNA-binding protein cnd41 [Arabidopsis thaliana]
 gb|AAM91722.1| putative nucleoid DNA-binding protein cnd41 [Arabidopsis thaliana]
 dbj|BAE98588.1| nucleoid DNA-binding protein cnd41 - like protein [Arabidopsis 
thaliana]
 gb|AED91593.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=464

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV TRLPT  Y  LR  FK+ M+ Y     +      LFDTCYDFT     T P I+F
Sbjct  346  SGTVFTRLPTKVYAELRSVFKEKMSSY-----KSTSGYGLFDTCYDFTGLDTVTYPTIAF  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD-GGIFGNYQQQTFDVVYDVAGGQLG  358
            +F G+  V LD  G+  P+    S VCLAF+ + D   IFGN QQ T DVVYDVAGG++G
Sbjct  401  SFAGSTVVELDGSGISLPIKI--SQVCLAFAGNDDLPAIFGNVQQTTLDVVYDVAGGRVG  458

Query  359  FASGGC  376
            FA  GC
Sbjct  459  FAPNGC  464



>emb|CDY40116.1| BnaC02g00140D [Brassica napus]
Length=479

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK++M  Y      +     L DTCYD   +   ++P +SF
Sbjct  358  SGTVITRLPPKAYAALRSAFKENMKNYTTTSAVE-----LLDTCYDPKGFDTMSVPKVSF  412

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +FGG   V L   G++ PLN   S VCLAF+ + + G   IFG+ QQ T  VVYD AGG+
Sbjct  413  SFGGGTTVELGLNGILYPLN--ASHVCLAFAGNDNDGDFAIFGSVQQMTLQVVYDKAGGR  470

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  471  IGFAQNGCS  479



>emb|CDX85746.1| BnaA02g00670D [Brassica napus]
Length=477

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL+DAFK  M+ YP           + DTC+D +     TIP ++F
Sbjct  356  SGTVITRLPPKAYAALKDAFKAKMSQYPSA-----SGVSILDTCFDLSGLKTVTIPKVAF  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L   GV+       S VCLAF   S  T+  IFGN QQQT +VVYD AGG+
Sbjct  411  SFSGGAVVELGSTGVLYAFKM--SQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGAGGR  468

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  469  VGFAPNGCS  477



>gb|KCW63886.1| hypothetical protein EUGRSUZ_G01558 [Eucalyptus grandis]
Length=446

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY AL  AF+  M  Y       P L  L DTCYDF+     T+P I+F
Sbjct  325  SGTVISRLPPTAYGALTTAFRNAMKNYT----MAPALP-LLDTCYDFSKESTITVPLITF  379

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G ++  LDP G+   +N   S VCLAF+     ++  I+GN QQ+TF+VVYDVAGG+
Sbjct  380  SFAGGVDADLDPNGIFFIVN--ASEVCLAFAPNQADSNLTIYGNTQQKTFEVVYDVAGGK  437

Query  353  LGFASGGCS  379
            LGF+S GCS
Sbjct  438  LGFSSNGCS  446



>ref|XP_009125277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=477

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL+DAFK  M+ YP           + DTC+D +     TIP ++F
Sbjct  356  SGTVITRLPPKAYAALKDAFKAKMSQYPSA-----SGVSILDTCFDLSGLKTVTIPKVAF  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L   GV+       S VCLAF   S  T+  IFGN QQQT +VVYD AGG+
Sbjct  411  SFSGGAVVELGSTGVLYAFKM--SQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGAGGR  468

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  469  VGFAPNGCS  477



>gb|AAN60226.1| unknown [Arabidopsis thaliana]
Length=464

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV TRLPT  Y  LR  FK+ M+ Y     +      LFDTCYDFT     T P I+F
Sbjct  346  SGTVFTRLPTKVYAELRSVFKEKMSSY-----KSTSGYGLFDTCYDFTGLDTVTYPTIAF  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD-GGIFGNYQQQTFDVVYDVAGGQLG  358
            +F G   V LD  G+  P+    S VCLAF+ + D   IFGN QQ T DVVYDVAGG++G
Sbjct  401  SFAGGTVVELDGSGISLPIKI--SQVCLAFAGNDDLPAIFGNVQQTTLDVVYDVAGGRVG  458

Query  359  FASGGC  376
            FA  GC
Sbjct  459  FAPNGC  464



>emb|CDY40117.1| BnaC02g00130D [Brassica napus]
Length=477

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL+DAFK  M+ YP           + DTC+D +     TIP ++F
Sbjct  356  SGTVITRLPPKAYAALKDAFKAKMSQYPSA-----SGVSILDTCFDLSGLKTVTIPKVAF  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L   GV+       S VCLAF   S  T+  IFGN QQQT +VVYD AGG+
Sbjct  411  SFSGGAVVELGSTGVLYAFKM--SQVCLAFAGNSDDTNAAIFGNVQQQTLEVVYDGAGGR  468

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  469  VGFAPNGCS  477



>ref|XP_009122025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Brassica rapa]
Length=473

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK+ M+ Y   +      + LFDTCYDFT   +  IP +SF
Sbjct  352  SGTVITRLPPTAYAALRTAFKEKMSNYKTALG-----RSLFDTCYDFTGLESVEIPKVSF  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V LD +GV+   +   S VCLAF   S   D  IFGN QQ+T  VVYD  GG+
Sbjct  407  SFKGGTVVELDLKGVLYVFDV--SQVCLAFAGNSNDEDVAIFGNVQQRTMQVVYDGPGGR  464

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  465  VGFAPNGC  472



>ref|XP_009122023.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Brassica rapa]
Length=476

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK+ M+ Y   +      + LFDTCYDFT   +  IP +SF
Sbjct  355  SGTVITRLPPTAYAALRTAFKEKMSNYKTALG-----RSLFDTCYDFTGLESVEIPKVSF  409

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V LD +GV+   +   S VCLAF   S   D  IFGN QQ+T  VVYD  GG+
Sbjct  410  SFKGGTVVELDLKGVLYVFDV--SQVCLAFAGNSNDEDVAIFGNVQQRTMQVVYDGPGGR  467

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  468  VGFAPNGC  475



>ref|XP_002324349.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02914.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=490

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR +F+  M+ YP       +   + DTCYDF++Y   ++P I F
Sbjct  369  SGTVITRLPPAAYSALRASFRNLMSKYP-----MTKALSILDTCYDFSSYTTISVPKIGF  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   +EV +D  G++    +  S VCLAF   S +TD  IFGN QQ+T +V YD + G+
Sbjct  424  SFSSGIEVDIDATGIL--YASSLSQVCLAFAGNSDATDVFIFGNVQQKTLEVFYDGSAGK  481

Query  353  LGFASGGCS  379
            +GFA GGCS
Sbjct  482  VGFAPGGCS  490



>ref|XP_008357233.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=600

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY ALRDAF+Q M  Y       P L  + DTCYDF+N    T P ISF
Sbjct  479  SGTVITRLQATAYRALRDAFRQQMKSYTSA----PALS-ILDTCYDFSNVKTXTYPKISF  533

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG + + LD  G+M   +     VCLAF+ +   +D GIFGN QQ+   VVYDV G +
Sbjct  534  AFGGGMTLDLDETGIMYVAS--ADQVCLAFAGNGDDSDVGIFGNVQQKRLQVVYDVGGRK  591

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  592  IGFAPAGC  599



>ref|XP_002324352.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
 gb|EEF02917.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
Length=472

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY+ L  AF+  MT YP           +FDTCYDF+ Y    IP +  
Sbjct  350  SGTVITRLSPTAYSELSSAFQNLMTDYPST-----SGYSIFDTCYDFSKYDTVRIPKVGV  404

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            TF G +E+ +D  G++ P+N G   VCLAF+ +   +D  IFGN QQ+T+ VVYD A G+
Sbjct  405  TFKGGVEMDIDVSGILYPVN-GLKKVCLAFAGNDDDSDTSIFGNVQQRTYQVVYDGAKGR  463

Query  353  LGFASGGCS  379
            +GFA GGCS
Sbjct  464  VGFAPGGCS  472



>ref|XP_002324351.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02916.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=472

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY+ L  AF+  MT YP           +FDTCYDF+ Y    IP +  
Sbjct  350  SGTVITRLSPTAYSELSSAFQNLMTDYPST-----SGYSIFDTCYDFSKYDTVRIPKVGV  404

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            TF G +E+ +D  G++ P+N G   VCLAF+ +   +D  IFGN QQ+T+ VVYD A G+
Sbjct  405  TFKGGVEMDIDVSGILYPVN-GLKKVCLAFAGNDDDSDTSIFGNVQQRTYQVVYDGAKGR  463

Query  353  LGFASGGCS  379
            +GFA GGCS
Sbjct  464  VGFAPGGCS  472



>ref|XP_011036735.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=469

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY+ L  AF+  MT YP           +FDTCYDF+ Y    IP +  
Sbjct  347  SGTVITRLSPTAYSELSSAFQNLMTDYPST-----SGYSIFDTCYDFSKYDTVRIPKVGV  401

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            TF G +E+ +D  G++ P+N G   VCLAF+ +   +D  IFGN QQ+T+ VVYD A G+
Sbjct  402  TFKGGVEMDIDVSGILYPVN-GLKRVCLAFAGNEDDSDTSIFGNVQQRTYQVVYDGAKGR  460

Query  353  LGFASGGCS  379
            +GFA GGCS
Sbjct  461  VGFAPGGCS  469



>ref|XP_010422811.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=467

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  +   FK+ M+ Y     +    + + DTCYDFT     TIP I+F
Sbjct  348  SGTVITRLPTKVYAEMSSVFKEKMSSY-----KTTSGRSILDTCYDFTGLATVTIPTIAF  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG-GIFGNYQQQTFDVVYDVAGGQLG  358
            TF G   V LD  G++  +    S VCLAF+   D   IFGN QQ T ++VYDVAGG++G
Sbjct  403  TFSGGTVVKLDGIGILYQITQ--SQVCLAFAGDDDILAIFGNVQQTTLEIVYDVAGGRVG  460

Query  359  FASGGCS  379
            FA  GCS
Sbjct  461  FAPNGCS  467



>ref|XP_003532147.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=482

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF+Q M  YP          +L DTCYDF+ Y   ++P I F
Sbjct  361  SGTVITRLPPTAYAALRSAFRQFMMKYPVAYG-----TRLLDTCYDFSGYKEISVPRIDF  415

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G ++V L   G++         +CLAF+ + +G    IFGN QQ+T +VVYDV GG+
Sbjct  416  EFAGGVKVELPLVGIL--YGESAQQLCLAFAANGNGNDITIFGNVQQKTLEVVYDVEGGR  473

Query  353  LGFASGGCS  379
            +GF + GC+
Sbjct  474  IGFGAAGCN  482



>ref|XP_010491756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=417

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +       FDTCYDFT     TIP I+F
Sbjct  297  SGTVITRLPTKVYAELRSVFKEKMSSY-----KATSGNGYFDTCYDFTGLDTITIPKIAF  351

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQL  355
             F G   V L   G++ PL    S VCLAF+   +    IFGN QQ+T ++VYDVAGG++
Sbjct  352  FFAGGTVVDLPGIGILYPLTR--SQVCLAFAGDNEHIPAIFGNVQQKTMEIVYDVAGGRV  409

Query  356  GFASGGCS  379
            GFA  GCS
Sbjct  410  GFAPNGCS  417



>ref|XP_007223364.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
 gb|EMJ24563.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
Length=451

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  Y   +        L DTCY+ + Y   + PDI+F
Sbjct  330  SGTVITRLPATAYTALRDAFREGMKNYTMTMS-----FSLLDTCYNVSGYETVSFPDIAF  384

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V LD  G++  +++  S VCLAF+ + D    GI GN QQ+  +VVYDVAGG+
Sbjct  385  GFGDGVTVDLDAAGILLAVSD--SQVCLAFAGNKDDSDIGIIGNVQQKRLEVVYDVAGGK  442

Query  353  LGFASGGC  376
            +GFA   C
Sbjct  443  VGFAPASC  450



>ref|XP_006289171.1| hypothetical protein CARUB_v10002609mg [Capsella rubella]
 gb|EOA22069.1| hypothetical protein CARUB_v10002609mg [Capsella rubella]
Length=465

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL+ AFK+ M+ Y         L    DTCYDFT   +  IP I+F
Sbjct  346  SGTVITRLPQKAYAALKSAFKEKMSTYKITSSGDGSL----DTCYDFTGLESVKIPRITF  401

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGGIFGNYQQQTFDVVYDVAGGQLGF  361
            TF G   V LDP+G++   +   S VCLAF+      IFG+ QQQT  VVYDVA  ++GF
Sbjct  402  TFKGGNVVELDPKGIL--YSQSRSKVCLAFAGDDLAFIFGSIQQQTLQVVYDVAARRVGF  459

Query  362  ASGGCS  379
            A  GC+
Sbjct  460  APQGCA  465



>ref|XP_010424699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=282

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  161  SGTVITRLPPKAYAALRSEFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  215

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  216  SFSGGAVVELGSKGLFYAFKM--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  273

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  274  VGFAPNGCS  282



>ref|XP_010491755.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
Length=468

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +       FDTCYDFT     TIP I+F
Sbjct  348  SGTVITRLPTKVYAELRSVFKEKMSSY-----KATSGNGYFDTCYDFTGLDTITIPKIAF  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQL  355
             F G   V L   G++ PL    S VCLAF+   +    IFGN QQ+T ++VYDVAGG++
Sbjct  403  FFAGGTVVDLPGIGILYPLTR--SQVCLAFAGDNEHIPAIFGNVQQKTMEIVYDVAGGRV  460

Query  356  GFASGGCS  379
            GFA  GCS
Sbjct  461  GFAPNGCS  468



>ref|XP_010491757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Camelina sativa]
Length=469

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  Y  LR  FK+ M+ Y     +       FDTCYDFT     TIP I+F
Sbjct  349  SGTVITRLPTKVYAELRSVFKEKMSSY-----KATSGNGYFDTCYDFTGLDTITIPKIAF  403

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQL  355
             F G   V L   G++ PL    S VCLAF+   +    IFGN QQ+T ++VYDVAGG++
Sbjct  404  FFAGGTVVDLPGIGILYPLTR--SQVCLAFAGDNEHIPAIFGNVQQKTMEIVYDVAGGRV  461

Query  356  GFASGGCS  379
            GFA  GCS
Sbjct  462  GFAPNGCS  469



>ref|XP_002309515.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93038.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=473

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 80/128 (63%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY+AL  AF++ MT YP           +FDTCYDF+      IP +  
Sbjct  351  SGTVITRLPSTAYSALSSAFQKLMTDYPST-----DGYSIFDTCYDFSKNETIKIPKVGV  405

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G +E+ +D  G++ P+ NG   VCLAF+ + D     IFGN QQ+T+ VVYD A G+
Sbjct  406  SFKGGVEMDIDVSGILYPV-NGLKKVCLAFAGNGDDVKAAIFGNTQQKTYQVVYDDAKGR  464

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  465  VGFAPSGC  472



>ref|XP_006287637.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
 gb|EOA20535.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
Length=481

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  360  SGTVITRLPPKAYAALRSSFKAQMSKYPTA-----SGVSILDTCFDLSGFKTVTIPKVAF  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  415  SFSGGAVVELGSKGIFYAFKI--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  472

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  473  VGFAPNGCS  481



>ref|XP_008379455.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=510

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 7/127 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTI--PDI  175
            SGTVITRLP  AYTA+RDAF++ M  Y E       ++ + DTCYD   Y   T+  P +
Sbjct  389  SGTVITRLPAVAYTAMRDAFREGMKSYGE----PKTVEGVLDTCYDLRAYNLDTVSFPAV  444

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGGIFGNYQQQTFDVVYDVAGGQL  355
            +FTF G L + L   G +  + +  S VCLAF  + + GI GN+QQ+ F+VVYDVAGG++
Sbjct  445  AFTFSGGLTLELKVGGTVVVIVDT-SQVCLAFLPTPEEGIIGNFQQKGFEVVYDVAGGKI  503

Query  356  GFASGGC  376
            GFA+G C
Sbjct  504  GFATGSC  510



>ref|XP_008777074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=437

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALR  F+QHMT Y    L QP +  + DTCY+FT Y + TIP +  
Sbjct  316  SGTVITRLPMQAYTALRSEFRQHMTKYQ---LVQPFV--ILDTCYNFTGYNHITIPAVVL  370

Query  182  TFGGNLEVHLDPRGVM--APLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAG  346
             F   + +++D  G++  A L    S  CLAF+ + D     I GN QQ+TF+VVYDV  
Sbjct  371  QFSNGVSLYVDASGILYFASL----SQACLAFAGNDDENAVSIVGNMQQRTFNVVYDVPN  426

Query  347  GQLGFASGGC  376
            G++GF SGGC
Sbjct  427  GRIGFGSGGC  436



>ref|XP_003530761.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=485

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY ALR AF+Q M  YP           LFDTCYDF+ Y   ++P I F
Sbjct  364  SGTVITRLAPTAYAALRSAFRQGMEKYPVA-----NEDGLFDTCYDFSGYKEISVPKIDF  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + V L   G++  +      VCLAF+ +    D  IFGN QQ+T +VVYDV GG+
Sbjct  419  EFAGGVTVELPLVGIL--IGRSAQQVCLAFAANGNDNDITIFGNVQQKTLEVVYDVEGGR  476

Query  353  LGFASGGCS  379
            +GF + GC+
Sbjct  477  IGFGAAGCN  485



>ref|XP_008379443.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=488

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 74/128 (58%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y ALR AF++ M  YP    +      L DTCYDF+     + P I F
Sbjct  366  SGTVITRLPATPYAALRVAFRKAMEKYPFAKSKSA----LLDTCYDFSGLKTVSYPKIGF  421

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG + V LD  G++      GS  CLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  422  VFGGGVTVDLDATGIL--FQTSGSQFCLAFAGNKDDNSVGIIGNVQQKRLQVVYDVAGGR  479

Query  353  LGFASGGC  376
            +GF S GC
Sbjct  480  IGFGSAGC  487



>ref|XP_002873476.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49735.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  354  SGTVITRLPPKAYAALRSSFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  409  SFSGGAVVELGSKGIFYAFKI--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  466

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  467  VGFAPNGCS  475



>emb|CDX69805.1| BnaA10g21540D [Brassica napus]
Length=570

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK+ M+ Y   +       +L DTCYDFT      IP +SF
Sbjct  330  SGTVITRLPPKAYAALRTAFKKKMSNYKTTLGS-----RLLDTCYDFTGQETVDIPKVSF  384

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G++   +   S VCLAF+ +++ G   IFGN QQ+T  VVYD AGG+
Sbjct  385  SFKGGTVVELHSKGILFAYD--VSQVCLAFAKNSNVGNVAIFGNVQQKTLQVVYDGAGGR  442

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  443  VGFAPNGC  450



>ref|XP_010453111.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=477

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  356  SGTVITRLPPKAYAALRSEFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  411  SFSGGAVVELGSKGIFYAFKM--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  468

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  469  VGFAPNGCS  477



>emb|CAB96832.1| nucleoid DNA-binding protein cnd41-like protein [Arabidopsis 
thaliana]
Length=446

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  325  SGTVITRLPPKAYAALRSSFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  379

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  380  SFSGGAVVELGSKGIFYVFKI--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  437

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  438  VGFAPNGCS  446



>ref|XP_010491758.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010491759.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=494

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  373  SGTVITRLPPKAYAALRSEFKAKMSKYPTA-----SGVSILDTCFDLSGFKTVTIPKVAF  427

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  428  SFSGGAVVELGSKGIFYAFKM--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  485

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  486  VGFAPNGCS  494



>emb|CDX97061.1| BnaC09g45640D [Brassica napus]
Length=152

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV++RLP  AY ALR AF   M+ YP           + DTC+DFT +   T+P +SF
Sbjct  31   SGTVVSRLPPKAYAALRSAFVAEMSQYPTAAG-----FLILDTCFDFTGFETVTLPRVSF  85

Query  182  TFGGNLEVHLDPRGVM-APLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGG  349
            TF G + V L+P G++ +P     S  CLAF+ + D G   IFG+ QQQT +VVYD  GG
Sbjct  86   TFSGGVVVDLEPTGILYSPTT---SYYCLAFAGNDDDGKAAIFGSAQQQTLEVVYDGVGG  142

Query  350  QLGFASGGCS  379
            ++GFA  GC+
Sbjct  143  RVGFAPNGCN  152



>emb|CDX97055.1| BnaC09g45700D [Brassica napus]
Length=419

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT ITRLP  AY ALR AFK+ M+ Y   +   P     FDTCYDFT     +IP ISF
Sbjct  294  SGTTITRLPPVAYAALRTAFKEKMSNYKTTLGPPP-----FDTCYDFTGLRTMSIPKISF  348

Query  182  TFGGNLEVHLDPRGV--MAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAG  346
            +F G   V LD +GV  M  ++ G S  CL F   +Y+ +  +FG+ QQ+T ++VYDV  
Sbjct  349  SFDGGTVVDLDSKGVLYMYGMSKGMSKGCLGFAGNTYNNNVAVFGSLQQKTLEIVYDVPS  408

Query  347  GQLGFASGGC  376
            G+LGFA  GC
Sbjct  409  GRLGFAPNGC  418



>ref|NP_196638.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAL77663.1| AT5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AAN46758.1| At5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AED91594.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=474

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  353  SGTVITRLPPKAYAALRSSFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  407

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  408  SFSGGAVVELGSKGIFYVFKI--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  465

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  466  VGFAPNGCS  474



>ref|XP_010050793.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=469

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +T LP  AYTAL+ AF++ M  Y       P     FDTCYDF+ +   T+P I+F
Sbjct  348  SGTTLTSLPPTAYTALQSAFQKAMANYTSAPPIYP-----FDTCYDFSMFSTITVPVITF  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G + V+LD  G+   +N   S VCLAF   +  TDG I+GN QQ+TF+V+YDV GGQ
Sbjct  403  SFDGPINVNLDWSGMFYWVN--ASEVCLAFVANNADTDGVIYGNTQQRTFEVIYDVPGGQ  460

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  461  IGFGAQGCS  469



>gb|KCW80527.1| hypothetical protein EUGRSUZ_C01881, partial [Eucalyptus grandis]
Length=413

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +T LP  AYTAL+ AF++ M  Y       P     FDTCYDF+ +   T+P I+F
Sbjct  292  SGTTLTSLPPTAYTALQSAFQKAMANYTSAPPIYP-----FDTCYDFSMFSTITVPVITF  346

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G + V+LD  G+   +N   S VCLAF   +  TDG I+GN QQ+TF+V+YDV GGQ
Sbjct  347  SFDGPINVNLDWSGMFYWVN--ASEVCLAFVANNADTDGVIYGNTQQRTFEVIYDVPGGQ  404

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  405  IGFGAQGCS  413



>ref|XP_009122022.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=493

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AFK  M+ Y     +      + DTCYD T     TIP +SF
Sbjct  372  SGTVISRLPPKAYAALRGAFKAKMSQY-----KNTSAVSILDTCYDLTGLKTVTIPTVSF  426

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L  +GV+       S VCLAF+ ++D     IFGN QQQT +VVYD A G+
Sbjct  427  YFNGGAVVQLGSKGVLYAFKM--SQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAAGR  484

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  485  VGFAPNGCS  493



>ref|XP_010422809.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=494

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  FK  M+ YP           + DTC+D + +   TIP ++F
Sbjct  373  SGTVITRLPPKAYAALRSEFKAKMSKYPTT-----SGVSILDTCFDLSGFKTVTIPKVAF  427

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L  +G+        S VCLAF+ ++D     IFGN QQQT +VVYD AGG+
Sbjct  428  SFSGGAVVELGSKGLFYAFKM--SQVCLAFAGNSDDSNAAIFGNVQQQTLEVVYDGAGGR  485

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  486  VGFAPNGCS  494



>gb|KDO67374.1| hypothetical protein CISIN_1g011556mg [Citrus sinensis]
Length=483

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR  FK+ M+ YP      P L  + DTCYDF+NY + ++P ISF
Sbjct  362  SGTVITRLPPAAYSALRSTFKKFMSKYPTA----PAL-SILDTCYDFSNYTSISVPVISF  416

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F   +EV ++   ++  + +    +CLAF   S  +D  I GN QQ+T +VVYDVA  +
Sbjct  417  FFNRGVEVSIEGSAIL--IGSSPKQICLAFAGNSDDSDVAIIGNVQQKTLEVVYDVAQRR  474

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  475  VGFAPKGCS  483



>ref|XP_006483510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=483

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR  FK+ M+ YP      P L  + DTCYDF+NY + ++P ISF
Sbjct  362  SGTVITRLPPAAYSALRSTFKKFMSKYPTA----PAL-SILDTCYDFSNYTSISVPVISF  416

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F   +EV ++   ++  + +    +CLAF   S  +D  I GN QQ+T +VVYDVA  +
Sbjct  417  FFNRGVEVSIEGSAIL--IGSSPKQICLAFAGNSDDSDVAIIGNVQQKTLEVVYDVAQRR  474

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  475  VGFAPKGCS  483



>ref|XP_011082009.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=490

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 10/117 (9%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AF+Q M  YP           + DTCYDF+NY   TIP ISF
Sbjct  369  SGTVITRLPPDAYSALSTAFQQQMKKYPSA-----PAYSILDTCYDFSNYTTLTIPTISF  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVA  343
            TFGGN++V L+  G +  +++  +  CLAF+ +    D GIFGN QQQ  +VVYDVA
Sbjct  424  TFGGNVKVDLEATGTLVAVSS--TQACLAFAGNGDDADVGIFGNIQQQKLEVVYDVA  478



>ref|XP_007225640.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
 gb|EMJ26839.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
Length=492

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY++L+ AF+Q M  YP       Q   + DTCYDF+++   + P ISF
Sbjct  371  SGTVITRLPPTAYSSLKAAFRQRMKSYPLT-----QELSILDTCYDFSSFKTVSYPKISF  425

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G L   LD  G++   +     VCLAF+ +   +D GIFGN QQ+   VVYD+AGG+
Sbjct  426  VFDGGLTQDLDATGILYVAS--ADQVCLAFAGNGDDSDIGIFGNVQQKRLQVVYDIAGGK  483

Query  353  LGFASGGC  376
            +GFA   C
Sbjct  484  VGFAPAAC  491



>emb|CDX97058.1| BnaC09g45670D [Brassica napus]
Length=491

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AFK  M+ Y     +      + DTC+D T +   TIP +SF
Sbjct  370  SGTVISRLPPKAYAALRGAFKAKMSQY-----KNASGVSILDTCFDLTGFKTVTIPTVSF  424

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L  +GV+       S VCLAF+ ++D     IFGN QQQT +VVYD A G+
Sbjct  425  YFNGGAVVELGSKGVLYAFKM--SKVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAAGR  482

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  483  VGFAPNGCS  491



>emb|CDX97054.1| BnaC09g45710D [Brassica napus]
Length=473

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK+ M+ Y   +      + + DTCYDFT      IP +SF
Sbjct  352  SGTVITRLPPMAYAALRTAFKEKMSNYKTTLG-----RSILDTCYDFTGQETMNIPKVSF  406

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V LD  GV+   N   S VCLAF   S   D  IFGN QQ+T  VVYD  GG+
Sbjct  407  SFKGGTVVELDSIGVLYVFNK--STVCLAFAGNSNDDDVTIFGNVQQKTMQVVYDGPGGR  464

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  465  VGFAPNGC  472



>ref|XP_008220631.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Prunus mume]
Length=501

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 79/130 (61%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF+Q M  YP       Q   + DTCYDF+++   + P ISF
Sbjct  380  SGTVITRLPPTAYSALKAAFRQRMKSYPLT-----QALSILDTCYDFSSFKTVSYPKISF  434

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSA--VCLAFSYS---TDGGIFGNYQQQTFDVVYDVAG  346
             F   L   LD  G++      GSA  VCLAF+ +   +D GIFGN QQ+   VVYD+AG
Sbjct  435  VFDDGLTQELDATGILYV----GSADQVCLAFAGNGDDSDIGIFGNVQQKRLQVVYDIAG  490

Query  347  GQLGFASGGC  376
            G++GFA   C
Sbjct  491  GKVGFAPAAC  500



>ref|XP_008783095.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=379

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY++LR AF++ M+ Y     +  Q   + DTCYD T Y    IP ++ 
Sbjct  259  SGTVITRLPPVAYSSLRSAFRRLMSCY-----RSAQALSILDTCYDLTGYSKVRIPKVAL  313

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG +  +LD  G++   N   S  CLAF+ ++D    GI GN QQ+ F+VVYDVA   
Sbjct  314  QFGGGIATNLDTSGILYLAN--ASQACLAFAGNSDAGDSGIIGNMQQKKFNVVYDVANKA  371

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  372  IGFGPNGC  379



>ref|XP_008220627.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=502

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  LR AF++ M  Y   +        L DTCYDF+     + P I+F
Sbjct  381  SGTVITRLPATAYAVLRGAFQEAMKNYTLTMGYS-----LLDTCYDFSGLDTVSYPKIAF  435

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FG  L V LD  G++ P++   S VCLAF+ +   +D GI GN+QQ+  +VVYDVAGG+
Sbjct  436  VFGDGLTVDLDATGILIPISP--SQVCLAFAGNKDDSDVGIIGNFQQRRLEVVYDVAGGK  493

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  494  VGFAPEGC  501



>ref|XP_007224453.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
 gb|EMJ25652.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
Length=418

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALRDAF++ M  Y    +  P    L DTCY+F+     + PDI+F
Sbjct  297  SGTVITRLPATAYTALRDAFREGMKNY---TMTMP--FSLLDTCYNFSGNETVSFPDIAF  351

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYST---DGGIFGNYQQQTFDVVYDVAGGQ  352
             F   + V LD  G++  +++  S VCLAF+ +    D GI GN QQ+  +VVYDVAGG+
Sbjct  352  GFADGVTVDLDAAGILLAVSD--SQVCLAFAGNKNDRDFGIIGNVQQKRLEVVYDVAGGK  409

Query  353  LGFASGGC  376
            +GFA   C
Sbjct  410  VGFAPASC  417



>ref|XP_007226285.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
 gb|EMJ27484.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
Length=454

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 76/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  LR AF++ M  Y            L DTCYDF+     + P I+F
Sbjct  333  SGTVITRLPATAYAVLRGAFREAMKNYTLT-----NGDSLLDTCYDFSGLNTVSYPKIAF  387

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  L V LD  G++ P++   S VCLAF+ + D    GI GN QQ+  +VVYDVAGG+
Sbjct  388  VFGDGLTVDLDATGILFPISP--SHVCLAFAGNKDDRDVGIIGNLQQKRLEVVYDVAGGK  445

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  446  VGFAPAGC  453



>gb|KGN55408.1| hypothetical protein Csa_4G651750 [Cucumis sativus]
Length=389

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF++ M  YP+     P+L  + DTCYD + Y    IP + F
Sbjct  269  SGTVITRLPPDAYSALKSAFEKGMAKYPKA----PELS-ILDTCYDLSKYSTIQIPKVGF  323

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
             F G  E+ LD  G+M   +   S VCLAF+ + D     I GN QQ+T  VVYDV GG+
Sbjct  324  VFKGGEELDLDGIGIMYGAST--SQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDVGGGK  381

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  382  IGFGYNGC  389



>ref|XP_004297874.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 76/128 (59%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  A++ALRDAF+  MT YP V    P      DTCYD    P  T P I F
Sbjct  135  SGTVISRLPPTAFSALRDAFQAAMTSYPSV----PG-DGFLDTCYDLNCNPTVTYPKIEF  189

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             FG  + + LD  G++  L+     VCLAF  + D     IFGN QQ+  +V+YDVAG +
Sbjct  190  VFGDGVTLTLDATGIVYLLDGTMKQVCLAFVGNDDADELTIFGNTQQKNMEVLYDVAGER  249

Query  353  LGFASGGC  376
            +GFA GGC
Sbjct  250  VGFAPGGC  257



>gb|KHG03216.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=480

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ LR AF++ M  YP       +   + DTCYDF+ Y   +IP IS 
Sbjct  359  SGTVITRLPPTAYSVLRSAFRKQMNHYP-----MAKSLSILDTCYDFSKYSTVSIPKISL  413

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYST---DGGIFGNYQQQTFDVVYDVAGGQ  352
             F  ++EV +D RG++    N  S VCLAF+ ++   D  I+GN QQ+T +VVYD     
Sbjct  414  FFEKDVEVPIDARGIL--YVNSISQVCLAFAGNSNDFDVLIYGNTQQKTLEVVYDGTRRM  471

Query  353  LGFASGGCS  379
            LGF +GGC+
Sbjct  472  LGFRTGGCT  480



>gb|KCW44809.1| hypothetical protein EUGRSUZ_L01628 [Eucalyptus grandis]
Length=419

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y            LFDTCYDF+      IP I+F
Sbjct  298  SGTVITRLPPTAYSALRTTVRKAMANYTTA-----PAASLFDTCYDFSKESTVVIPSITF  352

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LDP G+        S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  353  SFAEGVNIDLDPSGIF--YVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVAGRK  410

Query  353  LGFASGGCS  379
            LGF+  GCS
Sbjct  411  LGFSPNGCS  419



>ref|XP_002452641.1| hypothetical protein SORBIDRAFT_04g029670 [Sorghum bicolor]
 gb|EES05617.1| hypothetical protein SORBIDRAFT_04g029670 [Sorghum bicolor]
Length=466

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 12/128 (9%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  348  SGTVITRLPPTAYSALSSAFKAGMKKYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+LD  G+M  L+N     CLAF+ ++D    G  GN QQ+TF+V+YDV GG 
Sbjct  403  VFSGGAVVNLDFNGIMLELDN----WCLAFAANSDDSSLGFIGNVQQRTFEVLYDVGGGA  458

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  459  VGFRAGAC  466



>ref|XP_007223563.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
 gb|EMJ24762.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
Length=432

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY AL+ AF+Q M  YP       Q   + DTCY+ +++   + P ISF
Sbjct  311  SGTLITRLPPTAYNALKAAFRQRMKSYPLT-----QAVSILDTCYNLSSFKTVSYPKISF  365

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G L   LD  G++  ++     VCLAF+ + D    GI GN QQ+   VVYDVAGG+
Sbjct  366  VFDGGLTQELDATGILYGVS--ADQVCLAFAGNMDDSEVGIIGNVQQRRLKVVYDVAGGK  423

Query  353  LGFASGGCS  379
            +GFA  GC+
Sbjct  424  VGFAPAGCA  432



>ref|XP_004150866.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004157102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=473

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF++ M  YP+     P+L  + DTCYD + Y    IP + F
Sbjct  353  SGTVITRLPPDAYSALKSAFEKGMAKYPKA----PELS-ILDTCYDLSKYSTIQIPKVGF  407

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G  E+ LD  G+M   +   S VCLAF+ + D     I GN QQ+T  VVYDV GG+
Sbjct  408  VFKGGEELDLDGIGIMYGAST--SQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDVGGGK  465

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  466  IGFGYNGC  473



>gb|KEH33910.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=467

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y +LR+AF++ M  YP           + DTCYD     N  +P ISF
Sbjct  346  SGTVITRLPPSTYASLRNAFRKEMAKYPAA-----SGFSILDTCYDLRGRNNVVVPKISF  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             FGG + V L   GV+  +++    VCLAF+ + D     IFGN QQ+T +VVYDV GG+
Sbjct  401  VFGGGVTVELGAHGVLFTVSS--RQVCLAFAANRDDSDITIFGNVQQRTLEVVYDVGGGK  458

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  459  IGFGPNGC  466



>ref|XP_010913305.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=636

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+  Y+ALRD F++ M  Y       P L  +FDTCY+FT   + ++P +  
Sbjct  515  SGTVITRLPSSGYSALRDEFRRQMANYS----MAPPLS-IFDTCYNFTGVVSVSLPPVGL  569

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G + + +DP G++  ++   S  CLAF+ + D G   I GN QQ+T+D+VYDVA G 
Sbjct  570  LFSGGVTLDVDPSGILYVVSM--SQACLAFAANDDPGSISIIGNVQQRTYDIVYDVARGM  627

Query  353  LGFASGGCS  379
            +GF +GGCS
Sbjct  628  IGFGAGGCS  636


 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 74/132 (56%), Gaps = 16/132 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLPT  YTALR  F+QHM+ Y     Q  Q   + DTCY+FT Y   TIP ++ 
Sbjct  105  SGTVITRLPTETYTALRSEFRQHMSSY-----QLVQPYDILDTCYNFTGYSRITIPAVAL  159

Query  182  TFGGNLEVHLDPRGVM---APLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVA  343
             F   + +++D  G++   +P     S  CLAF+   D     I GN  Q+TF VVYDV 
Sbjct  160  QFSNGVSLNVDASGILYFASP-----SQACLAFAGKDDENFVSIVGNMLQRTFHVVYDVP  214

Query  344  GGQLGFASGGCS  379
             G +GF S   S
Sbjct  215  NGMIGFGSRASS  226



>ref|XP_010913225.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=463

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  F+Q MTMY    +  PQ   + DTCYDFT     ++P ++ 
Sbjct  342  SGTVITRLPPSAYAALRSRFRQLMTMYK---MAPPQ--SILDTCYDFTGNDTVSVPTVAL  396

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG   +++D  G++   N   S  CLAF+    ++D GI GN QQ+ FDVVYD+   +
Sbjct  397  VFGGGATLNVDFTGILYVFNM--SQACLAFAGNDDASDVGIIGNVQQKRFDVVYDITNSR  454

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  455  IGFGANGCS  463



>ref|XP_010040897.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y            LFDTCYDF+      IP I+F
Sbjct  355  SGTVITRLPPTAYSALRTTVRKAMANYTTA-----PAASLFDTCYDFSKESTVVIPSITF  409

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LDP G+    +   S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  410  SFAEGVNIDLDPSGIFYVED--ASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVAGRK  467

Query  353  LGFASGGCS  379
            LGF+  GCS
Sbjct  468  LGFSPNGCS  476



>ref|XP_009411894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=452

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+Q M+ Y     +      + DTCYDFT +   +IP ++ 
Sbjct  332  SGTVITRLPPTAYSALRSAFRQAMSSY-----KTASALSILDTCYDFTGHSTVSIPTVAL  386

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG + + LD  G +       S VCLAF+ +   +D GI GN QQ+TF+VVYDV+  +
Sbjct  387  QFGGGVTMELDLSGTL--YVGSQSQVCLAFAANGDDSDVGILGNVQQKTFNVVYDVSKKK  444

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  445  IGFGPGAC  452



>ref|XP_008777073.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=445

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ +Y+ALRD F++ M  Y       P L  +FDTCY+FT   + ++P +  
Sbjct  324  SGTVITRLPSSSYSALRDEFRRQMANYS----MAPPLS-IFDTCYNFTGVGSISLPSVGL  378

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G + + +DP G++   +   S  CLAF+ ++D     I GN QQ+T+D+VYDVA G 
Sbjct  379  RFSGGVTLDVDPSGILYIASI--SQACLAFAGNSDPSSISIIGNMQQRTYDIVYDVARGL  436

Query  353  LGFASGGCS  379
            +GF +GGCS
Sbjct  437  IGFGAGGCS  445



>ref|XP_010065985.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63734.1| hypothetical protein EUGRSUZ_G01380 [Eucalyptus grandis]
Length=419

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y       P +  LFDTCYDF+      IP I+F
Sbjct  298  SGTVITRLPPTAYSALRTTVRKAMANYTTA----PAVS-LFDTCYDFSKESTVVIPSITF  352

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LDP G+    +   S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  353  SFAEGVNIDLDPIGIFYVED--ASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVAGRK  410

Query  353  LGFASGGCS  379
            LGF+  GCS
Sbjct  411  LGFSPNGCS  419



>emb|CDX69804.1| BnaA10g21530D [Brassica napus]
Length=476

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AFK  M+ Y     +      + DTC+D T     TIP +SF
Sbjct  355  SGTVISRLPPKAYAALRGAFKAKMSQY-----KNTSGVSILDTCFDLTGLKTVTIPTVSF  409

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L  +GV+       S VCLAF+ ++D     IFGN QQQT +VVYD A G+
Sbjct  410  YFNGGAVVQLGSKGVLYAFKM--SQVCLAFAGNSDDNNAAIFGNVQQQTLEVVYDGAAGR  467

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  468  VGFAPNGCS  476



>gb|KDP33484.1| hypothetical protein JCGZ_07055 [Jatropha curcas]
Length=465

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AFK+ M  YP   +  P    + DTC+DF+     T P I  
Sbjct  344  SGTVITRLPPAAYSALRSAFKKKMAKYP---VAAPL--SILDTCFDFSKTQTITFPKIVL  398

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
            +F G  +V +D  G       G    CLAF+ + D G   I GN QQ+T++V+YD+ GG+
Sbjct  399  SFSGTTDVEVDKTGTF--FATGVDQACLAFAANGDAGDKAILGNTQQRTYEVIYDINGGK  456

Query  353  LGFASGGCS  379
            +GF+  GCS
Sbjct  457  IGFSPAGCS  465



>ref|XP_002324933.2| hypothetical protein POPTR_0018s03000g [Populus trichocarpa]
 gb|EEF03498.2| hypothetical protein POPTR_0018s03000g [Populus trichocarpa]
Length=463

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SG V+TRLP  AY+ALR  F++ M  YP  +L Q       DTCYDF+NY    IP IS 
Sbjct  343  SGAVLTRLPPKAYSALRSVFREMMKGYP--LLDQ---DDFLDTCYDFSNYSTVAIPSISV  397

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG-GIFGNYQQQTFDVVYDVAGGQLG  358
             F G +E+ +D  G+M  +  G    CLAF+   D   IFGN+QQ+T+ VV+D A  ++G
Sbjct  398  FFEGGVEMDIDVSGIMWQV-PGSKVYCLAFAELDDEVSIFGNFQQKTYTVVFDGAKERIG  456

Query  359  FASGGC  376
            FA GGC
Sbjct  457  FAPGGC  462



>ref|XP_007224537.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
 gb|EMJ25736.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
Length=489

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF++ M  Y    L +  L  L DTCYDF+     T P I+F
Sbjct  368  SGTVITRLPATAYAALRGAFREAMKNY---TLTESFL--LLDTCYDFSGLNTVTYPKIAF  422

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  L V  D  G++  ++   S VCLAF+ + D    GI GN QQ+  +VVYDVAGG+
Sbjct  423  MFGDGLTVDSDATGILLLISP--SQVCLAFAGNEDDSDFGIIGNVQQKRLEVVYDVAGGK  480

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  481  VGFAPEGC  488



>gb|KCW63885.1| hypothetical protein EUGRSUZ_G01557 [Eucalyptus grandis]
Length=419

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y       P +  L DTCYDF+      IP I+F
Sbjct  298  SGTVITRLPPTAYSALRTTVRKAMANYTTA----PAVS-LLDTCYDFSKESTVVIPSITF  352

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LDP G+        S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  353  SFAEGVNIDLDPTGIF--YVEDASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVAGRK  410

Query  353  LGFASGGCS  379
            LGF+  GCS
Sbjct  411  LGFSPNGCS  419



>ref|XP_011080092.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=509

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ +   F++ M  Y     +      + DTCYD +     TIP ISF
Sbjct  388  SGTVITRLPPAAYSTMSAEFRKQMVKY-----KTAPAYSILDTCYDLSGLTTITIPTISF  442

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            TFGG+++V L P G++  ++   S VCLAF+    + D  IFGN QQ+T +VVYDV  G 
Sbjct  443  TFGGSVKVDLAPSGILLAVST--SRVCLAFAGNNNADDVAIFGNTQQKTLEVVYDVGRGN  500

Query  353  LGFASGGC  376
            LGF   GC
Sbjct  501  LGFGPAGC  508



>ref|XP_010928895.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=464

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ALR AF+Q M+ Y       P L  + DTCYDF+ Y   +IP ++ 
Sbjct  344  SGTVISRLPPAAYSALRSAFRQLMSRYKSA----PALS-ILDTCYDFSGYSQISIPTVAL  398

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG +   LD  G++   +   S  CLAF   S + D GI GN QQ+ F+VVYDVA   
Sbjct  399  QFGGGITTILDSSGILYVASK--SQACLAFAGNSGAKDVGIIGNVQQRKFNVVYDVAKKA  456

Query  353  LGFASGGC  376
            +GF+  GC
Sbjct  457  IGFSPNGC  464



>ref|XP_009391894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=476

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ALR AF+Q M+ Y     +      L DTCYDFT Y   +IP ++ 
Sbjct  356  SGTVISRLPPTAYSALRSAFRQGMSSY-----KAAAPDSLLDTCYDFTGYTTVSIPTVAL  410

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F   + ++LD  G++  L+   S VCLAF+ ++D G   I GN QQ+TF VVYDV+   
Sbjct  411  EFSDGVTMNLDFGGILYALSQ--SQVCLAFAANSDDGDLGIVGNVQQRTFTVVYDVSKKV  468

Query  353  LGFASGGC  376
            +GF  GGC
Sbjct  469  IGFGPGGC  476



>ref|XP_004295359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=280

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 75/128 (59%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RL   A++ALRDAF+  M  YP V    P      DTCYD + YP  T P I F
Sbjct  158  SGTVISRLSPTAFSALRDAFQVEMKSYPSV----PG-DGFLDTCYDLSGYPTVTYPKIEF  212

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             FG  + + LD  G++   +     VCLAF  + D     IFGN QQ+  +V+YDVAG +
Sbjct  213  AFGDGVMLTLDATGIVYLADGTMKQVCLAFVGNDDADKVTIFGNTQQKNMEVLYDVAGER  272

Query  353  LGFASGGC  376
            +GFA GGC
Sbjct  273  VGFAPGGC  280



>ref|XP_008452815.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=475

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL+ AF++ M  YP+     P+L  + DTCYD + Y    IP +  
Sbjct  355  SGTVITRLPPDAYSALKSAFQKGMARYPKA----PELS-ILDTCYDLSKYSTIQIPKVGI  409

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G  E+ LD  G+M   +   S VCLAF+ + D     I GN QQ+T  VVYDV GG+
Sbjct  410  MFKGQEELDLDGTGIMYGAST--SQVCLAFAGNQDPSTVAIIGNVQQKTLQVVYDVGGGK  467

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  468  IGFGYNGC  475



>ref|XP_010066087.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y       P +  L DTCYDF+      IP I+F
Sbjct  355  SGTVITRLPPTAYSALRTTVRKAMANYTTA----PAVS-LLDTCYDFSKESTVVIPSITF  409

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LDP G+    +   S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  410  SFAEGVNIDLDPTGIFYVED--ASHVCLAFAANGADSDLVIYGNTQQRTFEVVYDVAGRK  467

Query  353  LGFASGGCS  379
            LGF+  GCS
Sbjct  468  LGFSPNGCS  476



>ref|XP_002515388.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46837.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=494

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL   F++ M+ YP      P L  + DTC+DF+N+   ++P I  
Sbjct  373  SGTVITRLPPAAYSALSSTFRKLMSQYPAA----PALS-ILDTCFDFSNHDTISVPKIGL  427

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + V +D  G+     N  + VCLAF   S ++D  IFGN QQ+T +VVYD A G+
Sbjct  428  FFSGGVVVDIDKTGIF--YVNDLTQVCLAFAGNSDASDVAIFGNVQQKTLEVVYDGAAGR  485

Query  353  LGFASGGCS  379
            +GFA  GCS
Sbjct  486  VGFAPAGCS  494



>ref|XP_010928894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+ALR AF+Q M+ Y       P L+ + DTCYDF+ Y   +IP ++ 
Sbjct  339  SGTVISRLPPAAYSALRSAFRQLMSRYKSA----PALE-ILDTCYDFSGYSQVSIPTVAL  393

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG +   LD  G++   +   S  CLAF+ ++D    GI GN QQ+ F+VVYDV+   
Sbjct  394  QFGGGITTILDGSGILYVASQ--SQACLAFAGNSDANDVGIIGNVQQRKFNVVYDVSKKA  451

Query  353  LGFASGGC  376
            +GF+  GC
Sbjct  452  IGFSPNGC  459



>gb|ACF84853.1| unknown [Zea mays]
 gb|ACF85941.1| unknown [Zea mays]
Length=208

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  93   SGTVITRLPPTAYSALSSAFKAGMKQYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  147

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++  L+N     CLAF+ ++D    GI GN QQ+TF+V+YDV  G 
Sbjct  148  VFSGGAVVSLDASGII--LSN-----CLAFAGNSDDSSLGIIGNVQQRTFEVLYDVGRGV  200

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  201  VGFRAGAC  208



>emb|CDY70207.1| BnaA10g30140D [Brassica napus]
Length=472

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AFK+ M+ Y       P      DTCYDFT   +  +P +SF
Sbjct  351  SGTVITRLPPKAYAALRTAFKEKMSNYTAAAGLPP-----LDTCYDFTGVESIDVPKVSF  405

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G   V L+P GV+   +   S VCLAF       D  I GN QQ+T  VVYD  GG+
Sbjct  406  SFKGGTVVELEPIGVLFVADR--SQVCLAFIANDKDDDVAILGNVQQKTLQVVYDGPGGR  463

Query  353  LGFASGGCS  379
            +GFA  GC+
Sbjct  464  VGFAPNGCN  472



>gb|KEH33912.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=486

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 78/130 (60%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY +LRD+FK+ MT YP      P +  + DTCYD + Y   +IP ISF
Sbjct  365  SGTVITRLPPTAYASLRDSFKKGMTKYPVA----PAVS-ILDTCYDLSGYKIVSIPKISF  419

Query  182  TFGGNLEVHLDPRGVM--APLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAG  346
              GG + V +   G++  A L       CLAF+ + D     IFGN QQ+T +VVYDV G
Sbjct  420  FLGGGVTVEIAAPGILYVASLKQA----CLAFAPNGDDSDITIFGNVQQRTLEVVYDVGG  475

Query  347  GQLGFASGGC  376
            G++GF   GC
Sbjct  476  GKIGFGPNGC  485



>ref|XP_010108295.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18775.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=433

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 11/131 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPT--IPDI  175
            SGTVI+RLP   Y ALR  F++ M+ YP V        +L DTCYDF+   N T  IP+I
Sbjct  309  SGTVISRLPPAVYDALRTEFRKDMSRYPLV-----SGDRLLDTCYDFSGSANGTVEIPNI  363

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAG  346
            +F FGG   V L P   +  ++N     CLAF+      D  IFGN QQ TF VVYDV  
Sbjct  364  TFLFGGGTSVDLGPENTLFGVSNP-QRFCLAFAGNDKDDDIAIFGNVQQLTFQVVYDVGA  422

Query  347  GQLGFASGGCS  379
             +LGFA GGC+
Sbjct  423  ARLGFAPGGCN  433



>ref|XP_008220626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Prunus 
mume]
Length=485

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALRDAF++ M  Y     +      L DTCY+ + Y   + P I+F
Sbjct  364  SGTVITRLPATAYRALRDAFREGMKNY-----KMTMSFSLLDTCYNISGYKTVSYPGIAF  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  + V LDP G++  +++  S  CLAF+   D    GI GN QQ+  +VVYDVAG +
Sbjct  419  RFGDGVTVDLDPAGILYMVSS--SQACLAFAGHKDDTGLGIIGNVQQKRLEVVYDVAGEK  476

Query  353  LGFASGGC  376
            +GFA   C
Sbjct  477  VGFAPASC  484



>ref|XP_002324355.2| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02920.2| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=477

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 78/130 (60%), Gaps = 11/130 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPT--IPDI  175
            SGT  T LP+P Y+AL  AF++ M  Y             F  CYDF+N  N T  IP I
Sbjct  354  SGTTFTFLPSPTYSALGSAFREMMANY-----TLTNGTSSFQPCYDFSNIGNGTLTIPGI  408

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAG  346
            S  F G +EV +D  G+M P+N G   VCLAF+ +   +D  IFGNYQQ+T++V+YDVA 
Sbjct  409  SIFFEGGVEVEIDVSGIMIPVN-GLKEVCLAFADTGSDSDFAIFGNYQQKTYEVIYDVAK  467

Query  347  GQLGFASGGC  376
            G +GFA  GC
Sbjct  468  GMVGFAPKGC  477



>gb|EMS67344.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=424

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP   L QP    +FDTC+DF+   + +IP +  
Sbjct  309  SGTIITRLPATAYSALSSAFKAGMKQYP---LAQPM--GIFDTCFDFSGQSSVSIPTVVL  363

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+L   G++          CLAF+ + D    GI GN QQ+TF+V+YDV GG 
Sbjct  364  VFSGGAAVNLASDGIIL-------GSCLAFAANNDDRPLGIIGNVQQRTFEVLYDVGGGA  416

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  417  VGFKAGAC  424



>ref|XP_009122891.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=416

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV++RLP  AY ALR AF   M+ YP           + DTC+DFT Y   T+P +SF
Sbjct  295  SGTVVSRLPPKAYAALRSAFVAGMSQYPTAAG-----FLILDTCFDFTGYERVTLPRVSF  349

Query  182  TFGGNLEVHLDPRGVM-APLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGG  349
            TF G + V L   G++ +P     S  CLAF+ + D G   IFGN QQQT +VVYD AGG
Sbjct  350  TFSGGVVVDLGLPGILYSPTT---SYYCLAFAGNDDDGKAAIFGNVQQQTLEVVYDGAGG  406

Query  350  QLGFASGGC  376
            ++GFA  GC
Sbjct  407  RVGFAPNGC  415



>ref|XP_008779510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=250

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY AL+ AF++ MT Y  V    P L  + DTCYDFT Y    +P ++ 
Sbjct  129  SGTVISRLPPSAYAALQSAFRKQMTRYKMV----PALS-ILDTCYDFTGYDTVWVPTVAL  183

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG   +++D  G++   N   S  CLAF+ + D    GI GN QQ+ F+VVYD+A  +
Sbjct  184  MFGGGTTLNVDFSGILYVPNV--SQACLAFAPNGDAKDFGIIGNAQQKRFNVVYDIANRR  241

Query  353  LGFASGGCS  379
            +GF + GC+
Sbjct  242  IGFGANGCN  250



>ref|XP_010050792.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=382

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT  T LP  AYTAL+ AFK+ M  Y       P      DTCYDF+   + T+P I+F
Sbjct  261  SGTTFTYLPPTAYTALQSAFKEAMANYTSAPPALP-----LDTCYDFSMLSDITVPAITF  315

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G + V LD  G+   L+   S VCLAF   +  TD  I+GN QQ+TF+V+YDV GGQ
Sbjct  316  SFDGPINVDLDVSGMFYVLDP--SLVCLAFVANNADTDTVIYGNTQQRTFEVIYDVPGGQ  373

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  374  IGFGAQGCS  382



>gb|KFK25358.1| hypothetical protein AALP_AA8G103000 [Arabis alpina]
Length=469

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 80/132 (61%), Gaps = 13/132 (10%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFT--NYPNPTIPDI  175
            SGTV+TRLP  AY ALR AFK+ M+ Y     +      L DTCYDFT  +    T P I
Sbjct  345  SGTVVTRLPLKAYEALRTAFKEKMSNY-----KTTTGLSLLDTCYDFTGVDLETVTFPKI  399

Query  176  SFTFGGNLEVHL-DPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVA  343
            SFTF G++ V L +P G++  L +  S VCLAF   S  +D  IFGN QQ+T  VVYD  
Sbjct  400  SFTFNGDIVVDLLNPVGIL--LASNISQVCLAFAGNSNESDVAIFGNIQQKTMQVVYDGP  457

Query  344  GGQLGFASGGCS  379
            G ++GFA  GCS
Sbjct  458  GKRVGFAPNGCS  469



>ref|XP_002454360.1| hypothetical protein SORBIDRAFT_04g029400 [Sorghum bicolor]
 gb|EES07336.1| hypothetical protein SORBIDRAFT_04g029400 [Sorghum bicolor]
Length=466

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTV+TRLP  AY+AL  AFK  M  YP           + DTC+DF+   + +IP ++ 
Sbjct  346  SGTVLTRLPPTAYSALSSAFKAGMKQYPSA-----PPSGILDTCFDFSGQSSVSIPTVAL  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V +   G+M  L    S +CLAF+ ++D    GI GN QQ+TF+V+YDV GG 
Sbjct  401  VFSGGAVVDIASDGIM--LQTSNSILCLAFAANSDDSSLGIIGNVQQRTFEVLYDVGGGA  458

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  459  VGFKAGAC  466



>ref|XP_009390624.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 14/128 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT ITRLP  AY ALR AF++HM+ YP     +P    L DTCYD + Y   T+P I+ 
Sbjct  328  SGTTITRLPPSAYEALRSAFREHMSAYP----LKPT-NGLLDTCYDLSGYETITVPSIAL  382

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQL  355
             FG  + + +D  G++          CLAFS +  G  GI GN QQ+T++VVYDV   ++
Sbjct  383  QFGDGITLDVDSSGILF-------HDCLAFSANQVGGLGIIGNVQQRTYEVVYDVGNERI  435

Query  356  GFASGGCS  379
            GFA   CS
Sbjct  436  GFAPNACS  443



>ref|XP_008776819.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=176

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +T LP  AY+ALR  F+QHM+ Y  V   +     + DTCY+FT Y    +P ++ 
Sbjct  56   SGTTVTWLPPAAYSALRSEFRQHMSKYSPVAAFE-----ILDTCYNFTGYSRIRVPAVAL  110

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG--IFGNYQQQTFDVVYDVAGGQL  355
             F   + +++D  G++  L    S  CLAF+   + G  I  N QQ+TFDVVYDVA   +
Sbjct  111  QFSAGVTLNVDASGIL--LFASPSQRCLAFASVDEDGFSIVRNMQQRTFDVVYDVAREMI  168

Query  356  GFASGGC  376
            GF +GGC
Sbjct  169  GFGAGGC  175



>ref|XP_010256103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=476

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            +GTVITRL   AY ALR AF+Q M  YP           LFDTCYD + +    IP I  
Sbjct  354  TGTVITRLQPSAYAALRSAFRQAMLNYPSA-----SAVFLFDTCYDLSGFNIVAIPKIML  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G   + L   G++  + +G S VCLAF+ + D G   I GN QQQT +VVYDV GG+
Sbjct  409  HFEGGAGIDLGLPGII--VTDGLSRVCLAFAGNDDPGKAAIIGNKQQQTLEVVYDVPGGR  466

Query  353  LGFASGGCS  379
            LGF SG CS
Sbjct  467  LGFGSGDCS  475



>gb|EMT32055.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=232

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 13/126 (10%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP     QP+ + + DTC+DF+      IP ++ 
Sbjct  114  SGTIITRLPRTAYSALSSAFKAGMKHYPPA---QPRARGILDTCFDFSGQSTVNIPSVTL  170

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   + L   G++  L+N     CLAF+ + D    G  GN QQQTF+V+YDV GG 
Sbjct  171  VFSGGAVIDLAFNGII--LDN-----CLAFAANRDDSSLGTIGNVQQQTFEVLYDVGGGV  223

Query  353  LGFASG  370
            +GF +G
Sbjct  224  VGFKAG  229



>ref|XP_002515386.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46835.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=387

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL    Y+AL   F+Q M  YP+          + DTCYDF+   + ++P ISF
Sbjct  265  SGTVITRLQPTVYSALSSKFQQLMKDYPKT-----DGFSILDTCYDFSGNESISVPRISF  319

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +   G++  +N     VCLAF+ + D G   +FGN QQQT+DVV+D+A G+
Sbjct  320  FFKGGVEVDIKFFGILTVIN-AWDKVCLAFAPNDDDGDFVVFGNSQQQTYDVVHDLAKGR  378

Query  353  LGFASGGCS  379
            +GFA  GC+
Sbjct  379  IGFAPSGCN  387



>ref|XP_008779067.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=442

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP+  Y+ALRD F++ M  Y       P L  L DTCY+FT   + ++P +  
Sbjct  321  SGTVITYLPSSGYSALRDEFRRQMANYS----MAPPLPML-DTCYNFTGVGSISLPSVGL  375

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G + + +DP G++ P +   S  CLAFS ++D     I GN  Q+T+D+VYDVA G 
Sbjct  376  RFSGGVTLDVDPSGILYPASI--SQACLAFSGNSDPSSISIIGNTVQRTYDIVYDVARGM  433

Query  353  LGFASGGCS  379
            +GF +GGCS
Sbjct  434  IGFGAGGCS  442



>ref|XP_008806169.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=405

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AF Q MT Y       P L  + DTCYDFT Y   ++P ++ 
Sbjct  284  SGTVISRLPPSAYAALRLAFHQQMTRYK----MAPALS-ILDTCYDFTGYDTVSVPTVAL  338

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG   +++D  G++   N   S  CLAF+ + D    GI GN QQ+ F+VVYD+A  +
Sbjct  339  MFGGGTTLNVDFSGILYVPNV--SQACLAFAPNGDAKDFGIIGNAQQKRFNVVYDIANRR  396

Query  353  LGFASGGCS  379
            +GF + GC+
Sbjct  397  IGFGANGCN  405



>ref|NP_001150335.1| aspartic proteinase nepenthesin-2 precursor [Zea mays]
 gb|ACG38714.1| aspartic proteinase nepenthesin-2 precursor [Zea mays]
Length=461

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  346  SGTVITRLPPTAYSALSSAFKAGMKQYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++  L+N     CLAF+ ++D    GI GN QQ+TF+V+YDV  G 
Sbjct  401  VFSGGAVVSLDASGII--LSN-----CLAFAANSDDSSLGIIGNVQQRTFEVLYDVGRGV  453

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  454  VGFRAGAC  461



>ref|XP_009409855.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=466

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 76/130 (58%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR AF+Q MT Y       P L  + DTCYD +     T+P+++ 
Sbjct  346  SGTVITRLPPTAYSALRSAFRQEMTTYKSA----PAL-SILDTCYDLSGLDKVTVPEVAL  400

Query  182  TFGGNLEVHLDPRGVM--APLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAG  346
              GG   +HLD   ++  A L    S  CLAF+ +   TD GI GN QQ+  DVVYDV+ 
Sbjct  401  HLGGGATIHLDITRILYIASL----SQACLAFAANRADTDLGIIGNVQQRGLDVVYDVSK  456

Query  347  GQLGFASGGC  376
              +GF  GGC
Sbjct  457  HVIGFGPGGC  466



>gb|ACN29145.1| unknown [Zea mays]
 gb|AFW63717.1| hypothetical protein ZEAMMB73_445506 [Zea mays]
Length=385

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  270  SGTVITRLPPTAYSALSSAFKAGMKQYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  324

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++  L+N     CLAF+ ++D    GI GN QQ+TF+V+YDV  G 
Sbjct  325  VFSGGAVVSLDASGII--LSN-----CLAFAGNSDDSSLGIIGNVQQRTFEVLYDVGRGV  377

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  378  VGFRAGAC  385



>gb|KCW63890.1| hypothetical protein EUGRSUZ_G01565, partial [Eucalyptus grandis]
Length=409

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP   Y+ALR  F++ M  Y              DTCYDF+     T+P I+F
Sbjct  288  SGTTITQLPPTVYSALRTVFRKAMANY-----TTAPADSTVDTCYDFSKERTVTVPSITF  342

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + + LD  G++  L    S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  343  LFAGGVNIDLDRSGIL--LMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVAGRK  400

Query  353  LGFASGGCS  379
            LGFA   CS
Sbjct  401  LGFAPNSCS  409



>dbj|BAJ89995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP     QP    +FDTC+DF+   + +IP ++ 
Sbjct  341  SGTIITRLPRTAYSALSSAFKAGMKQYPPA---QPM--GIFDTCFDFSGQSSVSIPTVAL  395

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L   G++          CLAF+ ++D    GI GN QQ+TF+V+YDV GG 
Sbjct  396  VFSGGAVVDLASDGIIL-------GSCLAFAANSDDTSLGIIGNVQQRTFEVLYDVGGGA  448

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  449  VGFKAGAC  456



>gb|ACF88017.1| unknown [Zea mays]
Length=461

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  346  SGTVITRLPPTAYSALSSAFKAGMKQYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++  L+N     CLAF+ ++D    GI GN QQ+TF+V+YDV  G 
Sbjct  401  VFSGGAVVSLDASGII--LSN-----CLAFAGNSDDSSLGIIGNVQQRTFEVLYDVGRGV  453

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  454  VGFRAGAC  461



>gb|KCW63736.1| hypothetical protein EUGRSUZ_G01384 [Eucalyptus grandis]
Length=470

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP   Y+ALR  F++ M  Y              DTCYDF+     T+P I+F
Sbjct  349  SGTTITQLPPTVYSALRTVFRKAMANY-----TTAPADSTVDTCYDFSKERTVTVPSITF  403

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + + LD  G++  +    S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  404  LFAGGVNIDLDRSGILVMVT--ASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVAGRK  461

Query  353  LGFASGGCS  379
            LGFA   CS
Sbjct  462  LGFAPNSCS  470



>gb|EMS67345.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=317

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP     QP    +FDTC+DF+      IP ++ 
Sbjct  202  SGTIITRLPATAYSALSSAFKAGMKQYPPA---QPM--GIFDTCFDFSGQSTINIPSVAL  256

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G + V L   G++  L++     CLAF+ ++D    GI GN QQ+T +V+YDV GG 
Sbjct  257  VFSGEVVVDLATDGII--LDS-----CLAFAANSDDSSLGIIGNVQQRTIEVLYDVGGGA  309

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  310  VGFKAGAC  317



>gb|EMT32054.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=461

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP     QP    +FDTC+DF+   + +IP +  
Sbjct  346  SGTIITRLPATAYSALSSAFKAGMKQYPPA---QPM--GIFDTCFDFSGQSSVSIPTVVL  400

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G + V+L   G++          CLAF+ ++D    GI GN QQ+T +V+YDV GG 
Sbjct  401  VFSGGVAVNLASDGIIL-------GSCLAFAANSDDSSLGIIGNVQQRTLEVLYDVGGGA  453

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  454  VGFKAGAC  461



>ref|NP_001140743.1| uncharacterized protein LOC100272818 [Zea mays]
 gb|ACF84520.1| unknown [Zea mays]
Length=351

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 72/128 (56%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            S T ITRLP  AY ALR AF+  MTMY     +    K   DTCYDFT   N  +P IS 
Sbjct  236  SRTAITRLPPTAYQALRAAFRSSMTMY-----RSAPPKGYLDTCYDFTGVVNIRLPKISL  290

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F  N  + LDP G++   N+     CLAF+ + D    G+ G+ QQQT +V+YDV GG 
Sbjct  291  VFDRNAVLPLDPSGIL--FND-----CLAFTSNADDRMPGVLGSVQQQTIEVLYDVGGGA  343

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  344  VGFRQGAC  351



>ref|XP_010066094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=449

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP   Y+ALR  F++ M  Y              DTCYDF+     T+P I+F
Sbjct  328  SGTTITQLPPTVYSALRTVFRKAMANY-----TTAPADSTVDTCYDFSKERTVTVPSITF  382

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + + LD  G++  L    S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  383  LFAGGVNIDLDRSGIL--LMVTASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVAGRK  440

Query  353  LGFASGGCS  379
            LGFA   CS
Sbjct  441  LGFAPNSCS  449



>gb|KCW63730.1| hypothetical protein EUGRSUZ_G01376 [Eucalyptus grandis]
Length=432

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+ALR   ++ M  Y       P +  LFDTCYDF+      IP I+F
Sbjct  311  SGTVITRLPPTAYSALRTTVRKAMANYTTA----PAVS-LFDTCYDFSKESTVVIPSITF  365

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F   + + LD  G+        S VCLAF+ +   +D  I+GN Q +TF+VVYDVAG +
Sbjct  366  SFAEGVNIDLDHSGIF--YVEDASHVCLAFAANAADSDLVIYGNTQPRTFEVVYDVAGRK  423

Query  353  LGFASGGCS  379
            LGF   GCS
Sbjct  424  LGFGPNGCS  432



>ref|XP_008220628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=503

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY +LR AF++ M  Y        +   L DTCYD +     + P+I+F
Sbjct  382  SGTVITRLPATAYASLRGAFREAMKNYTLT-----KSFSLLDTCYDISGLNTFSYPEIAF  436

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FG  L V LD  G++  ++   S VCLAF+ + D    GI GN QQ+  +VVYDV GG+
Sbjct  437  VFGDGLTVDLDATGILVLISP--SQVCLAFAGNMDDSDFGIIGNVQQKRLEVVYDVVGGK  494

Query  353  LGFASGGC  376
            +GF   GC
Sbjct  495  VGFGPAGC  502



>gb|ABR16115.1| unknown [Picea sitchensis]
Length=482

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY AL+ +F+      P       +   + DTCYD + +    IP I+F
Sbjct  358  SGTVITRLLPQAYNALKTSFRSKTRDLPSA-----KPFSILDTCYDLSRHSQVRIPTITF  412

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYST--DG-GIFGNYQQQTFDVVYDVAGGQ  352
             F  N +V +   G++ P+ NGGS VCLAF+ ++  DG  I GN+QQQ   V +D   G+
Sbjct  413  HFQNNADVAVSDVGILVPVQNGGSQVCLAFASASQMDGFNIIGNFQQQRMRVAFDTGAGR  472

Query  353  LGFASGGCS  379
            +GFASG C+
Sbjct  473  IGFASGSCA  481



>ref|XP_004973076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=459

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 74/131 (56%), Gaps = 18/131 (14%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+A+R AF+  M  YP     + +  ++ DTCYDF N    T+P +  
Sbjct  341  SGTIITRLPPRAYSAMRSAFRAGMLQYP-----RAKPLEILDTCYDFGNLTRVTVPAVEL  395

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG------IFGNYQQQTFDVVYDVA  343
             F G   V LD  G+M          CLAF+ S DGG      I GN QQ+TF+V++DV 
Sbjct  396  VFDGGAVVDLDVHGIMI-------FDCLAFAPSDDGGASSVPSIIGNVQQRTFEVLHDVG  448

Query  344  GGQLGFASGGC  376
             G +GF +G C
Sbjct  449  RGTIGFRAGAC  459



>ref|XP_004953759.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Setaria italica]
Length=455

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY+AL  AFK  M  YP      P    + DTC+DF+   + TIP ++ 
Sbjct  340  SGTVITRLQRTAYSALSSAFKAGMKQYPRA----PS-SGILDTCFDFSGQRSITIPTVAL  394

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+LD  G++          CLAF+ ++D    GI GN QQ+TF+V+YDV GG 
Sbjct  395  VFSGGAVVNLDANGIIL-------GSCLAFAGNSDDSSFGIIGNVQQRTFEVLYDVGGGS  447

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  448  VGFRAGAC  455



>ref|XP_004953760.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Setaria italica]
Length=456

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL   AY+AL  AFK  M  YP      P    + DTC+DF+   + TIP ++ 
Sbjct  341  SGTVITRLQRTAYSALSSAFKAGMKQYPRA----PS-SGILDTCFDFSGQRSITIPTVAL  395

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+LD  G++          CLAF+ ++D    GI GN QQ+TF+V+YDV GG 
Sbjct  396  VFSGGAVVNLDANGIIL-------GSCLAFAGNSDDSSFGIIGNVQQRTFEVLYDVGGGS  448

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  449  VGFRAGAC  456



>ref|XP_004966942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=465

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 80/128 (63%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AY+ALR AF+  M+ YP   L  P  K+  DTCY+FT + N T+P +S 
Sbjct  350  SGTVITGLPETAYSALRTAFRSAMSAYP---LLPP--KEDLDTCYNFTGFSNVTVPTVSL  404

Query  182  TFGGNLEVHLD-PRGVMAPLNNGGSAVCLAF--SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            TF G++ + LD P G++  L++     CLAF  + S D GI GN  Q+TF+V+YD   G 
Sbjct  405  TFDGDVTIDLDAPSGIL--LDD-----CLAFVGAGSDDTGIIGNVNQRTFEVLYDSGRGH  457

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  458  VGFRPGAC  465



>gb|AFW63716.1| aspartic proteinase nepenthesin-2 [Zea mays]
Length=531

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL  AFK  M  YP       Q   + DTC+DF+   + +IP ++ 
Sbjct  416  SGTVITRLPPTAYSALSSAFKAGMKQYPPA-----QPSGILDTCFDFSGQSSVSIPSVAL  470

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++  L+N     CLAF+ ++D    GI GN QQ+TF+V+YDV  G 
Sbjct  471  VFSGGAVVSLDASGII--LSN-----CLAFAGNSDDSSLGIIGNVQQRTFEVLYDVGRGV  523

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  524  VGFRAGAC  531



>ref|XP_010928159.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=470

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  F+Q M  Y       P L  + DTCYDFT Y    +P +  
Sbjct  350  SGTVITRLPPSAYAALRSRFRQLMRKYKTA----PALS-ILDTCYDFTGYETVQVPTVQL  404

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             FGG   + +D  G++       S  CLAF+ + D G   I GN QQ+ F+VVYD+A  Q
Sbjct  405  VFGGGASLSVDLSGILYVAKM--SQACLAFAGNGDVGDVTIIGNVQQRRFNVVYDIAKKQ  462

Query  353  LGFASGGC  376
            +GF + GC
Sbjct  463  IGFGAKGC  470



>gb|AFK48193.1| unknown [Lotus japonicus]
Length=157

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 74/128 (58%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP P YTAL+++F + M+   +   Q P +  + DTC+         +P+I  
Sbjct  35   SGTVITRLPMPVYTALKNSFVRIMS---KKYAQAPGIS-ILDTCFKGNVKEMSEVPEIQM  90

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG  ++ L     +  L+ G    CLA + S++     I GNYQQQTF V YDVA  +
Sbjct  91   IFGGGADLPLKAHNTLIELDKG--VTCLAIAGSSENNPIAIIGNYQQQTFKVAYDVANSK  148

Query  353  LGFASGGC  376
            +GFA+GGC
Sbjct  149  IGFAAGGC  156



>ref|XP_010913226.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=468

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALR  F++ M    +   + P L  + DTCYDFT Y   ++P ++ 
Sbjct  345  SGTVITRLPPSAYTALRSRFQKQMAK--KKYKRAPPLS-ILDTCYDFTGYNIVSVPTVAL  401

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             FG  + +++D  G++    +  S  CLAF+    ++D GI GN QQ+ FDVVYD+A  +
Sbjct  402  LFGSRVTLNVDFTGIL--YVSSVSQACLAFAGNDNASDPGIIGNVQQKRFDVVYDIANSR  459

Query  353  LGFASGGC  376
            +GF + GC
Sbjct  460  IGFGANGC  467



>ref|XP_010258628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=493

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 73/128 (57%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y+ALR AF+Q M+ Y     +  +   + DTCYD T Y    IP I  
Sbjct  372  SGTVITRLPPSVYSALRSAFRQLMSKY-----RSAEALSILDTCYDLTRYRTIRIPKIGL  426

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G++ + + P G++   N   S VCLAF+ + D G   I GN QQQ   V+YD+A  +
Sbjct  427  HFRGDIVLDVHPNGILYSGNV--SQVCLAFAGNDDNGDVTILGNKQQQNLKVIYDLAKQR  484

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  485  IGFGPGDC  492



>gb|KCW44808.1| hypothetical protein EUGRSUZ_L01627, partial [Eucalyptus grandis]
Length=394

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 10/122 (8%)
 Frame = +2

Query  23   LPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISFTFGGNLE  202
            +P+ A+  +R AF++ M  Y       P L  + DTCYD +     T+P I+F+F G  +
Sbjct  280  IPSTAFQCVRTAFRKAMANYTTA----PALS-ILDTCYDLSKESTVTVPTITFSFAGGAD  334

Query  203  VHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQLGFASGG  373
            ++LD  G+        S VCLAF+     +D GI+GN QQ+TF+VVYDVAGG+LGF S G
Sbjct  335  INLDHNGIFYVAK--ASQVCLAFAGNGADSDLGIYGNVQQKTFEVVYDVAGGKLGFGSNG  392

Query  374  CS  379
            CS
Sbjct  393  CS  394



>gb|EYU22027.1| hypothetical protein MIMGU_mgv1a005281mg [Erythranthe guttata]
Length=490

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 73/118 (62%), Gaps = 10/118 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY+A+  AF+Q M  Y            + DTC+DF N  + +IP ISF
Sbjct  369  SGTVISRLPPAAYSAMSSAFRQQMKQYTSA-----PAYSILDTCFDFGNLTSVSIPTISF  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAG  346
             F GNL V L P G++  +++  +  CLAF+ + D G   IFGN QQ+T +VVYDVAG
Sbjct  424  VFSGNLRVDLHPSGILVAVSS--TQACLAFAGNGDAGDVGIFGNTQQKTLEVVYDVAG  479



>ref|XP_004957153.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=472

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR +F   M  Y     + P L  L DTCYDFT +    IP ++ 
Sbjct  351  SGTVITRLPDTAYRALRSSFAGFMRRYK----RAPALS-LLDTCYDFTGHRTVQIPSVAL  405

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G + V LD  GV+    +  S  CLAF+ + D    GI GN QQ+TF VVYDVA  +
Sbjct  406  VFSGGVTVSLDFSGVL--YVSKVSQACLAFASNGDDTSIGILGNTQQKTFAVVYDVANQK  463

Query  353  LGFASGGCS  379
            +GF + GC+
Sbjct  464  IGFGAKGCT  472



>ref|XP_009390623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=465

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  LR AFKQ MT YP      P L  + DTCYDFT Y   ++P ++ 
Sbjct  344  SGTVITRLPPSAYAVLRSAFKQKMTQYPPA----PAL-SILDTCYDFTGYTTVSVPTVAL  398

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G   + +D  G++   +   S  CLAF+    + D  I  N QQ+T++VVYDV+  +
Sbjct  399  VFSGGATLSVDFTGILYVASV--SQACLAFAGNDNADDPAIIANVQQRTYNVVYDVSKRK  456

Query  353  LGFASGGCS  379
            +GF +  CS
Sbjct  457  IGFGAKACS  465



>ref|XP_010050794.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=466

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +T+LP  AYTALR AF++ M  Y      +P      DTCYDF+     T P I+F
Sbjct  347  SGTTVTQLPPTAYTALRSAFREAMANYTSAPPFEP-----LDTCYDFSGVSTFTGPVITF  401

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG-GIFGNYQQQTFDVVYDVAGGQLG  358
            TF G + + LD  G+   ++   S VCLAF    D   I+GN QQ+TF+VVYDV GGQ+G
Sbjct  402  TFDGPINIDLDLSGMFYVVDV--SQVCLAFVAGADDFAIYGNTQQRTFEVVYDVTGGQIG  459

Query  359  FASGGC  376
            F +  C
Sbjct  460  FGAKAC  465



>ref|XP_008647512.1| PREDICTED: uncharacterized protein LOC100272818 isoform X1 [Zea 
mays]
 gb|ACR36490.1| unknown [Zea mays]
 gb|AFW75313.1| hypothetical protein ZEAMMB73_520329 [Zea mays]
Length=481

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 72/128 (56%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            S T ITRLP  AY ALR AF+  MTMY     +    K   DTCYDFT   N  +P IS 
Sbjct  366  SRTAITRLPPTAYQALRSAFRSSMTMY-----RSAPPKGYLDTCYDFTGVVNIRLPKISL  420

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F  N  + LDP G++   N+     CLAF+ + D    G+ G+ QQQT +V+YDV GG 
Sbjct  421  VFDRNAVLPLDPSGIL--FND-----CLAFTSNADDRMPGVLGSVQQQTIEVLYDVGGGA  473

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  474  VGFRQGAC  481



>ref|XP_009401063.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=489

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 68/128 (53%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRL    Y  LRD F  H + YP      P    + DTC+D   Y    +P I F
Sbjct  364  SGTVITRLVPSVYKTLRDEFLWHFSGYPPA----PGYS-ILDTCFDLAGYKEVDVPTIRF  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            TF G+ EV +D  GV+       S VCLAF   SY  + GI GNYQQ+   VVYD  G +
Sbjct  419  TFDGDAEVDVDVNGVLYFAKPDASQVCLAFASLSYEEEIGIIGNYQQKNLRVVYDTVGSK  478

Query  353  LGFASGGC  376
            +GFA   C
Sbjct  479  VGFAEETC  486



>ref|XP_002436936.1| hypothetical protein SORBIDRAFT_10g011730 [Sorghum bicolor]
 gb|EER88303.1| hypothetical protein SORBIDRAFT_10g011730 [Sorghum bicolor]
Length=469

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 14/129 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT++T LP  AY+ALR AF+  M+ YP   L  P   +  DTCYDFT   N T+P ++ 
Sbjct  351  SGTIVTGLPETAYSALRTAFRSAMSAYP---LLPPNDDEDLDTCYDFTGNTNVTVPTVAL  407

Query  182  TFGGNLEVHLD-PRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGG  349
            TF G + + LD P GV+  L+      CLAF   +   D GI GN  Q+TF+V+YD A G
Sbjct  408  TFEGGVTIDLDVPSGVL--LDG-----CLAFVAGASDGDTGIIGNVNQRTFEVLYDSARG  460

Query  350  QLGFASGGC  376
             +GF +G C
Sbjct  461  HVGFRAGAC  469



>ref|NP_001047954.1| Os02g0720600 [Oryza sativa Japonica Group]
 dbj|BAD12876.1| putative 41 kD chloroplast nucleoid DNA binding protein (CND41) 
[Oryza sativa Japonica Group]
 dbj|BAD12996.1| putative 41 kD chloroplast nucleoid DNA binding protein (CND41) 
[Oryza sativa Japonica Group]
 dbj|BAF09868.1| Os02g0720600 [Oryza sativa Japonica Group]
 gb|EAZ24423.1| hypothetical protein OsJ_08176 [Oryza sativa Japonica Group]
 dbj|BAG97484.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 70/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  Y     +    + + DTC+DF      +IP ++ 
Sbjct  348  SGTIITRLPPTAYSALSSAFKAGMKQY-----RSAPARSILDTCFDFAGQTQISIPTVAL  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G   + LDP G+M          CLAF+ + D G   I GN QQ+TF+V+YDV    
Sbjct  403  VFSGGAAIDLDPNGIMY-------GNCLAFAATGDDGTTGIIGNVQQRTFEVLYDVGSST  455

Query  353  LGFASGGC  376
            LGF SG C
Sbjct  456  LGFRSGAC  463



>gb|EAY87323.1| hypothetical protein OsI_08727 [Oryza sativa Indica Group]
Length=463

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 70/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  Y     +    + + DTC+DF      +IP ++ 
Sbjct  348  SGTIITRLPPTAYSALSSAFKAGMKQY-----RSAPARSILDTCFDFAGQTQISIPTVAL  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G   + LDP G+M          CLAF+ + D G   I GN QQ+TF+V+YDV    
Sbjct  403  VFSGGAAIDLDPNGIMY-------GNCLAFAATGDDGTTGIIGNVQQRTFEVLYDVGSST  455

Query  353  LGFASGGC  376
            LGF SG C
Sbjct  456  LGFRSGAC  463



>ref|XP_010108293.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18773.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=579

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY A+R AF+Q M+ Y     +  Q   + DTCYDFT   +  +P ISF
Sbjct  459  SGTVITRLPPKAYDAVRKAFRQLMSDY-----KAAQSYSILDTCYDFTGVESVFVPKISF  513

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G++  ++   S VCLA + +   +D GIFGN+Q   ++V YDV   +
Sbjct  514  FFSGGVEVEVDVSGIIYAVSQ--SQVCLALAGNGDDSDVGIFGNFQHLKWEVAYDVGKER  571

Query  353  LGFASGGC  376
            +GF+   C
Sbjct  572  VGFSPSAC  579



>ref|XP_008679061.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Zea 
mays]
 gb|AFW63714.1| hypothetical protein ZEAMMB73_300584 [Zea mays]
Length=458

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  YP           + DTC+DF+   + +IP ++ 
Sbjct  338  SGTIITRLPPTAYSALSSAFKAGMQQYPPATP-----SGILDTCFDFSGQSSISIPTVTL  392

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V L   G+M  +++  S  CLAF+ + D    GI GN QQ+TF+V+YDV GG 
Sbjct  393  VFSGGAAVDLAFDGIMLEISS--SIRCLAFTPNGDDSSLGIIGNVQQRTFEVLYDVGGGA  450

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  451  VGFKAGAC  458



>ref|XP_007011660.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29279.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=469

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 74/128 (58%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  L+ +F+++MT YP      P L  + DTCYDF+       P IS 
Sbjct  348  SGTVITRLPPTAYAQLKSSFQKYMTSYPRA----PALS-ILDTCYDFSGSDVIITPTISI  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +D  G+        S  CLAF+ + D     IFGN QQ+T++VVYD   G+
Sbjct  403  VFNGGVEVDIDFSGIF--YIRKVSQACLAFAANKDARDVAIFGNVQQKTYEVVYDDVKGR  460

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  461  VGFAPRGC  468



>gb|EMS35741.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=118

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 68/128 (53%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            S  VIT+LP  AY ALR AF+  M  YP     +       DTCYDF    N  +P +S 
Sbjct  3    SSAVITQLPPTAYRALRRAFRNAMRAYP-----RSGATGTLDTCYDFLGLTNVRVPAVSL  57

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG   V LDP  VM     GG   CLAF+ ++     G  GN QQQT +V+YDVA G 
Sbjct  58   VFGGGAVVVLDPPAVML----GG---CLAFTATSSDLALGFIGNVQQQTHEVLYDVAAGG  110

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  111  VGFRRGAC  118



>gb|EMS54230.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=382

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 72/129 (56%), Gaps = 15/129 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SG V+T+LP  AY ALR AF+  MT Y    L  P   +  DTCYD T +P   +P +S 
Sbjct  265  SGAVVTQLPPSAYAALRAAFRSAMTAYGP--LADP--VRNLDTCYDLTRFPEVNVPKVSL  320

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG----GIFGNYQQQTFDVVYDVAGG  349
             F G   + L+P  +M  L+      CLAF+ S  G    G  GN QQQT++V+YDV  G
Sbjct  321  VFAGGATLELEPASIM--LDG-----CLAFTASPGGHGSIGFIGNVQQQTYEVLYDVGSG  373

Query  350  QLGFASGGC  376
             +GF SG C
Sbjct  374  SVGFRSGAC  382



>ref|XP_002454359.1| hypothetical protein SORBIDRAFT_04g029390 [Sorghum bicolor]
 gb|EES07335.1| hypothetical protein SORBIDRAFT_04g029390 [Sorghum bicolor]
Length=460

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 76/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AFK  M  Y     +    + + DTC+DF+   +  +P ++ 
Sbjct  345  SGTIITRLPRTAYSALSSAFKAGMKQY-----RPAPPRSIMDTCFDFSGQSSVRLPSVAL  399

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+LD  G++  L N     CLAF+ ++D    GI GN QQ+TF+V+YDV GG 
Sbjct  400  VFSGGAVVNLDANGII--LGN-----CLAFAANSDDSSPGIVGNVQQRTFEVLYDVGGGA  452

Query  353  LGFASGGC  376
            +GF +G C
Sbjct  453  VGFKAGAC  460



>ref|XP_008776818.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=365

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP  AY ALR AF++ MT Y       P+L  + DTCYDFT Y   T+P ++ 
Sbjct  244  SGTVISRLPPSAYAALRLAFRKQMTRYK----MAPRLS-ILDTCYDFTGYDTVTVPTVAL  298

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG   +++D  G++   +   S  CLAF+ +    D GI GN QQ+ F+VVYD+   +
Sbjct  299  VFGGGTTLNVDFSGILYVPSV--SQACLAFAPNGDPRDFGIIGNAQQKRFNVVYDIPNMR  356

Query  353  LGFASGGCS  379
            +GF +  CS
Sbjct  357  IGFGANACS  365



>ref|XP_006647806.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=473

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 70/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AF+  M  Y     +    + + DTC+DFT   N +IP +  
Sbjct  358  SGTIITRLPQTAYSALSSAFRAGMKQY-----RSAPPRSILDTCFDFTGQTNISIPTVEL  412

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G+M          CLAF+ + D    GI GN QQ+TF+V+YDV    
Sbjct  413  VFSGGATVDLDANGIMF-------GSCLAFTSTGDDRTTGIIGNVQQRTFEVLYDVGNSV  465

Query  353  LGFASGGC  376
            LGF SG C
Sbjct  466  LGFRSGAC  473



>ref|XP_010259084.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=470

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 68/116 (59%), Gaps = 10/116 (9%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF+Q M+ YP           + DTCYD + Y   TIP I+ 
Sbjct  349  SGTVITRLPPAAYAALRSAFRQAMSKYPST-----SSLSILDTCYDLSGYNTVTIPTITL  403

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDV  340
             FGG   + +D  G++   +   S VCLAF   S  +D  I GN QQQTF+VVYDV
Sbjct  404  HFGGGTGLAVDSSGILVVASL--SQVCLAFAGNSDPSDVAILGNKQQQTFEVVYDV  457



>ref|XP_002460430.1| hypothetical protein SORBIDRAFT_02g027990 [Sorghum bicolor]
 gb|EER96951.1| hypothetical protein SORBIDRAFT_02g027990 [Sorghum bicolor]
Length=488

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 68/126 (54%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT  +RLP  AY ALR +F+  M  Y     ++     +FDTCYDFT +    IP +  
Sbjct  367  SGTAFSRLPPSAYAALRSSFRSAMGRY---RYKRAPSSPIFDTCYDFTGHETVRIPAVEL  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGGIFGNYQQQTFDVVYDVAGGQLGF  361
             F     VHL P GV+   N+     CLAF  + D GI GN QQ+T  V+YDV   ++GF
Sbjct  424  VFADGATVHLHPSGVLYTWNDVAQ-TCLAFVPNHDLGILGNTQQRTLAVIYDVGSQRIGF  482

Query  362  ASGGCS  379
               GC+
Sbjct  483  GRKGCA  488



>dbj|BAJ99659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y ALR AF + M  Y     + P L  + DTCYDFT +    IP ++ 
Sbjct  361  SGTVITRLPPRVYAALRSAFARSMGRYG--YKRAPALS-ILDTCYDFTGHTTVRIPSVAL  417

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  GV+       S  CLAF+ + DG   GI GN QQ+T  VVYDVA  +
Sbjct  418  VFAGGAAVGLDFSGVLYVAKV--SQACLAFAPNGDGADAGIIGNTQQKTLAVVYDVARQK  475

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  476  IGFGANGCS  484



>ref|XP_007212799.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
 gb|EMJ13998.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
Length=386

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            +GTVITRLP  AY+ALRD F+Q +T YP       +   + D CYD ++Y     P I+F
Sbjct  270  TGTVITRLPAAAYSALRDVFRQALTKYPLT-----RALSVLDKCYDLSSYVTVKYPHIAF  324

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G L++ LD  G+    ++  S VCLAF+    +    + GN QQ+TF+     AGG+
Sbjct  325  YFQGGLKLKLDATGIF--YSSSASQVCLAFAGNDANNKFAVLGNVQQKTFE-----AGGR  377

Query  353  LGFASGGC  376
            +GFA GGC
Sbjct  378  VGFARGGC  385



>ref|XP_006656917.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=191

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 75/130 (58%), Gaps = 16/130 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AY ALR AF+  M+ Y  +    P      DTCYDFT + N T+P +S 
Sbjct  73   SGTVITALPATAYAALRSAFRSAMSEYRLL----PPSDGGLDTCYDFTGHSNVTVPRVSL  128

Query  182  TFGGNLEVHLD-PRGVMAPLNNGGSAVCLAFS--YSTDG--GIFGNYQQQTFDVVYDVAG  346
             F G+  V L  P GV   L +G    CLAF+   +TDG  GI GN  Q+TF+V+YD   
Sbjct  129  AFAGSATVELAVPSGV---LVDG----CLAFAGTGTTDGAIGIIGNVNQRTFEVLYDSGK  181

Query  347  GQLGFASGGC  376
            G +GF +G C
Sbjct  182  GTVGFRAGAC  191



>gb|EMS57901.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=440

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITRLP  AY+AL  AF+  M  YP       Q   + DTC+DF+   +  IP I+ 
Sbjct  325  SGTIITRLPRTAYSALSSAFRAGMKQYPPA-----QPMGILDTCFDFSGQSSIRIPTIAL  379

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V+L P G++          CLAF+ + D    GI GN QQ+ F+V+YDV GG 
Sbjct  380  MFSGGAVVNLSPEGIIL-------ESCLAFAANRDDSSLGIIGNVQQRMFEVLYDVGGGA  432

Query  353  LGFASGGC  376
            +GF  G C
Sbjct  433  VGFNVGAC  440



>gb|KDP33482.1| hypothetical protein JCGZ_07053 [Jatropha curcas]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y+AL   F++ MT YP           + DTCYDF+++   T+P IS 
Sbjct  353  SGTVITRLPPTVYSALSSKFQEMMTEYP-----MTDGFSILDTCYDFSDFDTVTVPKISV  407

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +EV +   G++  ++ G   VCLAF+     ++  IFGN QQQT++V++D+A  +
Sbjct  408  FFKGGVEVDIYVTGILIVVD-GIEKVCLAFAPNQKDSEFAIFGNTQQQTYEVLHDLAKER  466

Query  353  LGFASGGCS  379
            +GFA   CS
Sbjct  467  VGFAPAACS  475



>ref|XP_010108296.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18776.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=491

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY+AL   FK+ M+ YP      P L  + DTC++ + Y   TIP ISF
Sbjct  370  SGTVITRLPPTAYSALSGEFKKQMSKYPSA----PALS-ILDTCFNLSAYQTVTIPKISF  424

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             FGG   V LD  G++   +   S VCLAF+ ++D G   IFGN QQ+T  VVYD+ GG+
Sbjct  425  YFGGGTAVDLDATGILYAASL--SQVCLAFAGNSDDGDVAIFGNVQQKTLQVVYDIGGGR  482

Query  353  LGFASGGCS  379
            +GF SGGCS
Sbjct  483  IGFGSGGCS  491



>ref|XP_008652856.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=469

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY+ALR +F   M  Y       P L  + DTCYDFT      IP ++ 
Sbjct  348  SGTVITRLPSRAYSALRSSFAGFMRRYKRA----PALS-ILDTCYDFTGRTKVQIPSVAL  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   ++L   GV+   N   S  CLAF+ + D    GI GN QQ+TF VVYD+A  +
Sbjct  403  LFDGGATLNLGFGGVLYVANR--SQACLAFASNGDDTSVGILGNMQQKTFAVVYDLANQK  460

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  461  IGFGAKGCS  469



>ref|XP_010068417.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Eucalyptus grandis]
Length=597

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 10/124 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT IT+LP   Y+ALR  F++ M  Y              DTCYDF+     T+P I+F
Sbjct  232  SGTTITQLPPTVYSALRTVFRKAMANYTTA-----PADSTVDTCYDFSKERTVTVPSITF  286

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G + + LD  G++  +    S VCLAF+ +   +D  I+GN QQ+TF+VVYDVAG +
Sbjct  287  LFAGGVNIDLDRSGILVMVT--ASQVCLAFTANDADSDLIIYGNVQQRTFEVVYDVAGRK  344

Query  353  LGFA  364
            LGFA
Sbjct  345  LGFA  348



>gb|KCW80528.1| hypothetical protein EUGRSUZ_C01882, partial [Eucalyptus grandis]
Length=463

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 8/123 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +T+LP  AYTALR AF++ M  Y      +P      DTCYDF+     T P I+F
Sbjct  347  SGTTVTQLPPTAYTALRSAFREAMANYTSAPPFEP-----LDTCYDFSGVSTFTGPVITF  401

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG-GIFGNYQQQTFDVVYDVAGGQLG  358
            TF G + + LD  G+   ++   S VCLAF    D   I+GN QQ+TF+VVYDV GGQ+G
Sbjct  402  TFDGPINIDLDLSGMFYVVDV--SQVCLAFVAGADDFAIYGNTQQRTFEVVYDVTGGQIG  459

Query  359  FAS  367
            F +
Sbjct  460  FGA  462



>ref|XP_002297678.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE82483.1| aspartyl protease family protein [Populus trichocarpa]
Length=482

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y AL+D F +  + +P      P    + DTC++ + Y    IP+I  
Sbjct  357  SGTVITRLPPSIYQALKDEFVKQFSGFPSA----PAFM-ILDTCFNLSGYQEVEIPNIKM  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLA---FSYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F GN E+++D  GV   +    S VCLA    SY  + GI GNYQQ+   V+YD  G  
Sbjct  412  HFEGNAELNVDVTGVFYFVKTDASQVCLAIASLSYENEVGIIGNYQQKNQRVIYDTKGSM  471

Query  353  LGFASGGCS  379
            LGFA+  C+
Sbjct  472  LGFAAEACT  480



>gb|KDO37972.1| hypothetical protein CISIN_1g011746mg [Citrus sinensis]
Length=478

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SG  ITRLP+P Y ALR AF++ M  Y +    +   +  FDTCYD + Y    +P I+F
Sbjct  355  SGNEITRLPSPIYAALRSAFRKRMMKYKKT---KADDEDDFDTCYDLSAYETVVVPKITF  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY--STDGGI-FGNYQQQTFDVVYDVAGGQ  352
             F G +++ LD RG +   +   S VCLAF+   S    I  GN QQ+ ++V YDVAG +
Sbjct  412  HFLGGVDLELDVRGTLVVFS--VSQVCLAFAIFPSDPNSISLGNVQQRGYEVHYDVAGRR  469

Query  353  LGFASGGCS  379
            LGF  G CS
Sbjct  470  LGFGPGNCS  478



>ref|XP_011034591.1| PREDICTED: aspartic proteinase nepenthesin-1 [Populus euphratica]
Length=482

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP   Y AL+D F +  + +P      P    + DTC++ + Y    IP+I  
Sbjct  357  SGTVITRLPPSIYRALKDEFVKQFSGFPSA----PAFM-ILDTCFNLSGYQEVEIPNIKM  411

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLA---FSYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             F GN E+++D  GV   +    S VCLA    SY  + GI GNYQQ+   V+YD  G  
Sbjct  412  HFEGNAELNVDVTGVFYFVKTDASQVCLAIASLSYENEVGIIGNYQQKNQRVIYDTKGSM  471

Query  353  LGFASGGCS  379
            LGFA+  C+
Sbjct  472  LGFAAEACN  480



>gb|AHA84134.1| aspartic proteinase nepenthesin-1 [Phaseolus vulgaris]
Length=481

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 82/128 (64%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF+Q M+ YP       +L  + DTCYD + Y   +IP ++F
Sbjct  360  SGTVITRLPPTAYAALRSAFRQGMSKYPSAA----ELS-ILDTCYDLSAYEVISIPKVNF  414

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGGQ  352
             F G++ V L P+G++   +     VCLAF+ + D     IFGN QQ+T +VVYD+ GG+
Sbjct  415  VFAGSVTVELQPQGILYVAS--AKQVCLAFAANGDDSDITIFGNVQQRTLEVVYDLGGGK  472

Query  353  LGFASGGC  376
            +GF +GGC
Sbjct  473  IGFGAGGC  480



>gb|EMS59088.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=423

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SG V+T+LP P Y ALR AF+  M  Y  +      L    DTCYDFT +P   +P +S 
Sbjct  307  SGAVVTQLPPPVYAALRTAFRSAMAAYGPLAAPVRNL----DTCYDFTRFPEVKVPKVSL  362

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG----GIFGNYQQQTFDVVYDVAGG  349
             F G   + LDP  +M  L+      CLAF+ +T G    G  GN QQQT++V+YDV GG
Sbjct  363  VFAGGATLELDPASIM--LDG-----CLAFA-ATPGEESVGFIGNVQQQTYEVLYDVGGG  414

Query  350  QLGFASGGC  376
             +GF    C
Sbjct  415  SVGFRPAAC  423



>ref|XP_003573001.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brachypodium 
distachyon]
Length=151

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 16/129 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNP-TIPDIS  178
            SGT++TRLP  AY AL  AFK  M  YP     +PQ   + +TC+DFT   N  TIP ++
Sbjct  35   SGTIVTRLPPTAYEALSSAFKDGMKQYPPA---EPQ--SILNTCFDFTGQENNVTIPSVA  89

Query  179  FTFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTD---GGIFGNYQQQTFDVVYDVAGG  349
                G   V LDP G++        + CLAF+ + D    GI GN QQ+TF+V+YDV   
Sbjct  90   LVLDGGAVVDLDPNGIIL-------SSCLAFAATDDDRSSGIIGNVQQRTFEVLYDVGQS  142

Query  350  QLGFASGGC  376
              GF  G C
Sbjct  143  VFGFRPGVC  151



>tpg|DAA61984.1| TPA: hypothetical protein ZEAMMB73_915310 [Zea mays]
Length=523

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP+ AY+ALR +F   M  Y     + P L  + DTCYDFT      IP ++ 
Sbjct  402  SGTVITRLPSRAYSALRSSFAGFMRRYK----RAPALS-ILDTCYDFTGRTKVQIPSVAL  456

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   ++L   GV+   N   S  CLAF+ + D    GI GN QQ+TF VVYD+A  +
Sbjct  457  LFDGGATLNLGFGGVLYVANR--SQACLAFASNGDDTSVGILGNMQQKTFAVVYDLANQK  514

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  515  IGFGAKGCS  523



>ref|XP_002324354.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02919.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=471

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 75/130 (58%), Gaps = 11/130 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNP--TIPDI  175
            SGT +T LP+ A++AL  AF++ MT Y        +       CYDF+ + N   TIP I
Sbjct  348  SGTTLTYLPSTAHSALSSAFQEMMTNY-----TLTKGTSGLQPCYDFSKHANDNITIPQI  402

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAG  346
            S  F G +EV +D  G+    N G   VCLAF      TD  IFGN QQ+T++VVYDVA 
Sbjct  403  SIFFEGGVEVDIDDSGIFIAAN-GLEEVCLAFKDNGNDTDVAIFGNVQQKTYEVVYDVAK  461

Query  347  GQLGFASGGC  376
            G +GFA GGC
Sbjct  462  GMVGFAPGGC  471



>ref|XP_009390629.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT ITRLP  AY ALR AF++HM+ YP     +P    L DTCYDF+ Y   T+P ++ 
Sbjct  328  SGTTITRLPPSAYEALRSAFREHMSAYP----LKPT-NGLLDTCYDFSGYKTITVPKVAL  382

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS-YSTDG-GIFGNYQQQTFDVVYDVAGGQL  355
             F G + + L+  G++          CLAFS    D  GI GN QQ+TF+VVYDV   ++
Sbjct  383  HFDG-VTLDLNVSGIL-------RHDCLAFSGKQVDRLGIIGNVQQRTFEVVYDVGNERI  434

Query  356  GFASGGCS  379
            GFA   CS
Sbjct  435  GFAPHACS  442



>ref|XP_002283470.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Vitis 
vinifera]
Length=490

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 74/128 (58%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVI+RLP   Y++++  F++ M+ YP V     +   + DTCYD + Y    +P I  
Sbjct  369  SGTVISRLPPTVYSSVQKVFRELMSDYPRV-----KGVSILDTCYDLSKYKTVKVPKIIL  423

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G  E+ L P G++  L    S VCLAF+ ++D     I GN QQ+T  VVYD A G+
Sbjct  424  YFSGGAEMDLAPEGIIYVLKV--SQVCLAFAGNSDDDEVAIIGNVQQKTIHVVYDDAEGR  481

Query  353  LGFASGGC  376
            +GFA  GC
Sbjct  482  VGFAPSGC  489



>gb|KDO67372.1| hypothetical protein CISIN_1g011649mg [Citrus sinensis]
Length=480

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITR P P Y+ALR AF++ M  Y         ++ LFDTCYD + Y    +P I+ 
Sbjct  358  SGTIITRFPAPVYSALRSAFRKRMKKYK----MGKGIEDLFDTCYDLSAYKTVVVPKITI  413

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY---STDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +++ LD RG +  +      VCL F+      +  + GN QQ+ ++V YDVAG +
Sbjct  414  HFLGGVDLELDVRGTL--VVESVRQVCLGFALLPSDPNSILLGNVQQRGYEVHYDVAGRR  471

Query  353  LGFASGGCS  379
            LGF  G C+
Sbjct  472  LGFGPGNCN  480



>gb|KCW80526.1| hypothetical protein EUGRSUZ_C01880, partial [Eucalyptus grandis]
Length=463

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 74/123 (60%), Gaps = 10/123 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT  T LP  AYTAL+ AFK+ M  Y       P      DTCYDF+   + T+P I+F
Sbjct  348  SGTTFTYLPPTAYTALQSAFKEAMANYTSAPPALP-----LDTCYDFSMLSDITVPAITF  402

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G + V LD  G+   L+   S VCLAF   +  TD  I+GN QQ+TF+V+YDV GGQ
Sbjct  403  SFDGPINVDLDVSGMFYVLDP--SLVCLAFVANNADTDTVIYGNTQQRTFEVIYDVPGGQ  460

Query  353  LGF  361
            +GF
Sbjct  461  IGF  463



>ref|XP_003532146.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Glycine max]
Length=488

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AYTALR AF+Q M+ YP       +L  + DTCYD + Y   +IP I F
Sbjct  367  SGTVITRLPPTAYTALRSAFRQGMSKYPSA----GELS-ILDTCYDLSGYEVFSIPKIDF  421

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
            +F G + V L P+G++   +     VCLAF+ +   +D  I+GN QQ+T +VVYDV GG+
Sbjct  422  SFAGGVTVQLPPQGILYVAS--AKQVCLAFAANGDDSDVTIYGNVQQKTIEVVYDVGGGR  479

Query  353  LGFASGGC  376
            +GF +GGC
Sbjct  480  IGFGAGGC  487



>ref|XP_002966033.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
 gb|EFJ33453.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
Length=357

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 68/126 (54%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +TRLPT AYT +RDAF+      P           LFDTCYDF+   + TIP +SF
Sbjct  238  SGTSVTRLPTYAYTVMRDAFRSATQKLPRAAD-----FSLFDTCYDFSALTSVTIPTVSF  292

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY-STDGGIFGNYQQQTFDVVYDVAGGQLG  358
             F G   V L P   + P++  G+  C AFS  S D  I GN QQQT  V  D+   ++G
Sbjct  293  HFEGGASVQLPPSNYLVPVDTSGT-FCFAFSKTSLDLSIIGNIQQQTMRVAIDLDSSRVG  351

Query  359  FASGGC  376
            FA   C
Sbjct  352  FAPRQC  357



>ref|XP_002971459.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
 gb|EFJ27208.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
Length=357

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 68/126 (54%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT +TRLPT AYT +RDAF+      P           LFDTCYDF+   + TIP +SF
Sbjct  238  SGTSVTRLPTYAYTVMRDAFRSATQKLPRAAD-----FSLFDTCYDFSALTSVTIPTVSF  292

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY-STDGGIFGNYQQQTFDVVYDVAGGQLG  358
             F G   V L P   + P++  G+  C AFS  S D  I GN QQQT  V  D+   ++G
Sbjct  293  HFEGGASVQLPPSNYLVPVDTSGT-FCFAFSKTSLDLSIIGNIQQQTMRVAIDLDSSRVG  351

Query  359  FASGGC  376
            FA   C
Sbjct  352  FAPRQC  357



>emb|CDP18858.1| unnamed protein product [Coffea canephora]
Length=478

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 72/128 (56%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AYTAL   FKQ M  YP      P  +KL DTCYD T Y +  +P+I+ 
Sbjct  354  SGTVITYLPPSAYTALSKNFKQSMADYPPA----PSQEKL-DTCYDVTGYGSIRLPEITL  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFS---YSTDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG  +V L+P G++          CL F+    S D  I GN QQ+  D++YD+  G+
Sbjct  409  HFGGATDVSLNPSGIVWIAKKNPYIWCLGFAANKKSDDLTIIGNNQQRELDILYDIDAGK  468

Query  353  LGFASGGC  376
            +GF +  C
Sbjct  469  IGFGTKPC  476



>ref|XP_006660750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=483

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 73/128 (57%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR AF ++M  Y +     P L  + DTCYDFT +    IP ++ 
Sbjct  362  SGTVITRLPPRAYAALRSAFARYMGQYKKA----PALS-ILDTCYDFTGHATAQIPKVAL  416

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   + LD  GV+    +  S  CLAF+ + D     I GN QQ+TF V YDVA  +
Sbjct  417  LFEGGATMSLDFTGVL--YVSQVSQACLAFASNGDDTSIAILGNTQQKTFAVAYDVANQR  474

Query  353  LGFASGGC  376
            +GF + GC
Sbjct  475  IGFGANGC  482



>ref|XP_010266604.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=482

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 15/134 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTM--YPEVVLQQPQLKKLFDTCYDFTNYPNPTI--P  169
            SGTV+TRLP  AY ALR AF+Q M+   YP      P     +DTCYD + Y   T+  P
Sbjct  356  SGTVVTRLPPSAYDALRSAFRQVMSESNYPLAPPISP-----YDTCYDLSGYNIDTVNVP  410

Query  170  DISFTFGGNLEVHLDP-RGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYD  337
             I   F G+ ++ +DP  G +A L+   S  CLAF+ + D     IFGN QQ+TF+V+YD
Sbjct  411  SIVLHFDGDTDLQVDPFSGALAVLSE--SQACLAFAANIDDSQMVIFGNRQQRTFEVIYD  468

Query  338  VAGGQLGFASGGCS  379
            V G +LGFA G C+
Sbjct  469  VPGQRLGFAVGTCN  482



>ref|NP_001063501.1| Os09g0482200 [Oryza sativa Japonica Group]
 dbj|BAD33407.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAD33410.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAF25415.1| Os09g0482200 [Oryza sativa Japonica Group]
 gb|EAZ45148.1| hypothetical protein OsJ_29786 [Oryza sativa Japonica Group]
Length=485

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 71/129 (55%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  LR AF + M  Y +     P L  + DTCYDFT +    IP +  
Sbjct  364  SGTVITRLPPRAYAPLRAAFARSMAQYKKA----PALS-ILDTCYDFTGHRTAQIPTVEL  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  GV+    +  S  CLAF+ + D     I GN QQ+TF V YDVA  +
Sbjct  419  AFAGGATVSLDFTGVL--YVSKVSQACLAFAPNADDSSIAILGNTQQKTFAVAYDVANQR  476

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  477  IGFGAKGCS  485



>ref|XP_003561171.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brachypodium 
distachyon]
Length=506

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 70/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            S T+ITRLP  AY ALR AF+  M  Y  V       K   DTCYDFT  P   +P ++ 
Sbjct  391  SRTIITRLPPTAYMALRAAFRAQMRAYRAVAP-----KGQLDTCYDFTGVPMVRLPKVTL  445

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F  N  V LDP GVM  L++     CLAF+ + +    GI GN QQQT +V+Y+V G  
Sbjct  446  VFDRNAAVELDPSGVM--LDS-----CLAFAPNANDFMPGIIGNVQQQTLEVLYNVDGAS  498

Query  353  LGFASGGC  376
            +GF    C
Sbjct  499  VGFRRAAC  506



>ref|XP_010266605.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=470

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 15/134 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTM--YPEVVLQQPQLKKLFDTCYDFTNYPNPTI--P  169
            SGTV+TRLP  AY ALR AF+Q M+   YP      P     +DTCYD + Y   T+  P
Sbjct  344  SGTVVTRLPPSAYDALRSAFRQVMSESNYPLAPPISP-----YDTCYDLSGYNIDTVNVP  398

Query  170  DISFTFGGNLEVHLDP-RGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYD  337
             I   F G+ ++ +DP  G +A L+   S  CLAF+ + D     IFGN QQ+TF+V+YD
Sbjct  399  SIVLHFDGDTDLQVDPFSGALAVLSE--SQACLAFAANRDDSQMVIFGNRQQRTFEVIYD  456

Query  338  VAGGQLGFASGGCS  379
            V G +LGFA G C+
Sbjct  457  VPGQRLGFAVGTCN  470



>gb|EAZ09523.1| hypothetical protein OsI_31798 [Oryza sativa Indica Group]
Length=485

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 71/129 (55%), Gaps = 10/129 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY  LR AF + M  Y +     P L  + DTCYDFT +    IP +  
Sbjct  364  SGTVITRLPPRAYAPLRAAFARSMAQYKKA----PALS-ILDTCYDFTGHRTAQIPTVEL  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  GV+    +  S  CLAF+ + D     I GN QQ+TF V YDVA  +
Sbjct  419  AFAGGATVSLDFTGVL--YVSKVSQACLAFAPNADDSSIAILGNTQQKTFAVTYDVANQR  476

Query  353  LGFASGGCS  379
            +GF + GCS
Sbjct  477  IGFGAKGCS  485



>ref|XP_002873475.1| hypothetical protein ARALYDRAFT_909036 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49734.1| hypothetical protein ARALYDRAFT_909036 [Arabidopsis lyrata subsp. 
lyrata]
Length=292

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 7/117 (6%)
 Frame = +2

Query  35   AYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISFTFGGNLEVHLD  214
            AY AL+ AFK+ M+ Y        +L    DTCYDFT     TI  I+F+F G   V LD
Sbjct  181  AYAALKSAFKEKMSKYTITSSGDSEL----DTCYDFTGLKTVTITKIAFSFSGGTVVELD  236

Query  215  PRGVMAPLNNGGSAVCLAFSYSTDG--GIFGNYQQQTFDVVYDVAGGQLGFASGGCS  379
            P+G++   ++  S +CLAF+   D    IFG+ QQQT  VVYD  GG++GFA  GCS
Sbjct  237  PKGILYS-SSERSKLCLAFAEYPDDNVAIFGSVQQQTLQVVYDGVGGRVGFAPNGCS  292



>gb|EEE65583.1| hypothetical protein OsJ_21095 [Oryza sativa Japonica Group]
Length=441

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 75/129 (58%), Gaps = 14/129 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AY ALR AF+  M+ Y    L  P    + DTCYDFT + N T+P IS 
Sbjct  323  SGTVITGLPATAYAALRSAFRSAMSEY---RLLPPSNGGVLDTCYDFTGHANVTVPTISL  379

Query  182  TFGGNLEVHL-DPRGVMAPLNNGGSAVCLAFSYS-TDG--GIFGNYQQQTFDVVYDVAGG  349
            TF G   + L  P GV   L +G    CLAF+ + TD   GI GN  Q+TF+V+YD   G
Sbjct  380  TFSGGATIDLAAPAGV---LVDG----CLAFAGAGTDNAIGIIGNVNQRTFEVLYDSGKG  432

Query  350  QLGFASGGC  376
             +GF +G C
Sbjct  433  TVGFRAGAC  441



>gb|EEC71061.1| hypothetical protein OsI_02803 [Oryza sativa Indica Group]
Length=479

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY AL  AF+  MT Y      + +   + DTC++FT     +IP ++ 
Sbjct  364  SGTVITRLPPAAYAALSSAFRAGMTRY-----ARAEPLGILDTCFNFTGLDKVSIPTVAL  418

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             F G   V LD  G++       S  CLAF+ + D    G  GN QQ+TF+V+YDV GG 
Sbjct  419  VFAGGAVVDLDAHGIV-------SGGCLAFAPTRDDKAFGTIGNVQQRTFEVLYDVGGGV  471

Query  353  LGFASGGC  376
             GF +G C
Sbjct  472  FGFRAGAC  479



>gb|EMT19686.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=370

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 67/125 (54%), Gaps = 12/125 (10%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AY+AL  AF+  M  YP           + DTCYDFT   N ++P +  
Sbjct  258  SGTVITWLPRRAYSALSSAFRSGMRRYPRAAP-----VGILDTCYDFTGLSNVSVPTVEL  312

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGGIFGNYQQQTFDVVYDVAGGQLGF  361
             F G   + LD  G+M          CLAF+ ++D    GN QQ+TF+V++DV  G  GF
Sbjct  313  VFDGGAVMDLDSDGIMIEH-------CLAFAPTSDESFIGNVQQRTFEVLHDVGQGIFGF  365

Query  362  ASGGC  376
             SG C
Sbjct  366  RSGTC  370



>ref|XP_011036745.1| PREDICTED: aspartic proteinase nepenthesin-2-like, partial [Populus 
euphratica]
Length=238

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 72/130 (55%), Gaps = 10/130 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIP--DI  175
            SGT +T LP+ A++AL  AF++ MT Y                CYDF+   N  IP   I
Sbjct  114  SGTTLTFLPSTAHSALSSAFQEMMTNY-----TLTNGTSGLQPCYDFSKNANDNIPLPQI  168

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAG  346
            S  F G +EV +D  G++  +N G   +CLAF       D  IFGN QQ+T++VVYDVA 
Sbjct  169  SIFFEGGVEVDIDDSGILISVNGGLEEMCLAFIDNGNDKDLAIFGNLQQKTYEVVYDVAK  228

Query  347  GQLGFASGGC  376
            G +GFA  GC
Sbjct  229  GMVGFAPSGC  238



>ref|XP_008650536.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=578

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 14/129 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+IT LP  AY+ALR AF+  M+ YP   L  P    + DTCY+FT   N T+P ++ 
Sbjct  460  SGTIITGLPDTAYSALRTAFRTAMSAYP---LLPPNNDDVLDTCYNFTGIANVTVPTVAL  516

Query  182  TFGGNLEVHLD-PRGVMAPLNNGGSAVCLAFS-YSTDG--GIFGNYQQQTFDVVYDVAGG  349
            TF G   + LD P GV+          CLAF+  ++DG  GI GN  Q+TF+V+YD   G
Sbjct  517  TFDGGATIDLDVPSGVLI-------QDCLAFAGGASDGDVGIIGNVNQRTFEVLYDSGRG  569

Query  350  QLGFASGGC  376
             +GF  G C
Sbjct  570  HVGFRPGAC  578



>ref|XP_010266613.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=422

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+I+ LP  AY  LR+AF+  M+ YP     Q     +FDTCYD +     TIP I  
Sbjct  297  SGTIISYLPPSAYRILRNAFRAAMSGYPSAAPPQ----GVFDTCYDLSRNRTVTIPSIKL  352

Query  182  TFGGNLEVHLDP-RGVMAPLNNGGSAVCLAFSYSTDGG---IFGNYQQQTFDVVYDVAGG  349
             FGG +++ LD   GV+   N G S  CLAFS + D     I G+ QQ+T++V+YD+  G
Sbjct  353  NFGGGIDIPLDQYSGVIT--NVGASKFCLAFSANDDEEETTIIGSIQQKTYEVIYDIPRG  410

Query  350  QLGFASGG  373
            +LGF S G
Sbjct  411  RLGFRSVG  418



>gb|AFW77036.1| hypothetical protein ZEAMMB73_461996 [Zea mays]
Length=472

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 14/129 (11%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+IT LP  AY+ALR AF+  M+ YP   L  P    + DTCY+FT   N T+P ++ 
Sbjct  354  SGTIITGLPDTAYSALRTAFRTAMSAYP---LLPPNNDDVLDTCYNFTGIANVTVPTVAL  410

Query  182  TFGGNLEVHLD-PRGVMAPLNNGGSAVCLAFS-YSTDG--GIFGNYQQQTFDVVYDVAGG  349
            TF G   + LD P GV+          CLAF+  ++DG  GI GN  Q+TF+V+YD   G
Sbjct  411  TFDGGATIDLDVPSGVLI-------QDCLAFAGGASDGDVGIIGNVNQRTFEVLYDSGRG  463

Query  350  QLGFASGGC  376
             +GF  G C
Sbjct  464  HVGFRPGAC  472



>gb|EMT03324.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=140

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 67/127 (53%), Gaps = 15/127 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            S  VIT+LP  AY ALR AF+  M  YP     +       DTCYDF    N  +P +S 
Sbjct  3    SSAVITQLPPTAYRALRRAFRNAMRAYP-----RSGATGTLDTCYDFLGVANVRVPAVSL  57

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDG---GIFGNYQQQTFDVVYDVAGGQ  352
             FGG   V LDP  V+     GG   CLAF+ ++     G  GN QQQT +V+YDVA G 
Sbjct  58   VFGGGAVVVLDPPAVVL----GG---CLAFTATSSDLALGFIGNVQQQTHEVLYDVAAGG  110

Query  353  LGFASGG  373
            +GF  G 
Sbjct  111  VGFRRGA  117



>ref|XP_006483509.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Citrus sinensis]
 gb|KDO67373.1| hypothetical protein CISIN_1g011922mg [Citrus sinensis]
Length=475

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SG VITRLP+P Y ALR AF++ M  Y     +      + DTCYD   Y    +P I+ 
Sbjct  353  SGAVITRLPSPMYAALRSAFRKRMKKYK----RAKGAGDILDTCYDLRAYETVVVPKITI  408

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY---STDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +++ LD RG +   +   S VCL F+     T+  + GN QQ+  +V YDVAG +
Sbjct  409  HFLGGVDLELDVRGTLVVASV--SQVCLGFAVYPSDTNSFLLGNVQQRGHEVHYDVAGRR  466

Query  353  LGFASGGCS  379
            LGF  G CS
Sbjct  467  LGFGPGNCS  475



>dbj|BAK02683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 68/125 (54%), Gaps = 10/125 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT LP  AY+AL  AF+  MT       Q+     + DTCYDFT   N +IP +S 
Sbjct  342  SGTVITWLPRRAYSALSSAFRSSMTRLRH---QRAAPLGILDTCYDFTGLVNVSIPAVSL  398

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYSTDGGIFGNYQQQTFDVVYDVAGGQLGF  361
               G   V LD  G+M          CLAF+ ++   I GN QQ+TF+V++DV  G  GF
Sbjct  399  VLDGGAVVDLDGNGIMI-------QDCLAFAATSGDSIIGNVQQRTFEVLHDVGQGVFGF  451

Query  362  ASGGC  376
             SG C
Sbjct  452  RSGAC  456



>ref|XP_006483508.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Citrus sinensis]
Length=480

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGT+ITR P P Y+ALR AF++ M  Y         ++ LFDTCYD + Y    +P I+ 
Sbjct  358  SGTIITRFPAPVYSALRSAFRKRMKKYK----MGKGIEDLFDTCYDLSAYKTVVVPKITI  413

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSY---STDGGIFGNYQQQTFDVVYDVAGGQ  352
             F G +++ LD R  +  +      VCL F+      +  + GN QQ+ ++V YDVAG +
Sbjct  414  HFLGGVDLELDVRETL--VVESVRQVCLGFALLPSDPNSILLGNVQQRGYEVHYDVAGRR  471

Query  353  LGFASGGCS  379
            LGF  G CS
Sbjct  472  LGFGPGNCS  480



>ref|XP_008811141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=464

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVITRLP  AY ALR  F+Q M  Y       P L  + DTCYDFT Y   ++P +  
Sbjct  344  SGTVITRLPPSAYVALRSRFRQQMRKYKTA----PALS-ILDTCYDFTGYETVSVPTVEL  398

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYS---TDGGIFGNYQQQTFDVVYDVAGGQ  352
             FGG   ++LD  G++       S  CLAF+ +   +D  I GN QQ+  +VVYD+   Q
Sbjct  399  VFGGGTSINLDFAGILYVAKV--SQACLAFAGNGDVSDVTIIGNVQQRRVNVVYDIPKKQ  456

Query  353  LGFASGGC  376
            +GF +  C
Sbjct  457  IGFGAKSC  464



>ref|XP_002438291.1| hypothetical protein SORBIDRAFT_10g011210 [Sorghum bicolor]
 gb|EER89658.1| hypothetical protein SORBIDRAFT_10g011210 [Sorghum bicolor]
Length=464

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 72/128 (56%), Gaps = 15/128 (12%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIPDISF  181
            SGTVIT+LP  AY ALR AFK+ M  YP             DTC+DF+ +   T+P ++ 
Sbjct  349  SGTVITQLPPTAYQALRTAFKKEMKAYPSAAPVGS-----LDTCFDFSGFNTITVPTVTL  403

Query  182  TFGGNLEVHLDPRGVMAPLNNGGSAVCLAFSYST---DGGIFGNYQQQTFDVVYDVAGGQ  352
            TF     + LD  G++        A CLAF+ +    D GI GN QQ+TF++++DV G  
Sbjct  404  TFSRGAAMDLDISGILY-------AGCLAFTATAHDGDTGILGNVQQRTFEMLFDVGGRT  456

Query  353  LGFASGGC  376
            +GF SG C
Sbjct  457  IGFRSGAC  464



>ref|XP_011012148.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Populus euphratica]
Length=365

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 72/130 (55%), Gaps = 10/130 (8%)
 Frame = +2

Query  2    SGTVITRLPTPAYTALRDAFKQHMTMYPEVVLQQPQLKKLFDTCYDFTNYPNPTIP--DI  175
            SGT +T LP+ A++AL  AF++ MT Y                CYDF+   N  IP   I
Sbjct  241  SGTTLTFLPSTAHSALSSAFQEMMTNY-----TLTNGTSGLQPCYDFSKNANDNIPLPQI  295

Query  176  SFTFGGNLEVHLDPRGVMAPLNNGGSAVCLAF---SYSTDGGIFGNYQQQTFDVVYDVAG  346
            S  F G +EV +D  G++  +N G   VCLAF       D  IFGN QQ+T++VVYDVA 
Sbjct  296  SIFFEGGVEVDIDDSGILISVNGGLEEVCLAFIDNGNDKDLAIFGNLQQKTYEVVYDVAK  355

Query  347  GQLGFASGGC  376
            G +GFA  GC
Sbjct  356  GMVGFAPSGC  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 704648528304