BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22045_g1_i1 len=2119 path=[97:0-122 4462:123-218 315:219-221
318:222-275 4464:276-2118]

Length=2119
                                                                      Score     E

ref|XP_009607732.1|  PREDICTED: uncharacterized protein LOC104101...    495   1e-152   
ref|XP_009607731.1|  PREDICTED: uncharacterized protein LOC104101...    494   4e-152   
ref|XP_009607726.1|  PREDICTED: uncharacterized protein LOC104101...    494   4e-152   
ref|XP_009607730.1|  PREDICTED: uncharacterized protein LOC104101...    494   5e-152   
ref|XP_009782721.1|  PREDICTED: uncharacterized protein LOC104231421    476   2e-148   
ref|XP_010318021.1|  PREDICTED: uncharacterized protein LOC101253262    483   6e-147   
ref|XP_011069355.1|  PREDICTED: uncharacterized protein LOC105155189    441   7e-133   
ref|XP_010267595.1|  PREDICTED: uncharacterized protein LOC104604...    428   2e-128   
ref|XP_010267593.1|  PREDICTED: uncharacterized protein LOC104604...    428   2e-128   
ref|XP_010267594.1|  PREDICTED: uncharacterized protein LOC104604...    427   2e-128   
emb|CAN73471.1|  hypothetical protein VITISV_039356                     401   2e-121   Vitis vinifera
ref|XP_010662861.1|  PREDICTED: uncharacterized protein LOC100252...    400   1e-118   
emb|CBI23013.3|  unnamed protein product                                401   1e-118   
ref|XP_007039065.1|  Gamma-irradiation and mitomycin c induced 1,...    400   2e-118   
ref|XP_007039063.1|  Gamma-irradiation and mitomycin c induced 1,...    400   2e-118   
ref|XP_010662862.1|  PREDICTED: uncharacterized protein LOC100252...    398   3e-118   
ref|XP_010662860.1|  PREDICTED: uncharacterized protein LOC100252...    399   4e-118   
ref|XP_006493323.1|  PREDICTED: uncharacterized protein LOC102628...    391   3e-115   
ref|XP_006493320.1|  PREDICTED: uncharacterized protein LOC102628...    391   3e-115   
ref|XP_006441093.1|  hypothetical protein CICLE_v10018477mg             390   5e-115   
ref|XP_002318429.2|  hypothetical protein POPTR_0012s02310g             381   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011024837.1|  PREDICTED: uncharacterized protein LOC105125...    383   2e-112   
ref|XP_011024838.1|  PREDICTED: uncharacterized protein LOC105125...    383   2e-112   
ref|XP_008783195.1|  PREDICTED: uncharacterized protein LOC103702510    378   1e-110   
gb|KCW62609.1|  hypothetical protein EUGRSUZ_G00110                     368   2e-109   
ref|XP_010915961.1|  PREDICTED: uncharacterized protein LOC105040910    374   3e-109   
gb|KCW62600.1|  hypothetical protein EUGRSUZ_G00091                     367   4e-109   
ref|XP_010109257.1|  hypothetical protein L484_011879                   370   4e-108   
ref|XP_010027399.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    365   2e-106   
ref|XP_010067954.1|  PREDICTED: uncharacterized protein LOC104454747    365   3e-106   
ref|XP_004498513.1|  PREDICTED: uncharacterized protein LOC101490815    361   7e-105   
ref|XP_010027395.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    360   1e-104   
gb|KCW62380.1|  hypothetical protein EUGRSUZ_H05019                     354   1e-104   
ref|XP_010067951.1|  PREDICTED: uncharacterized protein LOC104454742    357   2e-103   
ref|XP_003588509.1|  hypothetical protein MTR_1g007990                  350   3e-103   
ref|XP_010038463.1|  PREDICTED: uncharacterized protein LOC104427005    350   4e-101   
ref|XP_010067964.1|  PREDICTED: uncharacterized protein LOC104454760    350   4e-101   
ref|XP_009607733.1|  PREDICTED: uncharacterized protein LOC104101...    329   6e-94    
gb|AES58766.2|  gamma-irradiation and mitomycin C induced protein...    329   8e-94    
ref|XP_004309137.1|  PREDICTED: uncharacterized protein LOC101291584    329   1e-93    
ref|XP_006394681.1|  hypothetical protein EUTSA_v10003513mg             326   1e-92    
ref|XP_009380586.1|  PREDICTED: uncharacterized protein LOC103968942    324   5e-92    
ref|XP_006286885.1|  hypothetical protein CARUB_v10000029mg             318   7e-90    
ref|XP_010495413.1|  PREDICTED: uncharacterized protein LOC104772508    316   2e-89    
dbj|BAB10394.1|  unnamed protein product                                316   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197816.3|  gamma-irradiation and mitomycin c induced 1           316   6e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KCW46562.1|  hypothetical protein EUGRSUZ_K003852                    300   8e-89    
ref|XP_010519440.1|  PREDICTED: uncharacterized protein LOC104798...    310   7e-87    
ref|XP_010519438.1|  PREDICTED: uncharacterized protein LOC104798...    310   7e-87    
ref|XP_002874183.1|  predicted protein                                  310   9e-87    
ref|XP_010519436.1|  PREDICTED: uncharacterized protein LOC104798...    306   2e-85    
ref|XP_006286349.1|  hypothetical protein CARUB_v10000030mg             306   2e-85    
ref|XP_010519439.1|  PREDICTED: uncharacterized protein LOC104798...    305   5e-85    
ref|XP_010519435.1|  PREDICTED: uncharacterized protein LOC104798...    304   7e-85    
ref|XP_010519434.1|  PREDICTED: uncharacterized protein LOC104798...    304   7e-85    
ref|XP_010519437.1|  PREDICTED: uncharacterized protein LOC104798...    304   7e-85    
ref|XP_006394682.1|  hypothetical protein EUTSA_v10003512mg             303   1e-84    
ref|XP_007039067.1|  Gamma-irradiation and mitomycin c induced 1,...    303   1e-84    
gb|EYU25236.1|  hypothetical protein MIMGU_mgv1a019692mg                297   1e-82    
emb|CDX88088.1|  BnaA06g26790D                                          297   2e-82    
ref|XP_009150949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    297   2e-82    
emb|CDX88084.1|  BnaA06g26750D                                          296   3e-82    
emb|CDX80426.1|  BnaC07g30180D                                          290   3e-80    
ref|XP_010456668.1|  PREDICTED: uncharacterized protein LOC104738142    290   7e-80    
emb|CDX80422.1|  BnaC07g30220D                                          286   9e-79    
dbj|BAB10393.1|  unnamed protein product                                275   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607734.1|  PREDICTED: uncharacterized protein LOC104101...    274   8e-75    
emb|CDP05057.1|  unnamed protein product                                271   1e-73    
ref|XP_010236672.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    268   2e-72    
ref|XP_006350630.1|  PREDICTED: uncharacterized protein LOC102601834    257   9e-69    
ref|XP_008234883.1|  PREDICTED: uncharacterized protein LOC103333768    233   2e-60    
ref|XP_007039064.1|  Gamma-irradiation and mitomycin c induced 1,...    220   2e-56    
ref|XP_007218895.1|  hypothetical protein PRUPE_ppa000400mg             216   3e-55    
gb|KDO54233.1|  hypothetical protein CISIN_1g0003663mg                  209   3e-54    
gb|KDO54232.1|  hypothetical protein CISIN_1g0003663mg                  209   2e-53    
ref|XP_010671900.1|  PREDICTED: uncharacterized protein LOC104888575    211   2e-53    
gb|KDO54229.1|  hypothetical protein CISIN_1g0003663mg                  209   5e-53    
gb|KDO54228.1|  hypothetical protein CISIN_1g0003663mg                  209   6e-53    
ref|XP_009357370.1|  PREDICTED: uncharacterized protein LOC103948098    207   2e-52    
ref|XP_008377037.1|  PREDICTED: uncharacterized protein LOC103440149    204   2e-52    
ref|XP_007147319.1|  hypothetical protein PHAVU_006G113900g             195   3e-52    
gb|KDO54234.1|  hypothetical protein CISIN_1g0003661mg                  192   1e-51    
ref|XP_007219447.1|  hypothetical protein PRUPE_ppa021059mg             194   2e-51    
ref|XP_009368768.1|  PREDICTED: uncharacterized protein LOC103958243    204   3e-51    
ref|XP_011024840.1|  PREDICTED: uncharacterized protein LOC105125...    202   8e-51    
ref|XP_007147320.1|  hypothetical protein PHAVU_006G113900g             191   8e-51    
gb|KEH24680.1|  defective in meristem silencing protein                 191   2e-50    
ref|XP_009625231.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    192   2e-50    
ref|XP_009625230.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    192   2e-50    
gb|KDO54231.1|  hypothetical protein CISIN_1g0003663mg                  201   2e-50    
ref|XP_010671438.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    191   7e-50    
ref|XP_009791513.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    189   2e-49    
ref|XP_003554769.1|  PREDICTED: uncharacterized protein LOC100794789    187   3e-49    
ref|XP_009607723.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    189   3e-49    
ref|XP_009625232.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    187   4e-49    
ref|XP_004494831.1|  PREDICTED: uncharacterized protein LOC101513030    186   4e-49    
ref|XP_009607725.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    189   5e-49    
emb|CDP04550.1|  unnamed protein product                                187   5e-49    
ref|XP_009607722.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    189   5e-49    
gb|KHG08560.1|  Bro-N domain-containing protein                         188   5e-49    
ref|XP_006429697.1|  hypothetical protein CICLE_v10011757mg             187   1e-48    
gb|EPS69220.1|  hypothetical protein M569_05551                         186   2e-48    
ref|XP_009791519.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    185   3e-48    
ref|XP_011044629.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    186   3e-48    
ref|XP_009774641.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    184   5e-48    
ref|XP_002516667.1|  conserved hypothetical protein                     184   5e-48    Ricinus communis
ref|XP_006600803.1|  PREDICTED: uncharacterized protein LOC100815144    192   1e-47    
ref|XP_006429696.1|  hypothetical protein CICLE_v10011757mg             182   1e-47    
ref|XP_008437605.1|  PREDICTED: uncharacterized protein LOC103482966    184   1e-47    
ref|XP_009774640.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    184   1e-47    
gb|KHN14095.1|  hypothetical protein glysoja_033322                     192   1e-47    
ref|XP_010267598.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    183   2e-47    
ref|XP_006376654.1|  hypothetical protein POPTR_0012s02300g             183   2e-47    
ref|XP_011084512.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    184   2e-47    
ref|XP_010267596.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    183   3e-47    
gb|KDP38261.1|  hypothetical protein JCGZ_05795                         183   3e-47    
ref|XP_002318428.2|  hypothetical protein POPTR_0012s02300g             183   3e-47    Populus trichocarpa [western balsam poplar]
ref|XP_009357310.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    183   3e-47    
gb|KCW62381.1|  hypothetical protein EUGRSUZ_H05027                     176   3e-47    
ref|XP_009368658.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    183   4e-47    
ref|XP_007039066.1|  Gamma-irradiation and mitomycin c induced 1,...    191   4e-47    
ref|XP_006429700.1|  hypothetical protein CICLE_v10011757mg             180   5e-47    
ref|XP_010109258.1|  hypothetical protein L484_011880                   185   5e-47    
ref|XP_008376714.1|  PREDICTED: uncharacterized protein LOC103439867    181   1e-46    
ref|XP_011024835.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    181   2e-46    
ref|XP_009150155.1|  PREDICTED: uncharacterized protein LOC103873495    180   2e-46    
ref|XP_010267600.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    178   2e-46    
ref|XP_010027405.1|  PREDICTED: uncharacterized protein LOC104417907    180   2e-46    
ref|XP_010267599.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    178   3e-46    
ref|XP_006481301.1|  PREDICTED: uncharacterized protein LOC102607...    178   3e-46    
emb|CDY00194.1|  BnaA06g20950D                                          179   3e-46    
ref|XP_010068987.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    180   5e-46    
gb|KEH24681.1|  defective in meristem silencing protein                 179   5e-46    
ref|XP_004145932.1|  PREDICTED: uncharacterized protein LOC101202858    179   7e-46    
ref|XP_002277586.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    179   7e-46    Vitis vinifera
emb|CDX86984.1|  BnaC03g52540D                                          178   8e-46    
ref|XP_010662859.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    179   8e-46    
ref|XP_006481298.1|  PREDICTED: uncharacterized protein LOC102630668    174   8e-46    
ref|XP_008380790.1|  PREDICTED: uncharacterized protein LOC103443673    179   9e-46    
gb|KCW57205.1|  hypothetical protein EUGRSUZ_H00020                     179   9e-46    
ref|XP_010519433.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    179   9e-46    
ref|XP_010519432.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    179   1e-45    
emb|CBI23012.3|  unnamed protein product                                179   3e-45    
ref|XP_007039062.1|  Defective in meristem silencing 3                  178   4e-45    
ref|XP_011080655.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    177   5e-45    
ref|XP_009352029.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    176   8e-45    
ref|XP_010519431.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    178   1e-44    
ref|XP_009349948.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    176   1e-44    
ref|XP_010519429.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    178   1e-44    
emb|CDY08119.1|  BnaA06g16070D                                          175   2e-44    
ref|XP_002877660.1|  hypothetical protein ARALYDRAFT_485283             174   2e-44    
ref|XP_003588515.1|  hypothetical protein MTR_1g008050                  182   2e-44    
emb|CDY05915.1|  BnaC08g20920D                                          174   3e-44    
ref|NP_001132336.1|  hypothetical protein                               173   5e-44    Zea mays [maize]
ref|XP_009381037.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    173   5e-44    
ref|XP_007219846.1|  hypothetical protein PRUPE_ppa027016mg             171   6e-44    
ref|XP_006291214.1|  hypothetical protein CARUB_v10017344mg             172   9e-44    
ref|XP_006404162.1|  hypothetical protein EUTSA_v10010429mg             172   9e-44    
ref|XP_009149755.1|  PREDICTED: uncharacterized protein LOC103873078    172   9e-44    
ref|XP_009381036.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    172   1e-43    
gb|KEH35455.1|  defective in meristem silencing protein                 172   1e-43    
gb|KFK34215.1|  hypothetical protein AALP_AA5G115500                    171   2e-43    
ref|XP_002321401.2|  hypothetical protein POPTR_0015s01490g             172   2e-43    Populus trichocarpa [western balsam poplar]
gb|KHN35383.1|  hypothetical protein glysoja_029013                     169   4e-43    
ref|XP_010318020.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    171   7e-43    
ref|XP_007136522.1|  hypothetical protein PHAVU_009G052300g             171   7e-43    
ref|XP_004234969.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    171   8e-43    
ref|XP_010915959.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    169   1e-42    
ref|XP_004502653.1|  PREDICTED: uncharacterized protein LOC101511352    169   1e-42    
gb|EEE54191.1|  hypothetical protein OsJ_01023                          169   2e-42    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042520.1|  Os01g0235200                                       169   2e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645689.1|  PREDICTED: uncharacterized protein LOC102704662    169   2e-42    
ref|XP_006350631.1|  PREDICTED: uncharacterized protein LOC102602167    170   2e-42    
ref|NP_566916.1|  protein defective in meristem silencing 3             168   3e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336764.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    166   4e-42    
ref|XP_008233132.1|  PREDICTED: uncharacterized protein LOC103332195    166   5e-42    
ref|XP_008376083.1|  PREDICTED: uncharacterized protein LOC103439318    166   6e-42    
ref|XP_004967373.1|  PREDICTED: uncharacterized protein LOC101755...    166   8e-42    
ref|XP_004967372.1|  PREDICTED: uncharacterized protein LOC101755...    166   9e-42    
ref|XP_004967374.1|  PREDICTED: uncharacterized protein LOC101755...    166   1e-41    
ref|XP_008466829.1|  PREDICTED: uncharacterized protein LOC103504141    166   1e-41    
ref|XP_002454876.1|  hypothetical protein SORBIDRAFT_03g000600          166   2e-41    Sorghum bicolor [broomcorn]
ref|XP_008783197.1|  PREDICTED: uncharacterized protein LOC103702...    166   2e-41    
gb|EEC70256.1|  hypothetical protein OsI_01056                          164   2e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_004306658.1|  PREDICTED: uncharacterized protein LOC101309380    164   2e-41    
ref|XP_010426429.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    166   3e-41    
ref|XP_006350539.1|  PREDICTED: uncharacterized protein LOC102601...    165   3e-41    
ref|XP_010515268.1|  PREDICTED: LOW QUALITY PROTEIN: protein DEFE...    165   3e-41    
ref|XP_008783198.1|  PREDICTED: uncharacterized protein LOC103702...    164   5e-41    
ref|XP_010503580.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    164   5e-41    
ref|XP_010503576.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    164   5e-41    
ref|XP_008783196.1|  PREDICTED: uncharacterized protein LOC103702...    164   6e-41    
ref|XP_004164774.1|  PREDICTED: uncharacterized protein LOC101228579    162   6e-41    
gb|ADN33744.1|  hypothetical protein                                    165   1e-40    
ref|XP_003523364.1|  PREDICTED: uncharacterized protein LOC100809...    164   1e-40    
ref|XP_006578904.1|  PREDICTED: uncharacterized protein LOC100809...    164   2e-40    
gb|KGN57665.1|  hypothetical protein Csa_3G239290                       164   2e-40    
ref|XP_002874182.1|  hypothetical protein ARALYDRAFT_351449             167   3e-40    
ref|XP_010322214.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    162   3e-40    
dbj|BAJ94830.1|  predicted protein                                      164   4e-40    
ref|XP_010671901.1|  PREDICTED: uncharacterized protein LOC104888577    168   6e-40    
ref|XP_006360207.1|  PREDICTED: uncharacterized protein LOC102585332    168   8e-40    
ref|XP_010322215.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    160   1e-39    
ref|XP_006581643.1|  PREDICTED: uncharacterized protein LOC100813482    158   2e-39    
gb|KGN65652.1|  hypothetical protein Csa_1G478600                       160   2e-39    
ref|XP_004309113.1|  PREDICTED: uncharacterized protein LOC101308826    161   2e-39    
gb|KCW60052.1|  hypothetical protein EUGRSUZ_H02781                     156   1e-38    
ref|XP_010322212.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    158   2e-38    
ref|XP_004149061.1|  PREDICTED: uncharacterized protein LOC101207120    158   2e-38    
ref|XP_010322213.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    158   2e-38    
gb|KDP28478.1|  hypothetical protein JCGZ_14249                         153   2e-38    
ref|XP_010493514.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    153   3e-38    
gb|EMT05096.1|  hypothetical protein F775_04749                         158   4e-38    
ref|XP_004165442.1|  PREDICTED: uncharacterized LOC101207120            157   5e-38    
ref|XP_004146267.1|  PREDICTED: uncharacterized protein LOC101206394    154   1e-37    
ref|XP_010322216.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    152   4e-37    
ref|XP_006852617.1|  hypothetical protein AMTR_s00021p00229230          153   4e-37    
ref|XP_010230664.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    152   3e-36    
ref|XP_010042908.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    144   6e-36    
gb|KHN19497.1|  hypothetical protein glysoja_027754                     147   7e-35    
ref|XP_006852618.1|  hypothetical protein AMTR_s00021p00230010          142   9e-34    
dbj|BAB01319.1|  unnamed protein product                                135   5e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783359.1|  predicted protein                                  143   1e-31    
gb|AFK47522.1|  unknown                                                 134   2e-31    
emb|CAB66404.1|  hypothetical protein                                   137   2e-31    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ74717.1|  At5g24280-like protein                                  130   4e-31    Arabidopsis lyrata [lyrate rockcress]
ref|XP_006852616.1|  hypothetical protein AMTR_s00021p00227450          140   5e-31    
ref|XP_011023169.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...    132   6e-30    
gb|AAZ74706.1|  At5g24280                                               124   3e-29    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ74715.1|  At5g24280                                               124   4e-29    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ74709.1|  At5g24280                                               124   4e-29    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ74705.1|  At5g24280                                               124   5e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302636.2|  hypothetical protein POPTR_0002s17300g             124   1e-27    Populus trichocarpa [western balsam poplar]
gb|AAZ74703.1|  At5g24280                                               120   1e-27    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ74701.1|  At5g24280                                               120   1e-27    Arabidopsis thaliana [mouse-ear cress]
gb|AAM97146.1|  putative protein                                        117   6e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002523333.1|  conserved hypothetical protein                     108   1e-22    Ricinus communis
ref|XP_010100726.1|  hypothetical protein L484_023495                   101   6e-20    
ref|XP_010027404.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...  96.7    1e-19    
ref|XP_004234924.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...  97.4    2e-19    
ref|XP_010317981.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...  98.2    9e-19    
gb|KFK32414.1|  hypothetical protein AALP_AA6G239100                  96.3    1e-18    
ref|XP_002874181.1|  hypothetical protein ARALYDRAFT_910454           89.0    8e-17    
ref|XP_004954816.1|  PREDICTED: uncharacterized protein LOC101764237  94.7    1e-16    
gb|KHG26772.1|  Uncharacterized protein F383_01873                    90.9    2e-16    
ref|XP_002994262.1|  hypothetical protein SELMODRAFT_432188           81.6    2e-12    
gb|ACU20405.1|  unknown                                               70.1    2e-10    Glycine max [soybeans]
ref|XP_010314893.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...  69.3    5e-10    
gb|KHN23363.1|  hypothetical protein glysoja_015665                   69.3    3e-09    
ref|XP_006429699.1|  hypothetical protein CICLE_v10011757mg           67.0    7e-09    
ref|XP_002973062.1|  hypothetical protein SELMODRAFT_98346            63.2    3e-08    
ref|XP_002984532.1|  hypothetical protein SELMODRAFT_423652           64.3    3e-07    
ref|XP_010915960.1|  PREDICTED: protein DEFECTIVE IN MERISTEM SIL...  58.9    4e-06    
ref|XP_006429704.1|  hypothetical protein CICLE_v10012614mg           58.2    5e-06    
emb|CAN63019.1|  hypothetical protein VITISV_022202                   56.2    4e-05    Vitis vinifera
ref|XP_006429703.1|  hypothetical protein CICLE_v10012614mg           54.3    4e-05    
ref|XP_010027407.1|  PREDICTED: uncharacterized protein LOC104417908  52.8    1e-04    
emb|CDY55605.1|  BnaC01g42620D                                        52.4    1e-04    
ref|XP_007039022.1|  Gamma-irradiation and mitomycin c induced 1-...  55.5    2e-04    



>ref|XP_009607732.1| PREDICTED: uncharacterized protein LOC104101890 isoform X4 [Nicotiana 
tomentosiformis]
Length=1628

 Score =   495 bits (1274),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 274/588 (47%), Positives = 386/588 (66%), Gaps = 15/588 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1016  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1075

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1076  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1135

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1136  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1195

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1196  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1252

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1253  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1312

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1313  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1371

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMIC  1260
              + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA  LG SING Y +IC
Sbjct  1372  SMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDILAAKLGISINGRYLVIC  1431

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
             L DIRPYT  +S      LA+  P L NGE+PPGFLGYAVNMI   A+HLQ RTASGHGL
Sbjct  1432  LEDIRPYT-RVSSDLLGELALPLPTLSNGETPPGFLGYAVNMIFPPAEHLQLRTASGHGL  1490

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFYRLLGELQVY +R+ + MASSC  +  AVSLDG +MRGNGV +  FG+P+I+FPV
Sbjct  1491  RETLFYRLLGELQVYESREHLYMASSCIEDG-AVSLDGGMMRGNGVVSVGFGEPYILFPV  1549

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                E Q+ L +   ++L  L+ KK++L ++Q+ I+ E    E+   K 
Sbjct  1550  IFPENQLPLSSDRVEILKQLEEKKLELSQMQDQIKEENRRREKYTRKL  1597



>ref|XP_009607731.1| PREDICTED: uncharacterized protein LOC104101890 isoform X3 [Nicotiana 
tomentosiformis]
Length=1681

 Score =   494 bits (1272),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 274/588 (47%), Positives = 386/588 (66%), Gaps = 15/588 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1069  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1128

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1129  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1188

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1189  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1248

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1249  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1305

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1306  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1365

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1366  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1424

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMIC  1260
              + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA  LG SING Y +IC
Sbjct  1425  SMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDILAAKLGISINGRYLVIC  1484

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
             L DIRPYT  +S      LA+  P L NGE+PPGFLGYAVNMI   A+HLQ RTASGHGL
Sbjct  1485  LEDIRPYT-RVSSDLLGELALPLPTLSNGETPPGFLGYAVNMIFPPAEHLQLRTASGHGL  1543

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFYRLLGELQVY +R+ + MASSC  +  AVSLDG +MRGNGV +  FG+P+I+FPV
Sbjct  1544  RETLFYRLLGELQVYESREHLYMASSCIEDG-AVSLDGGMMRGNGVVSVGFGEPYILFPV  1602

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                E Q+ L +   ++L  L+ KK++L ++Q+ I+ E    E+   K 
Sbjct  1603  IFPENQLPLSSDRVEILKQLEEKKLELSQMQDQIKEENRRREKYTRKL  1650



>ref|XP_009607726.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607727.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607728.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607729.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
Length=1704

 Score =   494 bits (1272),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 274/588 (47%), Positives = 386/588 (66%), Gaps = 15/588 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1092  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1151

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1152  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1211

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1212  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1271

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1272  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1328

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1329  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1388

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1389  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1447

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMIC  1260
              + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA  LG SING Y +IC
Sbjct  1448  SMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDILAAKLGISINGRYLVIC  1507

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
             L DIRPYT  +S      LA+  P L NGE+PPGFLGYAVNMI   A+HLQ RTASGHGL
Sbjct  1508  LEDIRPYT-RVSSDLLGELALPLPTLSNGETPPGFLGYAVNMIFPPAEHLQLRTASGHGL  1566

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFYRLLGELQVY +R+ + MASSC  +  AVSLDG +MRGNGV +  FG+P+I+FPV
Sbjct  1567  RETLFYRLLGELQVYESREHLYMASSCIEDG-AVSLDGGMMRGNGVVSVGFGEPYILFPV  1625

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                E Q+ L +   ++L  L+ KK++L ++Q+ I+ E    E+   K 
Sbjct  1626  IFPENQLPLSSDRVEILKQLEEKKLELSQMQDQIKEENRRREKYTRKL  1673



>ref|XP_009607730.1| PREDICTED: uncharacterized protein LOC104101890 isoform X2 [Nicotiana 
tomentosiformis]
Length=1703

 Score =   494 bits (1272),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 274/588 (47%), Positives = 386/588 (66%), Gaps = 15/588 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1091  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1150

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1151  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1210

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1211  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1270

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1271  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1327

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1328  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1387

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1388  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1446

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMIC  1260
              + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA  LG SING Y +IC
Sbjct  1447  SMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDILAAKLGISINGRYLVIC  1506

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
             L DIRPYT  +S      LA+  P L NGE+PPGFLGYAVNMI   A+HLQ RTASGHGL
Sbjct  1507  LEDIRPYT-RVSSDLLGELALPLPTLSNGETPPGFLGYAVNMIFPPAEHLQLRTASGHGL  1565

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFYRLLGELQVY +R+ + MASSC  +  AVSLDG +MRGNGV +  FG+P+I+FPV
Sbjct  1566  RETLFYRLLGELQVYESREHLYMASSCIEDG-AVSLDGGMMRGNGVVSVGFGEPYILFPV  1624

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                E Q+ L +   ++L  L+ KK++L ++Q+ I+ E    E+   K 
Sbjct  1625  IFPENQLPLSSDRVEILKQLEEKKLELSQMQDQIKEENRRREKYTRKL  1672



>ref|XP_009782721.1| PREDICTED: uncharacterized protein LOC104231421 [Nicotiana sylvestris]
Length=1264

 Score =   476 bits (1225),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 269/603 (45%), Positives = 373/603 (62%), Gaps = 44/603 (7%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVTAGYGK   LS+F
Sbjct  651   FDKYGNHMRKDEHIKLMLEGLCLLEKGDYFLKVDVHGCVNLNGTLKVTAGYGKPVFLSIF  710

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD+ V K+EFQ E R LR+AS+IP+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  711   SGDEVVLKKEFQTEERWLRVASKIPKVCAAGSHLEDIVFEVINSAGEVDEDIHDEEENGH  770

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + ++ ++ V+YSF HGRC VRSI LP++EG F F+A HSR+ ELQ  IE   
Sbjct  771   SHTLLIRQDSMRGEDNVKYSFSHGRCIVRSIPLPKNEGLFCFIANHSRFHELQTSIEAYV  830

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADH  747
             +K V                 N E E  Q R+ +K++    +S   KAP++ ++ +  D 
Sbjct  831   EKVV-----------------NSEHEIPQPRNLKKELMLLGDSYYSKAPEVVYEHTYDDF  873

Query  748   --------------------IVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTE  861
                                 + N   K L D++        + +  L+IL  ++SNI  E
Sbjct  874   SDGSILLLKDPCASAELEGGLQNQLEKKLVDDIFKCGLSINKRDANLKILRFRESNIVLE  933

Query  862   IFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEIL  1041
             + NL   IG  S  N    +  ++E+I G  D+AAA+  KL+ +P S  +LH ++A +IL
Sbjct  934   MSNLGAKIGPDSFHNLGYNRNMVVERIEGKADTAAAVVHKLLRSPISK-QLHLQYANDIL  992

Query  1042  VVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLA  1215
              VVALLG   +++LS + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA
Sbjct  993   GVVALLGEVHTHKLSSMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDMLA  1052

Query  1216  NNLGTSINGGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHI  1395
               LG SIN  Y +ICL ++RPYT  +S   Q  LA+  P L NGE+PPGF+GYAVN I +
Sbjct  1053  AKLGISINSRYLVICL-EVRPYTRGVSSDLQGELALPIPTLSNGETPPGFMGYAVNKIFL  1111

Query  1396  SAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
              A+HLQ RT SGHGLRETLFYRL G+LQVY +R+ + MASSC  +  AVSLDG +MRGNG
Sbjct  1112  PAEHLQLRTTSGHGLRETLFYRLFGKLQVYKSREHLYMASSCIEDG-AVSLDGGMMRGNG  1170

Query  1576  VTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEIN  1755
             V +  FG+P+I+FPV   E Q+ L +   ++L  L+ KK++L ++Q+ I+ E    E+  
Sbjct  1171  VVSVGFGEPYILFPVICPESQLPLSSDRVEILKQLEEKKLELSQMQDQIKEENRRREKYT  1230

Query  1756  NKF  1764
              K 
Sbjct  1231  RKL  1233



>ref|XP_010318021.1| PREDICTED: uncharacterized protein LOC101253262 [Solanum lycopersicum]
Length=1967

 Score =   483 bits (1243),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 269/578 (47%), Positives = 372/578 (64%), Gaps = 29/578 (5%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G    D+G    KVD +G +NL G LKVTAGYGK  SLSV 
Sbjct  1009  FDKYGNHMRKDEHIKLTLEGLHLLDKGNSFYKVDDHGCVNLSGTLKVTAGYGKLVSLSVL  1068

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD+ VFK+EFQ + R LR+AS++P+ C  GSHLE+++FEV+NS GEVDE I  + + G 
Sbjct  1069  SGDEVVFKKEFQTDRRSLRVASKVPKVCAAGSHLEDVVFEVVNSAGEVDEDIDSEIEDGH  1128

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ VRYSF  GRC VRSI LP +EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1129  SHTLQIRQDSLREEDNVRYSFHRGRCIVRSIPLPNNEGLFFFVASHSRFHELQTSIEVHV  1188

Query  568   KKAVEADSGYFQSQSPERQIL------NKEVENFQYRSAQKQIFPYENSSPYKAPKLEHD  729
             +KAV       Q +SP+++IL       K  E   + S   +I  + +S    A  +  D
Sbjct  1189  EKAV------IQPRSPKKEILLLEESNGKGPETVCHDSYDGRIMIFNDSC---ASMVLED  1239

Query  730   ESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
               +         L D++  Y    RQC+  ++ L  K+SNI+ E+ NL   IGL S  + 
Sbjct  1240  RQQK--------LGDDICRYGLCIRQCDANVESLSIKQSNIELEMSNLGAYIGLDSFHDL  1291

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                ++ IME+I G  DSAAA+  KL+ +P    +L+ ++A +IL VVALLG   +++LS 
Sbjct  1292  FYDKDVIMEKIEGKADSAAAVIHKLLRSPKPE-QLYLKYAHDILGVVALLGEVRTHKLSS  1350

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGAS--KMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L+ YLGE QMLA+VC + A++      +M G ++   AL  LA  LG SI G Y +ICL
Sbjct  1351  MLSTYLGEDQMLAIVCKSRAAARALENYQMDGNVNCGSALDILAAKLGISIKGRYLVICL  1410

Query  1264  NDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
              DIRPY   +S  PQR LAI +P L N E+PPGFLGYAVNMI + A++LQ+RTASG+GLR
Sbjct  1411  EDIRPYKQGVSSDPQRELAIPQPTLSNRETPPGFLGYAVNMIFLPAEYLQFRTASGYGLR  1470

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG--DPFIMFP  1617
             ETLFYRLLG+LQVY +R+ + MASSC  +  AVSLDG +MRGNGV + + G  DP+I+FP
Sbjct  1471  ETLFYRLLGKLQVYKSREQLYMASSCIEDG-AVSLDGGMMRGNGVISASVGSEDPYILFP  1529

Query  1618  VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE  1731
             +   E+Q+ L     + L  ++  K++  ++Q+ I+ E
Sbjct  1530  IICLERQLLLSPEKVERLKRIEELKLEQNQLQDRIQEE  1567


 Score =   162 bits (411),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 163/297 (55%), Gaps = 15/297 (5%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--------  921
             LED +       +  +  ++ L+ +K+ +   I +LE ++  + S +   ++        
Sbjct  1645  LEDAIEETGLQIKHHDDNIKFLEGQKNRLDDSILDLEAALAKTYSASGTGSENKESSNGQ  1704

Query  922   --ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E  +EQI     SAAAI  +L +   + +  +  F K+I+ +VALLG  +   LSR L
Sbjct  1705  NEEETIEQILSFDKSAAAICVQLQKRTGAQIT-NIPFMKDIVGIVALLGKVDDDNLSRTL  1763

Query  1096  AEYLGEKQMLAVVCNA--HASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             ++YLG+  MLA+VC       ++      G +  +  L  +  ++G  ++  Y +ICL +
Sbjct  1764  SDYLGQGTMLAIVCKTLDGLKALETYDKEGLIIKSSGLHGVGASIGRPLDDRYLVICLEN  1823

Query  1270  IRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPYT E ++  PQRRL+I KP   NG++ PGFLG+AVNMI+I   +L   T++GHGLRE
Sbjct  1824  LRPYTSEFIADDPQRRLSIKKPRYVNGKTLPGFLGFAVNMINIDTDNLYCVTSNGHGLRE  1883

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             TLFY L  +LQVY  R  M M +  F    A+SLDG I++  G+ +    +  I FP
Sbjct  1884  TLFYGLFSQLQVYKTRADM-MQALPFIAGGAISLDGGIIKSAGIFSLGKREVQIKFP  1939



>ref|XP_011069355.1| PREDICTED: uncharacterized protein LOC105155189 [Sesamum indicum]
Length=1640

 Score =   441 bits (1133),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 272/648 (42%), Positives = 362/648 (56%), Gaps = 75/648 (12%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLM---------CKVDKNGFINLGGVLKVTAG  177
             + DEY NH ++DE+I L +DGF   D+  ++          KV  NGF+ L   LKV+ G
Sbjct  1007  VFDEYGNHAKEDEKILLSLDGFSFQDESNILHDGGVMYYVKKVAANGFVELSNSLKVSKG  1066

Query  178   YGKKASLSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDE  357
             YGK   LS    D+ +F   FQ E RE+R AS++ ++C  GS LENI+FEV+N EGEVDE
Sbjct  1067  YGKDVLLSATFRDRVIFTLNFQTEKREIRTASKVFKNCEAGSQLENIVFEVVNPEGEVDE  1126

Query  358   SIHDDEKSGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYM  537
             SIHD+EK GQ HTLTIKS    ID++VRYSF HGRCT+RSI LP  EG F F AVH RY 
Sbjct  1127  SIHDEEKHGQSHTLTIKSNSFDIDDSVRYSFRHGRCTIRSIPLPHKEGIFSFSAVHFRYP  1186

Query  538   ELQLRIEVNTKKAVE---ADSGYFQS----------------------------------  606
             EL L IEV+ +K  +   A+ G ++                                   
Sbjct  1187  ELNLDIEVHVEKTWQGNFAEMGNYEDEGNPIFSPQNSCQENLLSLPHSPAPKVPEVVNRS  1246

Query  607   ---QSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDE  777
                QS  R ++N+   +   +S+ + + P       K PKLE     +D I     LED+
Sbjct  1247  LSPQSSSRYVVNR---SLSPQSSSRYVLPIGYLPSPKTPKLESRNENSD-ISPILELEDD  1302

Query  778   VIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI-GLSSSQNCCCTQESIMEQISGMG  954
             + +        E  ++IL++++S+I+  I  L+ SI G   +    C +E I +QI    
Sbjct  1303  LTNCGMRKMGRERNIEILNTRRSHIEQHISVLQASIDGDLRNATRTCAKELIQKQIESKS  1362

Query  955   DSAAAIACKLI-ETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAV  1131
              SA+A+ C+L  E P  S        ++IL +VALLG  ES E+SRILA+YLGE QM A+
Sbjct  1363  QSASAVICRLHEEVPFESR------PRDILGIVALLGTVESIEISRILAQYLGEDQMRAI  1416

Query  1132  VCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIGPQR  1311
             VC  +A++        +    + L  LA   G SI+GGY  +CL D+RP T   S  PQ 
Sbjct  1417  VCKNYAAA--------HCLETNTLHELATKFGKSISGGYLALCLEDVRPITSGPSTNPQE  1468

Query  1312  RLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYAN  1491
              L + KP LPNG+ P GF+GYAVNMI   A +L++RT SGHGLRETLFYRL GELQVY N
Sbjct  1469  LLPLQKPTLPNGDVPQGFIGYAVNMISTEASYLRWRTKSGHGLRETLFYRLFGELQVYRN  1528

Query  1492  RDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVL  1671
             RDCM  A SC  N  AVSLDG IMRGNG+ +    +P I+FPV    Q   L   +   L
Sbjct  1529  RDCMMSAQSCIKNG-AVSLDGGIMRGNGLVSLGHWEPDILFPV----QDKALTPQSLKSL  1583

Query  1672  NLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVN-LTQGSSS  1812
              +L+ KK +L E+   I+ E  A E+   K    RD Y + ++Q  SS
Sbjct  1584  QMLERKKRELTELNRQIDEESKALEQDRIKLEMSRDRYNSYMSQNGSS  1631



>ref|XP_010267595.1| PREDICTED: uncharacterized protein LOC104604778 isoform X3 [Nelumbo 
nucifera]
Length=1557

 Score =   428 bits (1100),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 263/591 (45%), Positives = 367/591 (62%), Gaps = 38/591 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCA-YDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLS  201
             MLD+Y NH+Q+ +EI L +DG    Y++G +  KVD  G++NL G+LKVT  YGK  SLS
Sbjct  963   MLDDYGNHLQEGDEILLNVDGLSVQYNKGSVY-KVDDRGYLNLSGLLKVTGSYGKTVSLS  1021

Query  202   VFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKS  381
             VF  +K +FK+EFQ+E RELRIAS++P+ C  G  LENI+FEV++SEG VD++IHDD K 
Sbjct  1022  VFLNEKMLFKKEFQVEKRELRIASKVPDYCAAGGQLENIMFEVVDSEGVVDQTIHDDVKC  1081

Query  382   GQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEV  561
             GQ HTLTIKSE   ID+TVRY+F HGRCT+  I +P ++G F  +A HS + EL   IEV
Sbjct  1082  GQSHTLTIKSESSGIDDTVRYTFQHGRCTIPFIIVPHEQGIFRLLAAHSHHPELHQNIEV  1141

Query  562   NTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEA  741
             +  K          +  PE    + +V   QY S +K +FP  +SSPY      H  S  
Sbjct  1142  HVTK----------TPKPE----HDDVAQSQY-SDEKTLFP-RDSSPYDM----HMVSIV  1181

Query  742   DHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---LSSSQNC  909
             + I+N  K LE  V +        E +L++L+ KK + + +I+NLE  +    LS   N 
Sbjct  1182  ETIINQEKDLEGNVCNIGSRVGDHERKLKMLNEKKESTEQDIYNLEALMAPQLLSQLDNV  1241

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE---FAKEILVVVALLGFAESYE  1080
                +E I+++I     +AAA+ C      S +V+L      F ++++ VVALLG  +S +
Sbjct  1242  LNEKEIIVKRIERKVGTAAAVLCNF----SKAVQLQEPQDYFKQDMVGVVALLGTVDSND  1297

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LSRI AEYLGE+ MLAVVC ++  ASS+   + +G +    AL   A  LG SING + +
Sbjct  1298  LSRIFAEYLGEENMLAVVCKSYAAASSLEKYEKNGKIDPEHALHATAAALGKSINGRFLV  1357

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL DIRPY+G+ ++  PQR+LA+ +P LP+G   PGFLGYAVNMI++   HL+ RTA G
Sbjct  1358  ICLEDIRPYSGKFVANDPQRKLALSEPLLPSGNIAPGFLGYAVNMINLDIHHLKTRTAKG  1417

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIM  1611
             HGLRETLFY L GEL VY  RD M  A + +  + AVSLDG IM+G+GV +  + +P + 
Sbjct  1418  HGLRETLFYLLFGELHVYDTRDHMIHARA-YAKHGAVSLDGGIMKGSGVISLGYCEPEVC  1476

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
             FPV + E Q        ++L  ++ K++ L   +++I  E MA+ E   KF
Sbjct  1477  FPVIT-EVQTCFPPHTMEILKQIEDKRLALEVTRDEIVKESMAHAEALKKF  1526



>ref|XP_010267593.1| PREDICTED: uncharacterized protein LOC104604778 isoform X1 [Nelumbo 
nucifera]
Length=1586

 Score =   428 bits (1100),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 263/591 (45%), Positives = 367/591 (62%), Gaps = 38/591 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCA-YDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLS  201
             MLD+Y NH+Q+ +EI L +DG    Y++G +  KVD  G++NL G+LKVT  YGK  SLS
Sbjct  992   MLDDYGNHLQEGDEILLNVDGLSVQYNKGSVY-KVDDRGYLNLSGLLKVTGSYGKTVSLS  1050

Query  202   VFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKS  381
             VF  +K +FK+EFQ+E RELRIAS++P+ C  G  LENI+FEV++SEG VD++IHDD K 
Sbjct  1051  VFLNEKMLFKKEFQVEKRELRIASKVPDYCAAGGQLENIMFEVVDSEGVVDQTIHDDVKC  1110

Query  382   GQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEV  561
             GQ HTLTIKSE   ID+TVRY+F HGRCT+  I +P ++G F  +A HS + EL   IEV
Sbjct  1111  GQSHTLTIKSESSGIDDTVRYTFQHGRCTIPFIIVPHEQGIFRLLAAHSHHPELHQNIEV  1170

Query  562   NTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEA  741
             +  K          +  PE    + +V   QY S +K +FP  +SSPY      H  S  
Sbjct  1171  HVTK----------TPKPE----HDDVAQSQY-SDEKTLFP-RDSSPYDM----HMVSIV  1210

Query  742   DHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---LSSSQNC  909
             + I+N  K LE  V +        E +L++L+ KK + + +I+NLE  +    LS   N 
Sbjct  1211  ETIINQEKDLEGNVCNIGSRVGDHERKLKMLNEKKESTEQDIYNLEALMAPQLLSQLDNV  1270

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE---FAKEILVVVALLGFAESYE  1080
                +E I+++I     +AAA+ C      S +V+L      F ++++ VVALLG  +S +
Sbjct  1271  LNEKEIIVKRIERKVGTAAAVLCNF----SKAVQLQEPQDYFKQDMVGVVALLGTVDSND  1326

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LSRI AEYLGE+ MLAVVC ++  ASS+   + +G +    AL   A  LG SING + +
Sbjct  1327  LSRIFAEYLGEENMLAVVCKSYAAASSLEKYEKNGKIDPEHALHATAAALGKSINGRFLV  1386

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL DIRPY+G+ ++  PQR+LA+ +P LP+G   PGFLGYAVNMI++   HL+ RTA G
Sbjct  1387  ICLEDIRPYSGKFVANDPQRKLALSEPLLPSGNIAPGFLGYAVNMINLDIHHLKTRTAKG  1446

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIM  1611
             HGLRETLFY L GEL VY  RD M  A + +  + AVSLDG IM+G+GV +  + +P + 
Sbjct  1447  HGLRETLFYLLFGELHVYDTRDHMIHARA-YAKHGAVSLDGGIMKGSGVISLGYCEPEVC  1505

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
             FPV + E Q        ++L  ++ K++ L   +++I  E MA+ E   KF
Sbjct  1506  FPVIT-EVQTCFPPHTMEILKQIEDKRLALEVTRDEIVKESMAHAEALKKF  1555



>ref|XP_010267594.1| PREDICTED: uncharacterized protein LOC104604778 isoform X2 [Nelumbo 
nucifera]
Length=1570

 Score =   427 bits (1099),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 263/591 (45%), Positives = 367/591 (62%), Gaps = 38/591 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCA-YDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLS  201
             MLD+Y NH+Q+ +EI L +DG    Y++G +  KVD  G++NL G+LKVT  YGK  SLS
Sbjct  976   MLDDYGNHLQEGDEILLNVDGLSVQYNKGSVY-KVDDRGYLNLSGLLKVTGSYGKTVSLS  1034

Query  202   VFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKS  381
             VF  +K +FK+EFQ+E RELRIAS++P+ C  G  LENI+FEV++SEG VD++IHDD K 
Sbjct  1035  VFLNEKMLFKKEFQVEKRELRIASKVPDYCAAGGQLENIMFEVVDSEGVVDQTIHDDVKC  1094

Query  382   GQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEV  561
             GQ HTLTIKSE   ID+TVRY+F HGRCT+  I +P ++G F  +A HS + EL   IEV
Sbjct  1095  GQSHTLTIKSESSGIDDTVRYTFQHGRCTIPFIIVPHEQGIFRLLAAHSHHPELHQNIEV  1154

Query  562   NTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEA  741
             +  K          +  PE    + +V   QY S +K +FP  +SSPY      H  S  
Sbjct  1155  HVTK----------TPKPE----HDDVAQSQY-SDEKTLFP-RDSSPYDM----HMVSIV  1194

Query  742   DHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---LSSSQNC  909
             + I+N  K LE  V +        E +L++L+ KK + + +I+NLE  +    LS   N 
Sbjct  1195  ETIINQEKDLEGNVCNIGSRVGDHERKLKMLNEKKESTEQDIYNLEALMAPQLLSQLDNV  1254

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE---FAKEILVVVALLGFAESYE  1080
                +E I+++I     +AAA+ C      S +V+L      F ++++ VVALLG  +S +
Sbjct  1255  LNEKEIIVKRIERKVGTAAAVLCNF----SKAVQLQEPQDYFKQDMVGVVALLGTVDSND  1310

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LSRI AEYLGE+ MLAVVC ++  ASS+   + +G +    AL   A  LG SING + +
Sbjct  1311  LSRIFAEYLGEENMLAVVCKSYAAASSLEKYEKNGKIDPEHALHATAAALGKSINGRFLV  1370

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL DIRPY+G+ ++  PQR+LA+ +P LP+G   PGFLGYAVNMI++   HL+ RTA G
Sbjct  1371  ICLEDIRPYSGKFVANDPQRKLALSEPLLPSGNIAPGFLGYAVNMINLDIHHLKTRTAKG  1430

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIM  1611
             HGLRETLFY L GEL VY  RD M  A + +  + AVSLDG IM+G+GV +  + +P + 
Sbjct  1431  HGLRETLFYLLFGELHVYDTRDHMIHARA-YAKHGAVSLDGGIMKGSGVISLGYCEPEVC  1489

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
             FPV + E Q        ++L  ++ K++ L   +++I  E MA+ E   KF
Sbjct  1490  FPVIT-EVQTCFPPHTMEILKQIEDKRLALEVTRDEIVKESMAHAEALKKF  1539



>emb|CAN73471.1| hypothetical protein VITISV_039356 [Vitis vinifera]
Length=1117

 Score =   401 bits (1031),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 244/578 (42%), Positives = 329/578 (57%), Gaps = 45/578 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH ++  E++  +DGFC  D   L  KVD  G I+L G+L+VT GYGK  SLSV
Sbjct  162   MFDAYGNHAREGLEVQFNVDGFCFQDHNGLKRKVDDRGCIDLSGLLRVTTGYGKNVSLSV  221

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG+K VFKQE Q E RELR AS +P+ C  GS LENI+FE+INS+GEVDE++H++EK G
Sbjct  222   LSGNKVVFKQELQTEKRELRAASIVPQSCAAGSQLENIVFEIINSKGEVDETVHEEEKHG  281

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTI S+   +D +VR++F +GRC + +I LP  +G F F+A HS + EL L ++V+
Sbjct  282   QFHTLTIMSDSFYLDGSVRFAFRNGRCIIPTIPLPRKQGDFTFLAAHSCHPELSLAVKVS  341

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               + ++      Q Q P   +L       Q   A + +   ENS       L +DE E  
Sbjct  342   VVEVLKVKQEDVQLQYPNENML-----LLQDSPAPRHV---ENSL---VESLMNDEKE--  388

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---CCC  915
                    +ED++          E +L++L  +K +I+  I  L+ S+   S  N      
Sbjct  389   -------IEDDICKIGLFIGDNERKLELLHKQKGDIEQSIEKLQASVEYDSFNNHRGYLS  441

Query  916   TQESIMEQISGMGDSAAAIACKL-----IETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              +ES+M  I     SAAA  C L      + P S      +  K+I+ VVALL       
Sbjct  442   KKESVMRCIEKKDKSAAAFFCNLSREIPFQDPVS------QLMKDIVGVVALLATVRINR  495

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             L R+LAEYLGE QMLAVVC ++  AS +   +  G +    AL  +A   G  IN  + +
Sbjct  496   LGRMLAEYLGEDQMLAVVCRSYEAASKLEKYEWDGKVDREHALYAVAKTFGKPINDRFLV  555

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL +IRPY G      PQR+L I  P LP GE PPGFLGYAVNM+ + + HL  RT +G
Sbjct  556   ICLENIRPYIGGFQDNDPQRKLNIPNPILPTGEMPPGFLGYAVNMVDLESHHLLTRTTAG  615

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCF-NNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             HGLRETLFY L GELQVY  R+   M  +CF   + AVSLDG IM+GNGV +    +P I
Sbjct  616   HGLRETLFYCLFGELQVYQTRE--DMKKACFYARHGAVSLDGGIMKGNGVISFGCREPQI  673

Query  1609  MFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
              FPV + E   N+      +L +++ K+  LR V N+I
Sbjct  674   WFPVANLESPKNVR-----ILEVIEEKRTSLRLVHNEI  706


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 20/153 (13%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG-------  888
             S+A+  VN+ K L+DE+       +Q E  ++ L ++K N+   I +L+ ++G       
Sbjct  798   SKAESAVNNSKKLQDELQTLGFKIKQHEDNIKYLKTQKDNLDGSILDLQVTLGKYCSSSI  857

Query  889   -------LSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVV  1047
                    LS S+    ++   +EQI     SAAAI C+L +    S   H   AK++L +
Sbjct  858   PTMENEALSKSR----SENETVEQILKYEKSAAAILCQL-KIRHGSQASHLTLAKDVLGI  912

Query  1048  VALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             VA LG  +   LSR+ +EYLG + M+A+VC  +
Sbjct  913   VATLGKVDDENLSRLFSEYLGLETMMAIVCKTY  945


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 73/147 (50%), Gaps = 5/147 (3%)
 Frame = +1

Query  1372  YAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD  1551
             + VNMI++ + ++   T+SG GLRETLFY L   LQVY  R  M +A  C  +  A+SLD
Sbjct  956   FEVNMINVDSANILCLTSSGCGLRETLFYNLFSRLQVYRTRAEMLLALPCITDG-ALSLD  1014

Query  1552  GVIMRGNGV-TTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIEN  1728
             G +++  GV +  +  D  + FP   K    NL     +    L     +  +V+ DI+ 
Sbjct  1015  GGMIKTAGVFSLGSREDVEVRFP---KSSGSNLPLEYFETEKELTEVNWKREKVEEDIQR  1071

Query  1729  ERMAYEEINNKFIGFRDAYVNLTQGSS  1809
             E+     IN  F   + A++     SS
Sbjct  1072  EQSLLNHINYTFRIKKQAFIKYLADSS  1098



>ref|XP_010662861.1| PREDICTED: uncharacterized protein LOC100252197 isoform X2 [Vitis 
vinifera]
Length=1610

 Score =   400 bits (1029),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 244/578 (42%), Positives = 329/578 (57%), Gaps = 45/578 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH ++  E++  +DGFC  D   L  KVD  G I+L G+L+VT GYGK  SLSV
Sbjct  1014  MFDAYGNHAREGLEVQFNVDGFCFQDHNGLKRKVDDRGCIDLSGLLRVTTGYGKNVSLSV  1073

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG+K VFKQE Q E RELR AS +P+ C  GS LENI+FE+INS+GEVDE++H++EK G
Sbjct  1074  LSGNKVVFKQELQTEKRELRAASIVPQSCAAGSQLENIVFEIINSKGEVDETVHEEEKHG  1133

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTI S+   +D +VR++F +GRC + +I LP  +G F F+A HS + EL L ++V+
Sbjct  1134  QFHTLTIMSDSFYLDGSVRFAFRNGRCIIPTIPLPRKQGDFTFLAAHSCHPELSLAVKVS  1193

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               + ++      Q Q P   +L       Q   A + +   ENS       L +DE E  
Sbjct  1194  VVEVLKVKQEDVQLQYPNENML-----LLQDSPAPRHV---ENSL---VESLMNDEKE--  1240

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---CCC  915
                    +ED++          E +L++L  +K +I+  I  L+ S+   S  N      
Sbjct  1241  -------IEDDICKIGLFIGDNERKLELLHKQKGDIEQSIEKLQASVEYDSFNNHRGYLS  1293

Query  916   TQESIMEQISGMGDSAAAIACKL-----IETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              +ES+M  I     SAAA  C L      + P S      +  K+I+ VVALL       
Sbjct  1294  KKESVMRCIEKKDKSAAAFFCNLSREIPFQDPVS------QLMKDIVGVVALLATVRINR  1347

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             L R+LAEYLGE QMLAVVC ++  AS +   +  G +    AL  +A   G  IN  + +
Sbjct  1348  LGRMLAEYLGEDQMLAVVCRSYEAASKLEKYEWDGKVDREHALYAVAKTFGKPINDRFLV  1407

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL +IRPY G      PQR+L I  P LP GE PPGFLGYAVNM+ + + HL  RT +G
Sbjct  1408  ICLENIRPYIGGFQDNDPQRKLNIPNPILPTGEMPPGFLGYAVNMVDLESHHLLTRTTAG  1467

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCF-NNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             HGLRETLFY L GELQVY  R+   M  +CF   + AVSLDG IM+GNGV +    +P I
Sbjct  1468  HGLRETLFYCLFGELQVYQTRE--DMKKACFYARHGAVSLDGGIMKGNGVISFGCREPQI  1525

Query  1609  MFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
              FPV + E   N+      +L +++ K+  LR V N+I
Sbjct  1526  WFPVANLESPKNVR-----ILEVIEEKRTSLRLVHNEI  1558



>emb|CBI23013.3| unnamed protein product [Vitis vinifera]
Length=1718

 Score =   401 bits (1030),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 244/579 (42%), Positives = 330/579 (57%), Gaps = 45/579 (8%)
 Frame = +1

Query  22    WMLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLS  201
             +M D Y NH ++  E++  +DGFC  D   L  KVD  G I+L G+L+VT GYGK  SLS
Sbjct  1121  FMFDAYGNHAREGLEVQFNVDGFCFQDHNGLKRKVDDRGCIDLSGLLRVTTGYGKNVSLS  1180

Query  202   VFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKS  381
             V SG+K VFKQE Q E RELR AS +P+ C  GS LENI+FE+INS+GEVDE++H++EK 
Sbjct  1181  VLSGNKVVFKQELQTEKRELRAASIVPQSCAAGSQLENIVFEIINSKGEVDETVHEEEKH  1240

Query  382   GQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEV  561
             GQ HTLTI S+   +D +VR++F +GRC + +I LP  +G F F+A HS + EL L ++V
Sbjct  1241  GQFHTLTIMSDSFYLDGSVRFAFRNGRCIIPTIPLPRKQGDFTFLAAHSCHPELSLAVKV  1300

Query  562   NTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEA  741
             +  + ++      Q Q P   +L       Q   A + +   ENS       L +DE E 
Sbjct  1301  SVVEVLKVKQEDVQLQYPNENML-----LLQDSPAPRHV---ENSL---VESLMNDEKE-  1348

Query  742   DHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---CC  912
                     +ED++          E +L++L  +K +I+  I  L+ S+   S  N     
Sbjct  1349  --------IEDDICKIGLFIGDNERKLELLHKQKGDIEQSIEKLQASVEYDSFNNHRGYL  1400

Query  913   CTQESIMEQISGMGDSAAAIACKL-----IETPSSSVELHHEFAKEILVVVALLGFAESY  1077
               +ES+M  I     SAAA  C L      + P S      +  K+I+ VVALL      
Sbjct  1401  SKKESVMRCIEKKDKSAAAFFCNLSREIPFQDPVS------QLMKDIVGVVALLATVRIN  1454

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              L R+LAEYLGE QMLAVVC ++  AS +   +  G +    AL  +A   G  IN  + 
Sbjct  1455  RLGRMLAEYLGEDQMLAVVCRSYEAASKLEKYEWDGKVDREHALYAVAKTFGKPINDRFL  1514

Query  1252  MICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL +IRPY G      PQR+L I  P LP GE PPGFLGYAVNM+ + + HL  RT +
Sbjct  1515  VICLENIRPYIGGFQDNDPQRKLNIPNPILPTGEMPPGFLGYAVNMVDLESHHLLTRTTA  1574

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCF-NNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             GHGLRETLFY L GELQVY  R+   M  +CF   + AVSLDG IM+GNGV +    +P 
Sbjct  1575  GHGLRETLFYCLFGELQVYQTRE--DMKKACFYARHGAVSLDGGIMKGNGVISFGCREPQ  1632

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
             I FPV + E   N+      +L +++ K+  LR V N+I
Sbjct  1633  IWFPVANLESPKNVR-----ILEVIEEKRTSLRLVHNEI  1666



>ref|XP_007039065.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
3 [Theobroma cacao]
 gb|EOY23566.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
3 [Theobroma cacao]
Length=1596

 Score =   400 bits (1028),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 239/585 (41%), Positives = 343/585 (59%), Gaps = 35/585 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E++  +DGF          KVD  G I+LGG+L+VTAGYGK  SLSV
Sbjct  1004  MFDAYGNHVAEGAEVQFHLDGFVIQGHLGSKYKVDDRGCIDLGGLLEVTAGYGKSVSLSV  1063

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 K VFK+EFQ E RELRIAS +PE C+ GS LE++ FEV++S+G VDE+ HDDEK G
Sbjct  1064  LHDGKVVFKREFQTEKRELRIASVVPERCIAGSILEDLAFEVVDSQGVVDETFHDDEKHG  1123

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H L + SE  +  +++ Y+F HG C V SI LPE EG F FVA HSRYM+L L ++V+
Sbjct  1124  QSHRLIVNSESFETCDSICYAFIHGCCIVTSIPLPEIEGPFCFVAFHSRYMDLYLNVKVS  1183

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +               R++ + E+E   Y S QK +F  ++ S      L        
Sbjct  1184  LVRP--------------RKVESDEIE---YPSDQKGLFLQKSQSVKDVGCL------LS  1220

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI--GLSSSQNCCCT  918
              +   K LEDEV  Y +   + E  L+ LD +K++I+  +  L+ S+   L  + +   T
Sbjct  1221  LVKYDKELEDEVCKYGERIAKWEHLLETLDCRKASIERYVSGLQASLEPNLIDNLDSLST  1280

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             +E +M +I     SAA++ C L +      E   +  + ++ VVALLG   + +LSRILA
Sbjct  1281  KEEMMIRIKERDHSAASVLCSLAQKLPFQ-EPWMDVIEGLVGVVALLGTVCTSKLSRILA  1339

Query  1099  EYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLGE QMLAVVC ++ ++    K   +G +     L   A  LG SI+G + ++CL DI
Sbjct  1340  EYLGEDQMLAVVCKSYTAARALEKYEHNGKVDWKLGLHAEATALGKSISGRFLVVCLEDI  1399

Query  1273  RPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             RPY G + +  PQR+LA+  P LP G +PPGF+GYAVNM++I   HL+  T +GHGLRET
Sbjct  1400  RPYPGLIEVSDPQRKLALPDPRLPTGNTPPGFIGYAVNMVNIDHPHLENLTTAGHGLRET  1459

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSK  1629
             LFYRL  +LQVY  R+ M  A +C  ++ A+SLDG I+R NG+ +  + +P I FPV   
Sbjct  1460  LFYRLFSKLQVYETREHMENARACIKHS-AISLDGGILRKNGIISLGYRNPEIHFPV---  1515

Query  1630  EQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
               QM++   + +++  +K  K++LR +   IE     + + + KF
Sbjct  1516  --QMHVSQQHKEIMEQIKKMKLELRSILQHIERISENHAKASKKF  1558



>ref|XP_007039063.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY23564.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
1 [Theobroma cacao]
Length=1595

 Score =   400 bits (1028),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 239/585 (41%), Positives = 343/585 (59%), Gaps = 35/585 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E++  +DGF          KVD  G I+LGG+L+VTAGYGK  SLSV
Sbjct  1003  MFDAYGNHVAEGAEVQFHLDGFVIQGHLGSKYKVDDRGCIDLGGLLEVTAGYGKSVSLSV  1062

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 K VFK+EFQ E RELRIAS +PE C+ GS LE++ FEV++S+G VDE+ HDDEK G
Sbjct  1063  LHDGKVVFKREFQTEKRELRIASVVPERCIAGSILEDLAFEVVDSQGVVDETFHDDEKHG  1122

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H L + SE  +  +++ Y+F HG C V SI LPE EG F FVA HSRYM+L L ++V+
Sbjct  1123  QSHRLIVNSESFETCDSICYAFIHGCCIVTSIPLPEIEGPFCFVAFHSRYMDLYLNVKVS  1182

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +               R++ + E+E   Y S QK +F  ++ S      L        
Sbjct  1183  LVRP--------------RKVESDEIE---YPSDQKGLFLQKSQSVKDVGCL------LS  1219

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI--GLSSSQNCCCT  918
              +   K LEDEV  Y +   + E  L+ LD +K++I+  +  L+ S+   L  + +   T
Sbjct  1220  LVKYDKELEDEVCKYGERIAKWEHLLETLDCRKASIERYVSGLQASLEPNLIDNLDSLST  1279

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             +E +M +I     SAA++ C L +      E   +  + ++ VVALLG   + +LSRILA
Sbjct  1280  KEEMMIRIKERDHSAASVLCSLAQKLPFQ-EPWMDVIEGLVGVVALLGTVCTSKLSRILA  1338

Query  1099  EYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLGE QMLAVVC ++ ++    K   +G +     L   A  LG SI+G + ++CL DI
Sbjct  1339  EYLGEDQMLAVVCKSYTAARALEKYEHNGKVDWKLGLHAEATALGKSISGRFLVVCLEDI  1398

Query  1273  RPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             RPY G + +  PQR+LA+  P LP G +PPGF+GYAVNM++I   HL+  T +GHGLRET
Sbjct  1399  RPYPGLIEVSDPQRKLALPDPRLPTGNTPPGFIGYAVNMVNIDHPHLENLTTAGHGLRET  1458

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSK  1629
             LFYRL  +LQVY  R+ M  A +C  ++ A+SLDG I+R NG+ +  + +P I FPV   
Sbjct  1459  LFYRLFSKLQVYETREHMENARACIKHS-AISLDGGILRKNGIISLGYRNPEIHFPV---  1514

Query  1630  EQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
               QM++   + +++  +K  K++LR +   IE     + + + KF
Sbjct  1515  --QMHVSQQHKEIMEQIKKMKLELRSILQHIERISENHAKASKKF  1557



>ref|XP_010662862.1| PREDICTED: uncharacterized protein LOC100252197 isoform X3 [Vitis 
vinifera]
Length=1470

 Score =   398 bits (1023),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 239/578 (41%), Positives = 329/578 (57%), Gaps = 39/578 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH ++  E++  +DGFC  D   L  KVD  G I+L G+L+VT GYGK  SLSV
Sbjct  868   MFDAYGNHAREGLEVQFNVDGFCFQDHNGLKRKVDDRGCIDLSGLLRVTTGYGKNVSLSV  927

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG+K VFKQE Q E RELR AS +P+ C  GS LENI+FE+INS+GEVDE++H++EK G
Sbjct  928   LSGNKVVFKQELQTEKRELRAASIVPQSCAAGSQLENIVFEIINSKGEVDETVHEEEKHG  987

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTI S+   +D +VR++F +GRC + +I LP  +G F F+A HS + EL L ++V 
Sbjct  988   QFHTLTIMSDSFYLDGSVRFAFRNGRCIIPTIPLPRKQGDFTFLAAHSCHPELSLAVKVE  1047

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
                 V              ++L  + E+ Q +   + +   ++S    AP+   +     
Sbjct  1048  CHVQVSV-----------VEVLKVKQEDVQLQYPNENMLLLQDSP---APRHVENSLVES  1093

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---CCC  915
              + + K +ED++          E +L++L  +K +I+  I  L+ S+   S  N      
Sbjct  1094  LMNDEKEIEDDICKIGLFIGDNERKLELLHKQKGDIEQSIEKLQASVEYDSFNNHRGYLS  1153

Query  916   TQESIMEQISGMGDSAAAIACKL-----IETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              +ES+M  I     SAAA  C L      + P S      +  K+I+ VVALL       
Sbjct  1154  KKESVMRCIEKKDKSAAAFFCNLSREIPFQDPVS------QLMKDIVGVVALLATVRINR  1207

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             L R+LAEYLGE QMLAVVC ++  AS +   +  G +    AL  +A   G  IN  + +
Sbjct  1208  LGRMLAEYLGEDQMLAVVCRSYEAASKLEKYEWDGKVDREHALYAVAKTFGKPINDRFLV  1267

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL +IRPY G      PQR+L I  P LP GE PPGFLGYAVNM+ + + HL  RT +G
Sbjct  1268  ICLENIRPYIGGFQDNDPQRKLNIPNPILPTGEMPPGFLGYAVNMVDLESHHLLTRTTAG  1327

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCF-NNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             HGLRETLFY L GELQVY  R+   M  +CF   + AVSLDG IM+GNGV +    +P I
Sbjct  1328  HGLRETLFYCLFGELQVYQTRE--DMKKACFYARHGAVSLDGGIMKGNGVISFGCREPQI  1385

Query  1609  MFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
              FPV + E   N+      +L +++ K+  LR V N+I
Sbjct  1386  WFPVANLESPKNVR-----ILEVIEEKRTSLRLVHNEI  1418



>ref|XP_010662860.1| PREDICTED: uncharacterized protein LOC100252197 isoform X1 [Vitis 
vinifera]
Length=1616

 Score =   399 bits (1025),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 239/578 (41%), Positives = 329/578 (57%), Gaps = 39/578 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH ++  E++  +DGFC  D   L  KVD  G I+L G+L+VT GYGK  SLSV
Sbjct  1014  MFDAYGNHAREGLEVQFNVDGFCFQDHNGLKRKVDDRGCIDLSGLLRVTTGYGKNVSLSV  1073

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG+K VFKQE Q E RELR AS +P+ C  GS LENI+FE+INS+GEVDE++H++EK G
Sbjct  1074  LSGNKVVFKQELQTEKRELRAASIVPQSCAAGSQLENIVFEIINSKGEVDETVHEEEKHG  1133

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTI S+   +D +VR++F +GRC + +I LP  +G F F+A HS + EL L ++V 
Sbjct  1134  QFHTLTIMSDSFYLDGSVRFAFRNGRCIIPTIPLPRKQGDFTFLAAHSCHPELSLAVKVE  1193

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
                 V              ++L  + E+ Q +   + +   ++S    AP+   +     
Sbjct  1194  CHVQVSV-----------VEVLKVKQEDVQLQYPNENMLLLQDSP---APRHVENSLVES  1239

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---CCC  915
              + + K +ED++          E +L++L  +K +I+  I  L+ S+   S  N      
Sbjct  1240  LMNDEKEIEDDICKIGLFIGDNERKLELLHKQKGDIEQSIEKLQASVEYDSFNNHRGYLS  1299

Query  916   TQESIMEQISGMGDSAAAIACKL-----IETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              +ES+M  I     SAAA  C L      + P S      +  K+I+ VVALL       
Sbjct  1300  KKESVMRCIEKKDKSAAAFFCNLSREIPFQDPVS------QLMKDIVGVVALLATVRINR  1353

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             L R+LAEYLGE QMLAVVC ++  AS +   +  G +    AL  +A   G  IN  + +
Sbjct  1354  LGRMLAEYLGEDQMLAVVCRSYEAASKLEKYEWDGKVDREHALYAVAKTFGKPINDRFLV  1413

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL +IRPY G      PQR+L I  P LP GE PPGFLGYAVNM+ + + HL  RT +G
Sbjct  1414  ICLENIRPYIGGFQDNDPQRKLNIPNPILPTGEMPPGFLGYAVNMVDLESHHLLTRTTAG  1473

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCF-NNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             HGLRETLFY L GELQVY  R+   M  +CF   + AVSLDG IM+GNGV +    +P I
Sbjct  1474  HGLRETLFYCLFGELQVYQTRE--DMKKACFYARHGAVSLDGGIMKGNGVISFGCREPQI  1531

Query  1609  MFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
              FPV + E   N+      +L +++ K+  LR V N+I
Sbjct  1532  WFPVANLESPKNVR-----ILEVIEEKRTSLRLVHNEI  1564



>ref|XP_006493323.1| PREDICTED: uncharacterized protein LOC102628315 isoform X4 [Citrus 
sinensis]
Length=1554

 Score =   391 bits (1004),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 236/610 (39%), Positives = 349/610 (57%), Gaps = 67/610 (11%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  984   MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  1043

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  1044  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  1103

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  1104  QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  1163

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  1164  IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  1194

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS  900
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+ S+   S 
Sbjct  1195  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKIEVEEVLSKLQVSVEPYS-  1253

Query  901   QNCCCTQESIMEQISGMGDSAAAIAC-----KLIETPSSSVELHHEFAKEILVVVALLGF  1065
                  T+E I+ +I  +  SAA++ C      L   P S+      F ++++  VAL+G 
Sbjct  1254  ---LLTKEEIIRRIKSIYQSAASVICCSTKEFLCSKPRSN------FMEDVVGPVALIGT  1304

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSIN  1239
               + +LSR LAEYLGE QMLA+VC +  ++    K    G +    AL   A  LG SI+
Sbjct  1305  VCTNKLSRTLAEYLGEHQMLALVCRSFEAAFALEKYEQDGTIDRKCALHATAAALGKSID  1364

Query  1240  GGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G Y +ICL  IRPY+G+  S  PQR+LA+  P LP G  P GF+GYAVNM+++   H+  
Sbjct  1365  GRYLVICLEGIRPYSGKFGSNDPQRKLALPAPTLPKGNIPAGFVGYAVNMVNLDGHHMHI  1424

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             RT++G+GLRETL YRL G+LQVY  R  M  A +C  +  AVSLDG I++ +G+ +   G
Sbjct  1425  RTSAGNGLRETLLYRLFGKLQVYKTRKDMIEAHTCIRHG-AVSLDGGILKEDGIISLGCG  1483

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE-------IN  1755
             +P I FP+     +  + T + + L  ++ KK++L  +   I+    A E+         
Sbjct  1484  NPTICFPIV----RTRISTQSIEALKQIEEKKLELDGIMQLIQESNKALEKDLEKLKNSE  1539

Query  1756  NKFIGFRDAY  1785
             +KF  F D +
Sbjct  1540  DKFNSFMDLW  1549



>ref|XP_006493320.1| PREDICTED: uncharacterized protein LOC102628315 isoform X1 [Citrus 
sinensis]
 ref|XP_006493321.1| PREDICTED: uncharacterized protein LOC102628315 isoform X2 [Citrus 
sinensis]
 ref|XP_006493322.1| PREDICTED: uncharacterized protein LOC102628315 isoform X3 [Citrus 
sinensis]
Length=1576

 Score =   391 bits (1004),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 236/610 (39%), Positives = 349/610 (57%), Gaps = 67/610 (11%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  1006  MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  1065

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  1066  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  1125

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  1126  QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  1185

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  1186  IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  1216

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS  900
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+ S+   S 
Sbjct  1217  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKIEVEEVLSKLQVSVEPYS-  1275

Query  901   QNCCCTQESIMEQISGMGDSAAAIAC-----KLIETPSSSVELHHEFAKEILVVVALLGF  1065
                  T+E I+ +I  +  SAA++ C      L   P S+      F ++++  VAL+G 
Sbjct  1276  ---LLTKEEIIRRIKSIYQSAASVICCSTKEFLCSKPRSN------FMEDVVGPVALIGT  1326

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSIN  1239
               + +LSR LAEYLGE QMLA+VC +  ++    K    G +    AL   A  LG SI+
Sbjct  1327  VCTNKLSRTLAEYLGEHQMLALVCRSFEAAFALEKYEQDGTIDRKCALHATAAALGKSID  1386

Query  1240  GGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G Y +ICL  IRPY+G+  S  PQR+LA+  P LP G  P GF+GYAVNM+++   H+  
Sbjct  1387  GRYLVICLEGIRPYSGKFGSNDPQRKLALPAPTLPKGNIPAGFVGYAVNMVNLDGHHMHI  1446

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             RT++G+GLRETL YRL G+LQVY  R  M  A +C  +  AVSLDG I++ +G+ +   G
Sbjct  1447  RTSAGNGLRETLLYRLFGKLQVYKTRKDMIEAHTCIRHG-AVSLDGGILKEDGIISLGCG  1505

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE-------IN  1755
             +P I FP+     +  + T + + L  ++ KK++L  +   I+    A E+         
Sbjct  1506  NPTICFPIV----RTRISTQSIEALKQIEEKKLELDGIMQLIQESNKALEKDLEKLKNSE  1561

Query  1756  NKFIGFRDAY  1785
             +KF  F D +
Sbjct  1562  DKFNSFMDLW  1571



>ref|XP_006441093.1| hypothetical protein CICLE_v10018477mg [Citrus clementina]
 gb|ESR54333.1| hypothetical protein CICLE_v10018477mg [Citrus clementina]
Length=1576

 Score =   390 bits (1002),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 236/610 (39%), Positives = 348/610 (57%), Gaps = 67/610 (11%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  1006  MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  1065

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  1066  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  1125

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTI+S+L+  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL   I+V 
Sbjct  1126  QSHTLTIRSDLINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNTSIKVP  1185

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  1186  IVRAPKLES-----------------DDIRTPCSGGKVFLLEGPSPIK------------  1216

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS  900
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+ S+   S 
Sbjct  1217  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQVSVEPYS-  1275

Query  901   QNCCCTQESIMEQISGMGDSAAAIAC-----KLIETPSSSVELHHEFAKEILVVVALLGF  1065
                  T+E I+ +I  +  SAA++ C      L   P S+      F ++++  VAL+G 
Sbjct  1276  ---LLTKEEIIRRIKSIYQSAASVICCSTKEFLYSKPRSN------FMEDVVGPVALIGT  1326

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSIN  1239
               + +LSR LAEYLGE QMLA+VC +  ++    K    G +    AL   A  LG SI+
Sbjct  1327  VCTNKLSRTLAEYLGEHQMLALVCRSFEAAFALEKYEQDGTIDRKCALHATAAALGKSID  1386

Query  1240  GGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G Y +ICL  IRPY+G+  S  PQR+LA+  P LP G  P GF+GYAVNM+++   H+  
Sbjct  1387  GRYLVICLEGIRPYSGKFGSNDPQRKLALPAPTLPKGNIPAGFVGYAVNMVNLDDHHMHI  1446

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             RT++G+GLRETL YRL G+LQVY  R  M  A +C  +  AVSLDG I++ +G+ +   G
Sbjct  1447  RTSAGNGLRETLLYRLFGKLQVYKTRKDMIEAHTCIRHG-AVSLDGGILKEDGIISLGCG  1505

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE-------IN  1755
             +P I FP+     +  + T + + L  ++ KK++L  +   I+    A E+         
Sbjct  1506  NPTICFPIV----RTRISTQSIEALKQIEEKKLELDGIMQSIQESNKALEKDLEKLKNSE  1561

Query  1756  NKFIGFRDAY  1785
             +KF  F D +
Sbjct  1562  DKFNSFMDLW  1571



>ref|XP_002318429.2| hypothetical protein POPTR_0012s02310g [Populus trichocarpa]
 gb|EEE96649.2| hypothetical protein POPTR_0012s02310g [Populus trichocarpa]
Length=1058

 Score =   381 bits (978),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 238/547 (44%), Positives = 321/547 (59%), Gaps = 53/547 (10%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             MLD + NHI+K  E++L +DGF   D+     KVDK+G I+L GVLKVTAG+G+  S SV
Sbjct  494   MLDAHGNHIKKGLEVQLNVDGFHILDKEGSKRKVDKDGCIDLSGVLKVTAGFGRIVSYSV  553

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                DK VFKQE Q E RELRIAS++PE    GS LENI+FEV++S+G+VD  IH++EK+G
Sbjct  554   SYQDKVVFKQELQTEKRELRIASKLPEFLTAGSDLENIVFEVVDSQGDVDPRIHNEEKAG  613

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H+LTIKS+   + + ++Y+  HGRC + +I +P  EG F F+A HS Y ELQLR+ + 
Sbjct  614   QCHSLTIKSDSFNLQDAIQYTLRHGRCAIPAIRIPPIEGSFCFIAAHSCYSELQLRVILP  673

Query  565   TKKA--VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESE  738
               KA  VE D                  EN    S++K     ++ S      LEH ES 
Sbjct  674   VMKAPIVECD------------------ENLSPYSSRKVPLLRDSLS------LEHTESL  709

Query  739   ADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLS-SSQNCC  912
                I N+ K L D++  Y +     E +L++L+ KK+ I+  +  L+ S+  + ++ N  
Sbjct  710   MTPIENNEKGLVDDIEKYGERIGNSERQLKVLNEKKTEIEEYVSGLQASMERTLNNSNYV  769

Query  913   CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRI  1092
              T+E I+ QI     SAA+I C      SS V  +H F + I  +VALLG   + +LSRI
Sbjct  770   LTKEEILVQIESRNHSAASILCHCYRDLSSQVPQNH-FMEGIFGLVALLGTVRTNKLSRI  828

Query  1093  LAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             LAE+LGE QMLAVVC +  +                    A+  G SI G + +ICL DI
Sbjct  829   LAEFLGEDQMLAVVCRSKEA--------------------ASAFGKSICGRFLVICLEDI  868

Query  1273  RPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             RPYTGEL  G PQR+L +  P L  G  P GF+GYA NMI+I  + +   TASG+GLRET
Sbjct  869   RPYTGELECGDPQRKLKLQDPTLQCGNVPSGFIGYAANMINIDTRDMNISTASGYGLRET  928

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMR--GNGVTTHAFGDPFIMFPVF  1623
             LFYRL GELQVY  ++ M  A +C  +  AVSLDG I R   NG+ +    D  I FPV 
Sbjct  929   LFYRLFGELQVYDTKEHMNEAGACIKHG-AVSLDGGINRVTENGIMSLGCWDSEICFPVG  987

Query  1624  SKEQQMN  1644
             + E +M+
Sbjct  988   TLENEMS  994



>ref|XP_011024837.1| PREDICTED: uncharacterized protein LOC105125881 isoform X1 [Populus 
euphratica]
Length=1602

 Score =   383 bits (983),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 241/554 (44%), Positives = 325/554 (59%), Gaps = 65/554 (12%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             MLD + NHI+K  E++L +DGF   D+     KVDK+G I+L GVLKVTAG+G+  S SV
Sbjct  1038  MLDAHGNHIKKGLEVQLNVDGFHILDKEGSNRKVDKDGCIDLSGVLKVTAGFGRIVSYSV  1097

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                DK VFKQE Q E RELRIAS++PE    GS LENI+FEV++S+G+VD  IH++EK+G
Sbjct  1098  SYQDKVVFKQELQTEKRELRIASKLPEFLTAGSDLENIVFEVVDSQGDVDPHIHNEEKAG  1157

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H+LTIKS+   + + ++Y+  HGRCT+ +I +P  EG F F+A HS Y ELQL +++ 
Sbjct  1158  QCHSLTIKSDSFNLQDAIQYTLRHGRCTIPAIRIPPIEGSFCFIAAHSCYSELQLSVKLP  1217

Query  565   TKKA--VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAP------KL  720
               KA  VE D           +IL+                PY   S  K P       L
Sbjct  1218  VMKAPVVEYD-----------EILS----------------PY---SSRKVPLLGDSLSL  1247

Query  721   EHDESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLS-  894
             EH ES    I N+ K L D++  Y +     E +L++L+ +K+ I+  +F L+ S+  + 
Sbjct  1248  EHTESLMTPIENNEKGLVDDIEKYGERIGNSERQLKVLNEQKTEIEEYVFGLQASLEPTL  1307

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             ++ N   T+E I+ QI     SAA+I C      SS V  +H F + I  +VALLG   +
Sbjct  1308  NNSNYVLTKEEILVQIESRNHSAASILCHCYRDLSSQVPQNH-FMEGIFGLVALLGTVRT  1366

Query  1075  YELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
              +LSRILAE+LGE QMLAVVC +  +                    A+  G SI G + +
Sbjct  1367  NKLSRILAEFLGEDQMLAVVCRSKEA--------------------ASAFGKSICGRFLV  1406

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL DIRPYTGEL  G PQR+L +  P L  G  P GF+GYA NMI+I  + +   TASG
Sbjct  1407  ICLEDIRPYTGELECGDPQRKLKLQDPTLQCGNVPSGFIGYAANMINIDTQDMNISTASG  1466

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMR--GNGVTTHAFGDPF  1605
             +GLRETLFYRL GELQVY  ++ M  A +C  +  AVSLDG I+R   NG+ +    D  
Sbjct  1467  YGLRETLFYRLFGELQVYDTKEHMNEAGACIKHG-AVSLDGGIIRVTENGIMSLGCWDSE  1525

Query  1606  IMFPVFSKEQQMNL  1647
             I FPV + E +M+L
Sbjct  1526  ICFPVGTLENEMSL  1539



>ref|XP_011024838.1| PREDICTED: uncharacterized protein LOC105125881 isoform X2 [Populus 
euphratica]
 ref|XP_011024839.1| PREDICTED: uncharacterized protein LOC105125881 isoform X2 [Populus 
euphratica]
Length=1582

 Score =   383 bits (983),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 241/554 (44%), Positives = 325/554 (59%), Gaps = 65/554 (12%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             MLD + NHI+K  E++L +DGF   D+     KVDK+G I+L GVLKVTAG+G+  S SV
Sbjct  1018  MLDAHGNHIKKGLEVQLNVDGFHILDKEGSNRKVDKDGCIDLSGVLKVTAGFGRIVSYSV  1077

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                DK VFKQE Q E RELRIAS++PE    GS LENI+FEV++S+G+VD  IH++EK+G
Sbjct  1078  SYQDKVVFKQELQTEKRELRIASKLPEFLTAGSDLENIVFEVVDSQGDVDPHIHNEEKAG  1137

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H+LTIKS+   + + ++Y+  HGRCT+ +I +P  EG F F+A HS Y ELQL +++ 
Sbjct  1138  QCHSLTIKSDSFNLQDAIQYTLRHGRCTIPAIRIPPIEGSFCFIAAHSCYSELQLSVKLP  1197

Query  565   TKKA--VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAP------KL  720
               KA  VE D           +IL+                PY   S  K P       L
Sbjct  1198  VMKAPVVEYD-----------EILS----------------PY---SSRKVPLLGDSLSL  1227

Query  721   EHDESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLS-  894
             EH ES    I N+ K L D++  Y +     E +L++L+ +K+ I+  +F L+ S+  + 
Sbjct  1228  EHTESLMTPIENNEKGLVDDIEKYGERIGNSERQLKVLNEQKTEIEEYVFGLQASLEPTL  1287

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             ++ N   T+E I+ QI     SAA+I C      SS V  +H F + I  +VALLG   +
Sbjct  1288  NNSNYVLTKEEILVQIESRNHSAASILCHCYRDLSSQVPQNH-FMEGIFGLVALLGTVRT  1346

Query  1075  YELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
              +LSRILAE+LGE QMLAVVC +  +                    A+  G SI G + +
Sbjct  1347  NKLSRILAEFLGEDQMLAVVCRSKEA--------------------ASAFGKSICGRFLV  1386

Query  1255  ICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL DIRPYTGEL  G PQR+L +  P L  G  P GF+GYA NMI+I  + +   TASG
Sbjct  1387  ICLEDIRPYTGELECGDPQRKLKLQDPTLQCGNVPSGFIGYAANMINIDTQDMNISTASG  1446

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMR--GNGVTTHAFGDPF  1605
             +GLRETLFYRL GELQVY  ++ M  A +C  +  AVSLDG I+R   NG+ +    D  
Sbjct  1447  YGLRETLFYRLFGELQVYDTKEHMNEAGACIKHG-AVSLDGGIIRVTENGIMSLGCWDSE  1505

Query  1606  IMFPVFSKEQQMNL  1647
             I FPV + E +M+L
Sbjct  1506  ICFPVGTLENEMSL  1519



>ref|XP_008783195.1| PREDICTED: uncharacterized protein LOC103702510 [Phoenix dactylifera]
Length=1597

 Score =   378 bits (970),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 230/592 (39%), Positives = 339/592 (57%), Gaps = 37/592 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NHI+   E+ + +DG C  D    + KV+ +G + L G+LKV AGYG K  LSV
Sbjct  1002  MFDAYGNHIEAGVEVSIHLDGLCFQDHMGSIRKVNSDGCVTLCGLLKVVAGYGSKVCLSV  1061

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             F  DK V +   Q+  RELR  S +P  C  GSHLEN++FE+ +S+G VDE+IH     G
Sbjct  1062  FVDDKLVVENILQVAKRELRAVSGVPGYCTAGSHLENVVFEIFDSDGVVDEAIH-----G  1116

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKSE LK+D T++Y+F HGRC V  I +P++ G F  +A H+ + +L++ IE+ 
Sbjct  1117  QHHTLTIKSEPLKLDGTIQYTFQHGRCIVPVIPVPQESGTFRIMAFHTHFPDLRISIEIC  1176

Query  565   TKKA--------VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKL  720
                A         +  +  +QSQ  + +I    +E+ Q  S+Q    P   +S Y    +
Sbjct  1177  VGLAPKLELVTVTDLGASIYQSQFSDDRI-PLLLESSQCHSSQMIPSP---TSLYVTSII  1232

Query  721   EHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---L  891
             +          + K L+D +       R+ E ++++LD +K+ I  EI++L+  +G   L
Sbjct  1233  D----------DAKKLDDAMAELGLRIREHEGKIKMLDDQKTQIGKEIYDLKVLMGPQHL  1282

Query  892   SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAE  1071
             S        +E I +QI G  D+AAA+ C L       +E    F ++++ + +LLG   
Sbjct  1283  SQINLLINAKEKITKQIEGKSDTAAAVFCNL-RKAIQILEPQEHFMEDVVGLASLLGTVS  1341

Query  1072  SYELSRILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGG  1245
               +LSRI AEYLGE  MLA+VC ++ ++    +    G ++   AL   A  LG +IN  
Sbjct  1342  DSKLSRIFAEYLGENYMLAIVCKSYEAATALERYGADGKINRHSALHEAAATLGITINRR  1401

Query  1246  YDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRT  1422
             + +ICL +I PY GE ++  PQR LA+  P L +GE+P GF GYAVNMI++   HL  RT
Sbjct  1402  FPVICLEEISPYKGEIINNDPQRWLALPDPLLQSGETPAGFKGYAVNMINLDIDHLNTRT  1461

Query  1423  ASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDP  1602
             A+G+GLRETLFYRL G+LQVY  R+ M +A +C  +  A+SLDG IMR NG+      +P
Sbjct  1462  AAGYGLRETLFYRLFGKLQVYQTREHMKVAKTCIKHG-AISLDGGIMRENGIILLGDCEP  1520

Query  1603  FIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINN  1758
              I+FPV + E QM L     DVL  ++ K+  L+ +  D E  ++A   +N+
Sbjct  1521  EIVFPVITFENQMELSRNMIDVLKQMEEKRCLLKVI--DEEMSKVAEARVND  1570



>gb|KCW62609.1| hypothetical protein EUGRSUZ_G00110 [Eucalyptus grandis]
Length=1073

 Score =   368 bits (945),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 234/613 (38%), Positives = 341/613 (56%), Gaps = 31/613 (5%)
 Frame = +1

Query  19    HWMLDEYNNHIQKDEEIKLQMDGFCAYDQ--------GCLMCKVDKNGFINLGGVLKVTA  174
             H M D Y NH  K  E+ L+++GF + DQ           + +VD++GF++L G+LKVTA
Sbjct  450   HKMFDAYGNHALKGSEVLLKVEGFSSKDQMGKKHKRRNKFLVQVDRDGFVHLSGMLKVTA  509

Query  175   GYGKKASLSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVD  354
             GY +   LSV +  + +FK+E Q E RELRIA  +P+ C  GS LEN +FE++++EG +D
Sbjct  510   GYNQNVLLSVTTVGEEIFKEELQTEKRELRIAEPVPQLCAAGSQLENFVFEIVDTEGNLD  569

Query  355   ESIHDDEKSGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRY  534
             E+IH+DE++G  HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+
Sbjct  570   ENIHNDEENGHFHTLSIKLDSSVTKTTTLYAFQKGRCTIPSLTVPRDAGCFSFSAVHSRH  629

Query  535   MELQLRIEVNTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAP  714
              EL L I+V T        G F       QI  +   + Q+    + + P  N    +  
Sbjct  630   RELSLSIKVATFYFC----GTFIELDFYTQIGIQPSSDLQHEI--QTLCPNTNIMMLQDK  683

Query  715   KLEHDESEADHIVNHKMLEDEVIHYAQLSRQCE-----IE-----LQILDSKKSNIQTEI  864
                +++     I+ +++LE+  +      R  E     IE     L++L  +K  I+  +
Sbjct  684   STPNNKGNVLSIIKNEVLEETALCIEHRERVLEETGSCIEHRERVLKLLHDRKVEIEQSL  743

Query  865   FNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKE-IL  1041
               L    G  +  +C   +E +++ I     SAA++ C+LI   +S  E  H  +++ I+
Sbjct  744   VELGVYAGPLNIVDCFFAKEEMIDMIENRDGSAASVLCELIRNFAS--EGPHGGSRDGII  801

Query  1042  VVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSADALSTLA  1215
              VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G +   +A+   A
Sbjct  802   GVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQNAVYAKA  861

Query  1216  NNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIH  1392
               LG SI G + +ICL +I PY GE+    PQR+LA   P LP+GE PPGF+GYAVNM+ 
Sbjct  862   AELGKSIRGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFVGYAVNMVD  921

Query  1393  ISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGN  1572
             I   H   RTA G GLRETLFYRL G+LQVY  R+ M  AS C ++  AVSLDG I+R +
Sbjct  922   IDFDHFATRTAEGLGLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDGGIIRED  980

Query  1573  GVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEI  1752
             G+ +  F  P I+FPV +    +N +  N  V   +    ++LR     I     A EE 
Sbjct  981   GLISLGFWKPDIIFPVVTSGIHINTLPENTQVGMQIAEAMLELRVTLCKIRKITRACEED  1040

Query  1753  NNKFIGFRDAYVN  1791
               +F+G    +V+
Sbjct  1041  KRQFLGKTKDFVS  1053



>ref|XP_010915961.1| PREDICTED: uncharacterized protein LOC105040910 [Elaeis guineensis]
Length=1594

 Score =   374 bits (959),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 226/589 (38%), Positives = 340/589 (58%), Gaps = 30/589 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH++   E+ + +DG    D    + KV+  G + L G+LKV AGYG K  LSV
Sbjct  1002  MFDAYGNHVEGGVEVSIHLDGLRFQDHLGSIRKVNNQGCVTLSGLLKVAAGYGSKVCLSV  1061

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             FS  K VF++  Q+  RELR+AS +P  C  GSHLEN++FE+ +S+G VDE+IH     G
Sbjct  1062  FSDGKLVFEKMLQVVMRELRVASGVPGYCKAGSHLENVVFEIFDSDGVVDETIH-----G  1116

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKSE  K+D+T++Y+F HGRC V  I +P++ G FH VA H+ + +LQ  IE+ 
Sbjct  1117  QHHTLTIKSEPRKLDDTIQYTFQHGRCIVPVIPVPQESGTFHIVAFHTHFPDLQTSIEIY  1176

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +            + +     +Q + +   I   + SS  + P  + D     
Sbjct  1177  VMQAPKLELA---------TVTDLGASIYQSQFSNDSISLVQESS--ECPSSQMDLFVQS  1225

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS---QNCCC  915
              + + K L+D +       R+ E +L++L+ +K+ I  EI++L+  +G   S    +   
Sbjct  1226  IMDDAKKLDDGMAEVGLRIRERESKLKMLNDQKTQIGKEIYDLQVLMGPQHSSQVDSLIN  1285

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHH---EFAKEILVVVALLGFAESYELS  1086
              +E I +QI G  D+AAA+ C L    S ++++      F ++++ +V+LLG   +  LS
Sbjct  1286  AKEQITKQIEGKSDTAAAVFCNL----SKAIQIQEPQKHFMEDVVGLVSLLGTVSNGNLS  1341

Query  1087  RILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMIC  1260
             RI AEYLGE  MLA+VC ++  AS++      G ++   AL  +A NLG +IN  + +IC
Sbjct  1342  RIFAEYLGENYMLAIVCKSYEAASALEKYGEDGKVNRNSALHEVAANLGITINRRFSVIC  1401

Query  1261  LNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHG  1437
             L +IRPY GE ++  PQR LA+  P L +GE+P GF+GYAVNMI++  + L  RTA G+G
Sbjct  1402  LEEIRPYKGEIINNDPQRWLALPDPLLQSGETPAGFIGYAVNMINLDIQCLNTRTAKGYG  1461

Query  1438  LRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             LRETLFYRL G+LQVY  R+ M +A +C  +  A+SLDG IMR NG+      +P ++FP
Sbjct  1462  LRETLFYRLFGKLQVYQTREHMRVAKTCIKHG-AISLDGGIMRENGIILLGDCEPEVVFP  1520

Query  1618  VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
             V   +  M L     DV   ++ KK  L  +   +  E  A+ +   +F
Sbjct  1521  VIIFQSPMALSGNMIDVHKKMEEKKCFLEVIDEQMTKEIEAHAKELARF  1569



>gb|KCW62600.1| hypothetical protein EUGRSUZ_G00091 [Eucalyptus grandis]
Length=1061

 Score =   367 bits (942),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 232/613 (38%), Positives = 345/613 (56%), Gaps = 28/613 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH  K  E+ L+++GF   DQ     KVD++GF++L G+LKVTAGY +  SLSV
Sbjct  433   MFDAYGNHALKGSELLLKVEGFSIKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVSLSV  492

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE++G
Sbjct  493   TTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENG  552

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL L I++ 
Sbjct  553   HFHTLSIKLDSSVTKTTTLYAFQKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIG  612

Query  565   TKKAVE-----------ADSGYFQSQSPERQILNKEVENFQYRSAQKQ------IFPYEN  693
             T+ + +            +    Q +S    I N  +  + Y S+         I   E 
Sbjct  613   TQPSSDLQHEIQTLCPNTNIMMLQDKSTPNNIGNLCLVTYNYCSSLALEETALCIEHRER  672

Query  694   SSPYKAPKLEHDESEADHIVNHKM-LEDEVIHYAQLS--RQCEIELQILDSKKSNIQTEI  864
                    ++EH E     + + K+ +E  ++    L+  R   I   ++D  ++++  + 
Sbjct  673   VLEETGSRIEHRERVLKLLRDRKVEIEQSLVELGDLNQVRTKMIAQLMVDFHQNHVGCD-  731

Query  865   FNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKE-IL  1041
             ++L  +  + +S+      E + + I     SAA++ C+LI   +S  E  H  +++ I+
Sbjct  732   YSLCLANPVVTSRTYITKLEEMTDMIENRDGSAASVLCELIRNFAS--ERPHGGSRDGII  789

Query  1042  VVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSADALSTLA  1215
              VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G +   +A+   A
Sbjct  790   GVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQNAVYAKA  849

Query  1216  NNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIH  1392
               LG SI+G + +ICL +I PY GE+    PQR+LA   P LP+GE PPGF+GYAVNM+ 
Sbjct  850   AELGKSISGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFMGYAVNMVD  909

Query  1393  ISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGN  1572
             I   HL  RT  G GLRETLFYRL G+LQVY  R+ M  AS C ++  AVSLDG I+R +
Sbjct  910   IDFDHLATRTTEGLGLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDGGIIRED  968

Query  1573  GVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEI  1752
             G+ +  F  P I+FPV + E  +N +  +  V   +     +LR     I     A EE 
Sbjct  969   GLISLGFWKPDIIFPVVTSEIHINTLPESTQVGMQIAEAMSELRVTLCKIRKITRACEED  1028

Query  1753  NNKFIGFRDAYVN  1791
               +F+G    +V+
Sbjct  1029  KRQFLGKTKDFVS  1041



>ref|XP_010109257.1| hypothetical protein L484_011879 [Morus notabilis]
 gb|EXC21437.1| hypothetical protein L484_011879 [Morus notabilis]
Length=1568

 Score =   370 bits (951),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 245/600 (41%), Positives = 336/600 (56%), Gaps = 36/600 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + NH+ +  E++L ++GF   DQ  L  KVD  G INL G+LKVTAGYG   S SV
Sbjct  963   MFDGHGNHVMEGSEVQLNLEGFEILDQLGLNRKVDDCGGINLNGILKVTAGYGANVSFSV  1022

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +K + KQEF+IE RELR+ S++P+  + GS L N++FE++NSEG+VDE+IHD++K G
Sbjct  1023  SSDNKVLIKQEFKIERRELRLVSKVPDVLMAGSILGNMVFEIVNSEGDVDETIHDEDKIG  1082

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q + LTIKS+L  + E+VRY+F HGRCTV  I +P+ EG F F A HSR+  L+L ++V 
Sbjct  1083  QSNLLTIKSDLDGMMESVRYTFKHGRCTVPVIPVPQREGSFCFSACHSRHSNLKLLVKVP  1142

Query  565   TKKAV------EADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEH  726
               K        + + G  QS   + +IL  +  +   +   K I   EN    K  +LEH
Sbjct  1143  LVKPAMPMVTPKLEYGKIQSTPSDGKILLLQDSSSPTQVENKIIMSIEN----KKKRLEH  1198

Query  727   DESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEE--SIGLSSS  900
             D            L    +    L R     L +L  +K  ++  +  L+E  S+ L   
Sbjct  1199  D------------LLCMGVSIGTLERT----LGLLKEEKEKLEQMVKELQESTSVCLVDF  1242

Query  901   QNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
             QNC CT+  + E+I  MG+SAAA  CK I       E  ++F K+I+ VVALLG   S +
Sbjct  1243  QNCFCTKVELTEEIEKMGNSAAAALCK-ISRRVPFQEQQNDFMKDIIGVVALLGRVNSSQ  1301

Query  1081  LSRILAEYLGEKQMLAVVCNA-HASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             LSRIL+EYLG  QMLAVV  +  A++V           +DA       L  SI   + + 
Sbjct  1302  LSRILSEYLGLDQMLAVVTRSFEAANVLQKYKQNEGDCSDARLAEGVALLKSIKDRFTVF  1361

Query  1258  CLNDIRPYTGELSI-GPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL DI PY       G QR L +  P +P+G  P GFLG+AVNMI +    LQ +T SGH
Sbjct  1362  CLEDISPYVAAPECGGSQRNLPLPVPFIPDGTVPTGFLGFAVNMIDLDVDQLQIKTTSGH  1421

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMF  1614
             GLRETLFY L G+LQVY  RD M  A +C  +  AVSLDG I++ N   T    +P I F
Sbjct  1422  GLRETLFYGLFGQLQVYRTRDEMLAARACIKHG-AVSLDGGILKENSGVTFGTRNPGICF  1480

Query  1615  PVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNL  1794
              V ++E +    +V+ + + LL  KK QLRE++  I  E    E+   KF   +  Y+ L
Sbjct  1481  QVVARETE----SVSGENVKLLAEKKSQLRELEQRIVVEMKTREKTIKKFKRMKSKYLKL  1536



>ref|XP_010027399.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417896 
[Eucalyptus grandis]
Length=1478

 Score =   365 bits (937),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 236/619 (38%), Positives = 337/619 (54%), Gaps = 48/619 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH  K  E+ L+++GF   DQ     KVD++GF++L G+LKVTAGY +  SLSV
Sbjct  858   MFDAYGNHALKGSELLLKVEGFSIKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVSLSV  917

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE++G
Sbjct  918   TTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENG  977

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL L I++ 
Sbjct  978   HFHTLSIKLDSSVTKTTTLYAFQKGRCTIPSLTVPRDAGWFSFSAVHSRHRELSLSIKIG  1037

Query  565   TKKAVEADSGYFQSQSPERQIL---NKEVEN-------------------FQYRSAQKQI  678
              + + +      Q+  P   I+   +K   N                     Y   Q  +
Sbjct  1038  IQPSSDLQH-EIQTLCPNTNIMMLQDKSTPNNIGNVLSIIKNESKLMPIILTYLYGQLCL  1096

Query  679   FPYENSSPY----KAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKS  846
               Y   S       A  +EH E         ++LE+         R     L++L  +K 
Sbjct  1097  VTYNYCSSLVLEETALCIEHRE---------RVLEETGSRIEHRERV----LKLLRDQKV  1143

Query  847   NIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEF  1026
              I+  +  L     L+   +C   +E + + I     SAA+I C+LI   +S  E  H  
Sbjct  1144  EIEQSLVELGGPSPLNIV-DCFFAKEEMTDMIENRDGSAASILCELIRNFAS--ERPHGG  1200

Query  1027  AKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSAD  1197
             +++ I+ VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G +   +
Sbjct  1201  SRDGIIGVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQN  1260

Query  1198  ALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGY  1374
             A+   A  LG SI+G + +ICL +I PY GE+    PQR+LA   P LP+GE PPGF+GY
Sbjct  1261  AVYAKAAELGKSISGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFMGY  1320

Query  1375  AVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDG  1554
             AVNM+ I   HL  RT  G GLRETLFYRL G+LQVY  R+ M  AS C ++  AVSLDG
Sbjct  1321  AVNMVDIDFDHLATRTTEGLGLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDG  1379

Query  1555  VIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENER  1734
              I+R +G+ +  F  P I+FPV + E  +N +  +  V   +     +LR     I    
Sbjct  1380  GIIRXDGLISLGFWKPDIIFPVVTSEIHINTLPESTQVGMQIAEAMSELRVTLCKIRKIT  1439

Query  1735  MAYEEINNKFIGFRDAYVN  1791
              A EE   +F+G    +V+
Sbjct  1440  RACEEDKRQFLGKTKDFVS  1458



>ref|XP_010067954.1| PREDICTED: uncharacterized protein LOC104454747 [Eucalyptus grandis]
Length=1547

 Score =   365 bits (936),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 235/624 (38%), Positives = 336/624 (54%), Gaps = 53/624 (8%)
 Frame = +1

Query  19    HWMLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASL  198
             H M D Y NH  K  E+ L+++GF + DQ     KVD++GF++L G+LKVTAGY +   L
Sbjct  924   HKMFDAYGNHALKGSEVLLKVEGFSSKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVLL  983

Query  199   SVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEK  378
             SV +  + +FK+E Q E RELRIA  +P+ C  GS LEN +FE++++EG +DE+IH+DE+
Sbjct  984   SVTTVGEEIFKEELQTEKRELRIAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEE  1043

Query  379   SGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIE  558
             +G  HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL L I+
Sbjct  1044  NGHFHTLSIKLDSSVTKTTTLYAFQKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIK  1103

Query  559   VNTKKAVEADSGYFQSQSPERQIL---NKEVEN-------------------FQYRSAQK  672
             +  + + +      Q+  P   I+   +K   N                     Y   Q 
Sbjct  1104  IGIQPSSDLQH-EIQTLCPNTNIMMLQDKSTPNNKGNVLSIIKNESKLMPIILTYLYGQL  1162

Query  673   QIFPYENSSPY----KAPKLEHDES---EADHIVNHKMLEDEVIHYAQLSRQCEIELQIL  831
              +  Y   S       A  +EH E    E    + H+                E  L++L
Sbjct  1163  CLVTYNYCSSQVLEETALCIEHRERVLEETGSCIEHR----------------ERVLKLL  1206

Query  832   DSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVE  1011
               +K  I+  +  L    G  +  +C   +E +++ I     SAA++ C+LI   +S  E
Sbjct  1207  HDRKVEIEQSLVELGVYAGPLNIVDCFFAKEEMIDMIENRDGSAASVLCELIRNFAS--E  1264

Query  1012  LHHEFAKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGY  1182
               H  +++ I+ VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G 
Sbjct  1265  GPHGGSRDGIIGVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGE  1324

Query  1183  LSSADALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPP  1359
             +   +A+   A  LG SI G + +ICL +I PY GE+    PQR+LA   P LP+GE PP
Sbjct  1325  VDLQNAVYAKAAELGKSIRGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPP  1384

Query  1360  GFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPA  1539
             GF+GYAVNM+ I   H   RTA G GLRETLFYRL G+LQVY  R+ M  AS C ++  A
Sbjct  1385  GFVGYAVNMVDIDFDHFATRTAEGLGLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-A  1443

Query  1540  VSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQND  1719
             VSLDG I+R +G+ +  F  P I+FPV +    +N +  N  V   +    ++LR     
Sbjct  1444  VSLDGGIIREDGLISLGFWKPDIIFPVVTSGIHINTLPENTQVGMQIAEAMLELRVTLCK  1503

Query  1720  IENERMAYEEINNKFIGFRDAYVN  1791
             I     A EE   +F+G    +V+
Sbjct  1504  IRKITRACEEDKRQFLGKTKDFVS  1527



>ref|XP_004498513.1| PREDICTED: uncharacterized protein LOC101490815 [Cicer arietinum]
Length=1483

 Score =   361 bits (926),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 223/602 (37%), Positives = 331/602 (55%), Gaps = 48/602 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  EI + + GF   +    + KVD  G INL G+LK+TAGYG+ AS+SV
Sbjct  892   MFDTYRNHVSEGMEINIAVAGFEMLNHCSTLYKVDDKGKINLSGLLKLTAGYGENASISV  951

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                +K+VFKQE+ I  R LRI SE+P  C  G  LENI FE++N  GEVD   H +++  
Sbjct  952   VFHNKTVFKQEYTIARRILRITSEVPAICAAGCELENIEFEIVNIGGEVDAKFHHNDQDC  1011

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H LTIKS+L   +E++RY+F HGRCT+ SI +P+ EG F F A HS++ EL L ++V 
Sbjct  1012  QFHMLTIKSDLFNAEESIRYTFKHGRCTIPSIHVPDIEGTFCFEASHSQFTELCLAVKVQ  1071

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               K + A+                  +  Q  S ++ +FP +  SP+      H+ +   
Sbjct  1072  VIKMLIAE------------------DVAQLPSLEENLFPLQEISPFN-----HESNLMI  1108

Query  745   HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC---  909
              ++N   K L D++       ++ E  L      K+  + EI  L++++      N    
Sbjct  1109  SVLNSDGKKL-DDICQLGMKIKRYEEYLNKAHDDKAVTEQEILVLQDNVKHYQLGNIDSL  1167

Query  910   -CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                T+E +  +I  M +SA+++ C L     S     ++F  EI+ VVALLG  +S ELS
Sbjct  1168  FTNTKEEMTTKIESMENSASSVLCSL-----SKKNQQNDFMDEIIGVVALLGSVQSPELS  1222

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGAS--KMHGYLSSADALSTLANNLGTSINGGYDMIC  1260
             R LAEYLGE QML V+C +  +++     K +G +  A AL   A +LG S+N  + ++ 
Sbjct  1223  RTLAEYLGEVQMLGVICRSFKTAISLERYKQNGEIDYASALHAEAASLGKSVNKRFLVMS  1282

Query  1261  LNDIRPYTGELS-IGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHG  1437
               DIRPY G L     QR+LA+  P LPNG++P GF+GYAVNM+ +   HL+ RTA G G
Sbjct  1283  FEDIRPYNGYLQEYDTQRKLALPDPKLPNGKTPAGFMGYAVNMVDLDTHHLKTRTAMGLG  1342

Query  1438  LRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             LRET+ + L  ++ VY  R+ M  A +C  +  AVSLDG I+R NG  +  +G+PF+ FP
Sbjct  1343  LRETVLFSLFKKVHVYKTRENMVAALACIEDG-AVSLDGGIIRENGTLSLGYGNPFVYFP  1401

Query  1618  VFSKEQQMNLMTVNP---DVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYV  1788
                     N M ++P   ++L  ++ KK  L   +  I       ++   KF   ++ Y+
Sbjct  1402  C------ANTMDISPEAKEILTRIEEKKANLLMFEEGITKLTERLQKYRQKFEKKKEKYI  1455

Query  1789  NL  1794
             NL
Sbjct  1456  NL  1457



>ref|XP_010027395.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417891 
[Eucalyptus grandis]
Length=1516

 Score =   360 bits (925),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 234/617 (38%), Positives = 336/617 (54%), Gaps = 41/617 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH  K  E+ L+++GF   DQ     KVD++GF++L G+LKVTAGY +  SLSV
Sbjct  893   MFDAYGNHALKGSEVLLKVEGFSIKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVSLSV  952

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE++G
Sbjct  953   TTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENG  1012

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
                TL+IK +      T  Y F  GRCT+ S+T+P D G F F AVHSR+ EL L I++ 
Sbjct  1013  HFRTLSIKLDSSVTKTTTLYPFRKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIG  1072

Query  565   TKKAVEADSGYFQSQSPERQIL---NKEVEN-------------------FQYRSAQKQI  678
              + + +      Q+  P   I+   +K   N                     Y   Q  +
Sbjct  1073  IQPSSDLQH-EIQTLCPNTNIMMLQDKSTSNNIGNVLSIIKNESKLMPIILTYLYGQLCL  1131

Query  679   FPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQT  858
               Y   S   +  LE      +H    ++LE+  +      R     L++L  +K  I+ 
Sbjct  1132  VTYNYCS---SQVLEETALCIEH--RERVLEETGLRIEHRERV----LKLLHDRKVEIEQ  1182

Query  859   EIFNLEESIG--LSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAK  1032
              +  L    G  L +  +C   +E + + I     SAA+I C+LI   +S  E  H  ++
Sbjct  1183  SLVELGVYAGPSLLNIVDCFFAKEEMTDMIENRDGSAASILCELIRNFAS--EGPHGGSR  1240

Query  1033  E-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSADAL  1203
             + I+ VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G +   +A+
Sbjct  1241  DGIIGVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQNAV  1300

Query  1204  STLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAV  1380
                A  LG SI+G + +ICL +I PY GE+    PQR+LA   P LP+GE PPGF+GYAV
Sbjct  1301  YAKAAELGKSISGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFMGYAV  1360

Query  1381  NMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVI  1560
             NM+ I   HL  RT  G  LRETLFYRL G+LQVY  R+ M  AS C ++  AVSLDG I
Sbjct  1361  NMVDIDFDHLATRTTEGLDLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDGGI  1419

Query  1561  MRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMA  1740
             +R +G+ +  F  P I+FPV + E  +N +  +  V   +     +LR     I     A
Sbjct  1420  IREDGLISLGFWKPDIIFPVVTSEIHINTLPESTQVGMQIAEAMSELRVTLCKIRKITRA  1479

Query  1741  YEEINNKFIGFRDAYVN  1791
              EE   +F+G    +V+
Sbjct  1480  CEEDKRQFLGKTKDFVS  1496



>gb|KCW62380.1| hypothetical protein EUGRSUZ_H05019 [Eucalyptus grandis]
Length=1020

 Score =   354 bits (909),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 232/612 (38%), Positives = 334/612 (55%), Gaps = 31/612 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH  K  E+ L+++GF   DQ     KVD++GF++L G+LKVTAGY +  SLSV
Sbjct  397   MFDAYGNHALKGSEVLLKVEGFSIKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVSLSV  456

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE++G
Sbjct  457   TTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENG  516

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
                TL+IK +      T  Y F  GRCT+ S+T+P D G F F AVHSR+ EL L I++ 
Sbjct  517   HFRTLSIKLDSSVTKTTTLYPFRKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIG  576

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDE---S  735
              + + +      Q+  P   I+  + ++                    A  +EH E    
Sbjct  577   IQPSSDLQH-EIQTLCPNTNIMMLQDKSTSNNIGNVLSIIKNEVLEETALCIEHRERVLE  635

Query  736   EADHIVNHKMLEDEVIHYAQLSRQCEIELQI------LDSKKSNIQTEIFNLEESIGLSS  897
             E    + H+    +++H     R+ EIE  +      L   K   Q  +   +  +G   
Sbjct  636   ETGLRIEHRERVLKLLH----DRKVEIEQSLVELGGDLSWTKMIAQLMVAFHQNHLGCDY  691

Query  898   S---QNCCCTQESIMEQISGMGD-------SAAAIACKLIETPSSSVELHHEFAKE-ILV  1044
             S    N   T  + + ++  M D       SAA+I C+LI   +S  E  H  +++ I+ 
Sbjct  692   SLCLANPVVTSRTYITKLEEMTDMIENRDGSAASILCELIRNFAS--EGPHGGSRDGIIG  749

Query  1045  VVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSADALSTLAN  1218
             VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     +G +   +A+   A 
Sbjct  750   VVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQNAVYAKAA  809

Query  1219  NLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHI  1395
              LG SI+G + +ICL +I PY GE+    PQR+LA   P LP+GE PPGF+GYAVNM+ I
Sbjct  810   ELGKSISGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFMGYAVNMVDI  869

Query  1396  SAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
                HL  RT  G  LRETLFYRL G+LQVY  R+ M  AS C ++  AVSLDG I+R +G
Sbjct  870   DFDHLATRTTEGLDLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDGGIIREDG  928

Query  1576  VTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEIN  1755
             + +  F  P I+FPV + E  +N +  +  V   +     +LR     I     A EE  
Sbjct  929   LISLGFWKPDIIFPVVTSEIHINTLPESTQVGMQIAEAMSELRVTLCKIRKITRACEEDK  988

Query  1756  NKFIGFRDAYVN  1791
              +F+G    +V+
Sbjct  989   RQFLGKTKDFVS  1000



>ref|XP_010067951.1| PREDICTED: uncharacterized protein LOC104454742 [Eucalyptus grandis]
Length=1561

 Score =   357 bits (915),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 226/593 (38%), Positives = 325/593 (55%), Gaps = 51/593 (9%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH  K  E               L+ KVD++GF++L G+LKVTAGY +  SLSV
Sbjct  996   MFDAYGNHALKGSE---------------LLLKVDRDGFVHLSGMLKVTAGYNQNVSLSV  1040

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE++G
Sbjct  1041  TTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENG  1100

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL L I++ 
Sbjct  1101  HFHTLSIKLDSSVTKTTTLYAFQKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIG  1160

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
             T+ + +      Q+  P     N  +   Q +S    I                      
Sbjct  1161  TQPSSDLQH-EIQTLCP-----NTNIMMLQDKSTPNNI------------------GNVL  1196

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQE  924
              I+ +++LE+         R     L++L  +K  I+  +  L     L+   +C   +E
Sbjct  1197  SIIKNEVLEETGSRIEHRERV----LKLLRDRKVEIEQSLVELGGPSPLNIV-DCFFAKE  1251

Query  925   SIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKE-ILVVVALLGFAESYELSRILAE  1101
              + + I     SAA++ C+LI   +S  E  H  +++ I+ VVALLG   + ELSRILA+
Sbjct  1252  EMTDMIENRDGSAASVLCELIRNFAS--ERPHGGSRDGIIGVVALLGTICNIELSRILAK  1309

Query  1102  YLGEKQMLAVVC--NAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIR  1275
             YLGE QML +VC  +  A S+     +G +   +A+   A  LG SI+G + +ICL +I 
Sbjct  1310  YLGEDQMLGIVCTNSETAFSLETYDKNGEVDLQNAVYAKAAELGKSISGEFRVICLEEIS  1369

Query  1276  PYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETL  1452
             PY GE+    PQR+LA   P LP+GE PPGF+GYAVNM+ I   HL  RT  G GLRETL
Sbjct  1370  PYRGEIEGCDPQRKLAFPHPTLPSGEIPPGFMGYAVNMVDIDFDHLATRTTEGLGLRETL  1429

Query  1453  FYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKE  1632
             FYRL G+LQVY  R+ M  AS C ++  AVSLDG I+R +G+ +  F  P I+FPV + E
Sbjct  1430  FYRLFGKLQVYDTREHMKQASVCIDHG-AVSLDGGIIREDGLISLGFWKPDIIFPVVTSE  1488

Query  1633  QQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVN  1791
               +N +  +  V   +     +LR     I     A EE   +F+G    +V+
Sbjct  1489  IHINTLPESTQVGMQIAEAMSELRVTLCKIRKITRACEEDKRQFLGKTKDFVS  1541



>ref|XP_003588509.1| hypothetical protein MTR_1g007990 [Medicago truncatula]
 gb|AES58760.1| gamma-irradiation and mitomycin C induced protein [Medicago truncatula]
Length=1009

 Score =   350 bits (898),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 221/571 (39%), Positives = 322/571 (56%), Gaps = 40/571 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E+ + ++GF   +    + KVD  G I+LGG LK+TAG+G+ AS+SV
Sbjct  417   MFDTYRNHVSEGVEVNIFLEGFERLNNCSTVYKVDDKGKIDLGGQLKLTAGFGENASISV  476

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 +  F+QEF +  R LRIASE+P+ C  G  LENI FE++N++G+VD  IH+D++  
Sbjct  477   MFEGEPKFRQEFSLARRILRIASEVPDFCATGGQLENIEFEIVNADGDVDMKIHNDDQEC  536

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H LTIKS L   DE++RY+F HGRCTV SI +PE EG F F A +S+Y EL L  +V 
Sbjct  537   QFHMLTIKSGLSNADESIRYTFKHGRCTVPSIRVPEIEGSFCFEASYSQYTELCLIRKVQ  596

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               K                    K+V   Q+ S  K  FP +  S      L HD +   
Sbjct  597   VIKMSNV----------------KDVA--QHLSPDKNTFPLKELS-----TLTHDNNLMI  633

Query  745   HIVNHKMLE-DEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC----  909
              ++N    + D++    Q   + E  L+  + ++     E+  L++++      N     
Sbjct  634   SVLNSDGKKFDDICQLGQKINEYEDYLKKFNDQEDETHKELLMLQDNVQHYQLGNADLLF  693

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
               T+E +  +I  M +SAA++ C L    S+  +  + F ++I+ VVALLG  +S ELSR
Sbjct  694   ATTKEEMTTKIKNMENSAASVLCSL----SAREKQQNHFLEDIIGVVALLGSVQSPELSR  749

Query  1090  ILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSSADALSTL-ANNLGTSINGGYDMIC  1260
             +LAEYLGE QML V+C +   A S+   K +G +    AL+   A +LG +I+  + ++ 
Sbjct  750   MLAEYLGEDQMLGVICRSLDTAISLEKYKQNGEIDYVHALNAAEAASLGKAISRRFHVMG  809

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
               DIRPY G L    QR+LA+  P L N  +P GF+GYAVNMI ++  HLQ RTASGHGL
Sbjct  810   FEDIRPYRGNLQNDSQRKLALPDPKLSN-RTPEGFMGYAVNMIELNTHHLQARTASGHGL  868

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RET+ + L  +L VY   + M  A  C  N  AVSLDG I+R NG  +  FG+P+I FP 
Sbjct  869   RETVLFSLFKKLHVYKTSESMMAAIECIENG-AVSLDGGIIRENGTLSLGFGNPYIYFPC  927

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQ  1713
              +K   M++      +LN ++ KK  L +++
Sbjct  928   GNK---MDIPPEATQMLNQIEKKKALLLKIE  955



>ref|XP_010038463.1| PREDICTED: uncharacterized protein LOC104427005 [Eucalyptus grandis]
Length=1558

 Score =   350 bits (899),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 229/639 (36%), Positives = 336/639 (53%), Gaps = 76/639 (12%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQ------GCL------------------------  114
             M D Y NH  K  E+ L+++GF   DQ       C+                        
Sbjct  926   MFDAYGNHALKGSEVLLKVEGFSIKDQMGKKHKRCIVYSYHIWNSICIADGLASVENYLR  985

Query  115   -----MCKVDKNGFINLGGVLKVTAGYGKKASLSVFSGDKSVFKQEFQIEARELRIASEI  279
                  + +VD +GF++L G+LKVTAG+ +   LSV +G + +FK+E Q E RELR+A  +
Sbjct  986   EWNKFLVQVDHDGFVHLSGMLKVTAGFNQNVLLSVIAGGEEIFKEELQTEKRELRVAEPV  1045

Query  280   PEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIKSELLKIDETVRYSFCHG  459
             P+ C  GS LEN +FE++++EG +DE+IH+DE++G  HTL+IK +      T  Y+F  G
Sbjct  1046  PQLCAAGSQLENFVFEIVDTEGNLDENIHNDEENGHFHTLSIKLDSSVTKTTTLYAFRKG  1105

Query  460   RCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNTKKAVEADSGYFQSQSPERQILNKE  639
             RCT+ S+T+P D G F F AVHSR+ EL L I++  + + +      Q+  P   I+  +
Sbjct  1106  RCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIGIQPSSDLQH-EIQTLCPNTNIMMLQ  1164

Query  640   VENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCE--  813
                             + S+P       +D      I+ +++LE+  +      R  E  
Sbjct  1165  ----------------DTSTP-------NDIGNVLSIIKNEVLEESALCIEHQERVLEET  1201

Query  814   ---IE-----LQILDSKKSNIQTEIFNLEESIGLSSSQ--NCCCTQESIMEQISGMGDSA  963
                IE     L++L  +K  I+  +  L    G S     +    +E +++ I     SA
Sbjct  1202  RSRIEHRERVLKLLHDRKVEIEQSLVELGVYAGPSPLNIVDSFFAKEEMIDMIENRDGSA  1261

Query  964   AAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--  1137
             A++ C+LI   S+S   H      I+ VVALLG   + ELSRILA+YLGE QML +VC  
Sbjct  1262  ASVLCELIRN-SASEGPHGRSRDGIIGVVALLGTIRNIELSRILAKYLGEDQMLGIVCTN  1320

Query  1138  NAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRR  1314
             +  A S+     +G +   +A+   A  LG SI+G + +ICL +I PY GE+    PQR+
Sbjct  1321  SEMAFSLETYDKNGEVDLQNAVYAKAAELGKSISGEFRVICLEEISPYRGEIEGCDPQRK  1380

Query  1315  LAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANR  1494
             LA+  P LP GE PPGF+GYAVNM++I   HL  RT  G GLRETLFYRL G+LQVY  R
Sbjct  1381  LALPYPTLPCGEIPPGFVGYAVNMVNIDFDHLATRTTKGLGLRETLFYRLFGKLQVYDTR  1440

Query  1495  DCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLN  1674
             + M  AS C  +  AVSLDG I+R +G+ +  F  P I+FPV + E  +N +  +  V  
Sbjct  1441  EHMKQASVCIEHG-AVSLDGGIIREDGLISLGFWKPDIIFPVVTSEIHINTLPGSTQVGM  1499

Query  1675  LLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVN  1791
              +     +LR     I     A EE   +F G  + +++
Sbjct  1500  QMAEAMSELRVTLCKIRKITRACEEDKRQFFGKTEDFIS  1538



>ref|XP_010067964.1| PREDICTED: uncharacterized protein LOC104454760 [Eucalyptus grandis]
Length=1588

 Score =   350 bits (898),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 221/572 (39%), Positives = 318/572 (56%), Gaps = 36/572 (6%)
 Frame = +1

Query  88    FCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVFSGDKSVFKQEFQIEARELRI  267
             F   DQ     KVD++GF++L G+LKVTAGY +  SLSV +G + +FK+E Q E RELR+
Sbjct  1029  FSIKDQMGKKHKVDRDGFVHLSGMLKVTAGYNQNVSLSVTTGGEEIFKEELQTEKRELRV  1088

Query  268   ASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIKSELLKIDETVRYS  447
             A  +P+ C  GS LEN IFE++++EG +DE+IH+DE++G  HTL+IK +      T  Y+
Sbjct  1089  AEPVPQLCAAGSQLENFIFEIVDTEGNLDENIHNDEENGHFHTLSIKLDSSVTKTTTLYA  1148

Query  448   FCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNTKKAVEADSGYFQSQSPERQI  627
             F  GRCT+ S+T+P D G F F AVHSR+ EL L I++  + + +      Q+  P    
Sbjct  1149  FQKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSIKIGIQPSSDLQH-EIQTLCP----  1203

Query  628   LNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQ  807
              N  +   Q +S    I                       I+ +++LE+         R 
Sbjct  1204  -NTNIMMLQDKSTPNNI------------------GNVLSIIKNEVLEETGSRIEHRERV  1244

Query  808   CEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLI  987
                 L++L  +K  I+  +  L     L+   +C   +E + + I     SAA++ C+LI
Sbjct  1245  ----LKLLRDRKVEIEQSLVELGGPSPLNIV-DCFFAKEEMTDMIENRDGSAASVLCELI  1299

Query  988   ETPSSSVELHHEFAKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSV  1158
                +S  E  H  +++ I+ VVALLG   + ELSRILA+YLGE QML +VC  +  A S+
Sbjct  1300  RNFAS--ERPHGGSRDGIIGVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSL  1357

Query  1159  GASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPA  1335
                  +G +   +A+   A  LG SI+G + +ICL +I PY GE+    PQR+LA   P 
Sbjct  1358  ETYDKNGEVDLQNAVYAKAAELGKSISGEFRVICLEEISPYRGEIEGCDPQRKLAFPHPT  1417

Query  1336  LPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMAS  1515
             LP+GE PPGF+GYAVNM+ I   HL  RT  G GLRETLFYRL G+LQVY  R+ M  AS
Sbjct  1418  LPSGEIPPGFMGYAVNMVDIDFDHLATRTTEGLGLRETLFYRLFGKLQVYDTREHMKQAS  1477

Query  1516  SCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKV  1695
              C ++  AVSLDG I+R +G+ +  F  P I+FPV + E  +N +  +  V   +     
Sbjct  1478  VCIDHG-AVSLDGGIIREDGLISLGFWKPDIIFPVVTSEIHINTLPESTQVGMQIAEAMS  1536

Query  1696  QLREVQNDIENERMAYEEINNKFIGFRDAYVN  1791
             +LR     I     A EE   +F+G    +V+
Sbjct  1537  ELRVTLCKIRKITRACEEDKRQFLGKTKDFVS  1568



>ref|XP_009607733.1| PREDICTED: uncharacterized protein LOC104101890 isoform X5 [Nicotiana 
tomentosiformis]
Length=1512

 Score =   329 bits (844),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 186/425 (44%), Positives = 273/425 (64%), Gaps = 13/425 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1092  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1151

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1152  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1211

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1212  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1271

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1272  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1328

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1329  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1388

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1389  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1447

Query  1087  RILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMIC  1260
              + + YLGE QMLAVVC + A++    K  M G ++ A  L  LA  LG SING Y +IC
Sbjct  1448  SMFSAYLGEDQMLAVVCKSRAAARALEKYQMDGNVNCASPLDILAAKLGISINGRYLVIC  1507

Query  1261  LNDIR  1275
             L DIR
Sbjct  1508  LEDIR  1512



>gb|AES58766.2| gamma-irradiation and mitomycin C induced protein, putative [Medicago 
truncatula]
Length=1462

 Score =   329 bits (843),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 206/554 (37%), Positives = 311/554 (56%), Gaps = 50/554 (9%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E+ + +DGF   +  C   KV   G I+L G+LK+TAGYG+ AS+SV
Sbjct  894   MFDAYRNHVSEGMEVNIVVDGFEMLNH-CSAYKVADKGKIDLSGLLKLTAGYGENASISV  952

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 + +FKQ+F I  R LRIAS++P+ C  G  LEN+ FE++N +G+VD  IH D +  
Sbjct  953   TFEGRPIFKQDFSIARRILRIASKVPDFCAAGGQLENVKFEIVNIDGDVDTKIHHDNQDY  1012

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H LTIKS+L+  +E++RY F  G CTV  I +PE EG F F A HS+Y +L L ++V 
Sbjct  1013  QFHMLTIKSDLINAEESIRYLFKQGCCTVPFIRVPEIEGTFCFEAFHSQYTKLCLAVKVR  1072

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               K   A                K+V   Q  S  K IFP +  SP+      H+ +   
Sbjct  1073  VIKMSNA----------------KDVA--QLLSPDKNIFPLQELSPF-----NHENNLMI  1109

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQE  924
              ++N    E ++       ++ E  L+    +K+  + E+  L +++ ++       T+E
Sbjct  1110  SVLNS---EGKICQLGSKIKKVEEYLKTCHEEKAEKEKEMLKLRDNVNVN-------TKE  1159

Query  925   SIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEY  1104
              ++ +I  M +SA ++ C L    S+  +  + F ++I+ VVALLG  +S +LSR+LAEY
Sbjct  1160  EVITKIKSMENSATSVLCSL----SAHEKQQNHFLEDIIGVVALLGSVKSPKLSRMLAEY  1215

Query  1105  LGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTS-INGGYDMICLNDIRPY  1281
             LGE QML V+C +  ++V   K +G +   D L   A  LG + I+  + ++   D+RPY
Sbjct  1216  LGEDQMLGVICRSFDTAVSLYKQNGEI---DCLHAEAAGLGEAIISKRFLVMSFEDLRPY  1272

Query  1282  TGELS-IGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFY  1458
              G L    PQ +LA+  P L NG +P GF+GYAVNMI + + HLQ RTA GHGLRET+ +
Sbjct  1273  KGYLQEHDPQMKLALPNPKLHNGRTPAGFIGYAVNMIDLDSHHLQTRTALGHGLRETVLF  1332

Query  1459  RLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQ  1638
              L  +L VY  R+ M  A  C  +  AVSLDG I+R N   +  +G+P + FP  +K   
Sbjct  1333  SLFKKLHVYETRENMVDALDCIEDG-AVSLDGGIIRENRALSIGYGNPSVYFPCTNK---  1388

Query  1639  MNLMTVNPDVLNLL  1680
                + ++P+ + +L
Sbjct  1389  ---LDISPEAMGIL  1399



>ref|XP_004309137.1| PREDICTED: uncharacterized protein LOC101291584 [Fragaria vesca 
subsp. vesca]
Length=1595

 Score =   329 bits (843),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 222/613 (36%), Positives = 338/613 (55%), Gaps = 33/613 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D+Y NH+ +  E++L ++GF   D+     K D +G I+LGG+LKVTAGY K  S SV
Sbjct  979   MFDQYGNHVIEGTEVQLNVEGFSIQDRLGTTRKADHHGCIDLGGLLKVTAGYEKNVSFSV  1038

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             +  +  +   + Q E R L+I+S++PE CV G+ +EN++FE+INSEG VD++ H +EKSG
Sbjct  1039  YYNNDVLLMLQSQTEKRVLKISSKVPEVCVVGTQMENLVFEIINSEGVVDDTFHHEEKSG  1098

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H LTIK+    ++E++R++F HGRCTV  +++PE E  F+FVA HS Y EL + +EV 
Sbjct  1099  QLHMLTIKAGSF-MEESLRFTFKHGRCTVTGLSVPEVEESFNFVAAHSYYPELHVNVEVP  1157

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               + V+    +   +  E+Q+ +  +    +  +     P +  +  + PK+EH E ++ 
Sbjct  1158  VVRPVKEKYDHLLIKK-EKQVESPTL----WDVSPLHELPQQVGN-LRVPKVEHQEFQSP  1211

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIE-------LQILDSKKSNIQTEIFNLEESIGLSSSQ  903
               + +     E     QL    E++       L + D ++     E    +    LS  Q
Sbjct  1212  SSIGNTFPSPESSCLLQLENVKELKNIMHQHGLCVGDVEEKLKILEKEKEKAKQELSDLQ  1271

Query  904   NCCCTQ--ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                     ESI  +I  M  SAAAI C L    S   E +++F ++++ +VALLG   S 
Sbjct  1272  GSIEPHKVESI-NRIESMNHSAAAIICTLFREVSFE-EANNQFMEDVIGLVALLGTVGSS  1329

Query  1078  ELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGY  1248
              LSR+L+EYLG   MLA+VC  +   V A +++   G ++    L  L  ++G  +   +
Sbjct  1330  NLSRVLSEYLGLDTMLAIVCKTY-DGVKALELYDNEGCINLNSGLHGLGASIGRKLEDRF  1388

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL +IRPY GE +   PQRRL I+KP LPNGE P GFLGYAVNMI++ + +L   TA
Sbjct  1389  LVICLENIRPYAGEFVQNDPQRRLDILKPRLPNGECPAGFLGYAVNMINVDSTNLFCLTA  1448

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---  1596
             SGHGLRETLFY L   LQVY  R  M +A  C  +  A+SLDG +MR  G+   + G   
Sbjct  1449  SGHGLRETLFYSLFSRLQVYITRAEMVLALPCITDG-AISLDGGMMRRTGL--FSLGNRE  1505

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQLREVQNDIENERMAYEEINNKFIGF  1773
             D  + FP  S    +    +     +N +K++K ++ E   D++ E   ++     F   
Sbjct  1506  DVDVKFPKLSVTSGLPESYLETQRQINEMKWRKEKMEE---DLKREEALWDNAKFNFDRK  1562

Query  1774  RDAYVNLTQGSSS  1812
             +  ++     SSS
Sbjct  1563  KKEFIKFLADSSS  1575



>ref|XP_006394681.1| hypothetical protein EUTSA_v10003513mg [Eutrema salsugineum]
 gb|ESQ31967.1| hypothetical protein EUTSA_v10003513mg [Eutrema salsugineum]
Length=1583

 Score =   326 bits (836),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 227/610 (37%), Positives = 325/610 (53%), Gaps = 36/610 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGC--LMCKVDKNGFINLGGVLKVTAGYGKKASL  198
             MLD YNNH+ +   +K+ +DG+   D     L  KVD +G I+L G+LKVTAGYGK  SL
Sbjct  987   MLDGYNNHVAEGTNVKICIDGYSIQDSNSMGLNRKVDSHGCIDLSGILKVTAGYGKSVSL  1046

Query  199   SVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEK  378
             +V SG K +FK+E  IE REL + +++PE C  GS+L N+IF+V  S+G +D SIHDDEK
Sbjct  1047  AVMSGKKEIFKKESLIEKRELVLLTKLPEYCTAGSNLTNLIFKVTESDGSLDTSIHDDEK  1106

Query  379   SGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQ--LR  552
             SG  HT++I+SE   ++  VRY+F HG C + S++LPE EG F F   HSRY EL   L+
Sbjct  1107  SGCSHTMSIESESSSVESGVRYAFLHGTCKIPSLSLPETEGAFSFKVFHSRYPELHMILK  1166

Query  553   IEVNTKKAVEADSG---------YFQSQSPERQILNKEVENFQ-YRSAQKQIFPYENSSP  702
             I++ + +  E D               QS      N  V   Q   S+Q ++      S 
Sbjct  1167  IQLTSPQTFEIDEAGCSTPYPRICLTPQSKMGSTTNPLVTPTQETPSSQCRVLAMRTVSS  1226

Query  703   YKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEES  882
                  L    S  D      ML+  +  Y +   +    L+ L+ +K + + E+  L+ S
Sbjct  1227  L---ALSSQTSPMDMEQYTGMLKANLSSYIERRAETYERLKCLEVEKEHAEQELRTLQAS  1283

Query  883   IG-LSSS-QNCCCTQESIMEQISGM-GDSAAAIACKLIETPSSSVELHHEFAKEILVVVA  1053
             +  LS++   C  T+E IM++I  M  D+AA++ C L     S   L     K +  +V 
Sbjct  1284  LEHLSAAFPECLSTKEIIMKKIEEMHQDTAASVFCSLYRNAPSPRSLFLS-KKGVFGLVV  1342

Query  1054  LLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTS  1233
              L   +S  LSR+L+EYLGE  MLA+VC    SS        YL     L T A  LG S
Sbjct  1343  TLATVDSTSLSRVLSEYLGEDTMLALVCR---SSRFVPNSAEYLR----LQTEAARLGRS  1395

Query  1234  INGGYDMICLNDIRPYT-GELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             I+  + ++CL+ IRP+  G +   PQR+LA+  P LP+GE  PGF GYAVN+I ++ + L
Sbjct  1396  ISNRFLVLCLDAIRPWIDGLVENDPQRKLAMDDPKLPDGEPIPGFKGYAVNLIDLAPEDL  1455

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
               +T +GHGLRETL+Y L G LQVY  +  +  A    +   AVSLDG I +GNG     
Sbjct  1456  HIKTYAGHGLRETLYYGLFGNLQVYETQAHVVEALPHIHGGGAVSLDGFIAKGNGFLYSG  1515

Query  1591  FGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIG  1770
                  I FP+   E +        + L  L+  K +LR V+  I  +R +  ++  K   
Sbjct  1516  CSKTEIHFPITVTENE-------GEKLRQLEAAKDRLRMVEEKILEDRFSLCKLEKKLKE  1568

Query  1771  FRDAYVNLTQ  1800
               + + N T+
Sbjct  1569  TNETFDNTTK  1578



>ref|XP_009380586.1| PREDICTED: uncharacterized protein LOC103968942 [Musa acuminata 
subsp. malaccensis]
Length=1584

 Score =   324 bits (831),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 226/624 (36%), Positives = 330/624 (53%), Gaps = 65/624 (10%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NHI++  E+ +  DGF   D    + KV+  G I+L G+L V+A +G    LSV
Sbjct  996   MFDAYGNHIEEGVEVFIHTDGFSFQDHLGYIRKVNCKGCIDLSGLLTVSASFGSYVHLSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 + V+K++FQ+  RELR  S +      G  LEN+IFEV + +G+VDE IH     G
Sbjct  1056  SYDKEIVYKKKFQVAQRELRAVSGVSGIHPIGCQLENVIFEVFDPDGQVDEKIH-----G  1110

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTL I S+ LK+D+T++Y+F HGRCTV  + +P   G F F A H+RY +L   IEVN
Sbjct  1111  QYHTLRIVSDSLKLDDTIQYTFHHGRCTVPFVPVPRRPGPFCFSAFHTRYHDLCTDIEVN  1170

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESE-A  741
               +A + +             L    E+  Y + Q Q+  + +SS      L H +    
Sbjct  1171  VLEASKLE-------------LFAATES--YGTFQSQVLDHMDSSKC----LSHQKDLLV  1211

Query  742   DHIVNHKMLEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIG---LSSSQNC  909
              +I +H  + DE I    L   + E +L+ L+ +K  ++ +I +L   IG   LS  ++ 
Sbjct  1212  KYISHHTQILDEKITEVGLKIGEHERKLKTLNDQKIQVEQDIHDLRVFIGPQYLSQIESL  1271

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEF------AKEILVVVALLGFAE  1071
               ++E I+++I   GD+AAAI C L    S +++    +       ++++ +VALLG   
Sbjct  1272  SSSREEILKRIGRKGDTAAAICCCL----SKAIQKQEPWKCFTNCTQDVVGLVALLGNVN  1327

Query  1072  SYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH-----GYLSSADALSTLANNLGTSI  1236
             + + SR+ +++LGE  MLA+VC ++ +   AS+M      G +    A+   A  LG +I
Sbjct  1328  TSKNSRMFSQFLGEDNMLAIVCKSYEA---ASRMEYYDEAGKIDHQQAVHGAAATLGINI  1384

Query  1237  NGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQ  1413
             +  + +ICL DIRPY G +    PQRRL +  P L +G  P GFLGYAVNMI++   H +
Sbjct  1385  SRRFPVICLEDIRPYQGRIMPNDPQRRLCLSNPLLQSGAVPAGFLGYAVNMINLDIHHCK  1444

Query  1414  YRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAF  1593
              +T SGHGLRETLFY L GE QVY  R  M  A SC     A+SLDG I+R +G      
Sbjct  1445  TKTLSGHGLRETLFYLLFGETQVYQTRADMRQARSCIKQG-AISLDGGIVRASGFILLGD  1503

Query  1594  GDPFIMFPV--------FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE  1749
              +P + FPV        FS++  MN+          ++ KK  L  +Q +I  E  AY E
Sbjct  1504  CEPDVTFPVIGTQAHRAFSQDMVMNIKQ--------MEEKKGLLTAIQQEIVKEYEAYTE  1555

Query  1750  INNKFIGFRDAYVNLTQGSSSVQN  1821
                KF    D    L   SSS  N
Sbjct  1556  DMAKFKKRSDRLRELLTESSSTTN  1579



>ref|XP_006286885.1| hypothetical protein CARUB_v10000029mg [Capsella rubella]
 gb|EOA19783.1| hypothetical protein CARUB_v10000029mg [Capsella rubella]
Length=1588

 Score =   318 bits (816),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 219/620 (35%), Positives = 335/620 (54%), Gaps = 44/620 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D YNNH+ +   + +  +G+C  D   L  KVD  G ++L G+L+VTAGYGK  SLSV
Sbjct  989   VFDGYNNHVAEGTNVLICTEGYCIKDSMGLNRKVDSCGCVDLSGILQVTAGYGKSLSLSV  1048

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG + +FK+E  IE RELR+ +++P+ C  G++L N+ F+V +S+G +D SIHDDEKSG
Sbjct  1049  MSGIEEIFKKESMIEKRELRLLTKLPDCCAAGTNLINLKFKVTDSDGLMDTSIHDDEKSG  1108

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQ--LRIE  558
               HT++I  +   ++ ++RY+F HG C V +++LPE EG F     HSR+ E+   L+I+
Sbjct  1109  YFHTMSIDFDSSGVESSIRYAFVHGFCKVPTLSLPESEGDFSIRVFHSRFPEIHMILKIQ  1168

Query  559   VNTKKAVEAD-----SGY-FQSQSPERQILNKE----VENFQYRSAQKQIFPYENSSPYK  708
             +   +  E D     + Y   S +P+ ++ +          Q   ++ ++     SS   
Sbjct  1169  LTPAQTFERDEIGCSTPYPMMSLTPQSKMASTTNSLVAPTGQTPCSEFRVLNIRASSS--  1226

Query  709   APKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG  888
                L       D     ++L++++I Y++   + E  L+ L+ ++++ + E+  L+ S+ 
Sbjct  1227  --ALGSQTGLMDMPQFTELLKEKLIRYSEHRVEVEERLKCLEDEQNHAKEELNTLQASLE  1284

Query  889   L--SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVA  1053
                ++   C  T+ES+M+QI     D+AA++ C L     P  S+ L     K +  +VA
Sbjct  1285  PLGATFPECLSTKESMMKQIEEKHQDTAASVFCCLYREAPPPQSLFLSK---KGVFGLVA  1341

Query  1054  LLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTS  1233
             LLG   S  LSR+L+EYLGE  MLA+VC + A  V +S  +  L S       A+ LG S
Sbjct  1342  LLGSVPSTSLSRVLSEYLGEDIMLALVCKS-AQCVPSSAAYLRLQSE------ADKLGRS  1394

Query  1234  I-NGGYDMICLNDIRPYT-GELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
             I N  + ++CL+ IRP+  G L   PQ++LA+  P L +G+  PGF GYAVNMI ++ + 
Sbjct  1395  ITNHRFHVLCLDAIRPWKDGLLENDPQKKLAMEDPKLSDGDPIPGFKGYAVNMIDLAIEE  1454

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L  +T SG+GLRETLFY L   LQVY  +  +  A    N   AVSLDG I +GNG    
Sbjct  1455  LSIQTYSGYGLRETLFYSLFENLQVYETQKQVEAALPHINGGGAVSLDGFIAKGNGFIYS  1514

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKV--QLREVQNDIENERMAYEEINNK  1761
                 P I FP+  KE +            L KY+K   ++R     IE E+ A  ++  K
Sbjct  1515  GCSKPEIHFPITVKENEEE---------KLRKYEKARDRVRNSAKKIEEEKCALRKLEKK  1565

Query  1762  FIGFRDAYVNLTQGSSSVQN  1821
                    Y N T     VQ 
Sbjct  1566  LEKTNGMYHNATNSLELVQT  1585



>ref|XP_010495413.1| PREDICTED: uncharacterized protein LOC104772508 [Camelina sativa]
Length=1449

 Score =   316 bits (810),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 206/551 (37%), Positives = 302/551 (55%), Gaps = 28/551 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D YNNH+ +  ++ +++DG+   D   +  KVD  G I+L G+LKVT GYGK  SLSV
Sbjct  863   MFDGYNNHVAEGTDVLIRIDGYRIEDWMGVNRKVDGRGCIDLSGLLKVTEGYGKSVSLSV  922

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
               G++ +F++E QIE RELR+ +E+PE C  GS+L N+IF+V + EG +D SIH DEKSG
Sbjct  923   IYGNEVIFRKESQIEERELRLVTELPECCAAGSNLVNLIFQVTDPEGSLDTSIHHDEKSG  982

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
                T++I+S+   ++  +RY+F HG C V  ++LPE EG F F   HSRY EL L ++  
Sbjct  983   WFRTMSIESDSSSVESAIRYAFVHGSCRVPYLSLPEIEGVFAFRVFHSRYPELHLSLKTQ  1042

Query  565   TKKAVEAD---SGYFQSQSPERQILNKEVENFQYRS----AQKQIFPYENSSPYKAPKLE  723
                A   +   +GY              +           +Q  +    +SS      L 
Sbjct  1043  VTSASSYEREGTGYSTPYPRTTTPPESGIPLITNPGLTPCSQIGVLAIRSSSL----ALS  1098

Query  724   HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SS  897
                S  D     + L++++  Y +   + +  L+ L ++  + + E+  L+ S+    +S
Sbjct  1099  SQTSLMDMAQYAESLKEKINTYEEYRFEVDKHLESLQAEHEHAEQELSALQASLEPLGAS  1158

Query  898   SQNCCCTQESIMEQIS-GMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALLGFA  1068
                C  T+ES+M+QI     D+AA++ C L     P  S  L +   K +  VVALLG  
Sbjct  1159  FPECLSTKESMMKQIEEKHHDTAASVFCCLYREAPPPQSFFLSN---KGMFGVVALLGSV  1215

Query  1069  ESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
              S  LSR+L+EYLG+  ML++VC    SS    K   Y      L + A + G +I   +
Sbjct  1216  ASTSLSRVLSEYLGKDTMLSLVCK---SSQFGQKSDEYRK----LQSEAASHGRTITNRF  1268

Query  1249  DMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL+  RP+  G +   PQ+RLA+  P LPNG+  PGF GY VNMIH++++ L  ++ 
Sbjct  1269  LVICLDATRPWRNGVVKNDPQKRLAMDSPYLPNGDPIPGFKGYGVNMIHLNSEELDIQSN  1328

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SGHGLRETLFY + GELQVY   + +  A    N + AVSLDGVI R NG        P 
Sbjct  1329  SGHGLRETLFYGIFGELQVYETAEDLEAALPHINGD-AVSLDGVIARENGFIYSGCCTPE  1387

Query  1606  IMFPVFSKEQQ  1638
             + FP+   E+Q
Sbjct  1388  VHFPITVTEKQ  1398



>dbj|BAB10394.1| unnamed protein product [Arabidopsis thaliana]
Length=1634

 Score =   316 bits (809),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 202/551 (37%), Positives = 306/551 (56%), Gaps = 27/551 (5%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D YNNH+ +  ++ + +DG+   D   +  KVD  G INL G+LKVT GYGK  SLSV
Sbjct  1047  LFDGYNNHVAEGTDVLIHIDGYRIEDWMGINRKVDSRGCINLSGILKVTEGYGKSVSLSV  1106

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG++ +F +E QI+ R+LR+ +E+P+ C  G++L N+IF+V   +G +D SIH DEKSG
Sbjct  1107  MSGNEVIFCKESQIDERQLRLVTELPDCCTAGTNLMNLIFQVTELDGSLDTSIHHDEKSG  1166

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HT++I+S+   ++  +RY+F HG C V S++LPE+EG F     HSRY ELQ+ I++ 
Sbjct  1167  CFHTMSIESDSSSVESAIRYAFVHGSCKVSSLSLPENEGVFSCRVFHSRYPELQMSIKIQ  1226

Query  565   TKKAVEA---DSGYFQSQS----PERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLE  723
                A  +   +SGY    S    P    +      +    +Q  +    +SS      L 
Sbjct  1227  VTSAPTSEREESGYSTPHSKTTPPPESGIPSITNPWPTPCSQFGVLAIRSSS----LALS  1282

Query  724   HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS-  900
              + S  D     + L++++    +   + E  L+ L +++ + + E   L+ S+    + 
Sbjct  1283  SETSLMDMAQYTEDLKEKINIDEERRVELEERLKCLQAQREHAEQECSRLQASLEPLGAP  1342

Query  901   -QNCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALLGFA  1068
                C  T+ES+M+QI     D+AA++ C L     P  S+ L     K +  VVALLG  
Sbjct  1343  FPECLSTKESMMKQIEEKHHDTAASVFCCLYRKAPPPRSLFLSQ---KGMFGVVALLGSV  1399

Query  1069  ESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
              S  LSR+L+EYLG+  ML++VC +      + +   + S A +       LG SI   +
Sbjct  1400  ASTSLSRVLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAAS-------LGRSITNRF  1452

Query  1249  DMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL+  RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++
Sbjct  1453  LVICLDATRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSS  1512

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SG+GLRETLFY +  ELQVY   + +  A    N   AVSLDGVI R NG        P 
Sbjct  1513  SGYGLRETLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENGFIYSGCCTPE  1572

Query  1606  IMFPVFSKEQQ  1638
             + FP+   E+Q
Sbjct  1573  VHFPITVTERQ  1583



>ref|NP_197816.3| gamma-irradiation and mitomycin c induced 1 [Arabidopsis thaliana]
 gb|AED93279.1| gamma-irradiation and mitomycin c induced 1 [Arabidopsis thaliana]
Length=1598

 Score =   316 bits (809),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 212/609 (35%), Positives = 326/609 (54%), Gaps = 34/609 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D YNNH+ +  ++ + +DG+   D   +  KVD  G INL G+LKVT GYGK  SLSV
Sbjct  1011  LFDGYNNHVAEGTDVLIHIDGYRIEDWMGINRKVDSRGCINLSGILKVTEGYGKSVSLSV  1070

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG++ +F +E QI+ R+LR+ +E+P+ C  G++L N+IF+V   +G +D SIH DEKSG
Sbjct  1071  MSGNEVIFCKESQIDERQLRLVTELPDCCTAGTNLMNLIFQVTELDGSLDTSIHHDEKSG  1130

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HT++I+S+   ++  +RY+F HG C V S++LPE+EG F     HSRY ELQ+ I++ 
Sbjct  1131  CFHTMSIESDSSSVESAIRYAFVHGSCKVSSLSLPENEGVFSCRVFHSRYPELQMSIKIQ  1190

Query  565   TKKAVEA---DSGYFQSQS----PERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLE  723
                A  +   +SGY    S    P    +      +    +Q  +    +SS      L 
Sbjct  1191  VTSAPTSEREESGYSTPHSKTTPPPESGIPSITNPWPTPCSQFGVLAIRSSS----LALS  1246

Query  724   HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS-  900
              + S  D     + L++++    +   + E  L+ L +++ + + E   L+ S+    + 
Sbjct  1247  SETSLMDMAQYTEDLKEKINIDEERRVELEERLKCLQAQREHAEQECSRLQASLEPLGAP  1306

Query  901   -QNCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALLGFA  1068
                C  T+ES+M+QI     D+AA++ C L     P  S+ L     K +  VVALLG  
Sbjct  1307  FPECLSTKESMMKQIEEKHHDTAASVFCCLYRKAPPPRSLFLSQ---KGMFGVVALLGSV  1363

Query  1069  ESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
              S  LSR+L+EYLG+  ML++VC +      + +   + S A +       LG SI   +
Sbjct  1364  ASTSLSRVLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAAS-------LGRSITNRF  1416

Query  1249  DMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL+  RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++
Sbjct  1417  LVICLDATRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSS  1476

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SG+GLRETLFY +  ELQVY   + +  A    N   AVSLDGVI R NG        P 
Sbjct  1477  SGYGLRETLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENGFIYSGCCTPE  1536

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAY  1785
             + FP+   E+Q   +      L + + KK   R+ +  +  E  +   +  K     + Y
Sbjct  1537  VHFPITVTERQEKALV----QLEITRDKK---RKTEEMMTEENRSLRRLVKKLKKANEKY  1589

Query  1786  VNLTQGSSS  1812
              N T  + S
Sbjct  1590  QNFTAMADS  1598



>gb|KCW46562.1| hypothetical protein EUGRSUZ_K003852, partial [Eucalyptus grandis]
Length=549

 Score =   300 bits (768),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 199/548 (36%), Positives = 296/548 (54%), Gaps = 36/548 (7%)
 Frame = +1

Query  196   LSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDE  375
             LSV +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+DE
Sbjct  2     LSVIAGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHNDE  61

Query  376   KSGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRI  555
             ++G  HTL+IK +      T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL L I
Sbjct  62    ENGHFHTLSIKLDSSVTKTTTLYAFRKGRCTIPSLTVPRDAGCFSFSAVHSRHRELSLSI  121

Query  556   EVNTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDES  735
             +V    A+    G F       QI  +   + Q+    + + P  N    +     +D  
Sbjct  122   KV----AMFYFCGTFIELDWYTQIGIQPSSDLQHEI--QTLCPNTNIMMLQDTSTPNDIG  175

Query  736   EADHIVNHKMLEDEVIHYAQLSRQCE-----IE-----LQILDSKKSNIQTEIFNLEESI  885
                 I+ +++LE+  +      R  E     IE     L++L  +K  I+  +  L    
Sbjct  176   NVLSIIKNEVLEESALCIEHQERVLEETRSRIEHRERVLKLLHDRKVEIEQSLVEL----  231

Query  886   GLSSSQNCC---CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVAL  1056
             G  S  N       +E +++ I     SAA++ C+LI   +S+ E  H  +++ ++ +  
Sbjct  232   GGPSPLNIVDSFFAKEEMIDMIENRDGSAASVLCELIR--NSASEGPHGRSRDGIIEL--  287

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKMHGYLSSADALSTLANNLGT  1230
                   +   RILA+YLGE QML +VC  +  A S+     +G +   +A+   A  LG 
Sbjct  288   -----HFPFWRILAKYLGEDQMLGIVCTNSEMAFSLETYDKNGEVDLQNAVYAKAAELGK  342

Query  1231  SINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
             SI+G + +ICL +I PY GE+    PQR+LA+  P LP GE PPGF+GYAVNM++I   H
Sbjct  343   SISGEFRVICLEEISPYRGEIEGCDPQRKLALPYPTLPCGEIPPGFVGYAVNMVNIDFDH  402

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L  RT  G GLRETLFYRL G+LQVY  R+ M  AS C  +  AVSLDG I+R +G+ + 
Sbjct  403   LATRTTKGLGLRETLFYRLFGKLQVYDTREHMKQASVCIEHG-AVSLDGGIIREDGLISL  461

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
              F  P I+FPV + E  +N +  +  V   +     +LR     I     A EE   +F 
Sbjct  462   GFWKPDIIFPVVTSEIHINTLPGSTQVGMQMAEAMSELRVTLCKIRKITRACEEDKRQFF  521

Query  1768  GFRDAYVN  1791
             G  + +++
Sbjct  522   GKTEDFIS  529



>ref|XP_010519440.1| PREDICTED: uncharacterized protein LOC104798901 isoform X7 [Tarenaya 
hassleriana]
Length=1628

 Score =   310 bits (794),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 217/621 (35%), Positives = 330/621 (53%), Gaps = 47/621 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  994   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1053

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1054  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1113

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + +++ 
Sbjct  1114  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIQ  1173

Query  565   TKKAVEAD------------SGYFQSQSPERQIL--------NKEVENFQYRSAQKQIFP  684
                A E++            +G F    P  +I          +E+E+    S +  + P
Sbjct  1174  LMAAPESERDDTESPYPCSGNGIFPEFHPHVKIQIETAPESEREEIESLLPFS-ENHVLP  1232

Query  685   YENSSPYKAPKLE----HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNI  852
              E S      ++     H+ SE         L +++  Y   +   E +L  L ++K  I
Sbjct  1233  LEVSPSSIHCQVSLMSAHERSEE--------LFEKLERYGSRNGALEKQLNGLMTQKKEI  1284

Query  853   QTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSSSVELHH  1020
             + ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S S     
Sbjct  1285  EQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISPS-RAQI  1343

Query  1021  EFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSA  1194
             +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +G +   
Sbjct  1344  QLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPNGVIDHE  1403

Query  1195  DALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLG  1371
               +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+  PGFLG
Sbjct  1404  FGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDMVPGFLG  1463

Query  1372  YAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD  1551
             YAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N   AVSLD
Sbjct  1464  YAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGGAAVSLD  1523

Query  1552  GVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE  1731
             G I++ +G        P + FPV  K ++         +L  ++ K+  LR +   I   
Sbjct  1524  GAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIVEQITGT  1577

Query  1732  RMAYEEINNKFIGFRDAYVNL  1794
               +  ++  KF   ++ Y  L
Sbjct  1578  DNSLRKVQKKFSKRKNEYEGL  1598



>ref|XP_010519438.1| PREDICTED: uncharacterized protein LOC104798901 isoform X5 [Tarenaya 
hassleriana]
Length=1630

 Score =   310 bits (794),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 217/621 (35%), Positives = 330/621 (53%), Gaps = 47/621 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  996   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1056  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1115

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + +++ 
Sbjct  1116  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIQ  1175

Query  565   TKKAVEAD------------SGYFQSQSPERQIL--------NKEVENFQYRSAQKQIFP  684
                A E++            +G F    P  +I          +E+E+    S +  + P
Sbjct  1176  LMAAPESERDDTESPYPCSGNGIFPEFHPHVKIQIETAPESEREEIESLLPFS-ENHVLP  1234

Query  685   YENSSPYKAPKLE----HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNI  852
              E S      ++     H+ SE         L +++  Y   +   E +L  L ++K  I
Sbjct  1235  LEVSPSSIHCQVSLMSAHERSEE--------LFEKLERYGSRNGALEKQLNGLMTQKKEI  1286

Query  853   QTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSSSVELHH  1020
             + ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S S     
Sbjct  1287  EQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISPS-RAQI  1345

Query  1021  EFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSA  1194
             +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +G +   
Sbjct  1346  QLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPNGVIDHE  1405

Query  1195  DALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLG  1371
               +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+  PGFLG
Sbjct  1406  FGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDMVPGFLG  1465

Query  1372  YAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD  1551
             YAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N   AVSLD
Sbjct  1466  YAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGGAAVSLD  1525

Query  1552  GVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE  1731
             G I++ +G        P + FPV  K ++         +L  ++ K+  LR +   I   
Sbjct  1526  GAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIVEQITGT  1579

Query  1732  RMAYEEINNKFIGFRDAYVNL  1794
               +  ++  KF   ++ Y  L
Sbjct  1580  DNSLRKVQKKFSKRKNEYEGL  1600



>ref|XP_002874183.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50442.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1607

 Score =   310 bits (793),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 203/535 (38%), Positives = 296/535 (55%), Gaps = 24/535 (4%)
 Frame = +1

Query  64    EIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVFSGDKSVFKQEFQ  243
             ++ + +DG+   D   +  KVD  G I+L G+LKVT GYGK  SLSV SG++ +F++E Q
Sbjct  1032  DVLINIDGYIIEDWMGINRKVDGRGCIDLSGILKVTEGYGKSVSLSVMSGNEVIFRKESQ  1091

Query  244   IEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIKSELLK  423
             IE RELR+ +E+P+ C  GS+L N+IF+V +S+G +D  IH DEKSG  HT+ I+S+   
Sbjct  1092  IEERELRLVTELPDCCAAGSNLVNLIFQVTDSDGSLDTRIHHDEKSGCFHTMCIESDSSI  1151

Query  424   IDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNTKKAVEADS-GY-  597
             ++ T+RY+F HG C V S++LPE+EG F +   HSRY EL + ++V      E D  GY 
Sbjct  1152  VESTIRYAFVHGSCKVPSLSLPENEGVFSYRVFHSRYPELHMSVKVTCAPTFERDEIGYS  1211

Query  598   --FQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLE  771
               + +  P    +           +Q  +    +SS      L       D     + L+
Sbjct  1212  TPYSTTPPPESGMPSITNPSSTPCSQFGVLAIRSSS----LALCSQTGLMDIAQYTESLK  1267

Query  772   DEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQNCCCTQESIMEQIS  945
             + +    +L  + +  L+ L  +  + + E   L+ S+    +S   C  T+E +M+QI 
Sbjct  1268  ETINSEEELRVELDKRLKCLQDQHEHAEQECSRLQASLEPLGASFPECLSTKELMMKQIE  1327

Query  946   GM-GDSAAAIACKLIET--PSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEK  1116
                 D+AA++ C L     P  S+ L     K +  +VALLG   S  LSR+L+EYLG+ 
Sbjct  1328  DKHHDTAASVFCCLYRKAPPPQSLFLSK---KGMFGLVALLGSVASTSLSRVLSEYLGKD  1384

Query  1117  QMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPY-TGEL  1293
              ML++VC    SS    K   Y      L + A +LG SI   + +ICL+ IRP+  G +
Sbjct  1385  TMLSLVCK---SSQFGPKSDEY----RKLQSEAASLGRSITNRFLVICLDAIRPWRNGLV  1437

Query  1294  SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGE  1473
                PQ+RLA+  P LPNG+   GF GYAVNMI +S++ L  +++SG+GLRETLFY + GE
Sbjct  1438  KNDPQKRLAMDNPYLPNGDPILGFKGYAVNMIDLSSEELNIQSSSGYGLRETLFYGVFGE  1497

Query  1474  LQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQ  1638
             LQVY   + +  A    N   AVSLDGVI R NG        P I FP+   E+Q
Sbjct  1498  LQVYETGEHLEAALPHINGGDAVSLDGVIARENGFIYSGCCTPEIHFPITVTERQ  1552



>ref|XP_010519436.1| PREDICTED: uncharacterized protein LOC104798901 isoform X3 [Tarenaya 
hassleriana]
Length=1639

 Score =   306 bits (784),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 215/625 (34%), Positives = 334/625 (53%), Gaps = 46/625 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  996   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1056  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1115

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + ++++
Sbjct  1116  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIS  1175

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFP--YENSSPYKAPKLEHDESE  738
                ++        + +PE +  + E     Y  +   IFP  + +     AP+ E +E E
Sbjct  1176  AWCSLFCILIQLMA-APESERDDTES---PYPCSGNGIFPEFHPHVKIETAPESEREEIE  1231

Query  739   A------DHIVNHKM--------------------LEDEVIHYAQLSRQCEIELQILDSK  840
             +      +H++  ++                    L +++  Y   +   E +L  L ++
Sbjct  1232  SLLPFSENHVLPLEVSPSSIHCQVSLMSAHERSEELFEKLERYGSRNGALEKQLNGLMTQ  1291

Query  841   KSNIQTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSSSV  1008
             K  I+ ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S S 
Sbjct  1292  KKEIEQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISPS-  1350

Query  1009  ELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGY  1182
                 +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +G 
Sbjct  1351  RAQIQLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPNGV  1410

Query  1183  LSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPP  1359
             +     +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+  P
Sbjct  1411  IDHEFGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDMVP  1470

Query  1360  GFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPA  1539
             GFLGYAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N   A
Sbjct  1471  GFLGYAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGGAA  1530

Query  1540  VSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQND  1719
             VSLDG I++ +G        P + FPV  K ++         +L  ++ K+  LR +   
Sbjct  1531  VSLDGAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIVEQ  1584

Query  1720  IENERMAYEEINNKFIGFRDAYVNL  1794
             I     +  ++  KF   ++ Y  L
Sbjct  1585  ITGTDNSLRKVQKKFSKRKNEYEGL  1609



>ref|XP_006286349.1| hypothetical protein CARUB_v10000030mg [Capsella rubella]
 gb|EOA19247.1| hypothetical protein CARUB_v10000030mg [Capsella rubella]
Length=1570

 Score =   306 bits (783),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 214/554 (39%), Positives = 309/554 (56%), Gaps = 36/554 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D YNNH+ +  ++ + + G+   D   +  KVD  G I+L G+L+VT GYGK  SLSV
Sbjct  986   MFDGYNNHVAEGTDVLIHIVGYRIEDWMGVNRKVDGCGCIDLSGLLRVTEGYGKSVSLSV  1045

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
               G+  +F +E QIE RELR+ +E+P  C  GS+L N+IF+V + EG +D SI+ DEKSG
Sbjct  1046  LYGNDVIFSKESQIEERELRLVTELPNCCAAGSNLVNLIFQVTDLEGCLDTSINHDEKSG  1105

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQ--LRIE  558
               HTL+I+ +       VRY+F HG C V S++LPE+EG F F  VHSRY EL   L+I+
Sbjct  1106  CFHTLSIEFDSSSEGSAVRYAFVHGSCKVPSLSLPENEGVFPFRVVHSRYPELHMSLKIQ  1165

Query  559   VNTKKAVEADS-GYFQSQSPERQILNKEVEN-FQYRSAQKQIFPYENSSPYKAPKLEHDE  732
             + +    E D  GY    S    +    ++N +  +S+Q  +    +SS   AP      
Sbjct  1166  LTSSPTFERDEIGYSTPYSKTTTLPESGIKNTWATQSSQFGVLAIRSSS--LAP------  1217

Query  733   SEADHIVNH----KMLEDEVIHYAQLSRQCEIE--LQILDSKKSNIQTEIFNLEESIGL-  891
             S    ++N     + L++E+  Y +  RQ EI+  L+ L ++  + + E+  L+ S+   
Sbjct  1218  SSQTGLINMAEYVESLKEELNIYKE--RQVEIDGRLKCLQAEYEHAEYELSTLQASLEPL  1275

Query  892   -SSSQNCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALL  1059
              +S   C  T+ S+M+QI     D+AA++ C L     P  S  L +   K I  VVALL
Sbjct  1276  GASFPECLSTKASMMKQIEEKYDDTAASVFCCLCRKAPPPQSFTLSN---KGIFGVVALL  1332

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSIN  1239
             G   S  LSR+L+EYLG+  ML++VC    SS    K   Y      L + A +L   I 
Sbjct  1333  GSVASTSLSRVLSEYLGKDTMLSLVCK---SSKFGPKSDEYCK----LQSEAASLERPIT  1385

Query  1240  GGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
               + +I ++  RP+  G +   PQ+RLA+  P L NG+  PGF GYAVNMI+++++ L  
Sbjct  1386  NRFLVISIDATRPWRNGLVRNDPQKRLAMDNPYLQNGDPIPGFKGYAVNMINLASEMLTV  1445

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             ++ SGHGLRETLFY L GELQVY   + +  A    N   AVSLDGVI+R N        
Sbjct  1446  QSNSGHGLRETLFYGLFGELQVYETAEDLEAALPHINGEDAVSLDGVIVRENCFIYPGCC  1505

Query  1597  DPFIMFPVFSKEQQ  1638
              P + FP+   E+Q
Sbjct  1506  APEVHFPISVTEKQ  1519



>ref|XP_010519439.1| PREDICTED: uncharacterized protein LOC104798901 isoform X6 [Tarenaya 
hassleriana]
Length=1624

 Score =   305 bits (780),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 215/627 (34%), Positives = 333/627 (53%), Gaps = 48/627 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  979   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1038

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1039  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1098

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + ++++
Sbjct  1099  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIS  1158

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF----PYENSSPYKAPKLEHDE  732
                ++        + +PE +  + E     Y  +   IF    P+       AP+ E +E
Sbjct  1159  AWCSLFCILIQLMA-APESERDDTES---PYPCSGNGIFPEFHPHVKIQIETAPESEREE  1214

Query  733   SEA------DHIVNHKM--------------------LEDEVIHYAQLSRQCEIELQILD  834
              E+      +H++  ++                    L +++  Y   +   E +L  L 
Sbjct  1215  IESLLPFSENHVLPLEVSPSSIHCQVSLMSAHERSEELFEKLERYGSRNGALEKQLNGLM  1274

Query  835   SKKSNIQTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSS  1002
             ++K  I+ ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S 
Sbjct  1275  TQKKEIEQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISP  1334

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--H  1176
             S     +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +
Sbjct  1335  S-RAQIQLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPN  1393

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G +     +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+ 
Sbjct  1394  GVIDHEFGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDM  1453

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
              PGFLGYAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N  
Sbjct  1454  VPGFLGYAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGG  1513

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQ  1713
              AVSLDG I++ +G        P + FPV  K ++         +L  ++ K+  LR + 
Sbjct  1514  AAVSLDGAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIV  1567

Query  1714  NDIENERMAYEEINNKFIGFRDAYVNL  1794
               I     +  ++  KF   ++ Y  L
Sbjct  1568  EQITGTDNSLRKVQKKFSKRKNEYEGL  1594



>ref|XP_010519435.1| PREDICTED: uncharacterized protein LOC104798901 isoform X2 [Tarenaya 
hassleriana]
Length=1639

 Score =   304 bits (779),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 215/627 (34%), Positives = 333/627 (53%), Gaps = 48/627 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  994   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1053

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1054  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1113

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + ++++
Sbjct  1114  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIS  1173

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF----PYENSSPYKAPKLEHDE  732
                ++        + +PE +  + E     Y  +   IF    P+       AP+ E +E
Sbjct  1174  AWCSLFCILIQLMA-APESERDDTES---PYPCSGNGIFPEFHPHVKIQIETAPESEREE  1229

Query  733   SEA------DHIVNHKM--------------------LEDEVIHYAQLSRQCEIELQILD  834
              E+      +H++  ++                    L +++  Y   +   E +L  L 
Sbjct  1230  IESLLPFSENHVLPLEVSPSSIHCQVSLMSAHERSEELFEKLERYGSRNGALEKQLNGLM  1289

Query  835   SKKSNIQTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSS  1002
             ++K  I+ ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S 
Sbjct  1290  TQKKEIEQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISP  1349

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--H  1176
             S     +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +
Sbjct  1350  S-RAQIQLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPN  1408

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G +     +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+ 
Sbjct  1409  GVIDHEFGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDM  1468

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
              PGFLGYAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N  
Sbjct  1469  VPGFLGYAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGG  1528

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQ  1713
              AVSLDG I++ +G        P + FPV  K ++         +L  ++ K+  LR + 
Sbjct  1529  AAVSLDGAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIV  1582

Query  1714  NDIENERMAYEEINNKFIGFRDAYVNL  1794
               I     +  ++  KF   ++ Y  L
Sbjct  1583  EQITGTDNSLRKVQKKFSKRKNEYEGL  1609



>ref|XP_010519434.1| PREDICTED: uncharacterized protein LOC104798901 isoform X1 [Tarenaya 
hassleriana]
Length=1641

 Score =   304 bits (779),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 215/627 (34%), Positives = 333/627 (53%), Gaps = 48/627 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  996   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1056  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1115

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + ++++
Sbjct  1116  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIS  1175

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF----PYENSSPYKAPKLEHDE  732
                ++        + +PE +  + E     Y  +   IF    P+       AP+ E +E
Sbjct  1176  AWCSLFCILIQLMA-APESERDDTES---PYPCSGNGIFPEFHPHVKIQIETAPESEREE  1231

Query  733   SEA------DHIVNHKM--------------------LEDEVIHYAQLSRQCEIELQILD  834
              E+      +H++  ++                    L +++  Y   +   E +L  L 
Sbjct  1232  IESLLPFSENHVLPLEVSPSSIHCQVSLMSAHERSEELFEKLERYGSRNGALEKQLNGLM  1291

Query  835   SKKSNIQTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSS  1002
             ++K  I+ ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S 
Sbjct  1292  TQKKEIEQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISP  1351

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--H  1176
             S     +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +
Sbjct  1352  S-RAQIQLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPN  1410

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G +     +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+ 
Sbjct  1411  GVIDHEFGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDM  1470

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
              PGFLGYAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N  
Sbjct  1471  VPGFLGYAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGG  1530

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQ  1713
              AVSLDG I++ +G        P + FPV  K ++         +L  ++ K+  LR + 
Sbjct  1531  AAVSLDGAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIV  1584

Query  1714  NDIENERMAYEEINNKFIGFRDAYVNL  1794
               I     +  ++  KF   ++ Y  L
Sbjct  1585  EQITGTDNSLRKVQKKFSKRKNEYEGL  1611



>ref|XP_010519437.1| PREDICTED: uncharacterized protein LOC104798901 isoform X4 [Tarenaya 
hassleriana]
Length=1632

 Score =   304 bits (779),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 215/627 (34%), Positives = 333/627 (53%), Gaps = 48/627 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+++  ++ L +DGF   DQ  L   VD  G I+L GVLKV AGYGK  SLSV
Sbjct  987   MFDGYGNHVEEGTDVMLHLDGFEIQDQMGLKRSVDDCGCIDLSGVLKVKAGYGKSVSLSV  1046

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S D+ +FK E +   REL++ +E+PE C  GS+LENI+F+V NS+G VD SIHDDEKSG
Sbjct  1047  RSSDEEIFKIESETVRRELQLVTELPEYCTAGSNLENIVFKVTNSDGTVDTSIHDDEKSG  1106

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTLT+KS+    +  +RY+F HG C + S+ LP++EG F     H R+ EL + ++++
Sbjct  1107  SYHTLTLKSDPAISENAIRYAFVHGCCKIPSLFLPKNEGLFCLEVFHFRHSELHMSLKIS  1166

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF----PYENSSPYKAPKLEHDE  732
                ++        + +PE +  + E     Y  +   IF    P+       AP+ E +E
Sbjct  1167  AWCSLFCILIQLMA-APESERDDTES---PYPCSGNGIFPEFHPHVKIQIETAPESEREE  1222

Query  733   SEA------DHIVNHKM--------------------LEDEVIHYAQLSRQCEIELQILD  834
              E+      +H++  ++                    L +++  Y   +   E +L  L 
Sbjct  1223  IESLLPFSENHVLPLEVSPSSIHCQVSLMSAHERSEELFEKLERYGSRNGALEKQLNGLM  1282

Query  835   SKKSNIQTEIFNLEESIGL---SSSQNCCCTQESIMEQIS-GMGDSAAAIACKLIETPSS  1002
             ++K  I+ ++  L+ S+G    +S   C  T+E++M +I     DSAA++ C L    S 
Sbjct  1283  TQKKEIEQDLNILQASLGQLDDASFPECLTTKEALMRKIEMEHFDSAASVYCCLSRHISP  1342

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--H  1176
             S     +  K+++  VALLG   S  LSRIL+EYLG++ MLA+VC ++ S+    +   +
Sbjct  1343  S-RAQIQLRKDVIGPVALLGSVVSSSLSRILSEYLGKETMLALVCKSYESARSLERYGPN  1401

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G +     +   A  L  S+   + +ICL  IR + G  +   P +RL++ +P LPNG+ 
Sbjct  1402  GVIDHEFGIHAEAAKLQGSVASRFTVICLERIRHWKGGYVKNDPLKRLSLGRPRLPNGDM  1461

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
              PGFLGYAVNMI ++++ L  R +SG+GLR+TLFY L   L VY  R+ +  A    N  
Sbjct  1462  VPGFLGYAVNMIDLASELLSVRISSGYGLRDTLFYALFKTLHVYETRNHLEAALPYINGG  1521

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQ  1713
              AVSLDG I++ +G        P + FPV  K ++         +L  ++ K+  LR + 
Sbjct  1522  AAVSLDGAIVKEDGFIRLGSWRPEMYFPVSVKSEETQ------SILKEIEAKRDDLRTIV  1575

Query  1714  NDIENERMAYEEINNKFIGFRDAYVNL  1794
               I     +  ++  KF   ++ Y  L
Sbjct  1576  EQITGTDNSLRKVQKKFSKRKNEYEGL  1602



>ref|XP_006394682.1| hypothetical protein EUTSA_v10003512mg [Eutrema salsugineum]
 gb|ESQ31968.1| hypothetical protein EUTSA_v10003512mg [Eutrema salsugineum]
Length=1599

 Score =   303 bits (777),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 197/558 (35%), Positives = 301/558 (54%), Gaps = 33/558 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D YNNH+ +  ++ + +DG+C      +  KVD  G I+L G+LKVT GYG+  S SV
Sbjct  996   MFDGYNNHVAEGTDVLIHIDGYCIEHWMGVNRKVDGRGCIDLSGILKVTKGYGQSVSFSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG++ +F++E QIE RELR+ +E+P  C  GS+L ++IF+V +S+G++D SIH DEK G
Sbjct  1056  MSGNEEIFRKESQIEERELRLVTELPVSCAAGSNLVDLIFKVTDSDGDMDTSIHHDEKFG  1115

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HT++I S+   +   +RY+F +G C V +++LPE+EG F F   HSRY EL + +++ 
Sbjct  1116  CFHTMSIDSDSRNMQSGIRYAFVYGCCKVPTLSLPENEGVFSFRVFHSRYPELHVNLKIP  1175

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAP----------  714
                A   +   F   +P  +      ++    +    + P  N    + P          
Sbjct  1176  LTSAPTVERDEFGCSTPYSRTTTTP-QSGMASTTYTGLTPTPNLGLEQTPCSQLDVMTIS  1234

Query  715   --KLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG  888
                L       D +   + L+ ++  Y +   + E  L+ L++++   + E+  L  S+ 
Sbjct  1235  SLDLSSQTDIVDIMQYTERLKQKISIYGEHQVEIEERLKYLEAEQEQAEQELTTLNASLE  1294

Query  889   LSSSQ--NCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVA  1053
               S+    C  T+ES+M +I     D+ A++ C L     P  S+ L     K +  +VA
Sbjct  1295  PISAALPECLSTRESLMREIEEKHHDTVASVFCSLYRKAPPPQSLFLSK---KGVFGIVA  1351

Query  1054  LLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSAD--ALSTLANNLG  1227
             LLG   S  LSR L+ YLG+  MLA+VC   +S  G        +SAD   L + A +L 
Sbjct  1352  LLGSVASTSLSRALSVYLGKDTMLALVCK--SSKFGP-------NSADYLRLQSEAASLE  1402

Query  1228  TSINGGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAK  1404
              +I     +ICL+  RP+ +G +    QR+LA+V P  PNG+  PGF+GYAVNMI ++++
Sbjct  1403  RAITSPLLIICLDATRPWSSGLVENDHQRKLAMVNPCHPNGDPIPGFVGYAVNMIELASE  1462

Query  1405  HLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTT  1584
              L  +T SGHGLRETLFY L G+LQVY     +  A    N+  AVSLDG I + NG   
Sbjct  1463  ELNIQTKSGHGLRETLFYGLFGDLQVYETVKDLEAALPYINSGNAVSLDGWISKENGYLY  1522

Query  1585  HAFGDPFIMFPVFSKEQQ  1638
                  P I FP+   E++
Sbjct  1523  SGCCKPEIHFPITVTEKE  1540



>ref|XP_007039067.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
5 [Theobroma cacao]
 gb|EOY23568.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
5 [Theobroma cacao]
Length=1532

 Score =   303 bits (775),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 207/588 (35%), Positives = 300/588 (51%), Gaps = 104/588 (18%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E++  +DGF          KVD  G I+LGG+L+VTAGYGK  SLSV
Sbjct  1003  MFDAYGNHVAEGAEVQFHLDGFVIQGHLGSKYKVDDRGCIDLGGLLEVTAGYGKSVSLSV  1062

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 K VFK+EFQ E RELRIAS +PE C+ GS LE++ FEV++S+G VDE+ HDDEK G
Sbjct  1063  LHDGKVVFKREFQTEKRELRIASVVPERCIAGSILEDLAFEVVDSQGVVDETFHDDEKHG  1122

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H L + SE  +  +++ Y+F HG C V SI LPE EG F FVA HSRYM+L L ++V+
Sbjct  1123  QSHRLIVNSESFETCDSICYAFIHGCCIVTSIPLPEIEGPFCFVAFHSRYMDLYLNVKVS  1182

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +               R++ + E+E   Y S QK +F            L+  +S  D
Sbjct  1183  LVRP--------------RKVESDEIE---YPSDQKGLF------------LQKSQSVKD  1213

Query  745   -----HIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI--GLSSS  900
                   +V + K LEDEV  Y +   + E  L+ LD +K++I+  +  L+ S+   L  +
Sbjct  1214  VGCLLSLVKYDKELEDEVCKYGERIAKWEHLLETLDCRKASIERYVSGLQASLEPNLIDN  1273

Query  901   QNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              +   T+E +M +I     SAA++ C L +                      L F E + 
Sbjct  1274  LDSLSTKEEMMIRIKERDHSAASVLCSLAQK---------------------LPFQEPW-  1311

Query  1081  LSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMIC  1260
                ++   +G   +L  VC    S +      G +  +D    LA               
Sbjct  1312  -MDVIEGLVGVVALLGTVC---TSKLSRRPYPGLIEVSDPQRKLA---------------  1352

Query  1261  LNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
             L D R  TG                     +PPGF+GYAVNM++I   HL+  T +GHGL
Sbjct  1353  LPDPRLPTG--------------------NTPPGFIGYAVNMVNIDHPHLENLTTAGHGL  1392

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFYRL  +LQVY  R+ M  A +C  ++ A+SLDG I+R NG+ +  + +P I FPV
Sbjct  1393  RETLFYRLFSKLQVYETREHMENARACIKHS-AISLDGGILRKNGIISLGYRNPEIHFPV  1451

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                  QM++   + +++  +K  K++LR +   IE     + + + KF
Sbjct  1452  -----QMHVSQQHKEIMEQIKKMKLELRSILQHIERISENHAKASKKF  1494



>gb|EYU25236.1| hypothetical protein MIMGU_mgv1a019692mg [Erythranthe guttata]
Length=1524

 Score =   297 bits (761),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 203/604 (34%), Positives = 296/604 (49%), Gaps = 113/604 (19%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCL---------MCKVDKNGFINLGGVLKVTAG  177
             +LDEY NH ++ E I L++DGF   D   +         +C VD +G ++L  +LKV+ G
Sbjct  1010  VLDEYGNHAREGENISLRVDGFSFQDGSNIVTEKGLKRKICLVDADGLVDLSNILKVSKG  1069

Query  178   YGKKASLSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDE  357
             YGK   L V S ++ +FK +FQ E RELR   ++ ++C  GS LENI+FE+ +++G+VDE
Sbjct  1070  YGKDVFLYVISEEEVIFKLQFQTEIRELRAVQKLFKNCKAGSQLENIVFEITDTQGKVDE  1129

Query  358   SIHDDEKSGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYM  537
             +I+D+                                       E  G+FH + + S+  
Sbjct  1130  NINDE---------------------------------------EKHGQFHTLKIKSKSF  1150

Query  538   ELQLRIEVNTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPK  717
             ++   +  +          +   +   R I    +E     SA    +P  N       +
Sbjct  1151  DIDDSVRYS----------FRHGRCIIRSIPLPNIEGILSFSASHSRYPELN---LDIEE  1197

Query  718   LEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSS  897
             LE D +     +N    + E++H+  L                +IQ  I +L++S+    
Sbjct  1198  LEDDLANCGMTINDHERKLEMLHFRWL----------------HIQRNISDLQDSV----  1237

Query  898   SQNCCCTQESI------MEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                  C   S+        QI     + AA+ CKL E    S         +IL +VALL
Sbjct  1238  -DGDLCISPSMSGKVLTQRQIESKCQTPAAVICKLDEVSFKSS------PGDILGIVALL  1290

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSIN  1239
             G  +S ELSR+LA+Y+GE +MLAVVC  +A++                  L   LG  + 
Sbjct  1291  GTVQSIELSRMLAQYIGEDKMLAVVCKNYAAAY----------------NLETTLGQYVR  1334

Query  1240  GGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYR  1419
             GGY  +CL DIR    E S+ P   + +  P+LPNG  P GFLGYAVNMI+I A +LQ+R
Sbjct  1335  GGYLALCLEDIRITIREPSVDPLELMPLKMPSLPNGIIPQGFLGYAVNMINIDASYLQWR  1394

Query  1420  TASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGD  1599
             T SGHGLRETLFYRL GELQVY +R+CM  A SC  +  AVSLDG I+RGNG+ +    +
Sbjct  1395  TTSGHGLRETLFYRLFGELQVYKDRECMMNARSCIQDG-AVSLDGGIIRGNGLLSLGHWE  1453

Query  1600  PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRD  1779
             P I+FPV  + + M     +   + LL+ KK++L E+   I+      E    KF+  RD
Sbjct  1454  PDILFPV--ENEAMPNTPQSSQAIRLLEAKKLELIEISKQIDEGNKFLESEREKFLISRD  1511

Query  1780  AYVN  1791
              Y N
Sbjct  1512  RYNN  1515



>emb|CDX88088.1| BnaA06g26790D [Brassica napus]
Length=1607

 Score =   297 bits (761),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 203/567 (36%), Positives = 305/567 (54%), Gaps = 38/567 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D +NNHI +   + ++ DG+C  D      KVD +G I+L G+LKVT GYGK  S SV
Sbjct  992   MFDGFNNHIAEGTSVLIKTDGYCVEDWMGDNRKVDGHGCIDLSGILKVTEGYGKHVSFSV  1051

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S  K +F++E QIE RELR+ +E+PE C  GS+L ++IF+V +S+G +D SIH DEK+ 
Sbjct  1052  VSDCKEIFRKESQIEERELRLVTELPESCTAGSNLTSLIFKVTDSDGSLDTSIHHDEKTR  1111

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+++S+   ++  +RY+F HG C V S++LPE EG F F   HSRY EL + +E+ 
Sbjct  1112  CIHTLSVESDSSSVESGIRYAFVHGSCKVPSLSLPETEGIFSFKVFHSRYPELHVNLEIL  1171

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSP--------------  702
                A  ++       +P  ++ +      Q   A    FP    +P              
Sbjct  1172  ITPAPTSERDDIGCSTPYSRMTSTP----QSGMASATPFPGVTPTPSLGLERTPCSQFGV  1227

Query  703   --YKAPKLEHD-ESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
                ++P L+    S    IV + + L+ E+  Y       +  L+ L++++  ++ E+  
Sbjct  1228  LAIRSPSLDGSCPSGVMDIVQYTQSLKQELSTYEAQREVTDERLKCLEAEQEQVEQELIT  1287

Query  871   LEESI---GLSSSQNCCCTQESIMEQISGMG-DSAAAIACKLIE--TPSSSVELHHEFAK  1032
              + S+   G++  + C  T+E +M+ I     ++AA++ C L     P  S  L ++  K
Sbjct  1288  FQASLEPQGVAFPE-CLSTKEQMMKHIEEEHYNTAASVFCSLYRKAPPPKSRFLSNKGGK  1346

Query  1033  -EILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYL-----SSA  1194
              E+  +VALLG   S  LSR+L+ YLG   MLA+VC   +S+ G +    YL     +  
Sbjct  1347  GEVFGIVALLGSVASTALSRVLSVYLGNDTMLALVCK--SSAYGPTSCAEYLKLQSETEY  1404

Query  1195  DALSTLANNLGTSINGGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLG  1371
               L + A  LG SI     + CL+  RP+ +G +   PQRRLA+V P+L NG+  PGF  
Sbjct  1405  QRLQSEAAKLGRSITNDLLIHCLDAFRPWSSGLMKNDPQRRLAMVNPSLSNGDPIPGFKD  1464

Query  1372  YAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD  1551
             YAVNMI ++   L  +T  GHGLRETLFY L G+L VY     +  A    + + AVSLD
Sbjct  1465  YAVNMIELATGELDIQTKLGHGLRETLFYGLFGDLHVYETGRDLEAALPFISGSDAVSLD  1524

Query  1552  GVIMRGNGVTTHAFGDPFIMFPVFSKE  1632
             G+I + NG+       P + FPV   E
Sbjct  1525  GLISKRNGLMHSVCLIPEVHFPVTVTE  1551



>ref|XP_009150949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103874295 
[Brassica rapa]
Length=1625

 Score =   297 bits (761),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 202/563 (36%), Positives = 304/563 (54%), Gaps = 38/563 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D +NNHI +   + ++ DG+C  D      KVD +G I+L G+LKVT GYGK  S SV
Sbjct  1010  MFDGFNNHIAEGTSVLIKTDGYCVEDWMGDNRKVDGHGCIDLSGILKVTEGYGKHVSFSV  1069

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S  K +F++E QIE RELR+ +E+PE C  GS+L ++IF+V +S+G +D SIH DEK+ 
Sbjct  1070  VSDCKEIFRKESQIEERELRLVTELPESCTAGSNLTSLIFKVTDSDGSLDTSIHHDEKTR  1129

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+++S+   ++  +RY+F HG C V S++LPE EG F F   HSRY EL + +E+ 
Sbjct  1130  CIHTLSVESDSSSVESGIRYAFVHGSCKVPSLSLPETEGIFSFKVFHSRYPELHVNLEIL  1189

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSP--------------  702
                A  ++       +P  ++ +      Q   A    FP    +P              
Sbjct  1190  ITPAPTSERDDIGCSTPYSRMTSTP----QSGMASATPFPGVTPTPSLGLERTPCSQFGV  1245

Query  703   --YKAPKLEHD-ESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
                ++P L+    S    IV + + L+ E+  Y       +  L+ L++++  ++ E+  
Sbjct  1246  LAIRSPSLDGSCPSGVMDIVQYTQSLKQELSTYEAQREVTDERLKCLEAEQEQVEQELIT  1305

Query  871   LEESI---GLSSSQNCCCTQESIMEQISGMG-DSAAAIACKLIE--TPSSSVELHHEFAK  1032
              + S+   G++  + C  T+E +M+ I     ++AA++ C L     P  S  L ++  K
Sbjct  1306  FQASLEPQGVAFPE-CLSTKEQMMKHIEEEHYNTAASVFCSLYRKAPPPKSRFLSNKGGK  1364

Query  1033  -EILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYL-----SSA  1194
              E+  +VALLG   S  LSR+L+ YLG   MLA+VC   +S+ G +    YL     +  
Sbjct  1365  GEVFGIVALLGSVASTSLSRVLSVYLGNDTMLALVCK--SSAYGPTSCAEYLKLQSETEY  1422

Query  1195  DALSTLANNLGTSINGGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLG  1371
               L + A  LG SI     + CL+  RP+ +G +   PQRRLA+V P+L NG+  PGF  
Sbjct  1423  QRLQSEAAKLGRSITNDLLIHCLDAFRPWSSGLMKNDPQRRLAMVNPSLSNGDPIPGFKD  1482

Query  1372  YAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD  1551
             YAVNMI ++   L  +T  GHGLRETLFY L G+L VY     +  A    + + AVSLD
Sbjct  1483  YAVNMIELATGELDIQTKLGHGLRETLFYGLFGDLHVYETGRDLEAALPFISGSDAVSLD  1542

Query  1552  GVIMRGNGVTTHAFGDPFIMFPV  1620
             G+I + NG+       P + FPV
Sbjct  1543  GLISKRNGLMHSVCLIPEVHFPV  1565



>emb|CDX88084.1| BnaA06g26750D [Brassica napus]
Length=1574

 Score =   296 bits (758),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 209/568 (37%), Positives = 305/568 (54%), Gaps = 57/568 (10%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M DEYNNH+ +   + +   GF   D+ CL  KVD +G I+L G+LKVTAGYGK  SLS+
Sbjct  982   MFDEYNNHVAEGTNVPICTSGFFIQDRMCLDLKVDSDGCIDLSGILKVTAGYGKPVSLSI  1041

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG+K +FK+E  +E RELR+ +E+PE C  G++L N+  +V +S G +D SI+++ +  
Sbjct  1042  MSGNKEIFKKESLVEIRELRLLTELPEYCTAGTNLTNLKLKVTDSYGIMDTSINNESECF  1101

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQ--LRIE  558
               HT++I+S+   +D T RY+F HG C + S++LPE EG F F   HSR+ EL   L+I+
Sbjct  1102  --HTMSIESDSSSVDSTTRYAFVHGSCKITSLSLPETEGAFSFKVFHSRHPELHMNLKIQ  1159

Query  559   VNTKKAVEAD---------SGYFQSQS-----------PERQILNKEVENFQYRSAQKQI  678
             +   +  E D           Y   QS           P +Q    +      R     I
Sbjct  1160  LTPAQTFERDEIGCSEPNPRIYLTPQSKMGSTTNPLGIPTQQTPPSQFRVLSIREISSAI  1219

Query  679   FPYENSSPYKAPKLEHDESEADHIVNHKMLE-DEVIHYAQLSRQCEIELQILDSKKSNIQ  855
                   S   AP      SE   I+  K+   +E I  A    +C   L+ L++++    
Sbjct  1220  ------SSQTAPVDMEQFSEYTEILKAKLNSYNERISEAN---EC---LKCLEAEQEEAV  1267

Query  856   TEIFNLEESI---GLSSSQNCCCTQESIMEQI-SGMGDSAAAIACKL-IETPSSSVELHH  1020
              E+  L+ S+   G+S  + C  T+ES+++ I     ++AA++ C L I  P+S   L  
Sbjct  1268  QELSALQASLEPHGVSFPE-CLSTKESMVKHIEEKYHNTAASVFCSLYINVPASKSML--  1324

Query  1021  EFAKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSAD  1197
               +KE +L +VALLG   S  LSR+L+EYLGE  MLA+VC +         M        
Sbjct  1325  -LSKEGVLGIVALLGSVASTPLSRVLSEYLGEVTMLALVCKSSRPGQNIDPM--------  1375

Query  1198  ALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGY  1374
              L + A  L  SI   + ++CL    P+TG L    PQR+LA+  P LP+G+  PGF+GY
Sbjct  1376  -LQSEAARLERSITSRFHVLCLGATSPWTGGLVENDPQRKLAMDDPKLPDGDPIPGFIGY  1434

Query  1375  AVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDG  1554
             AVNMI+++ K L  +T  GHGLRETLFY + G+LQVY  +  +  A    + + AVSLDG
Sbjct  1435  AVNMIYLAEKELNIKTYKGHGLRETLFYGVFGKLQVYETQTQVEEALLHISGDGAVSLDG  1494

Query  1555  VIMRGNGVTTHAFGDPFIMFPVFSKEQQ  1638
              I +GN         P I FP+  +E +
Sbjct  1495  FIAKGNEFICSGCSKPEIHFPITVRENE  1522



>emb|CDX80426.1| BnaC07g30180D [Brassica napus]
Length=1586

 Score =   290 bits (743),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 198/551 (36%), Positives = 294/551 (53%), Gaps = 33/551 (6%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D +NNHI +   + +  +G+C  D   +  KVD +G I+L G+LKVT GYGK  S SV
Sbjct  986   MFDGFNNHIAEGTSVLINTEGYCIEDWMGVNRKVDGSGCIDLSGILKVTEGYGKHVSFSV  1045

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S  K +F++E QIE RELR+ +E PE C  GS+L ++IF+V +S+G +D SIH DEK+ 
Sbjct  1046  VSDCKEIFRKESQIEERELRLVTERPESCTAGSNLTSLIFKVTDSDGSLDTSIHHDEKTR  1105

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+++S+   ++  +RY+F HG C + S++LPE EG F     HSRY EL + +E+ 
Sbjct  1106  CIHTLSVESDSSSVESGIRYAFVHGSCKIPSLSLPETEGIFSVKVFHSRYPELHVNLEIL  1165

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYEN--SSP--------YKAP  714
                A  ++       +P  ++ +      Q   A    FP      +P         ++P
Sbjct  1166  ITPAPTSERDDVGCSTPYSRMTSTP----QSGMASATPFPRVGLERTPCSQFGVLAIRSP  1221

Query  715   KLEHDESEADHIVN----HKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEES  882
              L  D S    +++     K L+ E+  Y     + +  ++ L+ ++   + E+  L+ S
Sbjct  1222  SL--DGSCPSGVMDIPQYTKSLKQELSTYEAQQEEIDERIKCLEGEQEQAEQELITLQAS  1279

Query  883   IG--LSSSQNCCCTQESIMEQI-SGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVA  1053
             +    ++   C  T+ES+M+ I     D+AA++ C L +       L       +  +VA
Sbjct  1280  LDSICAALPECLSTRESMMKHIEEEHQDTAASVFCSLTKKVPPPRSLFLSIKGGVFGIVA  1339

Query  1054  LLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTS  1233
             LLG   S  LSRIL+ YLG+++MLA+VC + A     ++   YL   D     A  LG S
Sbjct  1340  LLGSVASTSLSRILSAYLGKEKMLALVCKSSAYRASYAE---YLRLQDE----AARLGRS  1392

Query  1234  INGGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             I     +ICLN   P+ +G +   PQRRL +V P+L NG   PGF GYAVNMI ++ + L
Sbjct  1393  ITNPPQVICLNAYTPWRSGLVENDPQRRLDMVNPSLRNGGPIPGFKGYAVNMIELAVRDL  1452

Query  1411  QYRTASGHGLRETLFYRLLGELQVY-ANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
                T +GHGLRETLFY L G+LQVY   +D         +   AVSLDGVI   +G    
Sbjct  1453  DIGT-NGHGLRETLFYGLFGDLQVYETGKDLEAALPYIKDGVDAVSLDGVISNRDGFLFS  1511

Query  1588  AFGDPFIMFPV  1620
                 P + FPV
Sbjct  1512  GCCVPDVHFPV  1522



>ref|XP_010456668.1| PREDICTED: uncharacterized protein LOC104738142 [Camelina sativa]
Length=1711

 Score =   290 bits (742),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 190/503 (38%), Positives = 278/503 (55%), Gaps = 35/503 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D YNNH+ +  ++ + +DG+   D   +  KVD  G I+L G+LKVT GYGK  SLSV
Sbjct  967   IFDGYNNHVAEGTDVLIHIDGYRIEDWMGVNRKVDGRGCIDLSGLLKVTEGYGKSVSLSV  1026

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
               G++ +F++E QIE RELR+ +E+PE C  GS+  N+IF+V +SEG +D SIH DEKSG
Sbjct  1027  IYGNEVIFRKESQIEERELRLVTELPEYCAAGSNPVNLIFQVTDSEGSLDTSIHHDEKSG  1086

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HT++I+S+   ++  +RY+F HG C V  + LPE+EG F F   HSRY EL L ++  
Sbjct  1087  WFHTMSIESDSSSVESAIRYAFVHGSCRVPYLYLPENEGVFAFRVFHSRYPELHLSLKTQ  1146

Query  565   TKKA---------VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPK  717
                A                   +S    I N  +       +Q  +    +SS      
Sbjct  1147  VTSASTFEREETSTPYPRTTTPPESGIPLITNPGLTP----CSQIGVLAIRSSS----LA  1198

Query  718   LEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE---ESIG  888
             L       D     + L +++  Y +   + +  L+ L ++  + + E+  L+   E++G
Sbjct  1199  LSSQTGLMDMAEYAESLREKIKTYEENRFEVDQHLKGLQAEHEHAEQELSALQASLETLG  1258

Query  889   LSSSQNCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALL  1059
              S  + C  T+ES+M QI     D+AA++ C L     P  S  L +   K +  VVALL
Sbjct  1259  ASFPE-CLSTKESMMNQIEEKHHDTAASVFCCLYREAPPPQSFFLSN---KGMFGVVALL  1314

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSIN  1239
             G   S  LSR+L+EYLG+  ML++VC    SS    K   Y      L + A + G +I 
Sbjct  1315  GSVASTSLSRVLSEYLGKDTMLSLVCK---SSQFGQKSDEY----RKLQSEAASHGRTIT  1367

Query  1240  GGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
               + +ICL+  RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMIH++++ L  
Sbjct  1368  NRFLVICLDATRPWRNGLVKNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIHLNSEELDI  1427

Query  1417  RTASGHGLRETLFYRLLGELQVY  1485
             ++ SGHGLRETLFY + GELQVY
Sbjct  1428  QSNSGHGLRETLFYGVFGELQVY  1450


 Score =   152 bits (383),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 119/199 (60%), Gaps = 9/199 (5%)
 Frame = +1

Query  1045  VVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNL  1224
             VVALLG   S  LSR+L+EYLG+  ML++VC    SS    K   Y      L + A + 
Sbjct  1470  VVALLGSVASTSLSRVLSEYLGKDTMLSLVCK---SSQFGQKSDEY----RKLQSEAASH  1522

Query  1225  GTSINGGYDMICLNDIRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISA  1401
             G +I   + +ICL+  RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMIH+++
Sbjct  1523  GRTITNRFLVICLDATRPWRNGLVKNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIHLNS  1582

Query  1402  KHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVT  1581
             + L  ++ SGHGLRETLFY + GELQVY   + +  A    N + AVSLDGVI R NG  
Sbjct  1583  EELDIQSNSGHGLRETLFYGVFGELQVYETAEDLEAALPHINGD-AVSLDGVIARENGFI  1641

Query  1582  THAFGDPFIMFPVFSKEQQ  1638
                   P + FP+   E+Q
Sbjct  1642  YSGCCTPEVHFPITVTEKQ  1660



>emb|CDX80422.1| BnaC07g30220D [Brassica napus]
Length=1569

 Score =   286 bits (732),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 198/562 (35%), Positives = 292/562 (52%), Gaps = 50/562 (9%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M DEYNNH+ +   + +   G    D+ CL  KVD +G I+L G+LKVTAGYGK  SLS+
Sbjct  982   MFDEYNNHVAEGTNVPICTSGLFIQDRMCLDLKVDSDGCIDLSGILKVTAGYGKPVSLSI  1041

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              SG + +FK+E  +E RELR+ +++PE C  G++L N+ F+V +S G +D SI++D+KS 
Sbjct  1042  MSGKEEIFKKESLVEIRELRLLTKLPEYCTAGTNLTNLKFKVTDSYGIMDTSINNDDKSE  1101

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+I+S+   +D T RY+F HG C + S++LPE EG F F   HSR+ EL + +++ 
Sbjct  1102  CFHTLSIESDSSSVDSTTRYAFVHGSCKITSLSLPETEGAFSFKVFHSRHPELHMNLKIQ  1161

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
                A   +        P  +I         Y +   ++    N  P   P  +       
Sbjct  1162  LTPAQTFERDEIGCYEPNPRI---------YLTPLSKMGSTTN--PLVTPPSQFRVLSIR  1210

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQ-----------------TEIFNL  873
              + +    + + +  AQ S   EI    L+S    I                   E+  L
Sbjct  1211  EMSSAINSQTDPVDMAQFSEYTEILKAKLNSYTERISEANECLKCLEAEQEEAVQELSAL  1270

Query  874   EESI---GLSSSQNCCCTQESIMEQI-SGMGDSAAAIACKLIE-TPSSSVELHHEFAKE-  1035
             + S+   G+S  + C   +ES+M+ I     ++AA++ C L    P+S   L    +KE 
Sbjct  1271  QASLEPHGVSFPE-CLSNKESMMKHIEENHHNTAASVFCSLYRNAPASKSML---LSKEG  1326

Query  1036  ILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLA  1215
             +  +VALLG   S  LSR+L+EYLGE  MLA+VC +         M         L   A
Sbjct  1327  VFGIVALLGSVASTPLSRVLSEYLGEDTMLALVCKSSRLGPNIDPM---------LQAEA  1377

Query  1216  NNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIH  1392
               L  SI   + ++CL    P+TG L    PQR+LA+  P L +G+  PGF+GYAVNMI+
Sbjct  1378  ARLERSITSRFHVLCLGATSPWTGGLVENDPQRKLAMDDPKLSDGDPIPGFIGYAVNMIN  1437

Query  1393  ISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGN  1572
             ++ + L  +T  GHGLRETLFY + G+LQVY  +     A    + + AVSLDG I +GN
Sbjct  1438  LAEEELNIKTYEGHGLRETLFYDVFGKLQVYETQTQAKEALEHISGDGAVSLDGFIAKGN  1497

Query  1573  GVTTHAFGDPFIMFPVFSKEQQ  1638
                      P I FP+  +E +
Sbjct  1498  KFICSR--KPEIHFPITVRENE  1517



>dbj|BAB10393.1| unnamed protein product [Arabidopsis thaliana]
Length=1335

 Score =   275 bits (704),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 196/619 (32%), Positives = 317/619 (51%), Gaps = 81/619 (13%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGK------  186
             + D YNNH+ +   + + ++G+C  D   L  KV+  G I+L G+L+VTAGYGK      
Sbjct  774   VFDGYNNHVAEGTNVLICIEGYCINDSMGLNQKVNSCGCIDLSGILQVTAGYGKTSNICY  833

Query  187   ----KASLSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVD  354
                 + SLSV SG   +FK+E Q E REL + +++PE CV GS+L N+IF+V +S+G +D
Sbjct  834   HSFVRLSLSVMSGIDEIFKKESQTERRELMLLTKLPECCVAGSNLTNLIFKVTDSDGVMD  893

Query  355   ESIHDDEKSGQPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRY  534
              SIH DEKSG  HT++I+++    +  +RY+F HG C V +++LPE EG F F   HSR+
Sbjct  894   TSIHHDEKSGCFHTMSIETDSSSDESEIRYAFVHGSCKVPTLSLPEREGVFSFKVFHSRF  953

Query  535   MELQLRIEVNTKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYEN-SSPYKA  711
              EL L +++    A               QIL ++  ++    ++  + P    +S   +
Sbjct  954   PELHLSLKIQLTPA---------------QILQRDETSY----SRMGLTPKSKMASTTYS  994

Query  712   PKLEHDESEADHIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI  885
             P L      +   V    +  ++ +I Y++   + +  L  L+++++  + E+  L+ S+
Sbjct  995   PALSSQTGPSLRDVAQFTESFKENLIGYSEHRVEIDERLHCLEAEQNQAKEELRTLQASL  1054

Query  886   GLSSSQ--NCCCTQESIMEQI-SGMGDSAAAIACKLIET--PSSSVELHHEFAKEILVVV  1050
                 +    C  T+ES+M+QI     D+AA++ C L     P  S+ L     K +  +V
Sbjct  1055  EPLGAMFPECLSTKESMMKQIEEKHHDTAASVFCCLYRKSPPPQSLFLS---KKGVFGLV  1111

Query  1051  ALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGT  1230
             ALLG   S  LSR+L+EYLGE  +LA+VC   ++ +G +               A  L  
Sbjct  1112  ALLGSVASTSLSRVLSEYLGEDMLLALVCK--SAQIGPNN--------------AEFLRL  1155

Query  1231  SINGGYDMICLNDIRPYT-GELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
               N  + ++CL+ IRP+  G L   PQ++LA+  P LP+G+  PGF GYAVNMI ++ + 
Sbjct  1156  QSNHRFHVLCLDAIRPWKDGLLENDPQKKLAMDDPKLPDGDPIPGFKGYAVNMIDLAPEE  1215

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L  +T SG+GLRETLFY L G LQ+                   + L  V    + +   
Sbjct  1216  LTVQTYSGYGLRETLFYNLFGNLQLKTR---------------VLFLASVFTADDMIYGF  1260

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                 P   FP+  KE +        +V L  ++  + ++R     IE E+ +  +++ K 
Sbjct  1261  WISIPEFHFPITLKEDE--------EVKLRKMEAARDKVRMAAKKIEEEKCSMRKVDKKM  1312

Query  1765  IGFRDAYVNLTQGSSSVQN  1821
                 + Y N+T     +Q+
Sbjct  1313  KKTNEKYHNVTNSLELIQS  1331



>ref|XP_009607734.1| PREDICTED: uncharacterized protein LOC104101890 isoform X6 [Nicotiana 
tomentosiformis]
Length=1469

 Score =   274 bits (701),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 155/362 (43%), Positives = 234/362 (65%), Gaps = 11/362 (3%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G C  ++G    KVD +G +NL G LKVT+GYGK   LS+F
Sbjct  1092  FDKYRNHMRKDEHIKLMLEGLCLLEKGDCFLKVDVHGCVNLNGTLKVTSGYGKPVFLSIF  1151

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGD  V K+EFQ E R LR+AS++P+ C  GSHLE+I+FEVINS GEVDE IHD+E++G 
Sbjct  1152  SGDDVVLKKEFQTEERWLRVASKVPKVCAAGSHLEDIVFEVINSTGEVDEDIHDEEENGH  1211

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ V+YSF HGRC V SI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1212  SHTLLIRQDSLRGEDNVKYSFNHGRCIVHSIPLPKNEGLFCFVASHSRFHELQTSIEVHV  1271

Query  568   KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIF--PYENSSPYKAPKLEHDESEA  741
             +KAV ++    Q ++P+++++   +E+  Y  A + ++   Y++ S      L+   + A
Sbjct  1272  EKAVNSEHEIPQPRNPKKKLM---LEDSYYSKAPEIVYDHTYDDFSDGSILLLKDPCASA  1328

Query  742   D---HIVNH--KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN  906
             +    + N   K L D++        +C+  L+IL SK+SNI  E+ NL  +I   S  +
Sbjct  1329  ELEGRLQNQLEKKLVDDICKCGLSINKCDANLEILHSKESNIVLEMSNLGANISPDSFHD  1388

Query  907   CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELS  1086
                 +  ++E+I G  D+AAA+  KL+ +P S  +L+ ++A +IL VVAL+G  ++++LS
Sbjct  1389  LGYNRNMVVERIEGKADTAAAVVHKLLRSPISE-QLYLQYANDILGVVALIGEVQTHKLS  1447

Query  1087  RI  1092
              I
Sbjct  1448  SI  1449



>emb|CDP05057.1| unnamed protein product [Coffea canephora]
Length=1468

 Score =   271 bits (693),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 214/350 (61%), Gaps = 5/350 (1%)
 Frame = +1

Query  754   NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLS-SSQNCCCTQESI  930
             +H+ L DE+  Y    +Q E+ ++ L+   S+I+ ++ NL+ S  L          ++ +
Sbjct  1103  DHEELWDELCQYGLCIKQREMNIESLNLLLSDIEQDMSNLQGSPCLDLHDLERTAGKKLV  1162

Query  931   MEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLG  1110
              EQI   GDSAAA+ C+L ++ +   E   +FA ++L VVALLG  ++++LSRI A+YLG
Sbjct  1163  AEQIVCRGDSAAAVICRLFQSVTYK-EKGIDFADKVLGVVALLGTVQTHDLSRIFAQYLG  1221

Query  1111  EKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYT  1284
             E QMLA+VC ++A +    K    G +++A  L  LA  LG SIN  Y ++C+ +IRPY 
Sbjct  1222  EHQMLAIVCKSYADAAYLEKHDPDGRVNNAYGLHELATKLGISINRQYHVLCVENIRPYA  1281

Query  1285  GELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRL  1464
             G+ S  PQR L++ +P LPNG+ PPGFLGYA+NMI +      +RTASGHGLRETLFYRL
Sbjct  1282  GDFSSDPQRYLSLPEPTLPNGKLPPGFLGYAINMIELDVNFWFWRTASGHGLRETLFYRL  1341

Query  1465  LGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMN  1644
              GELQVY NR CM MAS C  +  AVSLDG I+RGNGV +    +P + FPV   + Q  
Sbjct  1342  FGELQVYENRQCMNMASCCIKDG-AVSLDGGILRGNGVISLGHWEPDVKFPVLPLDSQRY  1400

Query  1645  LMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNL  1794
                   +VL  ++ KK +LRE    ++ E     E+  KF   ++ Y +L
Sbjct  1401  FSPRKVEVLKEIEAKKQELRETNYQLKAEERTRAEVKKKFKETKERYQSL  1450



>ref|XP_010236672.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100829204 
[Brachypodium distachyon]
Length=1572

 Score =   268 bits (685),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 188/578 (33%), Positives = 305/578 (53%), Gaps = 45/578 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D  +NH+++  E+ + M G    D+   + KV+  GF++L G+LKV  G+G +A L +
Sbjct  974   VFDHCDNHVEEGTELVVTMVGLSFIDKHGPVRKVNSEGFVDLSGLLKVVNGFGSQACLMI  1033

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                +K +F + F+I  REL  A ++P+ C  G++L+NIIF+V  S+G +DE+I      G
Sbjct  1034  SRHEKKIFAKTFKIATREL-TAVKVPQSCQAGTYLQNIIFKVFYSDGLIDEAI-----DG  1087

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL+I+    ++ E  RY+F HGRC V  + +P + G   F+A H+ + +L+   +++
Sbjct  1088  PLHTLSIRLNEAELVEGARYAFEHGRCVVSRLAVPREPGTVSFLAYHTHFPDLKTVFQLH  1147

Query  565   T------KKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEH  726
                    +  +E ++G   S  P   +           S+Q  + P +  S Y++  L  
Sbjct  1148  VYACDLVRVNLEDEAGPIFSH-PTSSV-----------SSQNLLLPSQLVS-YQSNNLA-  1193

Query  727   DESEADHIVNHKMLEDEVIHYAQLSRQCEIE--LQILDSKKSNIQTEIFNLEESIGLSSS  900
               +  + ++ +  + DE+      S+ C  E  +  LD +K +++ EIFN ++ IG    
Sbjct  1194  --AYVEDVMGN--ISDEIEKLD--SKICSEEKLINFLDCQKKSLENEIFNRKDEIG-PIV  1246

Query  901   QNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
             ++C   +E    +I     +AA++ C L  +     E    F ++++ +VALLG     +
Sbjct  1247  ESCSGAKELTRHKIQESSGTAASVLCHL--SSGKGYEPGKCFREDVIGIVALLGTVAHKK  1304

Query  1081  LSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             +SR+L+ YLGE  MLAVVC     A+ +      G +     +   A NLG  IN  +  
Sbjct  1305  MSRMLSVYLGEDNMLAVVCMTRDAANYIEKYDTDGNVDVHFGIHREAANLGIPINRRFHT  1364

Query  1255  ICLNDI-RPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
              CL+ I RPY G+L    Q+ LA+     P+ E+P GF G+AVNMI ISA +L   T+SG
Sbjct  1365  FCLDAISRPYEGDLFQNKQKNLAL---PFPHYETPKGFCGFAVNMIDISADNLNKITSSG  1421

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIM  1611
             HGLRETLFY L GELQVY  R+ M  A     N  A+SLDG +++G+G       DP + 
Sbjct  1422  HGLRETLFYSLFGELQVYETRNDMLQAIPYLKNG-AISLDGGVIKGDGTWLLGDSDPEVT  1480

Query  1612  FP-VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDI  1722
             FP V +    +  +   P  + ++  KK  L+ V+  I
Sbjct  1481  FPFVPNGPDALEDLQDLPLKIKIMLGKKAHLKAVEAKI  1518



>ref|XP_006350630.1| PREDICTED: uncharacterized protein LOC102601834 [Solanum tuberosum]
Length=1790

 Score =   257 bits (657),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 190/287 (66%), Gaps = 6/287 (2%)
 Frame = +1

Query  883   IGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
             IGL S  +    ++ IME+I G  DSAAA+  KL+ +P    +L+ ++A +IL VVALLG
Sbjct  1466  IGLDSFHDLGYDKDVIMEKIEGKADSAAAVIHKLLRSPKPE-QLYLKYAHDILGVVALLG  1524

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAHASSVGAS--KMHGYLSSADALSTLANNLGTSI  1236
                +++LS + + YLGE QMLAVVC + A++      +M G ++ A AL  LA  LG SI
Sbjct  1525  EVRTHKLSSMFSTYLGEDQMLAVVCKSRAAARALENYRMDGNVNCASALDILAAKLGISI  1584

Query  1237  NGGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
              G Y +ICL DIRPY   +S  PQR LAI  P L N E+PPGFLGYAVNMI + A++LQ 
Sbjct  1585  KGRYLVICLEDIRPYKQGVSSDPQRELAIPHPTLSNRETPPGFLGYAVNMIFLPAEYLQL  1644

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             RTASGHGLRETLFYRL G+LQVY +R+ + MASSC     AVSLDG +MRGNGV + + G
Sbjct  1645  RTASGHGLRETLFYRLFGKLQVYKSREQLYMASSCIEEG-AVSLDGGMMRGNGVVSASVG  1703

Query  1597  --DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE  1731
               +P+I+FPV   E+Q+ L       L  ++  K++  ++Q+ I+ E
Sbjct  1704  SEEPYILFPVICLERQLLLSPEKVKRLKRIEELKLERNQLQDQIQEE  1750


 Score =   236 bits (602),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 180/288 (63%), Gaps = 6/288 (2%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D+Y NH++KDE IKL ++G    D+G    KVD +G +NL G LKVTAGYGK  SLSV 
Sbjct  1008  FDKYGNHMRKDEHIKLTLEGLHLLDKGDSFYKVDDHGCVNLSGTLKVTAGYGKLVSLSVL  1067

Query  208   SGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQ  387
             SGDK VFK+EFQ + R LR+AS++P+ C  GSHLE+++FEVINS GEVDE I  + + G 
Sbjct  1068  SGDKVVFKKEFQTDRRSLRVASKVPKVCAAGSHLEDVVFEVINSAGEVDEDIDSEVEDGH  1127

Query  388   PHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT  567
              HTL I+ + L+ ++ VRYSF HGRC VRSI LP++EG F FVA HSR+ ELQ  IEV+ 
Sbjct  1128  SHTLLIRQDSLREEDNVRYSFHHGRCIVRSIPLPDNEGLFCFVASHSRFHELQTSIEVHV  1187

Query  568   KKAVEADSGYFQSQSPERQIL------NKEVENFQYRSAQKQIFPYENSSPYKAPKLEHD  729
             +KAV       Q +SP+++IL       K  E   + +   +I  + +S      +    
Sbjct  1188  EKAVIRTHELTQPRSPKKEILLHEDSNGKGPETVCHNTFDGRIMIFNDSCASMDLEDRLQ  1247

Query  730   ESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNL  873
                    V+ + L D++  Y    R+C+  ++ L+ K+SNI+ E+ NL
Sbjct  1248  TVTKLECVSRQKLGDDICRYGLCIRRCDANVESLNIKQSNIELEMSNL  1295



>ref|XP_008234883.1| PREDICTED: uncharacterized protein LOC103333768 [Prunus mume]
Length=1781

 Score =   233 bits (593),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 200/367 (54%), Gaps = 42/367 (11%)
 Frame = +1

Query  637   EVENFQYRSAQKQIFPYENSSP-----------YKAPKLEHDES----------------  735
             E + FQ +S+  ++ P ++SS             KAPK+E+DES                
Sbjct  870   EFDEFQVQSSHGKVLPLQDSSSIQQVGNLMVPVMKAPKVEYDESPIPCPNEKIFLLQDSS  929

Query  736   --------EADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL  891
                     EA ++   K LE  +          E  L  L+ +K+ I+ +I+ ++ S+  
Sbjct  930   SLPQAQNLEASNVNKEKELEKGLHQIGMQIGDMEKNLDALNKEKAVIEQDIYVVQASVER  989

Query  892   SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAE  1071
              +S  C    E +  +I  M  +AA+  C L+  PS   E  ++F + ++ +VALLG   
Sbjct  990   CNSDYCSMKAE-LKHRIESMSHTAASTLCNLLRVPSQ--ESRNDFMRGVIGLVALLGSTG  1046

Query  1072  SYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGG  1245
             S ELSRIL+EYLGE QMLAVVC + A++V   K   +G + S  AL   A  LG SING 
Sbjct  1047  SSELSRILSEYLGEDQMLAVVCRSFAAAVALEKYEHNGEVDSRHALYAAAAKLGGSINGR  1106

Query  1246  YDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRT  1422
             + +I L DIRPYTG+     PQR+LA+  P LP+G +P GFLGYAVNM+ +   HL   T
Sbjct  1107  FLVISLEDIRPYTGDFDGSDPQRKLALPYPILPSGNTPDGFLGYAVNMVDLDELHLHMTT  1166

Query  1423  ASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDP  1602
             A+GHGLR+TLFY L GEL VY  R  M  A +C  +  AVSLDG I+R  G  +  +G+P
Sbjct  1167  AAGHGLRQTLFYFLFGELHVYKTRQDMLAARACIKHG-AVSLDGGILRQTGAVSLGYGNP  1225

Query  1603  FIMFPVF  1623
              I FPV 
Sbjct  1226  EICFPVL  1232


 Score =   193 bits (490),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/369 (34%), Positives = 201/369 (54%), Gaps = 26/369 (7%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             ++A+ I+ + K L+D++       +Q E  +++L S+++ +   I +L+  +G   +   
Sbjct  1393  AQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQRNKLDDSILDLQVILGKYHTSTA  1452

Query  910   ----------CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                       C ++E   ++I     SAA I  +L +T   +   H    K++L +VA+L
Sbjct  1453  SKIENEDHSHCKSEEETTKKILQREKSAAGILWQL-KTRHGTQAAHLTLTKDVLGIVAML  1511

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSR+L+EYLG   ML++VC  +    ++      G +  +  L  L  ++G +
Sbjct  1512  GKVEDDNLSRLLSEYLGVDTMLSIVCKTYEGVKALETYDNEGCIKKSSGLHGLGASIGRT  1571

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL+++RPY GE +   PQRRL ++KP LPNGE PPGFLGYAVNMIH+ +  L
Sbjct  1572  LEGRFQVICLDNLRPYAGEFVPDDPQRRLDLLKPRLPNGECPPGFLGYAVNMIHVDSTSL  1631

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TASGHGLRETLFY L   LQVY  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  1632  FCVTASGHGLRETLFYNLFCRLQVYKTRADMVPALPCISDG-AISLDGGMIRSTGV--FS  1688

Query  1591  FG---DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQLRE----VQNDIENERMAYE  1746
              G   D  + FP  S    +    ++ +  +N LK+KK +++E     Q  ++N +  ++
Sbjct  1689  LGNREDVDVRFPKLSVISSLPETYLDSERQINELKWKKEKMQEDMKREQALLDNAKFNFD  1748

Query  1747  EINNKFIGF  1773
                  F+ F
Sbjct  1749  RKKQDFLKF  1757



>ref|XP_007039064.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
2 [Theobroma cacao]
 gb|EOY23565.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
2 [Theobroma cacao]
Length=1375

 Score =   220 bits (560),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 203/363 (56%), Gaps = 26/363 (7%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E++  +DGF          KVD  G I+LGG+L+VTAGYGK  SLSV
Sbjct  1003  MFDAYGNHVAEGAEVQFHLDGFVIQGHLGSKYKVDDRGCIDLGGLLEVTAGYGKSVSLSV  1062

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 K VFK+EFQ E RELRIAS +PE C+ GS LE++ FEV++S+G VDE+ HDDEK G
Sbjct  1063  LHDGKVVFKREFQTEKRELRIASVVPERCIAGSILEDLAFEVVDSQGVVDETFHDDEKHG  1122

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H L + SE  +  +++ Y+F HG C V SI LPE EG F FVA HSRYM+L L ++V+
Sbjct  1123  QSHRLIVNSESFETCDSICYAFIHGCCIVTSIPLPEIEGPFCFVAFHSRYMDLYLNVKVS  1182

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +               R++ + E+E   Y S QK +F  ++ S      L        
Sbjct  1183  LVRP--------------RKVESDEIE---YPSDQKGLFLQKSQSVKDVGCL------LS  1219

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESI--GLSSSQNCCCT  918
              +   K LEDEV  Y +   + E  L+ LD +K++I+  +  L+ S+   L  + +   T
Sbjct  1220  LVKYDKELEDEVCKYGERIAKWEHLLETLDCRKASIERYVSGLQASLEPNLIDNLDSLST  1279

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             +E +M +I     SAA++ C L +      E   +  + ++ VVALLG   + +LSR+  
Sbjct  1280  KEEMMIRIKERDHSAASVLCSLAQKLPFQ-EPWMDVIEGLVGVVALLGTVCTSKLSRLYL  1338

Query  1099  EYL  1107
              ++
Sbjct  1339  PFI  1341



>ref|XP_007218895.1| hypothetical protein PRUPE_ppa000400mg [Prunus persica]
 gb|EMJ20094.1| hypothetical protein PRUPE_ppa000400mg [Prunus persica]
Length=1207

 Score =   216 bits (549),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/336 (39%), Positives = 187/336 (56%), Gaps = 19/336 (6%)
 Frame = +1

Query  598   FQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDE  777
             F + +P       E +  Q +S+  ++ P ++SS  +             + N   LE +
Sbjct  888   FSTDAPVIGTPKMEFDEIQVQSSHGKVLPLQDSSSIQ------------QVGNLMELEKD  935

Query  778   VIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGD  957
             +          E  L  L+ +K+ I+ +I+ ++ S+   +S  C    E +  +I  M  
Sbjct  936   LHQSGMQIGDMEKNLDALNKEKAVIEQDIYVVQASVERCNSDYCSMKAE-LKHRIESMSH  994

Query  958   SAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVC  1137
             +AA+  C L+  PS   EL ++F   ++ +VALLG   S ELSRIL+EYLGE QMLAVVC
Sbjct  995   TAASTLCNLLRVPSQ--ELSNDFMGGVIGLVALLGSTGSSELSRILSEYLGEDQMLAVVC  1052

Query  1138  NAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQ  1308
              + A++V   K   +G + S  AL   A  LG SING + +I L DI+PYTG+   G PQ
Sbjct  1053  RSFAAAVALEKYEHNGEVDSRHALYAAAAKLGRSINGRFLVISLEDIQPYTGDFDGGDPQ  1112

Query  1309  RRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYA  1488
             R+LA+  P LP+G +P GFLGYAVNM+ +   HL   TA+GHGLR+TLFY L GEL VY 
Sbjct  1113  RKLALPYPILPSGNTPDGFLGYAVNMVDLDEHHLHMTTAAGHGLRQTLFYFLFGELHVYK  1172

Query  1489  NRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
              R  M  A +C  +  AVSLDG I+R  G  +  +G
Sbjct  1173  TRQDMLAARACIKHG-AVSLDGGILRQTGAVSLGYG  1207



>gb|KDO54233.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=702

 Score =   209 bits (531),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 173/292 (59%), Gaps = 37/292 (13%)
 Frame = +1

Query  25   MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
            M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  440  MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  499

Query  205  FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  500  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  559

Query  385  QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
            Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  560  QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  619

Query  565  TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
              +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  620  IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  650

Query  745  HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
            H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+
Sbjct  651  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQ  702



>gb|KDO54232.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1065

 Score =   209 bits (533),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 173/292 (59%), Gaps = 37/292 (13%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  803   MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  862

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  863   LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  922

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  923   QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  982

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  983   IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  1013

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+
Sbjct  1014  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQ  1065



>ref|XP_010671900.1| PREDICTED: uncharacterized protein LOC104888575 [Beta vulgaris 
subsp. vulgaris]
Length=1681

 Score =   211 bits (536),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/383 (37%), Positives = 206/383 (54%), Gaps = 29/383 (8%)
 Frame = +1

Query  604   SQSPERQILNKEVENFQYRSAQKQIFPY------ENSSPYKAPKLEHDESEADHIVNHKM  765
             +Q+P++Q   K   N    ++ + + P+      E + P   P LE  ES          
Sbjct  1264  TQTPDKQPDQKYGLNSDIFNSPEGMMPFADTCTPERAIPSGGPGLEDFES----------  1313

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQNCCCTQESIMEQ  939
             +E+E+ HY    +  E  LQ    +K  I+ ++  L+ S+ L   S  +C   +E ++ +
Sbjct  1314  IEEEIYHYGSAIKDQEEALQWCLLRKDEIEEDLTQLQASMELLPVSQPDCSSQKEVVLGK  1373

Query  940   ISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQ  1119
             I    DSAA+I   +   P      H +F  +++ +VALL    +  LS  LAEYLGE Q
Sbjct  1374  IEEKVDSAASIYGIVTRNPLLK-NRHPDFIDDVVGLVALLATVSTPALSCSLAEYLGEDQ  1432

Query  1120  MLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LS  1296
             MLA+VC +  +     K + Y+     L +LA  LG  I     +ICL D++ Y G+ L 
Sbjct  1433  MLAIVCQSSVALTSPEK-YEYI-----LMSLAGELGKCIKNRQLIICLEDLKAYGGDILE  1486

Query  1297  IGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGEL  1476
               PQRRLA+  P LP G +P GFLGYAVNMI I   HLQ RT +GHGLRETLFYRL GEL
Sbjct  1487  TDPQRRLALPNPILPEGTTPHGFLGYAVNMIDIDVDHLQTRTYAGHGLRETLFYRLFGEL  1546

Query  1477  QVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IMFPVFSKEQQMNLMT  1653
             QVY  ++ M  A  C   + A+SLDG+IMRG G+ +    +   + FP  S++ Q  L+ 
Sbjct  1547  QVYDTKEHMKHARGCITTDGAISLDGLIMRGRGIVSLGSSEKVSVHFPSVSQDSQ--LVV  1604

Query  1654  VNPDVLNLLKYKKVQLREVQNDI  1722
              + +V+N ++ +K +L  V+  I
Sbjct  1605  SSGEVMNEIEKRKSELCIVEKAI  1627


 Score =   165 bits (417),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 149/254 (59%), Gaps = 21/254 (8%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             +LD ++NH+Q+  E++LQ+ GF   DQ  L  KVD +GFI+L G+LKVT G+GK  SL+V
Sbjct  927   VLDRHSNHVQQGIEVELQVHGFSFLDQIGLKRKVDDHGFIDLSGLLKVTEGFGKLVSLTV  986

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                   V  ++FQ+E REL++ + +P+ C  GS L+N+ FEV+NS+G+VD +IHD  K G
Sbjct  987   ICNKNVVANKKFQVEKRELKMVTVVPKLCHLGSKLKNLAFEVVNSKGDVDHTIHDSYKHG  1046

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             +  TL +K++    D+++RY+F  GRC + SITLP  EG F   A H +++EL  + E+ 
Sbjct  1047  RSDTLRLKTDFPGFDDSLRYAFKLGRCVIPSITLPLTEGTFCIEANHCQHLELCAKFEIR  1106

Query  565   TKKAVE-----------ADSGYFQSQSPERQILN--KEVENFQYRSAQKQ---IFPY---  687
               ++             +D  Y + +S    + +  K V N + RSA +      PY   
Sbjct  1107  VSRSTSTEKDTLSDLRASDQLYLKDRSASGSVSDAIKPVTN-RKRSALRDSEVTVPYVEE  1165

Query  688   -ENSSPYKAPKLEH  726
              + +SP +   LEH
Sbjct  1166  CDFASPLQTQNLEH  1179



>gb|KDO54229.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
 gb|KDO54230.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1268

 Score =   209 bits (531),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 173/292 (59%), Gaps = 37/292 (13%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  1006  MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  1065

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  1066  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  1125

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  1126  QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  1185

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  1186  IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  1216

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+
Sbjct  1217  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQ  1268



>gb|KDO54228.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1304

 Score =   209 bits (531),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 173/292 (59%), Gaps = 37/292 (13%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D + N+++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV
Sbjct  1042  MFDAFYNNVKKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSV  1101

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S +  +FKQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSG
Sbjct  1102  LSDNGVIFKQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSG  1161

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q HTLTIKS+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V 
Sbjct  1162  QSHTLTIKSDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVP  1221

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               +A + +S                 ++ +   +  ++F  E  SP K            
Sbjct  1222  IVRAPKLES-----------------DDIRTPCSDGKVFLLEGPSPIK------------  1252

Query  745   HIVNHKM--------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
             H+ NH +        LE EV +Y     + E  L++L+ +K  ++  +  L+
Sbjct  1253  HVGNHMVPIMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQ  1304



>ref|XP_009357370.1| PREDICTED: uncharacterized protein LOC103948098 [Pyrus x bretschneideri]
Length=1355

 Score =   207 bits (528),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/329 (39%), Positives = 179/329 (54%), Gaps = 9/329 (3%)
 Frame = +1

Query  646   NFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQ  825
             NF     Q     YE  SP+  P L  D S    + N +  E+++          E +L 
Sbjct  963   NFLVSEMQVPKVEYEELSPF--PLLLQDPSSLQQVENLQRKENDIKRIGLRIGDLEKQLV  1020

Query  826   ILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSS  1005
              L+  K  ++ EI +L+ S  LSSS +    +E +   I  M  +AA+    L   P   
Sbjct  1021  ELNEDKEILELEISHLQASYQLSSS-DYSSKKEELRNHIERMSHTAASTVSTLSRVPLQ-  1078

Query  1006  VELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--G  1179
              E  ++F   ++ +VALLG   + +LSRIL+EYLGE QMLAVVC +  ++    K H  G
Sbjct  1079  -EPDNDFIGGMIGLVALLGRVRNIKLSRILSEYLGEDQMLAVVCKSFTAACALEKYHRNG  1137

Query  1180  YLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELS-IGPQRRLAIVKPALPNGESP  1356
              + S  AL   A  L  SI   + +ICL D+RPYTG+     PQR+L +  PALP+G++P
Sbjct  1138  EVDSRHALYAEAAKLERSIESRFLVICLKDLRPYTGDFDGTDPQRKLFLPDPALPSGDTP  1197

Query  1357  PGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNP  1536
              GFLGYAVN++ +  +HL   T  GH LR+TLFY L GEL VY  R  M  A +C     
Sbjct  1198  SGFLGYAVNLVDLDDEHLHTVTTEGHNLRQTLFYALFGELHVYRTRKQMFNARACI-KQA  1256

Query  1537  AVSLDGVIMRGNGVTTHAFGDPFIMFPVF  1623
             AVSLDG I++  G+ +  +G+P I FP+F
Sbjct  1257  AVSLDGGILKQTGIASLGYGNPKICFPIF  1285



>ref|XP_008377037.1| PREDICTED: uncharacterized protein LOC103440149 [Malus domestica]
Length=881

 Score =   204 bits (520),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/329 (38%), Positives = 178/329 (54%), Gaps = 9/329 (3%)
 Frame = +1

Query  646   NFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQ  825
             NFQ    Q     YE  SP+  P L  D S    + N +  E+++          E  L 
Sbjct  493   NFQVSEMQVPKVEYEELSPF--PLLLQDPSSLQQVENLQKKENDIKRIGLHIGDLEKRLV  550

Query  826   ILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSS  1005
              L+  K  ++ EI +L+    LSSS +    +E +   I  M  +AA+    L   P   
Sbjct  551   ELNENKEILELEIAHLQACYQLSSS-DYSSKKEELRNHIERMSHTAASTVSTLSRVPLQG  609

Query  1006  VELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--G  1179
              +  ++F   ++ +VALLG   +++LSRIL+EYLGE QMLAVVC +  ++    K H  G
Sbjct  610   PD--NDFMGGMIGLVALLGRVRNFKLSRILSEYLGEDQMLAVVCKSFTAACALEKYHRSG  667

Query  1180  YLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELS-IGPQRRLAIVKPALPNGESP  1356
              + S  AL   A  L  SI+  + +ICL D+RPYTG+     PQR+L +  P LP+G++P
Sbjct  668   EVDSRHALYAEAAKLERSIDSRFLVICLEDLRPYTGDFDGTDPQRKLFLPDPVLPSGDTP  727

Query  1357  PGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNP  1536
              GFLGYAVN++ +  +HL   T  GH LR+TLFY L GEL VY  R  M  A +C     
Sbjct  728   SGFLGYAVNLVDLDDEHLHTVTTEGHNLRQTLFYSLFGELHVYRTRKQMFNARACI-KQA  786

Query  1537  AVSLDGVIMRGNGVTTHAFGDPFIMFPVF  1623
             AVSLDG I++  G+ +  +G+P I FP+ 
Sbjct  787   AVSLDGGILKQTGMVSLGYGNPKICFPIL  815



>ref|XP_007147319.1| hypothetical protein PHAVU_006G113900g [Phaseolus vulgaris]
 gb|ESW19313.1| hypothetical protein PHAVU_006G113900g [Phaseolus vulgaris]
Length=349

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 174/305 (57%), Gaps = 17/305 (6%)
 Frame = +1

Query  751   VNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC-----  915
             +NH  L D++   +++ +Q E  L+ L+S+ + +   IF+L+ S+    S N        
Sbjct  4     LNHTSLRDDISERSKIIKQHEDNLKFLNSQSNQLAESIFDLQVSLAKYHSNNVITSDSGN  63

Query  916   ----TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
                 T+E  MEQI    ++AA +   L     +S   +    K+++ VVA LG  ES  L
Sbjct  64    GAFHTEEETMEQIMKKENTAAGVFSWLKGNAQTS---NLTLTKDVVGVVATLGKVESDNL  120

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDMI  1257
             SRIL+E+LG ++MLA+VC+++       K    G ++    L  + +++G  ING + +I
Sbjct  121   SRILSEFLGLERMLAIVCSSYEGINALEKYDTEGLINCNAGLHGIGSSIGKRINGRFAVI  180

Query  1258  CLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
              L D+RP+ G L +  PQ++LA+ KP LPNGE PPGFL YAVNMIH+ +KHL + T  GH
Sbjct  181   SLEDLRPFVGGLVADDPQKKLALPKPRLPNGECPPGFLDYAVNMIHLDSKHLSFLTDIGH  240

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD-GVIMRGNGVTTHAFGDPFIM  1611
             GLRETLFY L   LQ+Y  R+ M +A  C  +  A+SLD G+I RG         D  + 
Sbjct  241   GLRETLFYGLFSRLQIYKTRNEMLLALPCIYDG-ALSLDGGMIQRGGMFALGCRKDVEVK  299

Query  1612  FPVFS  1626
             FP+ S
Sbjct  300   FPLIS  304



>gb|KDO54234.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
 gb|KDO54235.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
 gb|KDO54236.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
 gb|KDO54237.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
 gb|KDO54238.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
 gb|KDO54239.1| hypothetical protein CISIN_1g0003661mg, partial [Citrus sinensis]
Length=307

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 173/305 (57%), Gaps = 26/305 (9%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACK-----LIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
             T+E I+ +I  +  SAA++ C      L   P S+      F ++++  VAL+G   + +
Sbjct  9     TKEEIIRRIKSIYQSAASVICCSTKEFLCSKPRSN------FMEDVVGPVALIGTVCTNK  62

Query  1081  LSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDM  1254
             LSR LAEYLGE QMLA+VC +  ++    K    G +    AL   A  LG SI+G Y +
Sbjct  63    LSRTLAEYLGEHQMLALVCRSFEAAFALEKYEQDGTIDRKCALHATAAALGKSIDGRYLV  122

Query  1255  ICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL  IRPY+G+  S  PQR+LA+  P LP G  P GF+GYAVNM+++   H+  RT++G
Sbjct  123   ICLEGIRPYSGKFGSNDPQRKLALPAPTLPKGNIPAGFVGYAVNMVNLDDHHMHIRTSAG  182

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIM  1611
             +GLRETL YRL G+LQVY  R  M  A +C  +  AVSLDG I++ +G+ +   G+P I 
Sbjct  183   NGLRETLLYRLFGKLQVYKTRKDMIEAHTCIRHG-AVSLDGGILKEDGIISLGCGNPTIC  241

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE-------INNKFIG  1770
             FP+     +  + T + + L  ++ KK++L  +   I+    A E+         +KF  
Sbjct  242   FPIV----RTRISTQSIEALKQIEEKKLELDGIMQLIQESNKALEKDLEKLKNSEDKFNS  297

Query  1771  FRDAY  1785
             F D +
Sbjct  298   FMDLW  302



>ref|XP_007219447.1| hypothetical protein PRUPE_ppa021059mg, partial [Prunus persica]
 gb|EMJ20646.1| hypothetical protein PRUPE_ppa021059mg, partial [Prunus persica]
Length=396

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/369 (34%), Positives = 201/369 (54%), Gaps = 26/369 (7%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             ++A+ I+ + K L+D++       +Q E  +++L S+++ +   I +L+  +G   +   
Sbjct  22    AQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQRNKLDDSILDLQVILGKYHTSTA  81

Query  910   ----------CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                       C ++E   ++I     SAA I  +L +T   +   H    K++L +VA+L
Sbjct  82    SKIENEDHSHCKSEEETTKKILQREKSAAGILWQL-KTRHGTQAAHLTLTKDVLGIVAML  140

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSR+L+EYLG   ML++VC  +    ++      G +  +  L  L  ++G +
Sbjct  141   GKVEDDNLSRLLSEYLGIDTMLSIVCKTYEGVKALETYDNEGCIKKSSGLHGLGASIGRT  200

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL+++RPY GE +   PQRRL ++KP LPNGE PPGFLGYAVNMIH+ +  L
Sbjct  201   LEGRFQVICLDNLRPYAGEFVPDDPQRRLDLLKPRLPNGECPPGFLGYAVNMIHVDSTSL  260

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TASGHGLRETLFY L   LQ+Y  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  261   FCVTASGHGLRETLFYNLFFRLQIYKTRADMVPALPCISDG-AISLDGGMIRSTGV--FS  317

Query  1591  FG---DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQLRE----VQNDIENERMAYE  1746
              G   D  + FP  S    +    ++ +  +N LK+KK +++E     Q  ++N +  ++
Sbjct  318   LGNREDVDVRFPKLSVTSSLPETYLDSERQINELKWKKEKMQEDMKREQALLDNAKFNFD  377

Query  1747  EINNKFIGF  1773
                  F+ F
Sbjct  378   RKKQDFLKF  386



>ref|XP_009368768.1| PREDICTED: uncharacterized protein LOC103958243 [Pyrus x bretschneideri]
Length=1387

 Score =   204 bits (518),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 174/316 (55%), Gaps = 9/316 (3%)
 Frame = +1

Query  685   YENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEI  864
             YE  SP+  P L  D S    + N +  E+++          E +L  L+  K  ++ EI
Sbjct  1008  YEELSPF--PLLLQDPSSLQQVENLQRKENDIKRIGLRIGDLEKQLVELNEDKEILELEI  1065

Query  865   FNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILV  1044
              +L+    LSSS N    +E +   I  M  +AA+    L   P    E  ++F   ++ 
Sbjct  1066  SHLQACYQLSSS-NYSSKKEELRNHIERMSHTAASTVSTLSRVPLQ--EPDNDFMGGMIG  1122

Query  1045  VVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLAN  1218
             +VALLG   + +LSRIL+EYLGE QMLAVVC +  ++    K H  G + S  AL   A 
Sbjct  1123  LVALLGRVRNIKLSRILSEYLGEDQMLAVVCKSFTAACALEKYHRSGEVDSRHALYAEAA  1182

Query  1219  NLGTSINGGYDMICLNDIRPYTGELS-IGPQRRLAIVKPALPNGESPPGFLGYAVNMIHI  1395
              L  SI   + +ICL D+RPYTG+     PQR+L +  PALP+G++P GFLGYAVN++ +
Sbjct  1183  KLERSIESRFLVICLEDLRPYTGDFDGTDPQRKLFLPDPALPSGDTPSGFLGYAVNLVDL  1242

Query  1396  SAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
               +HL   T  GH LR+TLFY L GEL VY  R  M  A +C     AVSLDG I++  G
Sbjct  1243  DDEHLHTVTTEGHNLRQTLFYALFGELHVYRTRKQMFNARACI-KQAAVSLDGGILKQTG  1301

Query  1576  VTTHAFGDPFIMFPVF  1623
             + +  +G+P I FP+ 
Sbjct  1302  IASLGYGNPKICFPIL  1317



>ref|XP_011024840.1| PREDICTED: uncharacterized protein LOC105125881 isoform X3 [Populus 
euphratica]
Length=1314

 Score =   202 bits (514),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 125/293 (43%), Positives = 174/293 (59%), Gaps = 39/293 (13%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             MLD + NHI+K  E++L +DGF   D+     KVDK+G I+L GVLKVTAG+G+  S SV
Sbjct  1038  MLDAHGNHIKKGLEVQLNVDGFHILDKEGSNRKVDKDGCIDLSGVLKVTAGFGRIVSYSV  1097

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                DK VFKQE Q E RELRIAS++PE    GS LENI+FEV++S+G+VD  IH++EK+G
Sbjct  1098  SYQDKVVFKQELQTEKRELRIASKLPEFLTAGSDLENIVFEVVDSQGDVDPHIHNEEKAG  1157

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H+LTIKS+   + + ++Y+  HGRCT+ +I +P  EG F F+A HS Y ELQL +++ 
Sbjct  1158  QCHSLTIKSDSFNLQDAIQYTLRHGRCTIPAIRIPPIEGSFCFIAAHSCYSELQLSVKLP  1217

Query  565   TKKA--VEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAP------KL  720
               KA  VE D           +IL+                PY   S  K P       L
Sbjct  1218  VMKAPVVEYD-----------EILS----------------PY---SSRKVPLLGDSLSL  1247

Query  721   EHDESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
             EH ES    I N+ K L D++  Y +     E +L++L+ +K+ I+  +F L+
Sbjct  1248  EHTESLMTPIENNEKGLVDDIEKYGERIGNSERQLKVLNEQKTEIEEYVFGLQ  1300



>ref|XP_007147320.1| hypothetical protein PHAVU_006G113900g [Phaseolus vulgaris]
 gb|ESW19314.1| hypothetical protein PHAVU_006G113900g [Phaseolus vulgaris]
Length=350

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 175/306 (57%), Gaps = 18/306 (6%)
 Frame = +1

Query  751   VNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----  915
             +NH + L D++   +++ +Q E  L+ L+S+ + +   IF+L+ S+    S N       
Sbjct  4     LNHTQSLRDDISERSKIIKQHEDNLKFLNSQSNQLAESIFDLQVSLAKYHSNNVITSDSG  63

Query  916   -----TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
                  T+E  MEQI    ++AA +   L     +S   +    K+++ VVA LG  ES  
Sbjct  64    NGAFHTEEETMEQIMKKENTAAGVFSWLKGNAQTS---NLTLTKDVVGVVATLGKVESDN  120

Query  1081  LSRILAEYLGEKQMLAVVCNAHASSVGASK--MHGYLSSADALSTLANNLGTSINGGYDM  1254
             LSRIL+E+LG ++MLA+VC+++       K    G ++    L  + +++G  ING + +
Sbjct  121   LSRILSEFLGLERMLAIVCSSYEGINALEKYDTEGLINCNAGLHGIGSSIGKRINGRFAV  180

Query  1255  ICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             I L D+RP+ G L +  PQ++LA+ KP LPNGE PPGFL YAVNMIH+ +KHL + T  G
Sbjct  181   ISLEDLRPFVGGLVADDPQKKLALPKPRLPNGECPPGFLDYAVNMIHLDSKHLSFLTDIG  240

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLD-GVIMRGNGVTTHAFGDPFI  1608
             HGLRETLFY L   LQ+Y  R+ M +A  C  +  A+SLD G+I RG         D  +
Sbjct  241   HGLRETLFYGLFSRLQIYKTRNEMLLALPCIYDG-ALSLDGGMIQRGGMFALGCRKDVEV  299

Query  1609  MFPVFS  1626
              FP+ S
Sbjct  300   KFPLIS  305



>gb|KEH24680.1| defective in meristem silencing protein [Medicago truncatula]
Length=383

 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 193/347 (56%), Gaps = 29/347 (8%)
 Frame = +1

Query  754   NHKMLEDEVI----HYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC--  915
             N +  +D++I    ++    ++ E  ++ L+S+ + +   + +L+ S+G   S N     
Sbjct  25    NSESFKDQIIKQEGNFKGQIKKHEDNIEFLNSQSNRLTESVVDLQMSLGKYHSTNVTKSE  84

Query  916   -------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
                    T+E  +EQI    +SAA+I C +     +S   +  F K+ + VVA L   ES
Sbjct  85    NGNGAFHTEEETVEQILKKENSAASIFCWIKANTQTS---NLAFVKDAVGVVATLAKVES  141

Query  1075  YELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGY  1248
              +LSRIL+EY+G + MLA+VC+ +       K    G ++S   L  + ++ G  ING +
Sbjct  142   DDLSRILSEYVGLETMLAIVCSTNEGVKALEKYDPEGTVNSTGGLHGIGSSTGKKINGRF  201

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL D+RP+ G  +   PQ++LAI KP LPNGE PPGFL YAVNMIH+ +  L + TA
Sbjct  202   VVICLEDLRPFVGGFVENDPQKKLAIPKPRLPNGECPPGFLDYAVNMIHLDSNRLSFLTA  261

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---  1596
             SGHGLRETLFY L   LQ+Y  R+ M +A  C  +  A+SLDG ++R  G+   A G   
Sbjct  262   SGHGLRETLFYSLFSRLQIYKTRNEMMLALPCITDG-ALSLDGGMIRKCGI--FALGSRK  318

Query  1597  DPFIMFPVFSKEQQMNL-MTVNPDVLNLLKYKKVQLREVQNDIENER  1734
             D  + FP+ + E  +    T   DV+  L+++  +L     DI+ E+
Sbjct  319   DVEVKFPLIAGESDVPPDYTEAEDVVRKLQWETSKLAA---DIQREQ  362



>ref|XP_009625231.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Nicotiana tomentosiformis]
Length=425

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/304 (38%), Positives = 177/304 (58%), Gaps = 17/304 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN------  906
             I N K LED V+H   L  +Q E  ++ L ++K+ +   I +++ ++G   +++      
Sbjct  49    IYNSKKLED-VVHEMGLKIKQHEENIKFLKTQKNGLDNSILDMQVALGKYQTESESGPEN  107

Query  907   ----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
                    +++  +EQI     SAA I C+L +T   +   H    K++L +VA+LG  + 
Sbjct  108   EELSHVLSEQETIEQILRYEKSAAGIWCQL-KTRHGTQASHLPLTKDVLGIVAMLGKVDD  166

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LSR+L++YLG + MLA+VC  +    ++      GY++    L  L +++G S++G +
Sbjct  167   DNLSRLLSDYLGLETMLAIVCKTYDGIKALETYNKEGYINKTSGLHGLGSSIGRSLDGRF  226

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL ++RPY GE ++  PQRRL I+KP LPNGESPPGFLG+AVNM++I + +L   T+
Sbjct  227   LVICLENLRPYGGEFIADEPQRRLNILKPRLPNGESPPGFLGFAVNMVNIDSVNLYCATS  286

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SG+GLRETLFY L   L VY  R  M  A  C  +  A+SLDG I++ N V      +  
Sbjct  287   SGYGLRETLFYNLFSRLHVYRTRADMLQALPCIRDG-AISLDGGIIKHNNVFALGNREVD  345

Query  1606  IMFP  1617
             + FP
Sbjct  346   LKFP  349



>ref|XP_009625230.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/304 (38%), Positives = 177/304 (58%), Gaps = 17/304 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN------  906
             I N K LED V+H   L  +Q E  ++ L ++K+ +   I +++ ++G   +++      
Sbjct  49    IYNSKKLED-VVHEMGLKIKQHEENIKFLKTQKNGLDNSILDMQVALGKYQTESESGPEN  107

Query  907   ----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
                    +++  +EQI     SAA I C+L +T   +   H    K++L +VA+LG  + 
Sbjct  108   EELSHVLSEQETIEQILRYEKSAAGIWCQL-KTRHGTQASHLPLTKDVLGIVAMLGKVDD  166

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LSR+L++YLG + MLA+VC  +    ++      GY++    L  L +++G S++G +
Sbjct  167   DNLSRLLSDYLGLETMLAIVCKTYDGIKALETYNKEGYINKTSGLHGLGSSIGRSLDGRF  226

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL ++RPY GE ++  PQRRL I+KP LPNGESPPGFLG+AVNM++I + +L   T+
Sbjct  227   LVICLENLRPYGGEFIADEPQRRLNILKPRLPNGESPPGFLGFAVNMVNIDSVNLYCATS  286

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SG+GLRETLFY L   L VY  R  M  A  C  +  A+SLDG I++ N V      +  
Sbjct  287   SGYGLRETLFYNLFSRLHVYRTRADMLQALPCIRDG-AISLDGGIIKHNNVFALGNREVD  345

Query  1606  IMFP  1617
             + FP
Sbjct  346   LKFP  349



>gb|KDO54231.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1258

 Score =   201 bits (510),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 168/284 (59%), Gaps = 37/284 (13%)
 Frame = +1

Query  49    IQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVFSGDKSVF  228
             ++K  E++L +DGFC  DQ  L  KVD  G I+L G+LKV AGYGK  SLSV S +  +F
Sbjct  1004  LEKGLEVELNVDGFCIEDQLGLRRKVDGYGCIDLSGLLKVKAGYGKNVSLSVLSDNGVIF  1063

Query  229   KQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIK  408
             KQ+FQ E RELR+ S +PE C  GS LE+I FE+++S+G VD +IHDD+KSGQ HTLTIK
Sbjct  1064  KQDFQTEKRELRVISGVPECCTVGSQLEDITFEIVDSKGAVDVTIHDDDKSGQSHTLTIK  1123

Query  409   SELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNTKKAVEAD  588
             S+++  + ++RY+F  GRCTV +I+LP++EG F FVA HS+Y EL + I+V   +A + +
Sbjct  1124  SDVINTENSIRYAFRQGRCTVPAISLPQNEGCFCFVATHSQYTELNISIKVPIVRAPKLE  1183

Query  589   SGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKM-  765
             S                 ++ +   +  ++F  E  SP K            H+ NH + 
Sbjct  1184  S-----------------DDIRTPCSDGKVFLLEGPSPIK------------HVGNHMVP  1214

Query  766   -------LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE  876
                    LE EV +Y     + E  L++L+ +K  ++  +  L+
Sbjct  1215  IMKIVNELESEVRNYGLCIGRHEKALKLLNDQKMEVEEVLSKLQ  1258



>ref|XP_010671438.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 [Beta vulgaris 
subsp. vulgaris]
Length=435

 Score =   191 bits (484),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 129/367 (35%), Positives = 197/367 (54%), Gaps = 20/367 (5%)
 Frame = +1

Query  760   KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQES----  927
             K L+DEV       +Q E  L+ L ++K+ +   I +L+ S+G   S +   T++S    
Sbjct  55    KKLQDEVEKTGSKMKQHEDNLKFLKAQKNQLDDAILDLQVSLGKYISSSAPKTEDSDTSQ  114

Query  928   ------IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                    +EQI    +SAA I C+      S +      ++++L VVA LG  +   L+R
Sbjct  115   VRSEDETVEQILRHENSAAGIYCQFKYRHGSQLSTPI-LSEDVLGVVASLGKVDEDNLNR  173

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGYDMIC  1260
             + +EYLG + MLA+VC  +   +   +M+   G ++    +  L  ++G ++ G Y +IC
Sbjct  174   LFSEYLGLQNMLAIVCKTY-EGIKVLEMYDGEGLVNKGSGIQGLGASIGRALEGRYSVIC  232

Query  1261  LNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHG  1437
             L  +RPY GE LS  PQRRL I KP LPNG +P GFLGYAVNM+++   H+   T+SG G
Sbjct  233   LEYLRPYAGEFLSDDPQRRLDIPKPRLPNGNTPAGFLGYAVNMVNLDRPHIFCLTSSGSG  292

Query  1438  LRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMF  1614
             LRETLFY L   LQVY  R  M +A  C ++  AVSLDG ++R  GV +  +  D  + F
Sbjct  293   LRETLFYTLFSRLQVYRTRAEMLLALPCISDG-AVSLDGGMIRSTGVFSLGSREDVDVRF  351

Query  1615  PVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNL  1794
             P FS  Q+  L     ++ N +K KK +   +Q DI  E+   ++    F   +  ++  
Sbjct  352   PKFS--QRAGLPDKYYELENQIKQKKWEKERLQEDIRREQALLDQEKYNFSLRKQDFLKF  409

Query  1795  TQGSSSV  1815
                SS++
Sbjct  410   LADSSTI  416



>ref|XP_009791513.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X1 [Nicotiana sylvestris]
Length=425

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 175/304 (58%), Gaps = 17/304 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN------  906
             I N K LED V+H   L  +Q E  ++ L ++K+ +   I +++ ++G   +++      
Sbjct  49    IYNSKKLED-VVHEMGLKIKQHEENIKFLKTQKNGLDNSILDMQVALGKYQTESESGPEN  107

Query  907   ----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
                    +++  +EQI     SAA I C+L +T   +   H    K++L +VA+LG  + 
Sbjct  108   EELSHVLSEQETIEQILRYEKSAAGIWCQL-KTRHGTQASHLPLTKDVLGIVAMLGKVDD  166

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LSR+L++YLG + MLA+VC  +    ++      GY++       L +++G S++G +
Sbjct  167   DNLSRLLSDYLGLETMLAIVCKTYDGIKALETYDKEGYINKTSGFHGLGSSIGRSLDGRF  226

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +IC+ ++RPY GE ++  PQRRL I+KP LPNGESPPGFLG+AVNM+ I + +L   T+
Sbjct  227   LVICVENLRPYGGEFIADDPQRRLDILKPRLPNGESPPGFLGFAVNMVSIDSVNLYCATS  286

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF  1605
             SG+GLRETLFY L   L VY  R  M  A  C  +  A+SLDG I++ N V      +  
Sbjct  287   SGYGLRETLFYNLFSRLHVYRTRADMLQALPCIRDG-AISLDGGIIKHNNVFVLGKREVD  345

Query  1606  IMFP  1617
             + FP
Sbjct  346   LKFP  349



>ref|XP_003554769.1| PREDICTED: uncharacterized protein LOC100794789 [Glycine max]
Length=351

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 173/291 (59%), Gaps = 23/291 (8%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC---------TQESIMEQISGMG  954
             +Q E  L+ L+S+ + +   IF+L+ S+    S N            T+E  MEQ+    
Sbjct  23    KQHEDNLKFLNSQSNQLAESIFDLQVSLARYHSTNVITLENGNGAFHTEEETMEQVMKKE  82

Query  955   DSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAV  1131
             +SAA+I   L +   +S++ L     K+++ VVA L   ES +LSRIL+E+LG + MLA+
Sbjct  83    NSAASIFSWLKVNAQTSNLTL----TKDVVGVVATLAKVESDDLSRILSEFLGLETMLAI  138

Query  1132  VCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIG  1302
             VC+++       K    G ++    L  + +++G  ING + +I L DIRP+ G  ++  
Sbjct  139   VCSSYEGINALEKYDPEGLINCNGGLHGIGSSIGKRINGRFVVISLEDIRPFVGGFVAND  198

Query  1303  PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQV  1482
             PQ++LA+ KP LPNGE PPGFL YAVNMIH+ +K+L + T SG+GLRETLFY L   LQ+
Sbjct  199   PQKKLALPKPRLPNGECPPGFLDYAVNMIHLDSKYLSFLTDSGYGLRETLFYGLFSRLQI  258

Query  1483  YANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFPVFS  1626
             Y  R+ M +A  C ++  A+SLDG ++RG G+   A G   D  + FP+ S
Sbjct  259   YKTRNEMLLALPCIHDG-ALSLDGGMIRGRGM--FALGSRKDVEVKFPLIS  306



>ref|XP_009607723.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   189 bits (480),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 121/360 (34%), Positives = 196/360 (54%), Gaps = 20/360 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             I N K L+D +       +  E  ++ L ++K+ +   I + + ++G   S +   +Q  
Sbjct  59    ICNSKKLQDAMQEIGLKIKHHEDNIKFLKAQKNILDDSILDTQVALGRYQSASEPGSQNN  118

Query  922   --------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                     E I+EQI     SAA I C+L +T       H    K+++ +VALLG  +  
Sbjct  119   ESSNRRNEEEIIEQILKHDKSAAGIYCQL-KTHHGPQVTHLPLLKDVIGIVALLGKVDDD  177

Query  1078  ELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L++YLG + MLAVVC       ++      G+++ +  L  L  ++G +++  + 
Sbjct  178   NLSRLLSDYLGLETMLAVVCKTPDGIKALETYDKEGFINKSSGLYALGASIGRALDARFV  237

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL ++RPY G  ++  PQRRLA++KP LPNGE+PPGFLG+AVNMI+I + +L   T++
Sbjct  238   VICLGNLRPYEGAFIADDPQRRLALMKPRLPNGETPPGFLGFAVNMINIDSANLYCATST  297

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             GHGLRETLFY+L   LQVY  R  M  A +   +  A+SLDG I++ NGV    + +  +
Sbjct  298   GHGLRETLFYKLFSRLQVYKTRTEMLQALTVITHG-AISLDGGIIKSNGVFALGYSEVEV  356

Query  1609  MFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
              FP  S    +     + +  L  LK+K+ +    L   Q  +++ +  +E    +F+ F
Sbjct  357   KFPKSSGRSNLPENYFDTESRLKELKWKRDRFLEDLHREQTLLDHAKFNFEIKKQEFVKF  416



>ref|XP_009625232.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=393

 Score =   187 bits (476),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 174/298 (58%), Gaps = 17/298 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN----------CC  912
             LED V+H   L  +Q E  ++ L ++K+ +   I +++ ++G   +++            
Sbjct  20    LED-VVHEMGLKIKQHEENIKFLKTQKNGLDNSILDMQVALGKYQTESESGPENEELSHV  78

Query  913   CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRI  1092
              +++  +EQI     SAA I C+L +T   +   H    K++L +VA+LG  +   LSR+
Sbjct  79    LSEQETIEQILRYEKSAAGIWCQL-KTRHGTQASHLPLTKDVLGIVAMLGKVDDDNLSRL  137

Query  1093  LAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLN  1266
             L++YLG + MLA+VC  +    ++      GY++    L  L +++G S++G + +ICL 
Sbjct  138   LSDYLGLETMLAIVCKTYDGIKALETYNKEGYINKTSGLHGLGSSIGRSLDGRFLVICLE  197

Query  1267  DIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
             ++RPY GE ++  PQRRL I+KP LPNGESPPGFLG+AVNM++I + +L   T+SG+GLR
Sbjct  198   NLRPYGGEFIADEPQRRLNILKPRLPNGESPPGFLGFAVNMVNIDSVNLYCATSSGYGLR  257

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             ETLFY L   L VY  R  M  A  C  +  A+SLDG I++ N V      +  + FP
Sbjct  258   ETLFYNLFSRLHVYRTRADMLQALPCIRDG-AISLDGGIIKHNNVFALGNREVDLKFP  314



>ref|XP_004494831.1| PREDICTED: uncharacterized protein LOC101513030 [Cicer arietinum]
Length=356

 Score =   186 bits (473),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 192/360 (53%), Gaps = 37/360 (10%)
 Frame = +1

Query  772   DEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC---------TQE  924
             D +  ++   +Q E  ++ L+S+ + +   + +L+ S+G   S N            T+E
Sbjct  13    DNIESFSDQIKQHEDNIEFLNSQSNRLTESVLDLQVSLGRYHSANVISLENGNGAFHTEE  72

Query  925   SIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEY  1104
                EQI    +SAA+I C  I++ S +  L   F K+ + VVA L   ES +LSRIL+EY
Sbjct  73    ETAEQILKKENSAASIFC-WIKSNSQTSNL--AFVKDAVGVVATLARVESDDLSRILSEY  129

Query  1105  LGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRP  1278
             LG + MLA+VC+ +       K    G ++    L  + +     I G + +ICL D+RP
Sbjct  130   LGLETMLAIVCSTNEGVKALEKYDPEGTINCNGGLHGIGSRTERRIKGRFVVICLEDLRP  189

Query  1279  YTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLF  1455
             + G  ++  PQ++LA+ KP LPNGE PPGFL YAVNMIH+    L + TASGHGLRETLF
Sbjct  190   FVGGFVANDPQKKLALPKPRLPNGECPPGFLDYAVNMIHLDTNRLSFLTASGHGLRETLF  249

Query  1456  YRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFPVFS  1626
             Y L   LQ+Y  R+ M +A  C N+  A+SLDG ++R  G+   A G   D  + FP+  
Sbjct  250   YGLFSRLQIYKTRNEMLLALPCINDG-ALSLDGGMIRKCGM--FALGSRKDVEVKFPLIG  306

Query  1627  KEQQMNLMTVNPDVL---NLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLT  1797
              E       V PD +   ++++  K +  ++  DI+ E+        + + FR    N T
Sbjct  307   GEPD-----VPPDYIEAEDVVRRLKWETSKLAADIQREQ--------QLLDFRKGSSNTT  353



>ref|XP_009607725.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=440

 Score =   189 bits (479),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/380 (33%), Positives = 204/380 (54%), Gaps = 21/380 (6%)
 Frame = +1

Query  691   NSSPYKAPKLEHDESEADHIV-NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIF  867
             NSS +   +       A+ ++ N K L+D +       +  E  ++ L ++K+ +   I 
Sbjct  37    NSSVFAGDRDTMQNGAAEAVICNSKKLQDAMQEIGLKIKHHEDNIKFLKAQKNILDDSIL  96

Query  868   NLEESIGLSSSQNCCCTQ----------ESIMEQISGMGDSAAAIACKLIETPSSSVELH  1017
             + + ++G   S +   +Q          E I+EQI     SAA I C+L +T       H
Sbjct  97    DTQVALGRYQSASEPGSQNNESSNRRNEEEIIEQILKHDKSAAGIYCQL-KTHHGPQVTH  155

Query  1018  HEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSS  1191
                 K+++ +VALLG  +   LSR+L++YLG + MLAVVC       ++      G+++ 
Sbjct  156   LPLLKDVIGIVALLGKVDDDNLSRLLSDYLGLETMLAVVCKTPDGIKALETYDKEGFINK  215

Query  1192  ADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFL  1368
             +  L  L  ++G +++  + +ICL ++RPY G  ++  PQRRLA++KP LPNGE+PPGFL
Sbjct  216   SSGLYALGASIGRALDARFVVICLGNLRPYEGAFIADDPQRRLALMKPRLPNGETPPGFL  275

Query  1369  GYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSL  1548
             G+AVNMI+I + +L   T++GHGLRETLFY+L   LQVY  R  M  A +   +  A+SL
Sbjct  276   GFAVNMINIDSANLYCATSTGHGLRETLFYKLFSRLQVYKTRTEMLQALTVITHG-AISL  334

Query  1549  DGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQ  1713
             DG I++ NGV    + +  + FP  S    +     + +  L  LK+K+ +    L   Q
Sbjct  335   DGGIIKSNGVFALGYSEVEVKFPKSSGRSNLPENYFDTESRLKELKWKRDRFLEDLHREQ  394

Query  1714  NDIENERMAYEEINNKFIGF  1773
               +++ +  +E    +F+ F
Sbjct  395   TLLDHAKFNFEIKKQEFVKF  414



>emb|CDP04550.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 192/366 (52%), Gaps = 20/366 (5%)
 Frame = +1

Query  760   KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC----------  909
             K LED++       +Q E  ++ L  +   +   I +++ ++G   S +           
Sbjct  24    KKLEDDIHCLGLKIKQHEDNIKYLRQQVHRLDDSILDMQVALGKYHSSSTHRMENKDLSH  83

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
               ++E ++E I    +SAA    +L     S    H  + K+++ VVA LG  E   LSR
Sbjct  84    VGSEEEMVEHILAHENSAAGTLFQLKACHESHAS-HLAWMKDVVGVVATLGNVEDDNLSR  142

Query  1090  ILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L+EYLG ++MLAVVC  H   +++ A    G++S    L  L  ++   ++G +  ICL
Sbjct  143   LLSEYLGTEKMLAVVCKTHNCVTALEAYDKEGFISKTSGLHELGASIERPLDGRFLAICL  202

Query  1264  NDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
              ++RP+ G   +  PQRRL IVKP LPNGE+PPGFLG+AVNMI+I   +L + T+SG GL
Sbjct  203   ENLRPFVGNFVVNDPQRRLDIVKPRLPNGETPPGFLGFAVNMINIDKSNLYFVTSSGRGL  262

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG-DPFIMFP  1617
             RETLFY L   LQVY  R+ M  A   F  + A+SLDG IMRG G+     G D  + FP
Sbjct  263   RETLFYSLFSRLQVYRTREEMLRALP-FMTDAALSLDGGIMRGAGMFCLGKGKDVVLRFP  321

Query  1618  VFSKEQQMNLMTVNPDV-LNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNL  1794
               S    +       +  +   K+KK +L E   DI  E++  +++   +   +  +V  
Sbjct  322   KNSGRSSLPKEYFETETAMKEEKWKKERLSE---DIRREQIVLDQVKFNYEIKKQEFVKY  378

Query  1795  TQGSSS  1812
                SSS
Sbjct  379   LAESSS  384



>ref|XP_009607722.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=442

 Score =   189 bits (479),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/380 (33%), Positives = 204/380 (54%), Gaps = 21/380 (6%)
 Frame = +1

Query  691   NSSPYKAPKLEHDESEADHIV-NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIF  867
             NSS +   +       A+ ++ N K L+D +       +  E  ++ L ++K+ +   I 
Sbjct  39    NSSVFAGDRDTMQNGAAEAVICNSKKLQDAMQEIGLKIKHHEDNIKFLKAQKNILDDSIL  98

Query  868   NLEESIGLSSSQNCCCTQ----------ESIMEQISGMGDSAAAIACKLIETPSSSVELH  1017
             + + ++G   S +   +Q          E I+EQI     SAA I C+L +T       H
Sbjct  99    DTQVALGRYQSASEPGSQNNESSNRRNEEEIIEQILKHDKSAAGIYCQL-KTHHGPQVTH  157

Query  1018  HEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSS  1191
                 K+++ +VALLG  +   LSR+L++YLG + MLAVVC       ++      G+++ 
Sbjct  158   LPLLKDVIGIVALLGKVDDDNLSRLLSDYLGLETMLAVVCKTPDGIKALETYDKEGFINK  217

Query  1192  ADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFL  1368
             +  L  L  ++G +++  + +ICL ++RPY G  ++  PQRRLA++KP LPNGE+PPGFL
Sbjct  218   SSGLYALGASIGRALDARFVVICLGNLRPYEGAFIADDPQRRLALMKPRLPNGETPPGFL  277

Query  1369  GYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSL  1548
             G+AVNMI+I + +L   T++GHGLRETLFY+L   LQVY  R  M  A +   +  A+SL
Sbjct  278   GFAVNMINIDSANLYCATSTGHGLRETLFYKLFSRLQVYKTRTEMLQALTVITHG-AISL  336

Query  1549  DGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQ  1713
             DG I++ NGV    + +  + FP  S    +     + +  L  LK+K+ +    L   Q
Sbjct  337   DGGIIKSNGVFALGYSEVEVKFPKSSGRSNLPENYFDTESRLKELKWKRDRFLEDLHREQ  396

Query  1714  NDIENERMAYEEINNKFIGF  1773
               +++ +  +E    +F+ F
Sbjct  397   TLLDHAKFNFEIKKQEFVKF  416



>gb|KHG08560.1| Bro-N domain-containing protein [Gossypium arboreum]
Length=427

 Score =   188 bits (477),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/295 (41%), Positives = 167/295 (57%), Gaps = 15/295 (5%)
 Frame = +1

Query  733   SEADHIV-NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ  903
             SEA  I+ + + L+D++       +Q E  L++L ++K+ +   I +++  +G   SSS 
Sbjct  46    SEAKSIMESSEKLQDDLRTLGMKIKQHEDSLKLLRNQKNKLDDTILDMQVKLGKYHSSSS  105

Query  904   NCCCTQES-------IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
                   ES         EQI     SAA I C+L     S    H    K++L VVA LG
Sbjct  106   PVVNKDESHLQSEHETTEQILRHEKSAAGILCQLKAHHGSQAS-HLTLTKDVLGVVATLG  164

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSI  1236
               +   LSRI +EYLG + MLAVVCN      ++ A    G +     L  LA ++G S+
Sbjct  165   KVDDENLSRIFSEYLGVQTMLAVVCNTFEGVKALEAFNQDGCIDKTSGLHGLAASIGRSL  224

Query  1237  NGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQ  1413
              G + +ICL ++RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI++ + +L 
Sbjct  225   GGRFIVICLENLRPYAGDFVAEDRQRRLDLLKPRLPNGECPPGFLGFAVNMINVDSSNLS  284

Query  1414  YRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             + TASG GLRETLFY L   LQVY  R  M  A  C +   AVSLDG ++R NGV
Sbjct  285   FVTASGEGLRETLFYNLFSHLQVYQTRAEMFRALPCISEG-AVSLDGGMIRSNGV  338



>ref|XP_006429697.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 ref|XP_006429698.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 gb|ESR42937.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 gb|ESR42938.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
Length=436

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 129/370 (35%), Positives = 194/370 (52%), Gaps = 23/370 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-----------S  894
             I N K L+D++       +Q E  +++L S+   +   I +L+ ++G            S
Sbjct  58    IYNSKRLQDDLQMIGLKIKQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHS  117

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             + QN    +E    QI     SAA + C+L +T   +   H  F K++L +VA LG  E 
Sbjct  118   NHQN----EEETTGQILQHEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLED  172

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LS +L+EYLG   MLA+VC       ++      G++  +  L  L  ++G +I+G +
Sbjct  173   ENLSSLLSEYLGVDTMLAIVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRF  232

Query  1249  DMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL ++RP+ GE  +  PQRRL + KP LP GE PPGFLGYAVNMI+I +K+L   TA
Sbjct  233   LVICLENLRPFAGEFVVDDPQRRLDLWKPRLPTGECPPGFLGYAVNMINIDSKNLFCATA  292

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDP  1602
             SGHGLRETLFY L   LQVY  R  M +A    ++  A+SLDG I+R +GV +  +  D 
Sbjct  293   SGHGLRETLFYNLFYRLQVYRTRADMLLALPLISDG-AISLDGGIIRSSGVFSLGSRQDV  351

Query  1603  FIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDA  1782
              + FP  S    M  +         ++  K +L  +Q D++ E+   +   + F   +  
Sbjct  352   DVRFPKSSGTSDM--LAKYAATEKQIQEMKFRLETLQEDLKREQALLKNAKDTFERKKQE  409

Query  1783  YVNLTQGSSS  1812
             +V     SSS
Sbjct  410   FVKFLADSSS  419



>gb|EPS69220.1| hypothetical protein M569_05551, partial [Genlisea aurea]
Length=400

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 193/354 (55%), Gaps = 30/354 (8%)
 Frame = +1

Query  724   HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL----  891
             HDE     I + K ++D+V    +  +  E  ++ L S +  +++ + +++  IG     
Sbjct  11    HDEQFESIIAHSKKIQDDVQEQGESIKHHEENIKYLKSLEKKLESSLSDIQVRIGRYPRT  70

Query  892   -------SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVV  1050
                       +    ++E I+++++   +SAA++ C++  TP S     H   K++L VV
Sbjct  71    EFLKGKSVDPEKKGFSKEDIVQRVTNYKNSAASLLCRIKATPGSKSS-EHSSVKDVLGVV  129

Query  1051  ALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNL  1224
             A LG      +SRILAEYLG++ MLAVVC       ++ A   HG +     + +LA ++
Sbjct  130   ATLGKVNDANISRILAEYLGQETMLAVVCKTEKGVKAMEAYNSHGLIDKGFGIHSLAASM  189

Query  1225  GTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISA  1401
             G S++  + +ICL D+RPY+G L    P RRL ++ P L NGE+PPGFLG+AVNMI I +
Sbjct  190   GKSVDERFLVICLEDLRPYSGGLICDDPLRRLDLMAPRLANGENPPGFLGFAVNMIAIES  249

Query  1402  KHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVT  1581
               L     +G+ LRETLFY L  +LQVY +R+ M  A  C  ++ AVSLDG ++R  G++
Sbjct  250   TELYTIVGTGYSLRETLFYNLFSDLQVYKSREDMLKARPCITHS-AVSLDGGMIRNLGIS  308

Query  1582  THAFGDPFIMFPVFSKEQQMNLMTV---NPDVLNLLKYKKVQLREVQNDIENER  1734
               AFG          + + M+++T     P VL+  +Y ++Q    + + +  R
Sbjct  309   --AFG---------PRREGMDIITFPCDPPGVLHPAEYLELQKESKETEWKKNR  351



>ref|XP_009791519.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X2 [Nicotiana sylvestris]
Length=390

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 172/299 (58%), Gaps = 19/299 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLS-RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN-----------C  909
             LED V+H   L  +Q E  ++ L ++K+ +   I +++ ++G   +++            
Sbjct  20    LED-VVHEMGLKIKQHEENIKFLKTQKNGLDNSILDMQVALGKYQTESESGPENEELSHV  78

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                QE+I EQI     SAA I C+L +T   +   H    K++L +VA+LG  +   LSR
Sbjct  79    LSEQETI-EQILRYEKSAAGIWCQL-KTRHGTQASHLPLTKDVLGIVAMLGKVDDDNLSR  136

Query  1090  ILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L++YLG + MLA+VC  +    ++      GY++       L +++G S++G + +IC+
Sbjct  137   LLSDYLGLETMLAIVCKTYDGIKALETYDKEGYINKTSGFHGLGSSIGRSLDGRFLVICV  196

Query  1264  NDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
              ++RPY GE ++  PQRRL I+KP LPNGESPPGFLG+AVNM+ I + +L   T+SG+GL
Sbjct  197   ENLRPYGGEFIADDPQRRLDILKPRLPNGESPPGFLGFAVNMVSIDSVNLYCATSSGYGL  256

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             RETLFY L   L VY  R  M  A  C  +  A+SLDG I++ N V      +  + FP
Sbjct  257   RETLFYNLFSRLHVYRTRADMLQALPCIRDG-AISLDGGIIKHNNVFVLGKREVDLKFP  314



>ref|XP_011044629.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Populus 
euphratica]
Length=420

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 208/418 (50%), Gaps = 43/418 (10%)
 Frame = +1

Query  589   SGYFQSQSPE--RQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHK  762
             S + Q  SP    Q+  KE         Q   FP   +  Y + KL+ D     H++  K
Sbjct  5     SNHSQDASPSALMQVDPKETNIVVRDEMQNGRFPQAQTILYNSKKLQEDL----HVLGMK  60

Query  763   MLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG------LSSSQNCC----  912
             +            +  E  ++ L S K+ +   I +L+ ++G      + +++N      
Sbjct  61    I------------KHHEDNIKFLKSHKNKLDDSILDLQVTLGKYHSSTMPNNENDAHYSN  108

Query  913   CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRI  1092
              +++  ME I     SAA I C+L  +  + +  H  F  ++L VVA LG  +   L R+
Sbjct  109   QSEDETMEHILQHEKSAAGILCRLKMSHGTQIS-HPSFTNDVLGVVATLGKVDDDNLGRL  167

Query  1093  LAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLN  1266
              +EYLG + MLA+VC  +    ++      G ++    L  L  ++G  ++G + + CL 
Sbjct  168   FSEYLGVETMLAIVCKTYEGVKALETYDKEGQINKDSGLHGLGASIGKELDGRFLVFCLE  227

Query  1267  DIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
             ++RPY GE  +  PQRRL ++KP LPNGE PPGF+G+AVNMI++   +L Y T SG+GLR
Sbjct  228   NLRPYCGEFVVDDPQRRLDLLKPKLPNGECPPGFIGFAVNMINVEFTNLFYLTGSGYGLR  287

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IMFPV  1620
             ETLFY L   LQVY  R+ M +A  C ++  A+SLDG +M+G G+ +    +   + FP 
Sbjct  288   ETLFYNLFSRLQVYRTREDMVLALPCISDG-AISLDGGMMKGTGIFSLGNRNNVDVRFPK  346

Query  1621  FSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE-------RMAYEEINNKFIGF  1773
              S    +    +  D    LK  K +  ++  DI+ E       R ++E    +F+ F
Sbjct  347   LSVTSTLPDNYI--DTEKQLKETKWKREKMLEDIKREQALLDTARQSFERKKEEFVKF  402



>ref|XP_009774641.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Nicotiana sylvestris]
Length=391

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 121/360 (34%), Positives = 197/360 (55%), Gaps = 20/360 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQNCCCTQ  921
             I N K L+D +       +  E  ++ L ++K+ +   I + + ++G   S+S+     +
Sbjct  10    ICNSKKLQDAMQEIGLKIKHHEDNIKFLKAQKNILDDSILDTQVALGRYQSASEPGSENK  69

Query  922   ES--------IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
             ES        I+E+I     SAA I C+L +T       H    K+++ +VALLG  +  
Sbjct  70    ESSNRRNEEEIIERILKHDKSAAGIYCQL-KTHHGPQVTHLPLLKDVMGIVALLGKVDDD  128

Query  1078  ELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L++YLG + MLAVVC       ++      G+++ +  L  L  ++G +++  + 
Sbjct  129   NLSRLLSDYLGLETMLAVVCKTPDGIKALETYDKEGFINKSSGLYALGASIGRALDARFL  188

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL ++RPY G  ++  PQRRLA++KP LPNGE+PPGFLG+AVNMI+I + +L   T++
Sbjct  189   VICLGNLRPYEGAFIADDPQRRLALMKPRLPNGETPPGFLGFAVNMINIDSANLYCATST  248

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             GHGLRETLFY+L   LQVY  R  M  A +   +  A+SLDG I++ NGV      +  +
Sbjct  249   GHGLRETLFYKLFSRLQVYKTRTEMLQALTVITHG-AISLDGGIIKSNGVFALGNSEVEV  307

Query  1609  MFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
              FP  S    +     + +  L  LK+K+ +    L   Q  +++ +  +E    +F+ F
Sbjct  308   KFPKSSGRSNLPENYFDTESRLKELKWKRDRFLEDLHREQTLLDHAKFNFEIKKQEFVKF  367



>ref|XP_002516667.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45686.1| conserved hypothetical protein [Ricinus communis]
Length=402

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 197/370 (53%), Gaps = 23/370 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---------LSSS  900
             I + K L+D +       +Q E  +++L S+++ ++  I +L+  +G           ++
Sbjct  34    IYSSKKLQDNLHMIGLKIKQHEDNVKLLKSQRNKLEDAILDLQVILGKYHATTPPNTENA  93

Query  901   QNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
              N   ++E I EQ+     SAA I C+L     +    +    K +L +VA LG  E   
Sbjct  94    HNSNQSEEDITEQVLRHEKSAAGILCQLRMRHGTHAS-NLSCTKGVLGIVATLGRVEDDN  152

Query  1081  LSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LSR+ AEYLG + MLA+VC  +    ++      G++++   L  L  ++G  ++G + +
Sbjct  153   LSRLFAEYLGIESMLAIVCRTYEDIRALETYDTEGHINNGSGLHGLGASIGRVLDGRFLV  212

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL D+RPY GE L+  PQRRL ++KP L NGE PPGF+G+AVNMI +   +L Y T+SG
Sbjct  213   ICLEDLRPYCGEFLADDPQRRLDLLKPKLSNGECPPGFIGFAVNMIDLDCTNLLYVTSSG  272

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF--  1605
             +GLRETLFY L   LQVY  R+ M +A  C ++  A+S+DG I++  G    + G+P   
Sbjct  273   YGLRETLFYNLFSRLQVYKRREDMLLALPCISDG-AISMDGGIIKATGF--FSLGNPNNV  329

Query  1606  -IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDA  1782
              + FP  S     N +      L  + +KK ++ E   DI+ E+  +      F   ++ 
Sbjct  330   DVQFPKPSLNPPDNHLETEKQ-LKEMTWKKDKITE---DIKREQALWNSAKYNFERKKEE  385

Query  1783  YVNLTQGSSS  1812
             +V     SS+
Sbjct  386   FVKFLAESSA  395



>ref|XP_006600803.1| PREDICTED: uncharacterized protein LOC100815144 [Glycine max]
Length=1036

 Score =   192 bits (487),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 187/343 (55%), Gaps = 13/343 (4%)
 Frame = +1

Query  712   PKLEHDESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG  888
             P L H+ S  +  +N+ K L D +   A+  ++ E  L   + KK+  + E+  L E + 
Sbjct  651   PSLYHENSLIEFFLNYDKELFDSICKLAERIQKVESHLNNSNEKKAETEQEMVKLLEKVE  710

Query  889   LS--SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
                 S  +   T++ +M +I  M +S  ++ C L    S   +  + F ++++ VVAL+G
Sbjct  711   PYQLSIMDSSFTKDELMTKIRSMENSPYSVLCSL----SKREKPPNYFLEDLIGVVALIG  766

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSI  1236
               +  ELSRILAEYLGE +ML ++  +   ASS+      G +    AL   A  LG +I
Sbjct  767   TVQRPELSRILAEYLGEAKMLGLIYRSFDTASSLEKYNQKGEIDYERALHAEAAALGKAI  826

Query  1237  NGGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             +  + +IC  DIRPYTG L    QRRLA+  P + NGE+P GF+GYAVNM+ +    LQ 
Sbjct  827   SNRFHVICFEDIRPYTGWLHDDSQRRLALPNPRIANGETPEGFIGYAVNMVDLDINSLQI  886

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
              TAS  GLRET+ + L  +LQVY  R+ M  A +C  +  AVSLDG I+  NG+ +  +G
Sbjct  887   MTASDFGLRETVLFNLFKKLQVYNTRENMVAARTCIEDG-AVSLDGGILSENGILSLGYG  945

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIE  1725
             +P I FP    E Q  L      +L  ++ KK  LR ++  I+
Sbjct  946   NPSICFPC---ENQKVLPREIEKILPQMEGKKSDLRMIEERIK  985



>ref|XP_006429696.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 gb|ESR42936.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
Length=367

 Score =   182 bits (463),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 186/352 (53%), Gaps = 23/352 (7%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGL-----------SSSQNCCCTQESIMEQISG  948
             +Q E  +++L S+   +   I +L+ ++G            S+ QN    +E    QI  
Sbjct  7     KQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHSNHQN----EEETTGQILQ  62

Query  949   MGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLA  1128
                SAA + C+L +T   +   H  F K++L +VA LG  E   LS +L+EYLG   MLA
Sbjct  63    HEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLEDENLSSLLSEYLGVDTMLA  121

Query  1129  VVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG  1302
             +VC       ++      G++  +  L  L  ++G +I+G + +ICL ++RP+ GE  + 
Sbjct  122   IVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRFLVICLENLRPFAGEFVVD  181

Query  1303  -PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQ  1479
              PQRRL + KP LP GE PPGFLGYAVNMI+I +K+L   TASGHGLRETLFY L   LQ
Sbjct  182   DPQRRLDLWKPRLPTGECPPGFLGYAVNMINIDSKNLFCATASGHGLRETLFYNLFYRLQ  241

Query  1480  VYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMFPVFSKEQQMNLMTV  1656
             VY  R  M +A    ++  A+SLDG I+R +GV +  +  D  + FP  S    M  +  
Sbjct  242   VYRTRADMLLALPLISDG-AISLDGGIIRSSGVFSLGSRQDVDVRFPKSSGTSDM--LAK  298

Query  1657  NPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQGSSS  1812
                    ++  K +L  +Q D++ E+   +   + F   +  +V     SSS
Sbjct  299   YAATEKQIQEMKFRLETLQEDLKREQALLKNAKDTFERKKQEFVKFLADSSS  350



>ref|XP_008437605.1| PREDICTED: uncharacterized protein LOC103482966 [Cucumis melo]
Length=424

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/394 (34%), Positives = 208/394 (53%), Gaps = 40/394 (10%)
 Frame = +1

Query  739   ADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--------  891
             A++I N+ K LE+++  +    +Q E  ++ L ++K+ +   I +L+  +G         
Sbjct  39    AEYIFNYSKKLEEDLHMFGMKIKQHEDNIKFLKTQKNKLDESILDLQVILGKYHSSGTPV  98

Query  892   ------SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVA  1053
                   S SQN     E  MEQI     SAA+I CKL  T       +    K++L +VA
Sbjct  99    GENEVHSHSQN----DEETMEQIMRQEKSAASIICKL-STHHGLQAYNLMLTKDVLGIVA  153

Query  1054  LLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLG  1227
              LG  +   LSR+L+EYLG + MLA+VC  +     +      G ++ +  L  L  ++G
Sbjct  154   RLGKVDDDNLSRLLSEYLGMETMLAIVCRTYEGVKVLETYDKEGCINKSLGLHGLGASIG  213

Query  1228  TSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAK  1404
              +++G + +ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI+I + 
Sbjct  214   RNLDGRFLVICLEHLRPYAGDFIANDPQRRLDLLKPRLPNGECPPGFLGFAVNMINIDST  273

Query  1405  HLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTT  1584
             HL    A+G+GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG +++  GV  
Sbjct  274   HLFCLAANGYGLRETLFYSLFSRLQVYKTRADMLQALPCISDG-AVSLDGGMIKATGV--  330

Query  1585  HAFG---DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQL----REVQNDIENERMA  1740
                G   D  + FP  S +  +    +  +  +  LK+KK ++    R  Q  ++N ++ 
Sbjct  331   FCLGNQEDVQLRFPKASMKSSLPENYIESERQIKELKWKKEKMIEDIRREQALLDNTKVN  390

Query  1741  YEEINNKFIGFRDAYVNLTQGSSSVQNTYS*ARP  1842
             ++    +F+ F      LT+ SS        A+P
Sbjct  391   FDRKKAEFLKF------LTESSSYAAQQQLSAKP  418



>ref|XP_009774640.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Nicotiana sylvestris]
Length=440

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 121/360 (34%), Positives = 197/360 (55%), Gaps = 20/360 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQNCCCTQ  921
             I N K L+D +       +  E  ++ L ++K+ +   I + + ++G   S+S+     +
Sbjct  59    ICNSKKLQDAMQEIGLKIKHHEDNIKFLKAQKNILDDSILDTQVALGRYQSASEPGSENK  118

Query  922   ES--------IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
             ES        I+E+I     SAA I C+L +T       H    K+++ +VALLG  +  
Sbjct  119   ESSNRRNEEEIIERILKHDKSAAGIYCQL-KTHHGPQVTHLPLLKDVMGIVALLGKVDDD  177

Query  1078  ELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L++YLG + MLAVVC       ++      G+++ +  L  L  ++G +++  + 
Sbjct  178   NLSRLLSDYLGLETMLAVVCKTPDGIKALETYDKEGFINKSSGLYALGASIGRALDARFL  237

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL ++RPY G  ++  PQRRLA++KP LPNGE+PPGFLG+AVNMI+I + +L   T++
Sbjct  238   VICLGNLRPYEGAFIADDPQRRLALMKPRLPNGETPPGFLGFAVNMINIDSANLYCATST  297

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             GHGLRETLFY+L   LQVY  R  M  A +   +  A+SLDG I++ NGV      +  +
Sbjct  298   GHGLRETLFYKLFSRLQVYKTRTEMLQALTVITHG-AISLDGGIIKSNGVFALGNSEVEV  356

Query  1609  MFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
              FP  S    +     + +  L  LK+K+ +    L   Q  +++ +  +E    +F+ F
Sbjct  357   KFPKSSGRSNLPENYFDTESRLKELKWKRDRFLEDLHREQTLLDHAKFNFEIKKQEFVKF  416



>gb|KHN14095.1| hypothetical protein glysoja_033322 [Glycine soja]
Length=1131

 Score =   192 bits (487),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 187/343 (55%), Gaps = 13/343 (4%)
 Frame = +1

Query  712   PKLEHDESEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG  888
             P L H+ S  +  +N+ K L D +   A+  ++ E  L   + KK+  + E+  L E + 
Sbjct  746   PSLYHENSLIEFFLNYDKELFDSICKLAERIQKVESHLNNSNEKKAETEQEMVKLLEKVE  805

Query  889   LS--SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
                 S  +   T++ +M +I  M +S  ++ C L    S   +  + F ++++ VVAL+G
Sbjct  806   PYQLSIMDSSFTKDELMTKIRSMENSPYSVLCSL----SKREKPPNYFLEDLIGVVALIG  861

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSI  1236
               +  ELSRILAEYLGE +ML ++  +   ASS+      G +    AL   A  LG +I
Sbjct  862   TVQRPELSRILAEYLGEAKMLGLIYRSFDTASSLEKYNQKGEIDYERALHAEAAALGKAI  921

Query  1237  NGGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             +  + +IC  DIRPYTG L    QRRLA+  P + NGE+P GF+GYAVNM+ +    LQ 
Sbjct  922   SNRFHVICFEDIRPYTGWLHDDSQRRLALPNPRIANGETPEGFIGYAVNMVDLDINSLQI  981

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
              TAS  GLRET+ + L  +LQVY  R+ M  A +C  +  AVSLDG I+  NG+ +  +G
Sbjct  982   MTASDFGLRETVLFNLFKKLQVYNTRENMVAARTCIEDG-AVSLDGGILSENGILSLGYG  1040

Query  1597  DPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIE  1725
             +P I FP    E Q  L      +L  ++ KK  LR ++  I+
Sbjct  1041  NPSICFPC---ENQKVLPREIEKILPQMEGKKSDLRMIEERIK  1080



>ref|XP_010267598.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Nelumbo nucifera]
Length=397

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 197/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ------  903
             I   K L+D+V       +  E  L+ L +  +++   I +++ S+G   SSS+      
Sbjct  16    IDKSKKLQDDVQKLGLKIKHHEENLKFLKAVTNDLDESILDIQVSLGKYHSSSEAKIETE  75

Query  904   --NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
               N   T+E  +EQI     SAA I C+L     +    +    K++L +VA LG  ++ 
Sbjct  76    NLNHFQTEEDTIEQILRQEKSAAGILCQLKMRHGTQAS-YLPLTKDVLGIVATLGKVDND  134

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L+EYLG + M+A+VC  +    ++      G ++ +  L  L  ++G  ++G + 
Sbjct  135   NLSRLLSEYLGLETMMAIVCMTYEGVKTLEMCDKEGRINKSAGLHGLGPSIGRPMDGRFL  194

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL  +RPY G+ ++  PQR+LA++KP LPNG+ PPGF+G+AVNMI + + +L   TAS
Sbjct  195   VICLEGLRPYAGDFVADDPQRKLALLKPRLPNGDVPPGFIGFAVNMITVDSMNLSCLTAS  254

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPF  1605
             GHGLRETLFY L   LQVY  R  M +A+ C ++  A+SLDG ++R  G+ +     D  
Sbjct  255   GHGLRETLFYSLFSRLQVYRTRADMLLATPCISDG-AISLDGGMIRSTGIFSLGERKDIK  313

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE-------RMAYEEINNKF  1764
             + FP+       NL     D+ + +K  K +   +  D++ E       ++ Y+E   +F
Sbjct  314   VRFPISCTTS--NLPANYIDMEDRIKEMKWEKERILEDMQREQALLDHVKINYKEKKQEF  371

Query  1765  IGF  1773
             + F
Sbjct  372   LRF  374



>ref|XP_006376654.1| hypothetical protein POPTR_0012s02300g [Populus trichocarpa]
 gb|ERP54451.1| hypothetical protein POPTR_0012s02300g [Populus trichocarpa]
Length=417

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 194/368 (53%), Gaps = 35/368 (10%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ------  903
             I N K L+D++       +  E  +++L S K  +   I +L+ ++G   SS+Q      
Sbjct  43    IYNSKKLQDDLHVLGMKIKHHEDNIKLLKSHKYKLDDSILDLQVTLGKYHSSTQPNTEND  102

Query  904   --NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE-------FAKEILVVVAL  1056
               +   ++E   +QI     SAA I C+L        ++HH+         K++L VVA 
Sbjct  103   AHSSNPSEEETTKQILRHEKSAAGILCQL--------KMHHDTQTSHLSLTKDVLGVVAT  154

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGT  1230
             LG  +   LSR+ +EY+G + MLA+VC  +    ++      G ++       +  ++G 
Sbjct  155   LGKVDDDNLSRLFSEYVGVETMLAIVCKTYEGVKALETYDKDGQINKGSGFHAVGASIGK  214

Query  1231  SINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
              ++G + +ICL ++RPY GE  +  PQRRL ++KP LPNGE PPGF+G+AVNMI++   +
Sbjct  215   ELDGRFLVICLENLRPYCGEFMVDDPQRRLDLLKPKLPNGECPPGFIGFAVNMINVEFTN  274

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L   T SGHGLRETLFY L   +QVY  R+ M  +  C ++  A+SLDG +++G GV + 
Sbjct  275   LFLLTGSGHGLRETLFYNLFSHVQVYKTREDMAFSLPCISDG-AISLDGGMIKGAGVFSL  333

Query  1588  A-FGDPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQND---IENERMAYEE  1749
                 D  + FP  S    +  N +  N  +  +   ++  L +++ +   ++  R ++E 
Sbjct  334   GNRNDVDVRFPKSSVTSTLPDNYIDTNKHLKEMKWKRETMLEDIKREQALLDTARQSFER  393

Query  1750  INNKFIGF  1773
                +F+ F
Sbjct  394   KKEEFVKF  401



>ref|XP_011084512.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Sesamum 
indicum]
Length=442

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/385 (32%), Positives = 206/385 (54%), Gaps = 31/385 (8%)
 Frame = +1

Query  700   PYKAPKLE-----HDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEI  864
             PY  P+ +     H++       N K L+D++    +  +  E  ++ L + K+ ++  I
Sbjct  42    PYMVPRQDMQNGAHNQQAESISNNSKKLQDDLHELGEKIKHHEDNVKYLKTLKNKLEESI  101

Query  865   FNLEESIG----------LSSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVEL  1014
               ++ ++G          ++       ++E  ++ I    +SAAA+  ++ ++ + ++  
Sbjct  102   LEMQVALGKYDKASFSRTVNKDPALVKSEEETIDHILKHENSAAALLSRM-KSQAEALSS  160

Query  1015  HHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLS  1188
              H   K+++ +VA LG  +   LSR+ +E+LG + MLAVVC  +    ++ A    G + 
Sbjct  161   DHSLTKDVIGIVATLGKVDDDNLSRLFSEHLGLETMLAVVCKTYEGVKALEAYNKEGSID  220

Query  1189  SADALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGF  1365
                 L   A ++G  +   + +ICL DIRPY+GE+ +  PQRRL ++KP L NGE PPGF
Sbjct  221   KNSGLHAFAASIGRPLADRFLVICLEDIRPYSGEIIADDPQRRLTLLKPRLLNGEHPPGF  280

Query  1366  LGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVS  1545
             LG+AVNMI I + +L   + +GH LRETLFY L  +LQVY +R+ M  A SC  N  A+S
Sbjct  281   LGFAVNMITIDSTNLYCFSKNGHSLRETLFYHLFSDLQVYKSREDMLNALSCIRNG-AIS  339

Query  1546  LDGVIMRGNGVTT--HAFGDPFIMFPVFSKEQQMNLMTVNPDV---LNLLKYKKVQ----  1698
             LDG ++R  GV +  H  GD  + FP  S  Q++NL      +   L  +K+KK +    
Sbjct  340   LDGGMIRSRGVFSLGHHQGDIDVKFPTTS--QKLNLPESYFGIEVGLKEMKWKKDRTMED  397

Query  1699  LREVQNDIENERMAYEEINNKFIGF  1773
             ++  Q  + + R+ YE    +F+ F
Sbjct  398   MQREQALLAHARVNYETKKREFLQF  422



>ref|XP_010267596.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010267597.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Nelumbo nucifera]
Length=424

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 197/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ------  903
             I   K L+D+V       +  E  L+ L +  +++   I +++ S+G   SSS+      
Sbjct  43    IDKSKKLQDDVQKLGLKIKHHEENLKFLKAVTNDLDESILDIQVSLGKYHSSSEAKIETE  102

Query  904   --NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
               N   T+E  +EQI     SAA I C+L     +    +    K++L +VA LG  ++ 
Sbjct  103   NLNHFQTEEDTIEQILRQEKSAAGILCQLKMRHGTQAS-YLPLTKDVLGIVATLGKVDND  161

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L+EYLG + M+A+VC  +    ++      G ++ +  L  L  ++G  ++G + 
Sbjct  162   NLSRLLSEYLGLETMMAIVCMTYEGVKTLEMCDKEGRINKSAGLHGLGPSIGRPMDGRFL  221

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL  +RPY G+ ++  PQR+LA++KP LPNG+ PPGF+G+AVNMI + + +L   TAS
Sbjct  222   VICLEGLRPYAGDFVADDPQRKLALLKPRLPNGDVPPGFIGFAVNMITVDSMNLSCLTAS  281

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPF  1605
             GHGLRETLFY L   LQVY  R  M +A+ C ++  A+SLDG ++R  G+ +     D  
Sbjct  282   GHGLRETLFYSLFSRLQVYRTRADMLLATPCISDG-AISLDGGMIRSTGIFSLGERKDIK  340

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENE-------RMAYEEINNKF  1764
             + FP+       NL     D+ + +K  K +   +  D++ E       ++ Y+E   +F
Sbjct  341   VRFPISCTTS--NLPANYIDMEDRIKEMKWEKERILEDMQREQALLDHVKINYKEKKQEF  398

Query  1765  IGF  1773
             + F
Sbjct  399   LRF  401



>gb|KDP38261.1| hypothetical protein JCGZ_05795 [Jatropha curcas]
Length=425

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/371 (34%), Positives = 196/371 (53%), Gaps = 41/371 (11%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL------------  891
             I + K L+D++       +Q E  ++ L ++KS ++  I +L+  +G             
Sbjct  44    ICSSKKLQDDLHMLGLKIKQHEDNIKFLKNQKSKLEDSILDLQVILGKYHSATPPNTEND  103

Query  892   --SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGF  1065
               SSSQ    ++E   EQI     SAA I C+L     ++   H    K++L +VA LG 
Sbjct  104   QHSSSQ----SEEETTEQILRHEKSAAGILCQLRLRHGTNAS-HLALTKDVLGIVATLGK  158

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAHA--SSVGASKMHGYLSSADALSTLANNLGTSIN  1239
              +   LSR+L+EYLG   MLA+VC  +   +++ A    G +++   L  L  + G +++
Sbjct  159   VDDDNLSRLLSEYLGVDIMLAIVCKTYEGIAALEAYGKEGQINNDSGLHGLGASTGRALD  218

Query  1240  GGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G + +ICL  +RP+ GE ++  PQRRL ++KP LPNGE PPGF+G+AVNMI +   +L Y
Sbjct  219   GRFLVICLEHLRPFCGEFVTDDPQRRLDLLKPKLPNGECPPGFIGFAVNMIDVDCTNLFY  278

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA-F  1593
              T+SGHGLRETLFY L   LQVY +R+ M +A  C ++  A+SLDG +++  G  +    
Sbjct  279   VTSSGHGLRETLFYSLFSRLQVYKSREEMLLALPCISDG-AISLDGGMIKATGFFSLGNR  337

Query  1594  GDPFIMFPVFSKEQQMNLMTVNPD----VLNLLKYKKVQLREVQNDIENE-------RMA  1740
              D  + FP  S   Q+      PD        LK  K Q  ++  D + E       ++ 
Sbjct  338   NDVDVRFPKSSLASQL------PDNYRETEKQLKEMKWQKDKMMEDFKREQALLNAAKLN  391

Query  1741  YEEINNKFIGF  1773
             +E    +F+ F
Sbjct  392   FERKKEEFVKF  402



>ref|XP_002318428.2| hypothetical protein POPTR_0012s02300g [Populus trichocarpa]
 gb|EEE96648.2| hypothetical protein POPTR_0012s02300g [Populus trichocarpa]
Length=419

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 194/368 (53%), Gaps = 35/368 (10%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ------  903
             I N K L+D++       +  E  +++L S K  +   I +L+ ++G   SS+Q      
Sbjct  43    IYNSKKLQDDLHVLGMKIKHHEDNIKLLKSHKYKLDDSILDLQVTLGKYHSSTQPNTEND  102

Query  904   --NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE-------FAKEILVVVAL  1056
               +   ++E   +QI     SAA I C+L        ++HH+         K++L VVA 
Sbjct  103   AHSSNPSEEETTKQILRHEKSAAGILCQL--------KMHHDTQTSHLSLTKDVLGVVAT  154

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGT  1230
             LG  +   LSR+ +EY+G + MLA+VC  +    ++      G ++       +  ++G 
Sbjct  155   LGKVDDDNLSRLFSEYVGVETMLAIVCKTYEGVKALETYDKDGQINKGSGFHAVGASIGK  214

Query  1231  SINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
              ++G + +ICL ++RPY GE  +  PQRRL ++KP LPNGE PPGF+G+AVNMI++   +
Sbjct  215   ELDGRFLVICLENLRPYCGEFMVDDPQRRLDLLKPKLPNGECPPGFIGFAVNMINVEFTN  274

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L   T SGHGLRETLFY L   +QVY  R+ M  +  C ++  A+SLDG +++G GV + 
Sbjct  275   LFLLTGSGHGLRETLFYNLFSHVQVYKTREDMAFSLPCISDG-AISLDGGMIKGAGVFSL  333

Query  1588  A-FGDPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQND---IENERMAYEE  1749
                 D  + FP  S    +  N +  N  +  +   ++  L +++ +   ++  R ++E 
Sbjct  334   GNRNDVDVRFPKSSVTSTLPDNYIDTNKHLKEMKWKRETMLEDIKREQALLDTARQSFER  393

Query  1750  INNKFIGF  1773
                +F+ F
Sbjct  394   KKEEFVKF  401



>ref|XP_009357310.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Pyrus 
x bretschneideri]
Length=432

 Score =   183 bits (465),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 196/370 (53%), Gaps = 28/370 (8%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+ + K L+D++       +Q E  L++L S+K  +   I +L+  +G   S + 
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNLKLLKSQKHKLDDSILDLQVILGKYHSSST  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E   E+I     SAA I  +L     + V L     K+++ +V +L
Sbjct  105   PKIEDDDHSRRKSEEETTEKILQREKSAAGILWQLKTRHGTQVALFPPI-KDVVGIVGML  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + MLA+VC  +    ++   +  GY+     L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLAIVCKTYEGVKALEVYENEGYVKKTAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL ++RPY G  +   PQ RL ++KP L NGE PPGFLGYAVNMI++ + +L
Sbjct  224   LEGRFQVICLENLRPYAGASVPDDPQMRLDLLKPRLANGECPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG I+R  GV   +
Sbjct  284   YCLTANGHGLRATLFYNLFGRLQVYKTRADMVPALPCISDG-AISLDGGIIRSTGV--FS  340

Query  1591  FG---DPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLRE----VQNDIENERMAY  1743
              G   D  + FP  S    +  N +     + N LK+KK +++E     Q  ++N +  +
Sbjct  341   LGNREDVDVRFPKVSATSGLPENYLESERQI-NELKWKKDKMQEDMKREQALLDNAKFNF  399

Query  1744  EEINNKFIGF  1773
             +     F+ F
Sbjct  400   DRKKQDFLKF  409



>gb|KCW62381.1| hypothetical protein EUGRSUZ_H05027 [Eucalyptus grandis]
Length=211

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 135/207 (65%), Gaps = 7/207 (3%)
 Frame = +1

Query  958   SAAAIACKLIETPSSSVELHHEFAKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVV  1134
             SAA+I C+LI   +S  E  H  +++ I+ VVALLG   + ELSRILA+YLGE QML +V
Sbjct  8     SAASILCELIRNFAS--ERPHGGSRDGIIGVVALLGTICNIELSRILAKYLGEDQMLGIV  65

Query  1135  C--NAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGP  1305
             C  +  A S+     +G +   +A+   A  LG SI+G + +ICL +I PY GE+    P
Sbjct  66    CTNSETAFSLETYDKNGEVDLQNAVYAKAAELGKSISGEFRVICLEEISPYRGEIEGCDP  125

Query  1306  QRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVY  1485
             QR+LA   P LP+GE PPGF+GYAVNM+ I   HL  RT  G GLRETLFYRL G+LQVY
Sbjct  126   QRKLAFPHPTLPSGEIPPGFMGYAVNMVDIDFDHLATRTTEGLGLRETLFYRLFGKLQVY  185

Query  1486  ANRDCMCMASSCFNNNPAVSLDGVIMR  1566
               R+ M  AS C ++  AVSLDG I+R
Sbjct  186   DTREHMKQASVCIDHG-AVSLDGGIIR  211



>ref|XP_009368658.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Pyrus 
x bretschneideri]
Length=432

 Score =   183 bits (464),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 195/370 (53%), Gaps = 28/370 (8%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+ + K L+D++       +Q E  L++L S+K  +   I +L+  +G   S + 
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNLKLLKSQKHKLDDSILDLQVILGKYHSSST  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E   E+I     SAA I  +L     + V L     K+++ +V +L
Sbjct  105   PKIEDDDHSRRKSEEETTEKILQHEKSAAGILWQLKTRHGTQVALFPPI-KDVVGIVGML  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + MLA+VC  +    ++   +  GY+     L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLAIVCKTYEGVKALEVYEKEGYVKKTAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL  +RPY G  +   PQ RL ++KP L NGE PPGFLGYAVNMI++ + +L
Sbjct  224   LEGRFQVICLESLRPYAGASVPDDPQMRLDLLKPRLANGECPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG I+R  GV   +
Sbjct  284   YCLTANGHGLRATLFYNLFGRLQVYKTRADMVPALPCISDG-AISLDGGIIRSTGV--FS  340

Query  1591  FG---DPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLRE----VQNDIENERMAY  1743
              G   D  + FP  S    +  N +     + N LK+KK +++E     Q  ++N +  +
Sbjct  341   LGNREDVDVRFPKVSATSGLPENYLESERQI-NELKWKKDKMQEDMKREQALLDNAKFNF  399

Query  1744  EEINNKFIGF  1773
             +     F+ F
Sbjct  400   DRKKQDFLKF  409



>ref|XP_007039066.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
4 [Theobroma cacao]
 gb|EOY23567.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
4 [Theobroma cacao]
Length=1200

 Score =   191 bits (484),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 121/179 (68%), Gaps = 0/179 (0%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E++  +DGF          KVD  G I+LGG+L+VTAGYGK  SLSV
Sbjct  1003  MFDAYGNHVAEGAEVQFHLDGFVIQGHLGSKYKVDDRGCIDLGGLLEVTAGYGKSVSLSV  1062

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 K VFK+EFQ E RELRIAS +PE C+ GS LE++ FEV++S+G VDE+ HDDEK G
Sbjct  1063  LHDGKVVFKREFQTEKRELRIASVVPERCIAGSILEDLAFEVVDSQGVVDETFHDDEKHG  1122

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEV  561
             Q H L + SE  +  +++ Y+F HG C V SI LPE EG F FVA HSRYM+L L ++V
Sbjct  1123  QSHRLIVNSESFETCDSICYAFIHGCCIVTSIPLPEIEGPFCFVAFHSRYMDLYLNVKV  1181



>ref|XP_006429700.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 gb|ESR42940.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
Length=348

 Score =   180 bits (457),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 164/291 (56%), Gaps = 20/291 (7%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-----------S  894
             I N K L+D++       +Q E  +++L S+   +   I +L+ ++G            S
Sbjct  58    IYNSKRLQDDLQMIGLKIKQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHS  117

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             + QN    +E    QI     SAA + C+L +T   +   H  F K++L +VA LG  E 
Sbjct  118   NHQN----EEETTGQILQHEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLED  172

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LS +L+EYLG   MLA+VC       ++      G++  +  L  L  ++G +I+G +
Sbjct  173   ENLSSLLSEYLGVDTMLAIVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRF  232

Query  1249  DMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL ++RP+ GE  +  PQRRL + KP LP GE PPGFLGYAVNMI+I +K+L   TA
Sbjct  233   LVICLENLRPFAGEFVVDDPQRRLDLWKPRLPTGECPPGFLGYAVNMINIDSKNLFCATA  292

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             SGHGLRETLFY L   LQVY  R  M +A    ++  A+SLDG I+R +GV
Sbjct  293   SGHGLRETLFYNLFYRLQVYRTRADMLLALPLISDG-AISLDGGIIRSSGV  342



>ref|XP_010109258.1| hypothetical protein L484_011880 [Morus notabilis]
 gb|EXC21438.1| hypothetical protein L484_011880 [Morus notabilis]
Length=548

 Score =   185 bits (469),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 206/388 (53%), Gaps = 40/388 (10%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+++ K L+D++       +Q E  ++ L S+K+ +   I +L+ ++G   S + 
Sbjct  140   SQAESIIHYSKRLQDDLHMIGMKIKQHEDNIKFLKSQKNKLDDSILDLQVALGKYHSSSA  199

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E I EQI+    SAA I C+L    SS    H   AK++L +VA L
Sbjct  200   TTIENEDPSHRQSEEEIHEQITQQEKSAAGILCQLKARHSSQAS-HLTLAKDVLGIVATL  258

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGT  1230
             G      LSR+ +EYLG + MLA+VC  +   V A +++   G ++    L  L  ++G 
Sbjct  259   GKVGDDNLSRLFSEYLGMENMLAIVCKTY-EGVKALEIYDKEGCINKGSGLHGLGASIGR  317

Query  1231  SINGGYDMICLNDIR--------PYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVN  1383
             ++ G + ++CL ++R        PY G+ +   PQRRL ++KP L NGE PPGFLG+AVN
Sbjct  318   ALEGRFIVVCLENLRHESKAPPLPYAGDFVPDDPQRRLDLLKPRLANGECPPGFLGFAVN  377

Query  1384  MIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIM  1563
             MI++   +L   T+SGHGLRETLFY L   LQVY  R  M  A  C ++  A+SLDG ++
Sbjct  378   MINVDTTNLFCVTSSGHGLRETLFYFLFSRLQVYKTRAEMLNALPCISDG-ALSLDGGMI  436

Query  1564  RGNGVTTHAF-GDPFIMFPVFSKEQQMNLMTVNPDV----LNLLKYKKVQLREVQNDIEN  1728
             R  GV +     D  + FP      + +L +  P+     +  LK+KK ++ E   DI+ 
Sbjct  437   RATGVFSLGLRQDVDVRFP------KASLASSLPETYKKQIQELKWKKEKMME---DIKR  487

Query  1729  ERMAYEEINNKFIGFRDAYVNLTQGSSS  1812
             ER   +    KF   +  ++     SSS
Sbjct  488   ERALLDNAKFKFDRKKQEFLKFLAESSS  515



>ref|XP_008376714.1| PREDICTED: uncharacterized protein LOC103439867 [Malus domestica]
Length=432

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 196/368 (53%), Gaps = 24/368 (7%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+ + K L+D++       +Q E  +++L S+K  +   I +L+  +G   S + 
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQKHKLDDSILDLQVILGKYHSSST  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E   E+I     SAA I  +L     + V L     K+++ +V LL
Sbjct  105   PKIEDDDHSRRKSEEETTEKILQHEKSAAGILWQLKTRHGTQVALFPPI-KDVMGIVGLL  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + MLA+VC  +    ++   +  G +     L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLAIVCKTYEGVKALEVYENEGCIKKTAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL ++RPY G  +   PQ RL ++KP L NGE PPGFLGYAVNMI++ + +L
Sbjct  224   LEGRFQVICLENLRPYVGASVPDDPQMRLDLLKPRLANGECPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG I+R  GV +  
Sbjct  284   YCLTANGHGLRATLFYNLFGRLQVYKTRADMVPALPCISDG-AISLDGGIIRSTGVFSLG  342

Query  1591  -FGDPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLRE----VQNDIENERMAYEE  1749
              + D  + FP  S    +  N +     + N LK+KK +++E     Q+ ++N +  ++ 
Sbjct  343   NWEDVDVRFPKVSATSGLPENYLESERQI-NELKWKKDKMQEDMKREQSLLDNAKFNFDR  401

Query  1750  INNKFIGF  1773
                 F+ F
Sbjct  402   KKQDFLQF  409



>ref|XP_011024835.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 [Populus 
euphratica]
Length=420

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 196/374 (52%), Gaps = 47/374 (13%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG------LSSSQNC  909
             I N K L+D++       +  E  +++L   K+ +   I +L+ ++G      L +++N 
Sbjct  44    IYNSKKLQDDLHVLGMKIKHHEDNIKLLKIHKNKLDDSILDLQVTLGKYHSSTLPNTEND  103

Query  910   C----CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE-------FAKEILVVVAL  1056
                   ++E   +QI     SAA I C+L        ++HH+         K++L VVA 
Sbjct  104   AHSSNPSEEETTKQILQHEKSAAGILCQL--------KMHHDTQTSHLSLTKDVLGVVAT  155

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGT  1230
             LG  +   LSR+ +EYLG + MLA+VC  +    ++      G ++       L  ++G 
Sbjct  156   LGKVDDDNLSRLFSEYLGAETMLAIVCKTYEGVKALETYDKDGQINKGSGFHALGASIGK  215

Query  1231  SINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
              ++G + +ICL ++RP+ GE  +  PQRRL ++KP LPNGE PPGF+G+AVNMI++   +
Sbjct  216   ELDGRFLVICLENLRPFCGEFMVDDPQRRLDLLKPKLPNGECPPGFIGFAVNMINVEFTN  275

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L   T SGHGLRETLFY L   +QVY  R+ M  +  C  +  A+SLDG +++G GV + 
Sbjct  276   LFLLTGSGHGLRETLFYNLFSHMQVYKTREDMVFSLPCICDG-AISLDGGMIKGAGVFSL  334

Query  1588  A-FGDPFIMFPVFSKEQQMNLMTVNPDV-------LNLLKYKK-VQLREVQND---IENE  1731
               + D  + FP      +  + +  PD        L  +K+K+   L +++ +   ++  
Sbjct  335   GNWNDVDVRFP------KSYVTSTLPDNYIDTKKHLKEMKWKRETMLEDIKREQALLDTA  388

Query  1732  RMAYEEINNKFIGF  1773
             R ++E    +F+ F
Sbjct  389   RQSFERKKEEFVKF  402



>ref|XP_009150155.1| PREDICTED: uncharacterized protein LOC103873495 [Brassica rapa]
Length=405

 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/346 (36%), Positives = 176/346 (51%), Gaps = 18/346 (5%)
 Frame = +1

Query  811   EIELQILDSKKSNIQTEIFNLEESI------GLSSSQNC--CCTQESIMEQISGMGDSAA  966
             E  L+ L ++K+ +   I +L+  +      G   S+NC      E I EQI    +SAA
Sbjct  63    EDSLKFLKAQKTKLDESILDLQVHMNKLNPSGTPRSENCDGNLQGEDINEQILRHANSAA  122

Query  967   AIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             A+   +    S  V L     K ++ VVA LG      LS++L++YLG + MLA+VC  +
Sbjct  123   AVLTHVQSRHSPQVTL----TKGVVGVVAKLGKVHDENLSQVLSDYLGTRSMLALVCKDY  178

Query  1147  ASSVG--ASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRL  1317
              S  G  +    G +     L  L +++G +I G +D I L ++RPY G+   G PQRRL
Sbjct  179   DSVKGLESYDSQGNVDRNAGLHGLGSSIGRTIEGHFDAISLENLRPYVGQFIAGDPQRRL  238

Query  1318  AIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRD  1497
              ++KP LPNGE PPGFLG+AVNMI I   +L   TA GHGLRETLFY L   LQVY  R 
Sbjct  239   NLLKPKLPNGEYPPGFLGFAVNMIQIDPAYLLCVTAYGHGLRETLFYSLFSRLQVYKTRA  298

Query  1498  CMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNL  1677
              M  A  C +   AVSLDG I+R  G+ T    D   +   F+K      M  + +    
Sbjct  299   DMISALPCISEG-AVSLDGGIVRTGGILTLGSSDEVKL--RFAKPNASRAMDNHSEAERQ  355

Query  1678  LKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQGSSSV  1815
             +K  K +  +   DI+  ++  +     F   +D +V     SSS 
Sbjct  356   MKELKQKKEKTLEDIKRTQVLRDHAVYNFGKKKDEFVRFLAQSSST  401



>ref|XP_010267600.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X4 [Nelumbo nucifera]
Length=348

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 168/290 (58%), Gaps = 15/290 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ------  903
             I   K L+D+V       +  E  L+ L +  +++   I +++ S+G   SSS+      
Sbjct  43    IDKSKKLQDDVQKLGLKIKHHEENLKFLKAVTNDLDESILDIQVSLGKYHSSSEAKIETE  102

Query  904   --NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
               N   T+E  +EQI     SAA I C+L     +    +    K++L +VA LG  ++ 
Sbjct  103   NLNHFQTEEDTIEQILRQEKSAAGILCQLKMRHGTQAS-YLPLTKDVLGIVATLGKVDND  161

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L+EYLG + M+A+VC  +    ++      G ++ +  L  L  ++G  ++G + 
Sbjct  162   NLSRLLSEYLGLETMMAIVCMTYEGVKTLEMCDKEGRINKSAGLHGLGPSIGRPMDGRFL  221

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL  +RPY G+ ++  PQR+LA++KP LPNG+ PPGF+G+AVNMI + + +L   TAS
Sbjct  222   VICLEGLRPYAGDFVADDPQRKLALLKPRLPNGDVPPGFIGFAVNMITVDSMNLSCLTAS  281

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             GHGLRETLFY L   LQVY  R  M +A+ C ++  A+SLDG ++R  G+
Sbjct  282   GHGLRETLFYSLFSRLQVYRTRADMLLATPCISDG-AISLDGGMIRSTGI  330



>ref|XP_010027405.1| PREDICTED: uncharacterized protein LOC104417907 [Eucalyptus grandis]
Length=411

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 206/398 (52%), Gaps = 51/398 (13%)
 Frame = +1

Query  193   SLSVFSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDD  372
             SLSV +G + +FK+E Q E RELR+A  +P+ C  GS LEN +FE++++EG +DE+IH+D
Sbjct  27    SLSVTTGGEEIFKEELQTEKRELRVAEPVPQLCAAGSQLENFVFEIVDTEGNLDENIHND  86

Query  373   EKSGQPHTLTIK--SELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQ  546
             E++G  HTL+IK  S + KI  T  Y+F  GRCT+ S+T+P D G F F AVHSR+ EL 
Sbjct  87    EENGHFHTLSIKLDSSVTKI--TTLYAFRKGRCTIPSLTVPRDAGCFSFSAVHSRHRELS  144

Query  547   LRIEVNTKKAVEADSGYFQSQSPERQIL---NKEVEN-------------------FQYR  660
             L I++  + + +      Q+  P   I+   +K   N                     Y 
Sbjct  145   LSIKIGIQPSSDLQH-EIQTLCPNTNIMMLQDKSTPNNIGNVLSIIKNESKLMPIILTYL  203

Query  661   SAQKQIFPYENSSPY----KAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQI  828
               Q  +  Y   S       A  +EH E         ++LE+         R     L++
Sbjct  204   YGQLCLVTYNYCSSLVLEETALCIEHRE---------RVLEETGSRIEHRERV----LKL  250

Query  829   LDSKKSNIQTEIFNLEESIGLSSSQ--NCCCTQESIMEQISGMGDSAAAIACKLIETPSS  1002
             L  +K  I+  +  L    G S     +C   +E + + I     SAA++ C+LI   +S
Sbjct  251   LHDRKVEIEQSLVELGVYAGPSPLNIVDCFFAKEEMTDMIENRDGSAASVLCELIRNFAS  310

Query  1003  SVELHHEFAKE-ILVVVALLGFAESYELSRILAEYLGEKQMLAVVC--NAHASSVGASKM  1173
               E  H  +++ I+ VVALLG   + ELSRILA+YLGE QML +VC  +  A S+     
Sbjct  311   --ERPHGGSRDGIIGVVALLGTICNIELSRILAKYLGEDQMLGIVCTNSETAFSLETYDK  368

Query  1174  HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTG  1287
             +G +   +A+   A  LG SI+G + +ICL +I+  +G
Sbjct  369   NGEVDLQNAVYAKAAELGKSISGEFRVICLEEIKYISG  406



>ref|XP_010267599.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X3 [Nelumbo nucifera]
Length=355

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 167/286 (58%), Gaps = 15/286 (5%)
 Frame = +1

Query  760   KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQ--------NC  909
             K L+D+V       +  E  L+ L +  +++   I +++ S+G   SSS+        N 
Sbjct  47    KKLQDDVQKLGLKIKHHEENLKFLKAVTNDLDESILDIQVSLGKYHSSSEAKIETENLNH  106

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
               T+E  +EQI     SAA I C+L     +    +    K++L +VA LG  ++  LSR
Sbjct  107   FQTEEDTIEQILRQEKSAAGILCQLKMRHGTQAS-YLPLTKDVLGIVATLGKVDNDNLSR  165

Query  1090  ILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L+EYLG + M+A+VC  +    ++      G ++ +  L  L  ++G  ++G + +ICL
Sbjct  166   LLSEYLGLETMMAIVCMTYEGVKTLEMCDKEGRINKSAGLHGLGPSIGRPMDGRFLVICL  225

Query  1264  NDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
               +RPY G+ ++  PQR+LA++KP LPNG+ PPGF+G+AVNMI + + +L   TASGHGL
Sbjct  226   EGLRPYAGDFVADDPQRKLALLKPRLPNGDVPPGFIGFAVNMITVDSMNLSCLTASGHGL  285

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             RETLFY L   LQVY  R  M +A+ C ++  A+SLDG ++R  G+
Sbjct  286   RETLFYSLFSRLQVYRTRADMLLATPCISDG-AISLDGGMIRSTGI  330



>ref|XP_006481301.1| PREDICTED: uncharacterized protein LOC102607162 isoform X1 [Citrus 
sinensis]
 ref|XP_006481302.1| PREDICTED: uncharacterized protein LOC102607162 isoform X2 [Citrus 
sinensis]
Length=348

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 163/291 (56%), Gaps = 20/291 (7%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-----------S  894
             I   K L+D++       +Q E  +++L S+   +   I +L+ ++G            S
Sbjct  58    IYTSKRLQDDLQMIGLKIKQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHS  117

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             + QN    +E    QI     SAA + C+L +T   +   H  F K++L +VA LG  E 
Sbjct  118   NHQN----EEETTGQILQHEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLED  172

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LS +L+EYLG   MLA+VC       ++      G++  +  L  L  ++G +I+G +
Sbjct  173   ENLSSLLSEYLGVDTMLAIVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRF  232

Query  1249  DMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              +ICL ++RP+ GE  +  PQRRL + KP LP GE PPGFLGYAVNMI+I +K+L   TA
Sbjct  233   LVICLENLRPFAGEFVVDDPQRRLDLWKPRLPTGECPPGFLGYAVNMINIDSKNLFCATA  292

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             SGHGLRETLFY L   LQVY  R  M +A    ++  A+SLDG I+R +GV
Sbjct  293   SGHGLRETLFYNLFYRLQVYRTRADMLLALPLISDG-AISLDGGIIRSSGV  342



>emb|CDY00194.1| BnaA06g20950D [Brassica napus]
Length=404

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/346 (36%), Positives = 176/346 (51%), Gaps = 18/346 (5%)
 Frame = +1

Query  811   EIELQILDSKKSNIQTEIFNLEESI------GLSSSQNC--CCTQESIMEQISGMGDSAA  966
             E  L+ L ++K+ +   I +L+  +      G   S+NC      E I EQI    +SAA
Sbjct  63    EDSLKFLKAQKTKLDESILDLQVHMNKLNPSGTPRSENCDGNLQGEDINEQILRHANSAA  122

Query  967   AIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             A+   +    S  V L     K ++ VVA LG      LS++L++YLG + MLA+VC  +
Sbjct  123   AVLTHVQSRHSPQVTL----TKGVVGVVAKLGKVHDENLSQVLSDYLGTRSMLALVCKDY  178

Query  1147  ASSVG--ASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRL  1317
              S  G  +    G +     L  L +++G +I G +D I L ++RPY G+   G PQRRL
Sbjct  179   DSVKGLESYDSQGNVDRNAGLHGLGSSIGRTIEGHFDAISLENLRPYVGQFIAGDPQRRL  238

Query  1318  AIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRD  1497
              ++KP LPNGE PPGFLG+AVNMI I   +L   TA GHGLRETLFY L   LQVY  R 
Sbjct  239   NLLKPKLPNGEYPPGFLGFAVNMIQIDPAYLLCVTAYGHGLRETLFYSLFSRLQVYKTRA  298

Query  1498  CMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNL  1677
              M  A  C +   AVSLDG I+R  G+ T    D   +   F+K      M  + +    
Sbjct  299   DMISALPCISEG-AVSLDGGIVRTGGILTLGSSDEVKV--RFAKPNASRAMDNHSEAERQ  355

Query  1678  LKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQGSSSV  1815
             +K  K +  +   DI+  ++  +     F   +D +V     SSS 
Sbjct  356   MKELKQKKEKTLEDIKRTQVLRDHAVYNFGKKKDEFVRFLAQSSST  401



>ref|XP_010068987.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 [Eucalyptus 
grandis]
Length=433

 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 126/371 (34%), Positives = 197/371 (53%), Gaps = 33/371 (9%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-------  891
             +AD ++N  K L+D++       +Q E  ++ L ++K+ +   I +    +G        
Sbjct  50    QADTLMNSSKRLQDDLQSLGLKIKQHEDNIKSLKTQKNTLDDSILDKRVILGKYHSSAPP  109

Query  892   SSSQNCCCT--QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGF  1065
             S+  N   +  +E   EQI     SAA I C+L  +  +   +    +K+++ +VA LG 
Sbjct  110   SAEDNSLSSGGEEETTEQILKRDKSAAGIWCQLKNSRGTQAPIL-ALSKDVIGIVATLGK  168

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSIN  1239
              +   LSR+L+EYLG   ML++VC       ++      G +  +  L  L++++G  +N
Sbjct  169   VDDENLSRLLSEYLGADAMLSIVCKTREGMKALETYDTDGSIDMSAGLHGLSSSIGRDLN  228

Query  1240  GGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G + +ICL D+RPY G+ + +  QRRL + KP LP+GE PPGFLG+AVNM++I A HL  
Sbjct  229   GRFLVICLEDLRPYIGDFVDVDGQRRLDLFKPRLPSGECPPGFLGFAVNMVNIDATHLFC  288

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
              T SGHGLRETLFY L    QVY+ R  M  A    +   A+SLDG I+RG G+  +  G
Sbjct  289   LTPSGHGLRETLFYHLFSRTQVYSTRADMLRALPLISGG-AISLDGGIIRGPGM--YFLG  345

Query  1597  ---DPFIMFPVFS--KEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENER-------MA  1740
                D  + FPV S    +  N   V  + +  L++K+ +L E   D++ ER       M 
Sbjct  346   KREDVDVRFPVPSGASSRPANYHEVE-NQMKDLRWKREKLLE---DLQRERQMLDHAKMN  401

Query  1741  YEEINNKFIGF  1773
             +E    +F+ F
Sbjct  402   FERKKQEFVMF  412



>gb|KEH24681.1| defective in meristem silencing protein [Medicago truncatula]
Length=397

 Score =   179 bits (453),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 192/361 (53%), Gaps = 43/361 (12%)
 Frame = +1

Query  754   NHKMLEDEVI----HYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC--  915
             N +  +D++I    ++    ++ E  ++ L+S+ + +   + +L+ S+G   S N     
Sbjct  25    NSESFKDQIIKQEGNFKGQIKKHEDNIEFLNSQSNRLTESVVDLQMSLGKYHSTNVTKSE  84

Query  916   -------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
                    T+E  +EQI    +SAA+I C +     +S   +  F K+ + VVA L   ES
Sbjct  85    NGNGAFHTEEETVEQILKKENSAASIFCWIKANTQTS---NLAFVKDAVGVVATLAKVES  141

Query  1075  YELS--------------RILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALS  1206
              +LS               IL+EY+G + MLA+VC+ +       K    G ++S   L 
Sbjct  142   DDLSSWKYLLWSHLSSRFWILSEYVGLETMLAIVCSTNEGVKALEKYDPEGTVNSTGGLH  201

Query  1207  TLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVN  1383
              + ++ G  ING + +ICL D+RP+ G  +   PQ++LAI KP LPNGE PPGFL YAVN
Sbjct  202   GIGSSTGKKINGRFVVICLEDLRPFVGGFVENDPQKKLAIPKPRLPNGECPPGFLDYAVN  261

Query  1384  MIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIM  1563
             MIH+ +  L + TASGHGLRETLFY L   LQ+Y  R+ M +A  C  +  A+SLDG ++
Sbjct  262   MIHLDSNRLSFLTASGHGLRETLFYSLFSRLQIYKTRNEMMLALPCITDG-ALSLDGGMI  320

Query  1564  RGNGVTTHAFG---DPFIMFPVFSKEQQMNL-MTVNPDVLNLLKYKKVQLREVQNDIENE  1731
             R  G+   A G   D  + FP+ + E  +    T   DV+  L+++  +L     DI+ E
Sbjct  321   RKCGI--FALGSRKDVEVKFPLIAGESDVPPDYTEAEDVVRKLQWETSKLAA---DIQRE  375

Query  1732  R  1734
             +
Sbjct  376   Q  376



>ref|XP_004145932.1| PREDICTED: uncharacterized protein LOC101202858 [Cucumis sativus]
 ref|XP_004160377.1| PREDICTED: uncharacterized protein LOC101228918 [Cucumis sativus]
 gb|KGN49862.1| hypothetical protein Csa_5G139400 [Cucumis sativus]
Length=433

 Score =   179 bits (454),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 205/397 (52%), Gaps = 46/397 (12%)
 Frame = +1

Query  739   ADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC  915
             A++I N+ K LE+++  +    +Q E  ++ L ++K+ +   I +L+  +G   S     
Sbjct  48    AEYIFNYSKKLEEDLHMFGMKIKQHEDNIKFLKTQKNKLDESILDLQVILGKYHSSGTPV  107

Query  916   TQ----------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHE-------FAKEILV  1044
              +          E   EQI     SAA+I CKL          HH          K++L 
Sbjct  108   GENEVHSHSPNDEETREQIMQQEKSAASIICKL--------NAHHGIQAYNLMLTKDVLG  159

Query  1045  VVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLAN  1218
             +VA LG  +   LSR+L+EYLG + MLA+VC  +     +      G+++ +  L  L  
Sbjct  160   IVARLGRVDDDNLSRLLSEYLGMETMLAIVCRTYEGVKVLETYDKEGFINKSLGLHGLGA  219

Query  1219  NLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHI  1395
             ++G +++G + +ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI+I
Sbjct  220   SIGRNLDGRFLVICLEHLRPYAGDFIANDPQRRLDLLKPRLPNGECPPGFLGFAVNMINI  279

Query  1396  SAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
              + HL    A+G+GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG +++  G
Sbjct  280   DSTHLFCLAANGYGLRETLFYSLFSRLQVYKTRTDMLQALPCISDG-ALSLDGGMIKATG  338

Query  1576  VTTHAFG---DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQL----REVQNDIENE  1731
             V     G   D  + FP  S +  +    +  +  +  LK+KK ++    R  Q  ++N 
Sbjct  339   V--FCLGNQEDVQLRFPKPSMKSSLPENYIESERQIKELKWKKEKMVEDIRREQALLDNT  396

Query  1732  RMAYEEINNKFIGFRDAYVNLTQGSSSVQNTYS*ARP  1842
             +  ++    +F+ F      LT+ SS        A+P
Sbjct  397   KGNFDRKKAEFLKF------LTESSSYAAQQQLSAKP  427



>ref|XP_002277586.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Vitis vinifera]
Length=431

 Score =   179 bits (454),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 198/374 (53%), Gaps = 20/374 (5%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+  VN+ K L+DE+       +Q E  ++ L ++K N+   I +L+ ++G   S + 
Sbjct  45    SKAESAVNNSKKLQDELQTLGFKIKQHEDNIKYLKTQKDNLDGSILDLQVTLGKYCSSSI  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++   +EQI     SAAAI C+L +    S   H   AK++L +VA L
Sbjct  105   PTMENEALSKSRSENETVEQILKYEKSAAAILCQL-KIRHGSQASHLTLAKDVLGIVATL  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  +   LSR+ +EYLG + M+A+VC  +    ++      G ++    L  L +++G  
Sbjct  164   GKVDDENLSRLFSEYLGLETMMAIVCKTYEGVKTLETYDFEGGINKHSGLHGLGSSIGRH  223

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++G + +ICL  +RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI++ + ++
Sbjct  224   LDGRFRIICLEHLRPYAGDFVADDTQRRLDLLKPRLPNGECPPGFLGFAVNMINVDSANI  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTH  1587
                T+SG GLRETLFY L   LQVY  R  M +A  C  +  A+SLDG +++  GV +  
Sbjct  284   LCLTSSGCGLRETLFYNLFSRLQVYRTRAEMLLALPCITDG-ALSLDGGMIKTAGVFSLG  342

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
             +  D  + FP   K    NL     +    L     +  +V+ DI+ E+     IN  F 
Sbjct  343   SREDVEVRFP---KSSGSNLPLEYFETEKELTEVNWKREKVEEDIQREQSLLNHINYTFR  399

Query  1768  GFRDAYVNLTQGSS  1809
               + A++     SS
Sbjct  400   IKKQAFIKYLADSS  413



>emb|CDX86984.1| BnaC03g52540D [Brassica napus]
Length=402

 Score =   178 bits (452),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 178/347 (51%), Gaps = 20/347 (6%)
 Frame = +1

Query  811   EIELQILDSKKSNIQTEIFNLEESI------GLSSSQNCCCT--QESIMEQISGMGDSAA  966
             E  L+ L ++K+ +   I +L+  +      G   S+NC      E I EQI    +SAA
Sbjct  60    EDNLKFLKAQKTKLDESILDLQVHMNKLNPSGPPRSENCDANLQGEDINEQILRHANSAA  119

Query  967   AIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
              +   +    SS + L     K ++ VVA LG      LS++L+ YLG + MLA+VC  +
Sbjct  120   GVLAHVQSRHSSQMTL----TKGVVGVVAKLGKVHDENLSQVLSVYLGTRSMLALVCKDY  175

Query  1147  ASSVG--ASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRL  1317
              S  G  +    G +     L  LA+++G +I G +D I L ++RPY G+   G PQRRL
Sbjct  176   DSVKGLESYDSQGNVDRNAGLHGLASSIGRTIEGHFDAISLENLRPYVGQYIAGDPQRRL  235

Query  1318  AIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRD  1497
              ++KP LPNGE PPGFLG+AVNMI I   +L   TA GHGLRETLFY L   LQVY  R 
Sbjct  236   NLLKPKLPNGEYPPGFLGFAVNMIQIDPAYLLCVTAYGHGLRETLFYSLFSRLQVYKKRG  295

Query  1498  CMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IMFPVFSKEQQMNLMTVNPDVLN  1674
              M  A  C +   AVSLDG I+R  G+ T    D   + F   S  + M+  +     + 
Sbjct  296   DMISALPCISEG-AVSLDGGIVRTGGILTLGSSDEVKVRFAKPSASRAMDNHSEAERQMK  354

Query  1675  LLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQGSSSV  1815
              LK KK +  E   DI+  ++  +     F   +D +V     SSS 
Sbjct  355   ELKQKKEKTLE---DIKRTQVLRDHAVYNFGKKKDEFVRFLAQSSST  398



>ref|XP_010662859.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Vitis vinifera]
Length=423

 Score =   179 bits (453),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 198/374 (53%), Gaps = 20/374 (5%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+  VN+ K L+DE+       +Q E  ++ L ++K N+   I +L+ ++G   S + 
Sbjct  45    SKAESAVNNSKKLQDELQTLGFKIKQHEDNIKYLKTQKDNLDGSILDLQVTLGKYCSSSI  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++   +EQI     SAAAI C+L +    S   H   AK++L +VA L
Sbjct  105   PTMENEALSKSRSENETVEQILKYEKSAAAILCQL-KIRHGSQASHLTLAKDVLGIVATL  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  +   LSR+ +EYLG + M+A+VC  +    ++      G ++    L  L +++G  
Sbjct  164   GKVDDENLSRLFSEYLGLETMMAIVCKTYEGVKTLETYDFEGGINKHSGLHGLGSSIGRH  223

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++G + +ICL  +RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI++ + ++
Sbjct  224   LDGRFRIICLEHLRPYAGDFVADDTQRRLDLLKPRLPNGECPPGFLGFAVNMINVDSANI  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTH  1587
                T+SG GLRETLFY L   LQVY  R  M +A  C  +  A+SLDG +++  GV +  
Sbjct  284   LCLTSSGCGLRETLFYNLFSRLQVYRTRAEMLLALPCITDG-ALSLDGGMIKTAGVFSLG  342

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
             +  D  + FP   K    NL     +    L     +  +V+ DI+ E+     IN  F 
Sbjct  343   SREDVEVRFP---KSSGSNLPLEYFETEKELTEVNWKREKVEEDIQREQSLLNHINYTFR  399

Query  1768  GFRDAYVNLTQGSS  1809
               + A++     SS
Sbjct  400   IKKQAFIKYLADSS  413



>ref|XP_006481298.1| PREDICTED: uncharacterized protein LOC102630668 [Citrus sinensis]
Length=279

 Score =   174 bits (442),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 156/273 (57%), Gaps = 20/273 (7%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGL-----------SSSQNCCCTQESIMEQISG  948
             +Q E  +++L S+   +   I +L+ ++G            S+ QN    +E    QI  
Sbjct  7     KQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHSNHQN----EEETTGQILQ  62

Query  949   MGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLA  1128
                SAA + C+L +T   +   H  F K++L +VA LG  E   LS +L+EYLG   MLA
Sbjct  63    HEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLEDENLSSLLSEYLGVDTMLA  121

Query  1129  VVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG  1302
             +VC       ++      G++  +  L  L  ++G +I+G + +ICL ++RP+ GE  + 
Sbjct  122   IVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRFLVICLENLRPFAGEFVVD  181

Query  1303  -PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQ  1479
              PQRRL + KP LP GE PPGFLGYAVNMI+I +K+L   TASGHGLRETLFY L   LQ
Sbjct  182   DPQRRLDLWKPRLPTGECPPGFLGYAVNMINIDSKNLFCATASGHGLRETLFYNLFYRLQ  241

Query  1480  VYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             VY  R  M +A    ++  A+SLDG I+R +GV
Sbjct  242   VYRTRADMLLALPLISDG-AISLDGGIIRSSGV  273



>ref|XP_008380790.1| PREDICTED: uncharacterized protein LOC103443673 [Malus domestica]
Length=432

 Score =   179 bits (453),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 195/369 (53%), Gaps = 26/369 (7%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL------  891
             S+A+ I+ + K L+D++       +Q E  +++L S+K  +   I +L+  +G       
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQKHKLDDSILDLQVILGKYHTSTT  104

Query  892   ----SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                     +C  ++E   E+I     SAA I  +L     +   L     K+++ +V +L
Sbjct  105   PKIEDDGHSCRKSEEETTEKILQHEKSAAGILWQLKTRHGTQAALLSPI-KDVVGIVGML  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + MLA+VC  +    ++   +  G +  +  L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLAIVCKTYEGVKALEVYENEGCIKKSAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++  + +ICL ++RPY G  +   PQ RL I+KP L NGE PPGFLGYAVNMI++ + +L
Sbjct  224   LDSRFQVICLENLRPYAGASVPNDPQMRLDIIKPRLANGECPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  284   YCLTATGHGLRATLFYSLFGHLQVYKTRADMVPALPCISDG-AISLDGGMIRSTGV--FS  340

Query  1591  FG---DPFIMFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQLRE----VQNDIENERMAYE  1746
              G   D  + FP+ S    +       +  +N LK KK +L+E     Q+ ++N +  ++
Sbjct  341   LGNREDVDVRFPILSATSGLPENYFESERQINELKRKKDKLQEDMKSEQSLLDNAKFNFD  400

Query  1747  EINNKFIGF  1773
                  F+ F
Sbjct  401   RKKQDFLKF  409



>gb|KCW57205.1| hypothetical protein EUGRSUZ_H00020 [Eucalyptus grandis]
Length=458

 Score =   179 bits (455),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 196/367 (53%), Gaps = 25/367 (7%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-------  891
             +AD ++N  K L+D++       +Q E  ++ L ++K+ +   I +    +G        
Sbjct  75    QADTLMNSSKRLQDDLQSLGLKIKQHEDNIKSLKTQKNTLDDSILDKRVILGKYHSSAPP  134

Query  892   SSSQNCCCT--QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGF  1065
             S+  N   +  +E   EQI     SAA I C+L  +  +   +    +K+++ +VA LG 
Sbjct  135   SAEDNSLSSGGEEETTEQILKRDKSAAGIWCQLKNSRGTQAPIL-ALSKDVIGIVATLGK  193

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSIN  1239
              +   LSR+L+EYLG   ML++VC       ++      G +  +  L  L++++G  +N
Sbjct  194   VDDENLSRLLSEYLGADAMLSIVCKTREGMKALETYDTDGSIDMSAGLHGLSSSIGRDLN  253

Query  1240  GGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQY  1416
             G + +ICL D+RPY G+ + +  QRRL + KP LP+GE PPGFLG+AVNM++I A HL  
Sbjct  254   GRFLVICLEDLRPYIGDFVDVDGQRRLDLFKPRLPSGECPPGFLGFAVNMVNIDATHLFC  313

Query  1417  RTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
              T SGHGLRETLFY L    QVY+ R  M  A    +   A+SLDG I+RG G+  +  G
Sbjct  314   LTPSGHGLRETLFYHLFSRTQVYSTRADMLRALPLISGG-AISLDGGIIRGPGM--YFLG  370

Query  1597  ---DPFIMFPVFS--KEQQMNLMTVNPDVLNLLKYKKVQLREVQND---IENERMAYEEI  1752
                D  + FPV S    +  N   V   + +L   ++  L ++Q +   +++ +M +E  
Sbjct  371   KREDVDVRFPVPSGASSRPANYHEVENQMKDLRWKREKLLEDLQRERQMLDHAKMNFERK  430

Query  1753  NNKFIGF  1773
               +F+ F
Sbjct  431   KQEFVMF  437



>ref|XP_010519433.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X4 [Tarenaya hassleriana]
Length=429

 Score =   179 bits (453),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 162/295 (55%), Gaps = 14/295 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N K LED++    +  +Q E  ++ L ++K+ +   I +L+  +G   S     T+  
Sbjct  56    LFNTKRLEDDLRAVGKKIKQHEDNIRFLKAQKNKLDESILDLQVVLGRYFSSMAPRTETN  115

Query  922   -------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
                    E   EQI     +AA I   L+ET          F K+++ VVA LG  +   
Sbjct  116   DSSNHQSEEANEQIIRHEKTAAGI-LSLLETNHGMQASQLPFTKDVMGVVAKLGKVDDQN  174

Query  1081  LSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LS+ L +YLG + MLAVVC  + +  ++      G +     L  L +++G  I G +D+
Sbjct  175   LSQCLCDYLGTRTMLAVVCKTYDAIKALEVYDKKGNIDKNAGLHGLGSSIGRIIEGRFDV  234

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGF+G+AVNMIHI A+ L   T+ G
Sbjct  235   ICLKGLRPYVGQYVADDPQRRLDLLKPRLPNGECPPGFIGFAVNMIHIDAEDLLCVTSHG  294

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             +GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG I++  GV +   G
Sbjct  295   YGLRETLFYSLFSRLQVYKTRADMMNALPCISDG-AISLDGGIIKTTGVFSLGTG  348



>ref|XP_010519432.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X3 [Tarenaya hassleriana]
Length=473

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 162/295 (55%), Gaps = 14/295 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N K LED++    +  +Q E  ++ L ++K+ +   I +L+  +G   S     T+  
Sbjct  56    LFNTKRLEDDLRAVGKKIKQHEDNIRFLKAQKNKLDESILDLQVVLGRYFSSMAPRTETN  115

Query  922   -------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
                    E   EQI     +AA I   L+ET          F K+++ VVA LG  +   
Sbjct  116   DSSNHQSEEANEQIIRHEKTAAGI-LSLLETNHGMQASQLPFTKDVMGVVAKLGKVDDQN  174

Query  1081  LSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LS+ L +YLG + MLAVVC  + +  ++      G +     L  L +++G  I G +D+
Sbjct  175   LSQCLCDYLGTRTMLAVVCKTYDAIKALEVYDKKGNIDKNAGLHGLGSSIGRIIEGRFDV  234

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGF+G+AVNMIHI A+ L   T+ G
Sbjct  235   ICLKGLRPYVGQYVADDPQRRLDLLKPRLPNGECPPGFIGFAVNMIHIDAEDLLCVTSHG  294

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             +GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG I++  GV +   G
Sbjct  295   YGLRETLFYSLFSRLQVYKTRADMMNALPCISDG-AISLDGGIIKTTGVFSLGTG  348



>emb|CBI23012.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   179 bits (454),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 198/374 (53%), Gaps = 20/374 (5%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+  VN+ K L+DE+       +Q E  ++ L ++K N+   I +L+ ++G   S + 
Sbjct  132   SKAESAVNNSKKLQDELQTLGFKIKQHEDNIKYLKTQKDNLDGSILDLQVTLGKYCSSSI  191

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++   +EQI     SAAAI C+L +    S   H   AK++L +VA L
Sbjct  192   PTMENEALSKSRSENETVEQILKYEKSAAAILCQL-KIRHGSQASHLTLAKDVLGIVATL  250

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  +   LSR+ +EYLG + M+A+VC  +    ++      G ++    L  L +++G  
Sbjct  251   GKVDDENLSRLFSEYLGLETMMAIVCKTYEGVKTLETYDFEGGINKHSGLHGLGSSIGRH  310

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++G + +ICL  +RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI++ + ++
Sbjct  311   LDGRFRIICLEHLRPYAGDFVADDTQRRLDLLKPRLPNGECPPGFLGFAVNMINVDSANI  370

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTH  1587
                T+SG GLRETLFY L   LQVY  R  M +A  C  +  A+SLDG +++  GV +  
Sbjct  371   LCLTSSGCGLRETLFYNLFSRLQVYRTRAEMLLALPCITDG-ALSLDGGMIKTAGVFSLG  429

Query  1588  AFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
             +  D  + FP   K    NL     +    L     +  +V+ DI+ E+     IN  F 
Sbjct  430   SREDVEVRFP---KSSGSNLPLEYFETEKELTEVNWKREKVEEDIQREQSLLNHINYTFR  486

Query  1768  GFRDAYVNLTQGSS  1809
               + A++     SS
Sbjct  487   IKKQAFIKYLADSS  500



>ref|XP_007039062.1| Defective in meristem silencing 3 [Theobroma cacao]
 gb|EOY23563.1| Defective in meristem silencing 3 [Theobroma cacao]
Length=470

 Score =   178 bits (451),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/369 (34%), Positives = 193/369 (52%), Gaps = 37/369 (10%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSS------Q  903
             I + + L+D++       +  E  +++L  +K+ +   I +++   G   SSS      +
Sbjct  91    IQSSEKLQDDLRMLGLKIKHHEDNIKLLKIQKNKLDDSILDMQVMRGKYHSSSAPKIGNE  150

Query  904   NCCCTQ--ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
             NC   Q  E   EQI   G SAA I C+L +  +++   +    +++L  VA LG  +  
Sbjct  151   NCSHLQSEEETTEQILRHGKSAAGILCQL-KIHNATQASYLTLTRDVLGAVATLGKVDDE  209

Query  1078  ELSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LS + +EYLG + M+A+VC  + S  ++      G +     L  L  ++G +I+G + 
Sbjct  210   NLSWLFSEYLGVQTMMAIVCKTYESVRALETYNQDGCIDKTSGLHRLGASIGRAIDGRFH  269

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI + + +L   TAS
Sbjct  270   VICLESLRPYAGDFVADDPQRRLDLLKPRLPNGECPPGFLGFAVNMIQVDSSNLFCVTAS  329

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDP--  1602
             G GLRETLFY L   LQVY  R  M +A  C +   AVSLDG ++R +GV   +FG+   
Sbjct  330   GDGLRETLFYNLFSRLQVYRTRAEMVLALPCISEG-AVSLDGGMIRSSGV--FSFGNREE  386

Query  1603  -FIMFPVFS-----------KEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYE  1746
               + FP  S            E+QM  MT   + L      +  ++  Q  ++N +  +E
Sbjct  387   VDVRFPKPSAKSDVPQNYIETEKQMKEMTWRKEKL------EEDMKREQALLDNAKFNFE  440

Query  1747  EINNKFIGF  1773
                  F+ F
Sbjct  441   RKKQDFVKF  449



>ref|XP_011080655.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Sesamum 
indicum]
Length=441

 Score =   177 bits (448),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 194/386 (50%), Gaps = 26/386 (7%)
 Frame = +1

Query  739   ADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG------LSS  897
             A+ +VNH K L+D++    +  +  E+ ++ L + K+ ++  I  ++ SIG       S 
Sbjct  58    AESVVNHSKKLQDDLQELGEKIKHHEVNVKYLKTLKNKLEDSILEMQVSIGKYHTASFSK  117

Query  898   SQN----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGF  1065
              +N       ++E I++ I     S AA+ C++   P + V   H   K++L +VA LG 
Sbjct  118   VENEDPSSVESEEEIIQHILKCKKSVAALLCRMRSNPEAQVS-DHPLMKDVLGIVATLGK  176

Query  1066  AESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGY-----LSSADALSTLANNLGT  1230
              +   LSR+ +EYLG + MLAVVC       G   + GY     ++    +   A + G 
Sbjct  177   VDDVNLSRLFSEYLGLETMLAVVCKTFE---GVKALEGYTKDGLINKGFGIDAFAASTGR  233

Query  1231  SINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
               +  + +ICL ++ PY GEL +  PQRRL ++KP L NGE+P GFLG+AVNMI I   +
Sbjct  234   PQDDRFLVICLENLIPYAGELIADDPQRRLDLLKPRLINGETPQGFLGFAVNMITIDNTN  293

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTT-  1584
             L   + +GH LRETLFY L   LQVY +R+ M  A  C  N  A+SLDG ++R  GV   
Sbjct  294   LYGISKTGHSLRETLFYYLFSNLQVYRSREDMLKALPCIPNG-AISLDGGMIRSPGVFAL  352

Query  1585  -HAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNK  1761
              H   +  + FP     Q+ NL     +  N LK  K +      D++ E+   + +   
Sbjct  353   GHHRENIDVKFPCDC--QRFNLPVNYFETENQLKETKRKKDRAWEDLQREQALLDHVRYS  410

Query  1762  FIGFRDAYVNLTQGSSSVQNTYS*AR  1839
             +   +  +V     +SS    Y   R
Sbjct  411   YETKKREFVQFLAETSSYSTQYQVGR  436



>ref|XP_009352029.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Pyrus 
x bretschneideri]
Length=432

 Score =   176 bits (446),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 121/370 (33%), Positives = 195/370 (53%), Gaps = 28/370 (8%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+ + K L+D++       +Q E  +++L S+K  +   I +L+  +G   +   
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQKHKLDDSILDLQVILGKYHTSTT  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E   E+I     SAA I  +L     +   L     K+++ +V +L
Sbjct  105   PKIEDDGHSRRKSEEETTEKILQHEKSAAGILWQLKTRHGTQAALLSPI-KDVVGIVGML  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + ML++VC  +    ++   +  G +  +  L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLSIVCKTYEGVKALEVYENEGCIKKSAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL ++RPY G  +   PQ RL I+KP L NG+ PPGFLGYAVNMI++ + +L
Sbjct  224   LEGRFQVICLENLRPYAGASVPDDPQMRLDIIKPRLANGQCPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  284   YCLTATGHGLRATLFYSLFGRLQVYKTRADMVPALPCISDG-AISLDGGMIRSTGV--FS  340

Query  1591  FG---DPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLRE----VQNDIENERMAY  1743
              G   D  + FP  S    +  N +     + N LK+KK +L+E     Q+ ++N +  +
Sbjct  341   LGNREDVDVRFPKLSATSGLPENYLESERQI-NELKWKKDKLQEDMKSEQSLLDNAKFNF  399

Query  1744  EEINNKFIGF  1773
             +     F+ F
Sbjct  400   DRKKQDFLKF  409



>ref|XP_010519431.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Tarenaya hassleriana]
Length=553

 Score =   178 bits (452),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 162/295 (55%), Gaps = 14/295 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N K LED++    +  +Q E  ++ L ++K+ +   I +L+  +G   S     T+  
Sbjct  48    LFNTKRLEDDLRAVGKKIKQHEDNIRFLKAQKNKLDESILDLQVVLGRYFSSMAPRTETN  107

Query  922   -------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
                    E   EQI     +AA I   L+ET          F K+++ VVA LG  +   
Sbjct  108   DSSNHQSEEANEQIIRHEKTAAGI-LSLLETNHGMQASQLPFTKDVMGVVAKLGKVDDQN  166

Query  1081  LSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LS+ L +YLG + MLAVVC  + +  ++      G +     L  L +++G  I G +D+
Sbjct  167   LSQCLCDYLGTRTMLAVVCKTYDAIKALEVYDKKGNIDKNAGLHGLGSSIGRIIEGRFDV  226

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGF+G+AVNMIHI A+ L   T+ G
Sbjct  227   ICLKGLRPYVGQYVADDPQRRLDLLKPRLPNGECPPGFIGFAVNMIHIDAEDLLCVTSHG  286

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             +GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG I++  GV +   G
Sbjct  287   YGLRETLFYSLFSRLQVYKTRADMMNALPCISDG-AISLDGGIIKTTGVFSLGTG  340



>ref|XP_009349948.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Pyrus 
x bretschneideri]
Length=432

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 121/370 (33%), Positives = 195/370 (53%), Gaps = 28/370 (8%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             S+A+ I+ + K L+D++       +Q E  +++L S+K  +   I +L+  +G   +   
Sbjct  45    SQAESIIYYTKKLQDDLQMMGMKIKQHEDNIKLLKSQKHKLDDSILDLQVILGKYHTSTT  104

Query  910   CC----------TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALL  1059
                         ++E   E+I     SAA I  +L     +   L     K+++ +V +L
Sbjct  105   PKIEDDGHSRRKSEEETTEKILQHEKSAAGILWQLKTRHGTQAALLSPI-KDVVGIVGML  163

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTS  1233
             G  E   LSRI +EYLG + ML++VC  +    ++   +  G +  +  L  L +++G +
Sbjct  164   GKVEDDNLSRIFSEYLGIETMLSIVCKTYEGVKALEVYENEGCIKKSAGLHGLGSSIGRT  223

Query  1234  INGGYDMICLNDIRPYTG-ELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             + G + +ICL ++RPY G  +   PQ RL I+KP L NG+ PPGFLGYAVNMI++ + +L
Sbjct  224   LEGRFQVICLENLRPYAGASVPDDPQMRLDIIKPRLANGQCPPGFLGYAVNMINVDSANL  283

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                TA+GHGLR TLFY L G LQVY  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  284   YCLTATGHGLRATLFYSLFGRLQVYKTRADMVPALPCISDG-AISLDGGMIRSTGV--FS  340

Query  1591  FG---DPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLRE----VQNDIENERMAY  1743
              G   D  + FP  S    +  N +     + N LK+KK +L+E     Q+ ++N +  +
Sbjct  341   LGNREDVDVRFPKLSATSGLPENYLESERQI-NELKWKKDKLQEDMKSEQSLLDNAKFNF  399

Query  1744  EEINNKFIGF  1773
             +     F+ F
Sbjct  400   DRKKQDFLKF  409



>ref|XP_010519429.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010519430.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Tarenaya hassleriana]
Length=561

 Score =   178 bits (452),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/295 (38%), Positives = 162/295 (55%), Gaps = 14/295 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N K LED++    +  +Q E  ++ L ++K+ +   I +L+  +G   S     T+  
Sbjct  56    LFNTKRLEDDLRAVGKKIKQHEDNIRFLKAQKNKLDESILDLQVVLGRYFSSMAPRTETN  115

Query  922   -------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYE  1080
                    E   EQI     +AA I   L+ET          F K+++ VVA LG  +   
Sbjct  116   DSSNHQSEEANEQIIRHEKTAAGI-LSLLETNHGMQASQLPFTKDVMGVVAKLGKVDDQN  174

Query  1081  LSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDM  1254
             LS+ L +YLG + MLAVVC  + +  ++      G +     L  L +++G  I G +D+
Sbjct  175   LSQCLCDYLGTRTMLAVVCKTYDAIKALEVYDKKGNIDKNAGLHGLGSSIGRIIEGRFDV  234

Query  1255  ICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASG  1431
             ICL  +RPY G+ ++  PQRRL ++KP LPNGE PPGF+G+AVNMIHI A+ L   T+ G
Sbjct  235   ICLKGLRPYVGQYVADDPQRRLDLLKPRLPNGECPPGFIGFAVNMIHIDAEDLLCVTSHG  294

Query  1432  HGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG  1596
             +GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG I++  GV +   G
Sbjct  295   YGLRETLFYSLFSRLQVYKTRADMMNALPCISDG-AISLDGGIIKTTGVFSLGTG  348



>emb|CDY08119.1| BnaA06g16070D [Brassica napus]
Length=422

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/320 (36%), Positives = 165/320 (52%), Gaps = 11/320 (3%)
 Frame = +1

Query  652   QYRSAQKQIFPYENSSPYKAPKLEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQIL  831
             Q  +   Q+ P E SS                + N   L+ ++       ++ E  L+ L
Sbjct  18    QSTTTMMQLDPKETSSGGGTQNGGGMSQAEFALFNSDRLQSDLEAMGNKIKEHEDNLKFL  77

Query  832   DSKKSNIQTEIFNLEESIGLSSSQNCCCTQ------ESIMEQISGMGDSAAAIACKLIET  993
              S+K+ +   I  L+  +G   +   C  +      E I EQI    +SAA +    +++
Sbjct  78    KSQKNKLDESILKLQVHMGKLHTSGTCTIENTNLQGEDINEQILRQVNSAAGV-LSYVQS  136

Query  994   PSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM  1173
                S  L  +    ++ VVA LG      LS+ L++YLG + MLA+V   + S     K 
Sbjct  137   HHYSEALQLDMTNGVVGVVAKLGKVNDQNLSQALSDYLGTRSMLALVYKDYKSVKPLEKY  196

Query  1174  --HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPN  1344
                G +  + A+  LA+++G +I G +D+ICL ++RPY G+   G PQRRL +  P LPN
Sbjct  197   DNQGNVDRSGAIHGLASSIGRTIEGQFDVICLENLRPYVGKRIAGDPQRRLDLPNPKLPN  256

Query  1345  GESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCF  1524
             GE PPGFLGYAVN+IHI   +L   TA G+GLRETLFY L  +LQVY  R  M  A  C 
Sbjct  257   GEYPPGFLGYAVNLIHIDPAYLLCVTAYGYGLRETLFYSLFSQLQVYKTRVDMISALPCI  316

Query  1525  NNNPAVSLDGVIMRGNGVTT  1584
              +  AVSLDG I+R  G+ T
Sbjct  317   TDG-AVSLDGGIIRKTGIFT  335



>ref|XP_002877660.1| hypothetical protein ARALYDRAFT_485283 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53919.1| hypothetical protein ARALYDRAFT_485283 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/370 (36%), Positives = 189/370 (51%), Gaps = 18/370 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLE------ESIGLSSSQNC  909
             + N K L+ ++       +Q E  L+ L S+K+ +   I +L+       S     S+NC
Sbjct  53    MFNSKRLQSDLEAMGNKLKQHEDNLKFLKSQKNKLDEAIVDLQVHMSKLHSSPTPRSENC  112

Query  910   --CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
                   E I EQI    +SAA +   L+ET   +        K ++ VVA LG      L
Sbjct  113   DNNLQGEDINEQILRHENSAAGV-LGLVETFHGAQASQLMLTKGVVGVVAKLGKVNDENL  171

Query  1084  SRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+ILA YLG + MLAVVC  + S  ++ A    G +     L  L  ++G +I   +D I
Sbjct  172   SQILANYLGTRSMLAVVCRNYESVTALEAYDNQGNIDRNAGLHGLGASIGRTIGSNFDAI  231

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ GH
Sbjct  232   CLENLRPYVGQHIADDLQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGH  291

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IM  1611
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+      D   + 
Sbjct  292   GLRETLFYSLFSRLQVYKTRADMISALPCISDG-AVSLDGGIIRTQGIFNLGNRDEVNVR  350

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVN  1791
             F   +  + M+  +     +  LK+KK +  E   DI+ E++  E     F   ++ +V 
Sbjct  351   FAKPTASRTMDNYSEAERKMKELKWKKEKTLE---DIKREQVLREHAVFNFGKKKEEFVR  407

Query  1792  -LTQGSSSVQ  1818
              L Q S + Q
Sbjct  408   CLAQSSYTNQ  417



>ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago truncatula]
Length=1675

 Score =   182 bits (463),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 122/353 (35%), Positives = 191/353 (54%), Gaps = 38/353 (11%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             M D Y NH+ +  E+ + +DGF   +  C   KV   G I+L G+LK+TAGYG+ AS+SV
Sbjct  933   MFDAYRNHVSEGMEVNIVVDGFEMLNH-CSAYKVADKGKIDLSGLLKLTAGYGENASISV  991

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                 + +FKQ+F I  R LRIAS++P+ C  G  LEN+ FE++N +G+VD  IH D +  
Sbjct  992   TFEGRPIFKQDFSIARRILRIASKVPDFCAAGGQLENVKFEIVNIDGDVDTKIHHDNQDY  1051

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             Q H LTIKS+L+  +E++RY F  G CTV  I +PE EG F F A HS+Y +L L ++V 
Sbjct  1052  QFHMLTIKSDLINAEESIRYLFKQGCCTVPFIRVPEIEGTFCFEAFHSQYTKLCLAVKVR  1111

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               K   A                K+V   Q  S  K IFP +  SP+      H+ +   
Sbjct  1112  VIKMSNA----------------KDVA--QLLSPDKNIFPLQELSPF-----NHENNLMI  1148

Query  745   HIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQE  924
              ++N    E ++       ++ E  L+    +K+  + E+  L +++ ++       T+E
Sbjct  1149  SVLNS---EGKICQLGSKIKKVEEYLKTCHEEKAEKEKEMLKLRDNVNVN-------TKE  1198

Query  925   SIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
              ++ +I  M +SA ++ C L    S+  +  + F ++I+ VVALLG  +S +L
Sbjct  1199  EVITKIKSMENSATSVLCSL----SAHEKQQNHFLEDIIGVVALLGSVKSPKL  1247


 Score =   147 bits (370),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 118/199 (59%), Gaps = 12/199 (6%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSI-NGGYDMICLN  1266
             +LAEYLGE QML V+C +  ++V   K +G +   D L   A  LG +I +  + ++   
Sbjct  1388  MLAEYLGEDQMLGVICRSFDTAVSLYKQNGEI---DCLHAEAAGLGEAIISKRFLVMSFE  1444

Query  1267  DIRPYTGELS-IGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
             D+RPY G L    PQ +LA+  P L NG +P GF+GYAVNMI + + HLQ RTA GHGLR
Sbjct  1445  DLRPYKGYLQEHDPQMKLALPNPKLHNGRTPAGFIGYAVNMIDLDSHHLQTRTALGHGLR  1504

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVF  1623
             ET+ + L  +L VY  R+ M  A  C  +  AVSLDG I+R N   +  +G+P + FP  
Sbjct  1505  ETVLFSLFKKLHVYETRENMVDALDCIEDG-AVSLDGGIIRENRALSIGYGNPSVYFPCT  1563

Query  1624  SKEQQMNLMTVNPDVLNLL  1680
             +K      + ++P+ + +L
Sbjct  1564  NK------LDISPEAMGIL  1576



>emb|CDY05915.1| BnaC08g20920D [Brassica napus]
Length=420

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 152/275 (55%), Gaps = 25/275 (9%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLE------ESIGLSSSQNCCCTQESIMEQISGMGDSA  963
             ++ E  L+ L S+K+ +   I  L+       + G+S+ +N     E I EQI    +SA
Sbjct  68    KEHEDNLKFLKSQKNKLDESILKLQVHMGKLHTSGISTIENTNLQGEDINEQILRQVNSA  127

Query  964   AAIACKLIETPSSSVELHH-------EFAKEILVVVALLGFAESYELSRILAEYLGEKQM  1122
             A +         S V+ HH       +    ++ VVA LG      LS++L++YLG + M
Sbjct  128   AGVL--------SYVQSHHYSQASQLDMTNGVVGVVAKLGRVNDENLSQVLSDYLGTRSM  179

Query  1123  LAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELS  1296
             LA+VC  + S     K    G +  + A+  LA+++G +I G +D+ICL ++RPY G+  
Sbjct  180   LALVCKDYKSVKPLEKYDNQGNVDRSGAIHGLASSIGRTIEGHFDVICLENLRPYVGKRI  239

Query  1297  IG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGE  1473
              G PQRRL +  P LPNGE PPGFLGYAVN+I I   +L   T  G+GLRETLFY L  +
Sbjct  240   DGDPQRRLDLPNPKLPNGEYPPGFLGYAVNLIQIDPAYLLCVTGYGYGLRETLFYSLFSQ  299

Query  1474  LQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LQVY  R  M  A  C  +  AVSLDG I+R  G+
Sbjct  300   LQVYKRRVDMVSALPCITDG-AVSLDGGIIRKTGI  333



>ref|NP_001132336.1| hypothetical protein [Zea mays]
 gb|ACF81141.1| unknown [Zea mays]
 gb|ACG39176.1| hypothetical protein [Zea mays]
 gb|ACR33892.1| unknown [Zea mays]
 tpg|DAA52721.1| TPA: hypothetical protein ZEAMMB73_105164 [Zea mays]
 tpg|DAA52722.1| TPA: hypothetical protein ZEAMMB73_105164 [Zea mays]
Length=405

 Score =   173 bits (439),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 156/292 (53%), Gaps = 26/292 (9%)
 Frame = +1

Query  754   NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSS------QNCCC  915
             N+K +ED++   A      E  ++ L S+ + ++    +L   +G   S       N   
Sbjct  14    NYKAIEDKLKRLALEVSHHENNIRFLKSQLNTVEEACVDLGIKLGNYHSSVAAVVNNDTS  73

Query  916   TQES---IMEQISGMGDSAAAIACKLIETPSSSVELHHEFA------KEILVVVALLGFA  1068
              QE+    +  I   G +AA I C+L          HHE A      K+IL  VA LG  
Sbjct  74    AQEAEQRTIRSILDQGKTAAGIICQLKVR-------HHELASKMPLMKDILGFVATLGKV  126

Query  1069  ESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSING  1242
              +  LSR+L EYLG   MLA+VC  +    G  K    G + +   +  L  ++G  ++G
Sbjct  127   NNDNLSRLLTEYLGMDNMLALVCKTYDGVKGLEKYDKDGIIDNTSGIHGLGRSVGKFLDG  186

Query  1243  GYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYR  1419
              + + CL ++RP++G++ I  PQR+L + +P LP GESPPGFL +AVNMIH+   HL++ 
Sbjct  187   RFTVFCLENLRPFSGDVIIDDPQRKLILHRPRLPGGESPPGFLDFAVNMIHLDRAHLRFL  246

Query  1420  TASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TASGHGLRETLFY L   LQVY  R  +  A     +  AVSLDG ++R NG
Sbjct  247   TASGHGLRETLFYTLFSHLQVYKTRTDIQSALPLIKDG-AVSLDGGLLRPNG  297



>ref|XP_009381037.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=398

 Score =   173 bits (438),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 120/379 (32%), Positives = 197/379 (52%), Gaps = 28/379 (7%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQ---  903
             + D I +H + LEDE+       +  E  L+ L ++ ++I   I +++ ++G   S    
Sbjct  13    DVDFIKSHSQKLEDELQKLGLKIKHHEDNLKFLKAQMNSIDESILDMQVNLGKYHSSAGA  72

Query  904   ------NCCCTQESIMEQISGMGDSAAAIACKLI---ETPSSSVELHHEFAKEILVVVAL  1056
                   +   T++  +E I     +AA I C+L       +S + L     K++L +VA 
Sbjct  73    VDNNDFSTANTEKQTIENILKQEQTAAGIICQLKVYHAVQASKLPL----TKDVLGIVAT  128

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGT  1230
             LG      LSR+L++YLG + MLA+VC  +       K    G +  +  L  +   +G 
Sbjct  129   LGKVNDVNLSRVLSDYLGPENMLAIVCKTYEGVKELEKYDKEGMIDKSYGLHGIGKAIGR  188

Query  1231  SINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
              ++G Y + C+ ++RPY G  +   PQRRLA++KP LPNG+ PPGF+ +AVNMI +   H
Sbjct  189   HLDGRYLVFCIENLRPYIGGFVPEDPQRRLALLKPRLPNGDPPPGFIDFAVNMIDVDHMH  248

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L   TASGHGLRETLFY L   LQVY  R  M  A   F +  A+SLDG IM+  G+   
Sbjct  249   LSCITASGHGLRETLFYNLFSRLQVYKTRSDMLRALP-FLSEGAISLDGGIMKSGGLFYL  307

Query  1588  AFGDPF-IMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINN  1758
                +   ++FP+ S   ++  +++ +  + L LL+++K +L E   D++ E      +  
Sbjct  308   GGRNCIEVIFPISSGISRLPTDVLEIE-EQLKLLRWQKERLLE---DMQREETLLNHVKT  363

Query  1759  KFIGFRDAYVNLTQGSSSV  1815
              F   ++ YV   + ++ +
Sbjct  364   MFSTKKEEYVKYLRETAQI  382



>ref|XP_007219846.1| hypothetical protein PRUPE_ppa027016mg, partial [Prunus persica]
 gb|EMJ21045.1| hypothetical protein PRUPE_ppa027016mg, partial [Prunus persica]
Length=337

 Score =   171 bits (433),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 113/314 (36%), Positives = 172/314 (55%), Gaps = 35/314 (11%)
 Frame = +1

Query  850   IQTEIFNLEESI----------------GLSSSQNCCCTQESIMEQISGMGDSAAAIACK  981
             +Q+EI  L ESI                G ++  +    ++   EQI     SAA++ C+
Sbjct  11    LQSEINRLSESILDLQVSLGKHLPANGTGTTNESSTTLAEKDETEQILRHEKSAASLLCR  70

Query  982   L--IETPSSSVELHHEFAKEILVVV---ALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             L  +++P ++  L+    K++L +V   A LG  +   LSR+L+EYLG + MLA+VC  +
Sbjct  71    LNLLKSPHTTQALNLALTKDVLGIVGIVATLGRVDDDNLSRLLSEYLGLETMLAIVCRTY  130

Query  1147  ASSVGASKMHGYLSSADALST-----LANNLGTSINGGYDMICLNDIRPYTGELSIGPQR  1311
                 G   +  Y +    +ST     L +++G SI G + +ICL D+R    E S  PQR
Sbjct  131   E---GVKVLEKYDADGTIISTAGIHGLGSSIGKSIKGRFLVICLEDLRQ---ETSDDPQR  184

Query  1312  RLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYAN  1491
             +L++ KP LPNGE PPGFL YAVN I++  K+L   T+ GHGLRETLFY L   LQ+Y  
Sbjct  185   KLSLPKPKLPNGECPPGFLDYAVNTINLDDKNLDCLTSGGHGLRETLFYSLFSRLQIYRT  244

Query  1492  RDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMFPVFSKEQQMNLMTV-NPD  1665
             R  M +A  C N+  A+SLDG +++ +GV    +  D  + FP  S E  M+   +   D
Sbjct  245   RAEMRLALPCINDG-ALSLDGGVIKKSGVFILGSRKDIEVKFPATSVESSMSAKYLETED  303

Query  1666  VLNLLKYKKVQLRE  1707
             ++  LK+++  + E
Sbjct  304   MIKKLKWERSHVTE  317



>ref|XP_006291214.1| hypothetical protein CARUB_v10017344mg [Capsella rubella]
 gb|EOA24112.1| hypothetical protein CARUB_v10017344mg [Capsella rubella]
Length=414

 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 111/288 (39%), Positives = 154/288 (53%), Gaps = 13/288 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG-LSSS-------Q  903
             + N K L+ ++       +Q E  L+ L ++K+ +   I +L+  +  L SS        
Sbjct  51    MFNSKRLQSDLEVMGNKIKQHEDNLKFLKAQKNKLDEAIVDLQVHMSKLHSSPTPRIETS  110

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I EQI    +SAA +   L+ET   +        K I+ VVA LG      L
Sbjct  111   DANLQGEDINEQILRYKNSAAGV-LSLLETRHGAQGSQWMLTKGIVGVVAKLGKVNDENL  169

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+ L+ YLG + MLAVVC  H S V        G +     L  LA ++  +I   +D I
Sbjct  170   SQTLSNYLGSRSMLAVVCKNHDSVVALEPYDNQGSIDRTAGLHGLAASIDWTIKDNFDAI  229

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL +++PY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  230   CLENLKPYVGQHIADDPQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  289

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             GLRETLFY L   LQVY  RD M  A  C  +  A+SLDG I+R  G+
Sbjct  290   GLRETLFYSLFSRLQVYKKRDDMISALPCITDG-AISLDGGIIRKPGI  336



>ref|XP_006404162.1| hypothetical protein EUTSA_v10010429mg [Eutrema salsugineum]
 gb|ESQ45615.1| hypothetical protein EUTSA_v10010429mg [Eutrema salsugineum]
Length=396

 Score =   172 bits (436),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 120/346 (35%), Positives = 179/346 (52%), Gaps = 17/346 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N + L+ ++    +  +Q E  L  L S+K+ +   I +L+  +    S     ++  
Sbjct  35    MFNSRRLQSDLEAMGRKIKQHEDNLLFLKSQKNKLDESILDLQVRMSQLQSSATPISENF  94

Query  922   ------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
                   E + EQI    +SAA +   L+++   S        K ++ VVA LG      L
Sbjct  95    GDNHQGEDVDEQILRYENSAAGV-LGLVQSRHGSQVSQLTLTKGVVGVVAQLGRVSDENL  153

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+ L++YLG + MLA+VC  + S  G       G +     L  L  ++G +I G +D I
Sbjct  154   SQALSDYLGTRSMLALVCKDYESVKGLESYDNQGNVDKNAGLHGLGASIGRNIEGHFDAI  213

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL  +RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   TA+G+
Sbjct  214   CLETLRPYVGQYIADDPQRRLDLLKPKLPNGEYPPGFLGFAVNMIQIVPAYLLCVTANGY  273

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IM  1611
             GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG I+R  G+ T    D   I 
Sbjct  274   GLRETLFYSLFSRLQVYKTRVDMINARPCISDG-AISLDGGIIRSGGIFTLGSCDEVNIR  332

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE  1749
             F      + M+  +     +  +K+KK +  E   DI+ E++  EE
Sbjct  333   FAKPIASRVMDNYSETEKQMREMKWKKDKTLE---DIKREQVLREE  375



>ref|XP_009149755.1| PREDICTED: uncharacterized protein LOC103873078 [Brassica rapa]
Length=414

 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 108/288 (38%), Positives = 157/288 (55%), Gaps = 11/288 (4%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             + N   L+ ++       ++ E  L+ L S+K+ +   I  L+  +G   +   C  +  
Sbjct  44    LFNSDRLQSDLEAMGNKIKEHEDNLKFLKSQKNKLDESILKLQVHMGKLHTSGTCTIENT  103

Query  922   ----ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                 E I EQI    +SAA +    +++   S  L  +    ++ VVA LG      LS+
Sbjct  104   NLQGEDINEQILRQVNSAAGV-LSYVQSHHYSEALQLDMTNGVVGVVAKLGKVNDQNLSQ  162

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L++YLG + MLA+V   + S     K    G +  + A+  LA+++G +I G +D+ICL
Sbjct  163   VLSDYLGTRSMLALVYKDYKSVKPLEKYDNQGNVDRSGAIHGLASSIGRTIEGRFDVICL  222

Query  1264  NDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
              ++RPY G+   G PQRRL +  P LPNGE PPGFLGYAVN+I I   +L   TA G+GL
Sbjct  223   ENLRPYVGKCIAGDPQRRLDLPNPKLPNGEYPPGFLGYAVNLIQIDPAYLLCVTAYGYGL  282

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTT  1584
             RETLFY L  +LQVY  R  M  A  C  +  AVSLDG I+R  G+ T
Sbjct  283   RETLFYSLFSQLQVYKTRVDMISALPCITDG-AVSLDGGIIRKTGIFT  329



>ref|XP_009381036.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=410

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/379 (32%), Positives = 197/379 (52%), Gaps = 28/379 (7%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQ---  903
             + D I +H + LEDE+       +  E  L+ L ++ ++I   I +++ ++G   S    
Sbjct  34    DVDFIKSHSQKLEDELQKLGLKIKHHEDNLKFLKAQMNSIDESILDMQVNLGKYHSSAGA  93

Query  904   ------NCCCTQESIMEQISGMGDSAAAIACKLI---ETPSSSVELHHEFAKEILVVVAL  1056
                   +   T++  +E I     +AA I C+L       +S + L     K++L +VA 
Sbjct  94    VDNNDFSTANTEKQTIENILKQEQTAAGIICQLKVYHAVQASKLPL----TKDVLGIVAT  149

Query  1057  LGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGT  1230
             LG      LSR+L++YLG + MLA+VC  +       K    G +  +  L  +   +G 
Sbjct  150   LGKVNDVNLSRVLSDYLGPENMLAIVCKTYEGVKELEKYDKEGMIDKSYGLHGIGKAIGR  209

Query  1231  SINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
              ++G Y + C+ ++RPY G  +   PQRRLA++KP LPNG+ PPGF+ +AVNMI +   H
Sbjct  210   HLDGRYLVFCIENLRPYIGGFVPEDPQRRLALLKPRLPNGDPPPGFIDFAVNMIDVDHMH  269

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTH  1587
             L   TASGHGLRETLFY L   LQVY  R  M  A   F +  A+SLDG IM+  G+   
Sbjct  270   LSCITASGHGLRETLFYNLFSRLQVYKTRSDMLRALP-FLSEGAISLDGGIMKSGGLFYL  328

Query  1588  AFGDPF-IMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINN  1758
                +   ++FP+ S   ++  +++ +  + L LL+++K +L E   D++ E      +  
Sbjct  329   GGRNCIEVIFPISSGISRLPTDVLEIE-EQLKLLRWQKERLLE---DMQREETLLNHVKT  384

Query  1759  KFIGFRDAYVNLTQGSSSV  1815
              F   ++ YV   + ++ +
Sbjct  385   MFSTKKEEYVKYLRETAQI  403



>gb|KEH35455.1| defective in meristem silencing protein [Medicago truncatula]
Length=417

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 171/304 (56%), Gaps = 32/304 (11%)
 Frame = +1

Query  733   SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             ++AD I+   + L+D++       +Q E +L +L ++KS +   I +L+ +IG S S + 
Sbjct  35    TKADMIIRESQKLQDDLRSLGMKIKQHEDKLSLLTTEKSQLDDAILHLQVAIGKSKSSST  94

Query  910   C----------CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHE-------FAKEI  1038
                         T+E + +QI     SAA I C+        V+ HH          +++
Sbjct  95    AKIGNADDLHITTEEEVNKQILQHEKSAAGILCQ--------VKTHHGAQASLLGLTQDV  146

Query  1039  LVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALST  1209
             + VVA+LG  E   LSR+ +EYLG + +LA+VC  +   V A +++   GY++ +  L  
Sbjct  147   VGVVAMLGKVEDDNLSRLFSEYLGVETVLAIVCRTY-EGVKALELYDKEGYINKSCGLHG  205

Query  1210  LANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNM  1386
             L  ++G  ++G + +ICL  +RPY G+  +   QR+L I+ P LPNGE P GF+G+AVNM
Sbjct  206   LGASIGRPLDGRFLVICLESLRPYAGKYVVDDSQRKLDILNPRLPNGECPAGFIGFAVNM  265

Query  1387  IHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMR  1566
             I+I  ++L   T SG+GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG ++R
Sbjct  266   INIDNRYLFCLTPSGYGLRETLFYNLFSRLQVYKTRAEMIQALPCISDG-ALSLDGGMIR  324

Query  1567  GNGV  1578
               GV
Sbjct  325   SCGV  328



>gb|KFK34215.1| hypothetical protein AALP_AA5G115500 [Arabis alpina]
Length=415

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 165/289 (57%), Gaps = 13/289 (4%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--LSSSQNCCCT-  918
             + N + L+ ++       +  E  L+ L S+K+ +   I +L+  +   LSS+     T 
Sbjct  47    LYNSQRLQSDLESMGNKIKHHEDNLKFLKSQKTKLDESIVDLQVVMSKLLSSATPNYDTN  106

Query  919   ---QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                ++ I EQI   G+SAA +    IE+   +        K ++ VVA LG      LS+
Sbjct  107   LQGEDIINEQILRCGNSAAGV-LGAIESRHGAQTSQLTMTKGVVGVVAKLGKVNDENLSQ  165

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGYDMIC  1260
             +L++YLG + MLAVVC  +  SV A +++   G +  +  +  L +++G +I G +D+IC
Sbjct  166   VLSDYLGTRSMLAVVCQNY-DSVKALEIYETQGNIDKSSGIYGLGSSIGRTIEGHFDVIC  224

Query  1261  LNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHG  1437
             L ++RPY G+ ++  PQRRL +VKP  PNGE PPGFLG+AVNM+ I   +L   T+ G+G
Sbjct  225   LENLRPYVGQHIADDPQRRLDLVKPKFPNGECPPGFLGFAVNMVQIDPAYLLCVTSYGYG  284

Query  1438  LRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTT  1584
             LRETLFY L   LQVY  R  M  A  C ++  A+SLDG I+R  G+ T
Sbjct  285   LRETLFYSLFSRLQVYKTRAEMISALPCISDG-AISLDGGIIRTVGIFT  332



>ref|XP_002321401.2| hypothetical protein POPTR_0015s01490g [Populus trichocarpa]
 gb|EEF05528.2| hypothetical protein POPTR_0015s01490g [Populus trichocarpa]
Length=425

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/375 (31%), Positives = 192/375 (51%), Gaps = 24/375 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG------LSSSQNC  909
             + N K L++++       +  E  ++ L S K+ +   I +L+ ++G      + +++N 
Sbjct  44    LYNSKKLQEDLHVLGMKIKHHEDNIKFLKSHKNKLDDSILDLQVTLGKYHSSTMPNNEND  103

Query  910   C----CTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                   +++  MEQI     SAA I C+L  +  + +  H  F  ++L VVA LG  +  
Sbjct  104   AHYSNQSEDETMEQILQHEKSAAGILCRLKMSHGTQIS-HPSFTNDVLGVVATLGKVDDD  162

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              L R+ +EYLG + MLA+VC  +    ++      G ++    L  L  ++G  ++G + 
Sbjct  163   NLGRLFSEYLGVETMLAIVCKTYEGVKALETYDKEGQINKDSGLHGLGASIGKELDGRFL  222

Query  1252  MICLN------DIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
              + +         RPY GE  +  PQRRL ++KP LPNGE PPGF+G+AVNMI++   +L
Sbjct  223   SVKIPLSVHFPFCRPYCGEFVVDDPQRRLDLLKPKLPNGECPPGFIGFAVNMINVEFTNL  282

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
              Y T SG+GLRETLFY L   LQVY  R+ M +A  C ++  A+SLDG +M+G G+ +  
Sbjct  283   FYLTGSGYGLRETLFYNLFSRLQVYRTREDMVLALPCISDG-AISLDGGMMKGTGIFSLG  341

Query  1591  FGDPF-IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
               +   + FP  S    +    +  D    LK  K +  ++  DI+ E+   +     F 
Sbjct  342   NRNNVDVRFPKLSVTSTLPDNYI--DTEKQLKETKWKREKMLEDIKREQALLDAAKQSFE  399

Query  1768  GFRDAYVNLTQGSSS  1812
               ++ +V     SS+
Sbjct  400   RKKEEFVKFLAQSSA  414



>gb|KHN35383.1| hypothetical protein glysoja_029013 [Glycine soja]
Length=342

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 165/290 (57%), Gaps = 30/290 (10%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC---------TQESIMEQISGMG  954
             +Q E  L+ L+S+ + +   IF+L+ S+    S N            T+E  MEQ+    
Sbjct  23    KQHEDNLKFLNSQSNQLAESIFDLQVSLARYHSTNVITLENGNGAFHTEEETMEQVMKKE  82

Query  955   DSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAV  1131
             +SAA+I   L +   +S++ L     K+++ VVA L   ES +LSRIL+E+LG + MLA+
Sbjct  83    NSAASIFSWLKVNAQTSNLTL----TKDVVGVVATLAKVESDDLSRILSEFLGLETMLAI  138

Query  1132  VCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIGP  1305
             VC+++       K    G ++    L  + +++G  ING    +         G ++  P
Sbjct  139   VCSSYEGINALEKYDPEGLINCNGGLHGIGSSIGKRINGRLPFV--------GGFVANDP  190

Query  1306  QRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVY  1485
             Q++LA+ KP LPNGE PPGFL YAVNMIH+ +K+L + T SG+GLRETLFY L   LQ+Y
Sbjct  191   QKKLALPKPRLPNGECPPGFLDYAVNMIHLDSKYLSFLTDSGYGLRETLFYGLFSRLQIY  250

Query  1486  ANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFPVFS  1626
               R+ M +A  C ++  A+SLDG ++RG G+   A G   D  + FP+ S
Sbjct  251   KTRNEMLLALPCIHDG-ALSLDGGMIRGRGM--FALGSRKDVEVKFPLIS  297



>ref|XP_010318020.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X2 [Solanum lycopersicum]
Length=437

 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 188/360 (52%), Gaps = 20/360 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             I N K LED +  +    +  E  ++ L + K+ +   I ++  ++G + S +   ++  
Sbjct  56    ICNSKKLEDAMQEFGLKIKHHEDNVKYLKAVKNELDDSILDIRVALGTTKSASETGSENK  115

Query  922   --------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                     E  +EQI     SAAAI C  ++  S +      F K+I+ +VALLG  +  
Sbjct  116   ESSNGQNEEETIEQILSFDKSAAAI-CVQLQKRSGTQITQIPFMKDIIGIVALLGKVDDD  174

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR L++YLG + ML VV        ++      G ++ +     L  ++G  ++  Y 
Sbjct  175   NLSRSLSDYLGLETMLGVVFKTRDGVKALETYDREGRINKSSGFHGLGASIGRPLDDRYL  234

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL D+RPYTG+ ++  PQRRL I KP   N E+PPGFLG+AVNMI+I   +L   T++
Sbjct  235   VICLEDLRPYTGKFIADDPQRRLDIKKPRYLNEETPPGFLGFAVNMINIDTANLYCVTST  294

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             G+GLRETLFYRL   LQVY  R  M  A     +  A+SLDG I++ +G+++    +  I
Sbjct  295   GYGLRETLFYRLFSRLQVYKTRADMLQALPLIADG-AISLDGGIIKSSGISSLGEREVKI  353

Query  1609  MFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
              FP+ S    +       ++ L  L++K+ +    L+  Q  +++ +  +E     F+ F
Sbjct  354   KFPMSSGRPNVPENYYETEIRLKELQWKRARFVDDLQREQTLLDHAKFNFEIKKQDFVKF  413



>ref|XP_007136522.1| hypothetical protein PHAVU_009G052300g [Phaseolus vulgaris]
 gb|ESW08516.1| hypothetical protein PHAVU_009G052300g [Phaseolus vulgaris]
Length=435

 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 197/375 (53%), Gaps = 21/375 (6%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCC  912
             +A  I+ H + LED++       +Q E  +  L+S+KS +   I +L+ +IG S S +  
Sbjct  51    QAQSIMQHSQKLEDDLRMLGTQIKQRENNINHLNSEKSKLDGSIIHLQVTIGKSESSSKA  110

Query  913   CT----------QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
                          E + +QIS    SAA I C+L +    +   H    K+++ +VA LG
Sbjct  111   TAGDIDNPPSTNDEEVDKQISQHEKSAAGILCQL-KIRHGAQASHLTTTKDVVGIVATLG  169

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTS  1233
               E   LSR+L+EYLG + MLA+VC  +   V A +M+   G ++ +  L  L  ++G +
Sbjct  170   KVEDDNLSRLLSEYLGVETMLAIVCKTY-EGVKALEMYDKEGCINKSYGLHGLGASIGRA  228

Query  1234  INGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++G + +ICL  +RPY G   +   QR+L I+ P LPNGE P GFLG+AVNMI++ + +L
Sbjct  229   LDGRFLVICLEYLRPYAGNHVVDDAQRKLDILNPRLPNGECPAGFLGFAVNMINVDSSNL  288

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                T +G+GLRETLFY L   LQVY  R  M  A  C +   A+SLDG I+R  GV T  
Sbjct  289   FCVTPNGYGLRETLFYNLFSRLQVYKTRAEMIQALPCISEG-ALSLDGGIIRSCGVFTLG  347

Query  1591  -FGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFI  1767
                D  + FP    E+ M L   + ++   LK  K +  ++  +++ E+   +     F 
Sbjct  348   NREDIDVRFP--RPERSMELDNHHGEISRQLKEVKWKKEKILEELKREQTLLDMTRLNFN  405

Query  1768  GFRDAYVNLTQGSSS  1812
               +  Y+     SSS
Sbjct  406   KKKGDYLKYLAQSSS  420



>ref|XP_004234969.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X1 [Solanum lycopersicum]
Length=439

 Score =   171 bits (432),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 188/360 (52%), Gaps = 20/360 (6%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             I N K LED +  +    +  E  ++ L + K+ +   I ++  ++G + S +   ++  
Sbjct  58    ICNSKKLEDAMQEFGLKIKHHEDNVKYLKAVKNELDDSILDIRVALGTTKSASETGSENK  117

Query  922   --------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                     E  +EQI     SAAAI C  ++  S +      F K+I+ +VALLG  +  
Sbjct  118   ESSNGQNEEETIEQILSFDKSAAAI-CVQLQKRSGTQITQIPFMKDIIGIVALLGKVDDD  176

Query  1078  ELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR L++YLG + ML VV        ++      G ++ +     L  ++G  ++  Y 
Sbjct  177   NLSRSLSDYLGLETMLGVVFKTRDGVKALETYDREGRINKSSGFHGLGASIGRPLDDRYL  236

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL D+RPYTG+ ++  PQRRL I KP   N E+PPGFLG+AVNMI+I   +L   T++
Sbjct  237   VICLEDLRPYTGKFIADDPQRRLDIKKPRYLNEETPPGFLGFAVNMINIDTANLYCVTST  296

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             G+GLRETLFYRL   LQVY  R  M  A     +  A+SLDG I++ +G+++    +  I
Sbjct  297   GYGLRETLFYRLFSRLQVYKTRADMLQALPLIADG-AISLDGGIIKSSGISSLGEREVKI  355

Query  1609  MFPVFSKEQQMNLMTVNPDV-LNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
              FP+ S    +       ++ L  L++K+ +    L+  Q  +++ +  +E     F+ F
Sbjct  356   KFPMSSGRPNVPENYYETEIRLKELQWKRARFVDDLQREQTLLDHAKFNFEIKKQDFVKF  415



>ref|XP_010915959.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Elaeis guineensis]
Length=396

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/389 (32%), Positives = 203/389 (52%), Gaps = 41/389 (11%)
 Frame = +1

Query  748   IVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQE  924
             + NH + L+D++   A   +  E  ++ L ++  NI   I +++ ++G   S +    Q 
Sbjct  17    VKNHTQKLQDDLQKLALKVKHHEDNMKFLKTQMDNIDESILDMQVNLGKYHSSSAALEQS  76

Query  925   S--------------IMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALL  1059
             +              I++Q+     +AA I C++ I     + +L  +  K++L +VA L
Sbjct  77    NDVSAIQSEQQTVGKILQQVK----TAAGIICQMKIRHGFQASKL--QLTKDVLGIVATL  130

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTS  1233
             G      LSR+ +EYLG + MLA+VC  +       K    G +     L  L  ++G  
Sbjct  131   GKVNDDNLSRLFSEYLGLETMLAIVCKTYEGVKALEKYDREGMIDKNAGLHGLGPSIGRL  190

Query  1234  INGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             +NG + + CL ++RPY GE +   PQ++LA++KP LPNGE+PPGF+G+AVNMI +   HL
Sbjct  191   LNGRFLVFCLENLRPYIGEFVPEDPQKKLALLKPRLPNGENPPGFIGFAVNMIDVDHMHL  250

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                T +GHGLRETLFY L   LQVY  R  M  A   F ++ A+SLDG +++ +G+    
Sbjct  251   SCLTPNGHGLRETLFYTLFSHLQVYKTRGDMQNALP-FISDGAISLDGGMIKSSGLFN--  307

Query  1591  FGD------PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEI  1752
              GD       F++ P  SK    N++ +  + L L+ ++K +L E   D++ E     + 
Sbjct  308   LGDRKDVEVKFLISPGISKPA--NVIEIE-EKLKLMSWQKERLAE---DVQREEALLNQA  361

Query  1753  NNKFIGFRDAYVN-LTQGSSSVQNTYS*A  1836
              N F   +  +V  L++ +S ++   S A
Sbjct  362   KNLFNIQKQEFVKYLSETASHIKQAQSMA  390



>ref|XP_004502653.1| PREDICTED: uncharacterized protein LOC101511352 [Cicer arietinum]
Length=433

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 124/381 (33%), Positives = 202/381 (53%), Gaps = 34/381 (9%)
 Frame = +1

Query  736   EADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC-  909
             +A++I+ H + L+D++       +Q E  L +L+ +KS +     +L+ +IG S S +  
Sbjct  51    KAENIIRHSQKLQDDLHTLGIKIKQHEDRLNLLNIEKSKLDDSSLHLQVTIGKSKSSSTP  110

Query  910   ---------CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLG  1062
                        T+E + +QI     +AA I C++     +   L    +K+++ +VA+LG
Sbjct  111   KTGNADDSHSTTEEEVNKQILQHEKTAAGILCQVKTRHGAQASLL-TLSKDVVGIVAMLG  169

Query  1063  FAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTS  1233
               E   LSR+ +EYLG   MLA+VC  +   V A +M+   G ++ +  L  L   +G +
Sbjct  170   KVEDDNLSRLFSEYLGVDTMLAIVCRTY-EGVSALEMYDREGCINKSCGLHGLGATIGRA  228

Query  1234  INGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHL  1410
             ++G + +ICL  +RPY G+  +   QR+L I+ P LPNGE P GF+G+AVNMI+I + +L
Sbjct  229   LDGRFLVICLESLRPYAGKFVVDDSQRKLDILNPRLPNGECPAGFMGFAVNMINIDSWNL  288

Query  1411  QYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHA  1590
                T SG+GLRETLFY L   LQVY  R  M  A  C ++  A+SLDG ++R  GV   +
Sbjct  289   FCVTPSGYGLRETLFYNLFSRLQVYKTRAEMIQALPCISDG-ALSLDGGMVRSCGV--FS  345

Query  1591  FG---DPFIMFP----VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEE  1749
              G   D  + FP    V   + Q+ +     DV    ++KK    ++ +D++ ER   + 
Sbjct  346   LGNREDVDVRFPRPERVAGIDDQIEIERQMKDV----QWKK---EKILDDLKRERALLDM  398

Query  1750  INNKFIGFRDAYVNLTQGSSS  1812
                 F   ++ ++     SSS
Sbjct  399   AKFNFNKKKNDFLKFLASSSS  419



>gb|EEE54191.1| hypothetical protein OsJ_01023 [Oryza sativa Japonica Group]
Length=416

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 196/387 (51%), Gaps = 28/387 (7%)
 Frame = +1

Query  754   NHKMLEDE-------VIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCC  912
             N K+++DE       V H+ +  R  + EL  ++   +++  +I N   S+   ++ +  
Sbjct  23    NSKVMQDELQKLALKVNHHEENIRFLKSELNAVEDSCADLGIKIGNYYSSMAAIANNDTS  82

Query  913   C--TQESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
                 ++  ++ I    ++AA I C+L I     + +L     K++L VVA LG   +  L
Sbjct  83    VEEAEQRTIQSILKQDETAAGIICQLKIRHYQHASKL--PLMKDVLGVVATLGKINNDNL  140

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMI  1257
             SR+L+EYLG   ML VVC  +    G       G +     +  L   +G  ++G + + 
Sbjct  141   SRVLSEYLGLDNMLGVVCKTYDGVEGLETYDKEGMVDKTSGIHGLGRTIGKFLDGRFTVF  200

Query  1258  CLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL +IRP++G+  I  PQR+L + KP LP+GE PPGFLG+AVNMIH+   +L   TA GH
Sbjct  201   CLENIRPFSGDFMIDDPQRKLLLHKPRLPSGEFPPGFLGFAVNMIHLDQANLSCLTAGGH  260

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---  1605
             GLRETLFY L  +LQVY  R  +  A    N+  AVSLDG I+R NG  +   G+     
Sbjct  261   GLRETLFYSLFSQLQVYKTRAELRNAIPLINDG-AVSLDGSILRPNG--SFCLGNRASLG  317

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRD--  1779
             I FPV +     NL     ++   +K+K  +   +  DI+ +     ++ + F   ++  
Sbjct  318   IQFPVTANLGVSNLPVTITELEEQVKHKNWEKERLLEDIKRQEDLLNQVKDLFSKKKEQF  377

Query  1780  -AYVN----LTQGSSSVQNTYS*ARPG  1845
              AY+     L + S +     S A PG
Sbjct  378   MAYITQPGMLQRASQASPTIPSPATPG  404



>ref|NP_001042520.1| Os01g0235200 [Oryza sativa Japonica Group]
 dbj|BAD81261.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD81389.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04434.1| Os01g0235200 [Oryza sativa Japonica Group]
 dbj|BAG88963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=418

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 196/387 (51%), Gaps = 28/387 (7%)
 Frame = +1

Query  754   NHKMLEDE-------VIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCC  912
             N K+++DE       V H+ +  R  + EL  ++   +++  +I N   S+   ++ +  
Sbjct  23    NSKVMQDELQKLALKVNHHEENIRFLKSELNAVEDSCADLGIKIGNYYSSMAAIANNDTS  82

Query  913   C--TQESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
                 ++  ++ I    ++AA I C+L I     + +L     K++L VVA LG   +  L
Sbjct  83    VEEAEQRTIQSILKQDETAAGIICQLKIRHYQHASKL--PLMKDVLGVVATLGKINNDNL  140

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMI  1257
             SR+L+EYLG   ML VVC  +    G       G +     +  L   +G  ++G + + 
Sbjct  141   SRVLSEYLGLDNMLGVVCKTYDGVEGLETYDKEGMVDKTSGIHGLGRTIGKFLDGRFTVF  200

Query  1258  CLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL +IRP++G+  I  PQR+L + KP LP+GE PPGFLG+AVNMIH+   +L   TA GH
Sbjct  201   CLENIRPFSGDFMIDDPQRKLLLHKPRLPSGEFPPGFLGFAVNMIHLDQANLSCLTAGGH  260

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---  1605
             GLRETLFY L  +LQVY  R  +  A    N+  AVSLDG I+R NG  +   G+     
Sbjct  261   GLRETLFYSLFSQLQVYKTRAELRNAIPLINDG-AVSLDGSILRPNG--SFCLGNRASLG  317

Query  1606  IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRD--  1779
             I FPV +     NL     ++   +K+K  +   +  DI+ +     ++ + F   ++  
Sbjct  318   IQFPVTANLGVSNLPVTITELEEQVKHKNWEKERLLEDIKRQEDLLNQVKDLFSKKKEQF  377

Query  1780  -AYVN----LTQGSSSVQNTYS*ARPG  1845
              AY+     L + S +     S A PG
Sbjct  378   MAYITQPGMLQRASQASPTIPSPATPG  404



>ref|XP_006645689.1| PREDICTED: uncharacterized protein LOC102704662 [Oryza brachyantha]
Length=458

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 188/375 (50%), Gaps = 26/375 (7%)
 Frame = +1

Query  775   EVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC--TQESIMEQISG  948
             +V H+ +  R    EL +++   +++  +I N   S+   S+ +      ++  ++ I  
Sbjct  80    KVNHHEENIRFLRSELNVIEELCADLGIKIGNYYSSMAAISNNDTSVEEAEQRTIQSILN  139

Query  949   MGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQML  1125
               ++AA I C+L +     + +L     K++L +VA LG      LSRIL+EYLG   ML
Sbjct  140   QDETAAGIICQLKVRHYQHASKL--PLVKDVLGIVATLGKLNDDNLSRILSEYLGLDNML  197

Query  1126  AVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSI  1299
              VVC  +    G       G +     +  L   +G  ++G + + CL +IRP++G+L I
Sbjct  198   GVVCKTYDGVKGLETYDKEGIIDKTSGIHGLGRTIGKFVDGRFTVFCLENIRPFSGDLMI  257

Query  1300  G-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGEL  1476
               PQR+L + KP LPNGE PPGFLG+AVN+IH+   +L   TA GHGLRETLFY L   L
Sbjct  258   NDPQRKLLLHKPRLPNGEIPPGFLGFAVNLIHLDQTNLSCLTAGGHGLRETLFYSLFSHL  317

Query  1477  QVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---IMFPVFSKEQQMNL  1647
             QVY  R  +  A    N+  AVSLDG I+R NG  +   G+     I FPV       NL
Sbjct  318   QVYKTRAELRNAIPLINDG-AVSLDGAILRPNG--SFCLGNRTSLGIKFPVTVNLGVSNL  374

Query  1648  MTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFR---------DAYVNLTQ  1800
                  ++   +K+K  +   +  D++ E     ++ + F   +          A V   Q
Sbjct  375   PGTITELEEQVKHKNWEKERLLEDMKREGDLLSQVKDLFSKKKHQLMEYLTQPAMVQRVQ  434

Query  1801  GSSSVQNTYS*ARPG  1845
             GS +V+   S A PG
Sbjct  435   GSPTVR---SPATPG  446



>ref|XP_006350631.1| PREDICTED: uncharacterized protein LOC102602167 [Solanum tuberosum]
Length=478

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 192/375 (51%), Gaps = 28/375 (7%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             I N K LED +       +  E  ++ L ++K+ +   I ++   +G + S +   ++  
Sbjct  97    ICNSKKLEDAMQEIGLKIKHHEDNVKFLKAQKNRLDDSILDIRVVLGKTHSASETGSENK  156

Query  922   --------ESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                     E  +EQI     SAA+I  +L +   + +  H  F K+++ +VALLG  +  
Sbjct  157   ESSNGQNEEETIEQILSFDKSAASICVQLQKRTGTQIT-HIPFMKDMIGIVALLGKVDDD  215

Query  1078  ELSRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYD  1251
              LSR L++YLG + ML VVC       ++      G ++ +  L  L  ++G  ++  Y 
Sbjct  216   NLSRTLSDYLGLETMLGVVCKTRDGHKALETYDKEGLINKSSGLHGLGASIGKPLDDRYL  275

Query  1252  MICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             +ICL ++RPY G  ++  PQRRL I KP   N E+PPGFLG+AVNMI+I   +L   T++
Sbjct  276   VICLENLRPYAGTFIADDPQRRLDIKKPRYLNEETPPGFLGFAVNMINIDTANLYCVTST  335

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFI  1608
             GHGLRETLFYRL   LQVY  R  M  A     +  A+SLDG I++  G+++    +  I
Sbjct  336   GHGLRETLFYRLFSHLQVYKTRADMLQALPLIADG-AISLDGGIIKSGGISSLGEREVKI  394

Query  1609  MFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIG  1770
              FP  S    +  N      + +  LK+K+ +    L+  Q  +++ +  +E    +F+ 
Sbjct  395   KFPKSSGRPNVPENYYETE-NRMKELKWKRARFVDDLQREQTLLDHAKFNFEIKKQEFVK  453

Query  1771  FRDAYVNLTQGSSSV  1815
             F      L Q SS V
Sbjct  454   F------LAQSSSYV  462



>ref|NP_566916.1| protein defective in meristem silencing 3 [Arabidopsis thaliana]
 sp|Q94A79.1|DMS3_ARATH RecName: Full=Protein DEFECTIVE IN MERISTEM SILENCING 3; AltName: 
Full=Protein INVOLVED IN DE NOVO 1 [Arabidopsis thaliana]
 gb|AAK83630.1| AT3g49250/F2K15_110 [Arabidopsis thaliana]
 gb|AAL90947.1| AT3g49250/F2K15_110 [Arabidopsis thaliana]
 gb|AEE78515.1| protein defective in meristem silencing 3 [Arabidopsis thaliana]
Length=420

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/288 (39%), Positives = 157/288 (55%), Gaps = 13/288 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG-LSSS-------Q  903
             + N K LE ++       +Q E  L+ L S+K+ +   I +L+  +  L+SS        
Sbjct  50    MFNSKRLESDLEAMGNKIKQHEDNLKFLKSQKNKMDEAIVDLQVHMSKLNSSPTPRSENS  109

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I  QI    +SAA +   L+ET   +        K ++ VVA LG      L
Sbjct  110   DNSLQGEDINAQILRHENSAAGV-LSLVETLHGAQASQLMLTKGVVGVVAKLGKVNDENL  168

Query  1084  SRILAEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+IL+ YLG + MLAVVC  + S  ++ A   HG +     L  L +++G  I   +D I
Sbjct  169   SQILSNYLGTRSMLAVVCRNYESVTALEAYDNHGNIDINAGLHCLGSSIGREIGDSFDAI  228

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  229   CLENLRPYVGQHIADDLQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  288

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+
Sbjct  289   GLRETLFYNLFSRLQVYKTRADMISALPCISDG-AVSLDGGIIRKTGI  335



>ref|XP_009336764.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Pyrus 
x bretschneideri]
Length=349

 Score =   166 bits (421),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 171/291 (59%), Gaps = 18/291 (6%)
 Frame = +1

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIAC--KLIETPSSSVELHHEFAKEILVVV---ALL  1059
             +++N   T+E   +QI     SAA + C  KL+E+  ++  L+    K++L +V   A L
Sbjct  52    TNENGPTTEEE--DQILQYEKSAAGLLCRLKLLESQHATQALNLALTKDVLGIVGIVATL  109

Query  1060  GFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHG---YLSSADALSTLANNLGT  1230
             G  +  +LSR+L+EYLG + MLA+VC  + + +   K  G    L+SA  +  L  ++G 
Sbjct  110   GRVDDDKLSRLLSEYLGLETMLAIVCRTNEAVMVLEKYDGDGTILTSA-GIHGLGASMGK  168

Query  1231  SINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKH  1407
             SI G + +ICL+++ PY G  ++  PQR+L I KP LPNGE P GFL YAVN I++ + +
Sbjct  169   SIRGRFLVICLDELSPYVGGFVADDPQRKLDIPKPQLPNGECPHGFLDYAVNTINLDSNN  228

Query  1408  LQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TT  1584
             L   T+SGHGLRETLFY LL  LQ+Y  R  M +A  C N+  A+SLDG I++ +GV   
Sbjct  229   LVNVTSSGHGLRETLFYSLLSRLQIYRTRAEMLLALPCINHG-ALSLDGGIIKKSGVFIL  287

Query  1585  HAFGDPFIMFPVFSKEQQMNLMTVNPD-VLNLLKYKKVQLREVQNDIENER  1734
              +  D  I F   S E     MTVN D   +++K  K++   V  D++ E+
Sbjct  288   GSSKDIEIKFLAKSGEPS---MTVNYDETEDMIKKLKLKRTHVTEDMQREQ  335



>ref|XP_008233132.1| PREDICTED: uncharacterized protein LOC103332195 [Prunus mume]
Length=355

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 113/323 (35%), Positives = 174/323 (54%), Gaps = 34/323 (11%)
 Frame = +1

Query  850   IQTEIFNLEESI----------------GLSSSQNCCCTQESIMEQISGMGDSAAAIACK  981
             +Q+EI  L ESI                G ++       ++   EQI     SAA++ C+
Sbjct  25    LQSEINRLSESILDLQVSLGKHLPANGTGTTNESGATLAEKDETEQILRHEKSAASLLCR  84

Query  982   L--IETPSSSVELHHEFAKEILVVV---ALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             L  +++  ++  L+    K++L +V   A LG      LSR+L+EYLG + MLA+VC  +
Sbjct  85    LELLKSHHATQALNLALTKDVLGIVGIVATLGRVHDDNLSRLLSEYLGLETMLAIVCKTY  144

Query  1147  ASSVGASKMHGYLSSADALST-----LANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQ  1308
                 G   +  Y +    +ST     L +++G SI G + +ICL D+ PY G  ++  PQ
Sbjct  145   E---GVKVLEKYDADGTIISTAGIHGLGSSIGKSIKGRFLVICLEDLSPYVGGFVADDPQ  201

Query  1309  RRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYA  1488
             R+L++ KP LPNGE PPGFL YAVN I++  K+L   T+ GHGLRETLFY L   LQ+Y 
Sbjct  202   RKLSLPKPKLPNGECPPGFLDYAVNTINLDDKNLDCLTSGGHGLRETLFYSLFSCLQIYR  261

Query  1489  NRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMFPVFSKEQQMNLMTVNPD  1665
              R  M +A  C N+  A+SLDG +++ +GV    +  D  + FP  S E  M    +  +
Sbjct  262   TRAEMRLALPCINDG-ALSLDGGVIKKSGVFILGSRKDIEVKFPATSGESSMPAKYL--E  318

Query  1666  VLNLLKYKKVQLREVQNDIENER  1734
             + +++K  K +   V  D++ E+
Sbjct  319   IEDMIKKLKWERSHVTEDMQREQ  341



>ref|XP_008376083.1| PREDICTED: uncharacterized protein LOC103439318 [Malus domestica]
Length=348

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 157/270 (58%), Gaps = 16/270 (6%)
 Frame = +1

Query  958   SAAAIAC--KLIETPSSSVELHHEFAKEILVVV---ALLGFAESYELSRILAEYLGEKQM  1122
             SAA + C  KL+++  +S  L+    K++L +V   A LG  E   LSR+L+EYLG + M
Sbjct  71    SAAGLLCRLKLLKSQHASQALNLALTKDVLGIVGIVATLGRVEDDNLSRLLSEYLGLETM  130

Query  1123  LAVVCNAHASSVGASKMHG---YLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-  1290
             LA+VC    + +   K  G    L+SA  +  L  ++G SI G + +ICL+D+ PY G  
Sbjct  131   LAIVCRTSEAVMVLEKYDGDGTVLTSA-GIHGLGVSIGKSIKGRFLVICLDDLSPYVGGF  189

Query  1291  LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLG  1470
             ++  PQR+LA+ KP LPNGE P GFL YAVN I++   +L   T+SGHGLRETLFY L  
Sbjct  190   VADDPQRKLALPKPQLPNGECPRGFLDYAVNTINLDGNNLVNVTSSGHGLRETLFYSLFS  249

Query  1471  ELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMFPVFSKEQQMNL  1647
              LQ+Y  R  M +A  C N+  A+SLDG I++ +GV    +  D  I F   S E     
Sbjct  250   RLQIYRTRAEMLLALPCINHG-ALSLDGGIIKKSGVFILGSSKDTEIKFLAKSGESS---  305

Query  1648  MTVNPD-VLNLLKYKKVQLREVQNDIENER  1734
             MT N D   +++K  K + + V  D++ E+
Sbjct  306   MTANYDETEDMIKKLKFKRKHVAEDMQREQ  335



>ref|XP_004967373.1| PREDICTED: uncharacterized protein LOC101755838 isoform X2 [Setaria 
italica]
Length=388

 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 137/241 (57%), Gaps = 15/241 (6%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             T  SI++Q      +AAAI C+L     S +       K+IL  VA LG   +  LSR+L
Sbjct  64    TVRSILDQ----DRTAAAIICQL--KLRSELASKMPLMKDILGFVATLGKVNNDNLSRLL  117

Query  1096  AEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDMICLND  1269
             AEYLG   MLA+VC  +    G  K    G +  +  +  L  ++G  +NG + + CL +
Sbjct  118   AEYLGMDNMLALVCKTYNGVKGLEKYDKDGIIDKSSGIHGLGRSVGKLLNGRFTVFCLEN  177

Query  1270  IRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RP++G+++I  PQR+L + +P  P GESP GFL +AVNMIH+   HL   TASGHGLRE
Sbjct  178   LRPFSGDVNIDDPQRKLILHRPRFPGGESPAGFLDFAVNMIHLDRAHLSCLTASGHGLRE  237

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---IMFP  1617
             TLFY L   LQVY  R  +  A    N+  AVSLDG I++ NG  +   GD     + FP
Sbjct  238   TLFYSLFSHLQVYKTRSDIQRALPLINDG-AVSLDGGILKPNG--SFCLGDSKNLEVKFP  294

Query  1618  V  1620
             V
Sbjct  295   V  295



>ref|XP_004967372.1| PREDICTED: uncharacterized protein LOC101755838 isoform X1 [Setaria 
italica]
Length=405

 Score =   166 bits (421),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 162/305 (53%), Gaps = 20/305 (7%)
 Frame = +1

Query  751   VNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG---------LSSSQ  903
             +N K++E+++        + E  L+ L S+ + I+    +L   +G         +++  
Sbjct  13    LNCKVMEEKLKSLGSEVNRHEDNLRFLKSEINAIEEACVDLAIKLGNYHSSVAAVMNNDT  72

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +    +E  +  I     +AAAI C+L     S +       K+IL  VA LG   +  L
Sbjct  73    SAQEAEERTVRSILDQDRTAAAIICQL--KLRSELASKMPLMKDILGFVATLGKVNNDNL  130

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDMI  1257
             SR+LAEYLG   MLA+VC  +    G  K    G +  +  +  L  ++G  +NG + + 
Sbjct  131   SRLLAEYLGMDNMLALVCKTYNGVKGLEKYDKDGIIDKSSGIHGLGRSVGKLLNGRFTVF  190

Query  1258  CLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RP++G+++I  PQR+L + +P  P GESP GFL +AVNMIH+   HL   TASGH
Sbjct  191   CLENLRPFSGDVNIDDPQRKLILHRPRFPGGESPAGFLDFAVNMIHLDRAHLSCLTASGH  250

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---  1605
             GLRETLFY L   LQVY  R  +  A    N+  AVSLDG I++ NG  +   GD     
Sbjct  251   GLRETLFYSLFSHLQVYKTRSDIQRALPLINDG-AVSLDGGILKPNG--SFCLGDSKNLE  307

Query  1606  IMFPV  1620
             + FPV
Sbjct  308   VKFPV  312



>ref|XP_004967374.1| PREDICTED: uncharacterized protein LOC101755838 isoform X3 [Setaria 
italica]
Length=376

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 137/241 (57%), Gaps = 15/241 (6%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             T  SI++Q      +AAAI C+L     S +       K+IL  VA LG   +  LSR+L
Sbjct  52    TVRSILDQ----DRTAAAIICQL--KLRSELASKMPLMKDILGFVATLGKVNNDNLSRLL  105

Query  1096  AEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDMICLND  1269
             AEYLG   MLA+VC  +    G  K    G +  +  +  L  ++G  +NG + + CL +
Sbjct  106   AEYLGMDNMLALVCKTYNGVKGLEKYDKDGIIDKSSGIHGLGRSVGKLLNGRFTVFCLEN  165

Query  1270  IRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RP++G+++I  PQR+L + +P  P GESP GFL +AVNMIH+   HL   TASGHGLRE
Sbjct  166   LRPFSGDVNIDDPQRKLILHRPRFPGGESPAGFLDFAVNMIHLDRAHLSCLTASGHGLRE  225

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---IMFP  1617
             TLFY L   LQVY  R  +  A    N+  AVSLDG I++ NG  +   GD     + FP
Sbjct  226   TLFYSLFSHLQVYKTRSDIQRALPLINDG-AVSLDGGILKPNG--SFCLGDSKNLEVKFP  282

Query  1618  V  1620
             V
Sbjct  283   V  283



>ref|XP_008466829.1| PREDICTED: uncharacterized protein LOC103504141 [Cucumis melo]
Length=408

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 174/332 (52%), Gaps = 31/332 (9%)
 Frame = +1

Query  703   YKAPKLEHDESEADH----IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
             +K PK E  + E  H     ++ K L+D++       +  E  ++ L + K  +   I +
Sbjct  9     FKVPKDEMQDVELSHEDPINLHSKKLQDDLQTMGMKIQLHEDNIRFLRTLKDKLVDSIID  68

Query  871   LEESIGL----------------SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSS  1002
             L+  +G                 + S++    Q++I++Q     +SAA+I C L   P  
Sbjct  69    LQVILGKYHASNSPKIENKDGSDTQSEDKPSYQKAILQQ----ENSAASILCHLKTNPKM  124

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMH  1176
              +      ++++L VVA LG  E   LS +L+EYLG + M A+VC  +    S+      
Sbjct  125   -LASDPTMSEDVLGVVAELGHVEDDTLSSLLSEYLGTETMSAIVCKTYNGVKSLEKYDTD  183

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G ++    L     +LG ++ G +++I L  +RPY+GE ++  PQRRL I KP LPNG+ 
Sbjct  184   GGINKTSGLHGFGTSLGKTLEGRFNVISLETLRPYSGEFVADDPQRRLDIPKPRLPNGDC  243

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
             P GFLGYAVNMI+I   HL + TASG+GLRETLFY L   LQ+Y  R  M  A  C  + 
Sbjct  244   PAGFLGYAVNMINIDRTHLFFLTASGYGLRETLFYSLFFCLQIYKTRTEMLQAVPCITDG  303

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSK  1629
              A+SLDG I++ +G+     G+   M   FSK
Sbjct  304   -ALSLDGGIIKRSGL--FCLGNRGDMKATFSK  332



>ref|XP_002454876.1| hypothetical protein SORBIDRAFT_03g000600 [Sorghum bicolor]
 gb|EER99995.1| hypothetical protein SORBIDRAFT_03g000600 [Sorghum bicolor]
Length=388

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/247 (42%), Positives = 137/247 (55%), Gaps = 26/247 (11%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFA------KEILVVVALLGFAESY  1077
             T  SI++Q +    +AA I C+L          HHE A      K IL  VA LG   + 
Sbjct  64    TIRSILDQDT----TAAGIICQLKVR-------HHELASKMTLMKGILGFVATLGKVNND  112

Query  1078  ELSRILAEYLGEKQMLAVVCNAHASSVGASKMH--GYLSSADALSTLANNLGTSINGGYD  1251
              LSR+L EYLG   MLA+VC  +       K    G +     +  L  ++G  ++G + 
Sbjct  113   NLSRLLTEYLGMDNMLALVCKTYDGVKDLEKYDKDGIIDKTSGVHGLGRSVGKFLDGRFT  172

Query  1252  MICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTAS  1428
             + CL ++RP++G+++IG PQR+L + +P LP GESPPGFL +AVNMIH+   HL   TAS
Sbjct  173   VFCLENLRPFSGDINIGDPQRKLILHRPRLPGGESPPGFLDFAVNMIHLDRAHLSCLTAS  232

Query  1429  GHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-  1605
             GHGLRETLFY L   LQVY  R  +  A     +  AVSLDG I+R NG  +   GD   
Sbjct  233   GHGLRETLFYTLFSHLQVYKTRADIQSALPLIKDG-AVSLDGGILRPNG--SFCLGDSKN  289

Query  1606  --IMFPV  1620
               + FPV
Sbjct  290   LEVRFPV  296



>ref|XP_008783197.1| PREDICTED: uncharacterized protein LOC103702511 isoform X2 [Phoenix 
dactylifera]
Length=392

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 186/359 (52%), Gaps = 31/359 (9%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ--  921
             I++++ L+DE+   A   +  E  ++ L ++  NI   I +++ ++G   S +    Q  
Sbjct  5     ILSYEKLQDELQKLALKVKHHEDNMKFLKTQMDNIDESILDMQVNLGKYHSSSAALEQNN  64

Query  922   --------ESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAES  1074
                     +  + +I     +AA I C++ I     + +L  +  K++L +VA LG    
Sbjct  65    DVSAMQSEQQTVGKILQQEKAAAGIICQMKIRHGLQASKL--QLTKDVLGIVATLGKVND  122

Query  1075  YELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGY  1248
               LSR+ +EYLG + MLA+VC  +       K    G +     L  L  ++G  +NG +
Sbjct  123   DNLSRLFSEYLGLETMLAIVCKTYEGIKALEKYDKEGMIDKNAGLHGLGPSIGRLLNGRF  182

Query  1249  DMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTA  1425
              + CL ++RPY GE +   PQ++LA++KP LPNGE P GF+G+AVNMI++   HL   T 
Sbjct  183   LVFCLENLRPYIGEFVPEDPQKKLALLKPRLPNGEIPRGFIGFAVNMINVDHMHLSCLTP  242

Query  1426  SGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGD--  1599
             +GHGLRETLFY L   LQVY  R  M  A  C ++  A+SLDG +++ +G+     GD  
Sbjct  243   NGHGLRETLFYTLFSRLQVYKTRADMQSALPCVSDG-AISLDGGMIKSSGLFN--LGDRK  299

Query  1600  ----PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                  F + P  SK   ++ +    + L L+ ++K +L E   D++ E        N F
Sbjct  300   DVEVKFPISPGISKPADVSEIE---EKLKLMNWQKERLEE---DVQREEALLNNAKNLF  352



>gb|EEC70256.1| hypothetical protein OsI_01056 [Oryza sativa Indica Group]
Length=344

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 157/290 (54%), Gaps = 16/290 (6%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAESYELSRI  1092
             T +SI++Q     ++AA I C+L I     + +L     K++L VVA LG   +  LSR+
Sbjct  18    TIQSILKQ----DETAAGIICQLKIRHYQHASKL--PLMKDVLGVVATLGKINNDNLSRV  71

Query  1093  LAEYLGEKQMLAVVCNAHASSVG--ASKMHGYLSSADALSTLANNLGTSINGGYDMICLN  1266
             L+EYLG   ML VVC  +    G       G +     +  L   +G  ++G + + CL 
Sbjct  72    LSEYLGLDNMLGVVCKTYDGVEGLETYDKEGMVDKTSGIHGLGRTIGKFLDGRFTVFCLE  131

Query  1267  DIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
             +IRP++G+  I  PQR+L + KP LP+GE PPGFLG+AVNMIH+   +L   TA GHGLR
Sbjct  132   NIRPFSGDFMIDDPQRKLLLHKPRLPSGEFPPGFLGFAVNMIHLDQANLSCLTAGGHGLR  191

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF---IMF  1614
             ETLFY L  +LQVY  R  +  A    N+  AVSLDG I+R NG  +   G+     I F
Sbjct  192   ETLFYGLFSQLQVYKTRAELRNAIPLINDG-AVSLDGSILRPNG--SFCLGNRASLGIQF  248

Query  1615  PVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
             PV +     NL     ++   +K+K  +   +  DI+ +     ++ + F
Sbjct  249   PVTANLGVSNLPVTITELEEQVKHKNWEKERLLEDIKRQEDLLNQVKDLF  298



>ref|XP_004306658.1| PREDICTED: uncharacterized protein LOC101309380 [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 150/267 (56%), Gaps = 25/267 (9%)
 Frame = +1

Query  850   IQTEIFNLEESI----------------GLSSSQNCCCTQESIMEQISGMGDSAAAIACK  981
             +QTEI  L +SI                G +        +E   EQI     SAAA+ CK
Sbjct  22    LQTEIKRLSQSILNVQVSLANHHSGNGNGATDENGATRMEEEETEQIMRHERSAAALLCK  81

Query  982   L--IETPSSSVELHHEFAKEILV---VVALLGFAESYELSRILAEYLGEKQMLAVVCNAH  1146
             L  +++  ++  L+    +++L    VVA LG  +S +LSRIL+EYLG + MLA+VC   
Sbjct  82    LKPMKSHHATQALNLTLTQDVLGIVGVVASLGRVDSDDLSRILSEYLGLETMLAIVCRTF  141

Query  1147  ASSVGASKMH--GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRL  1317
                    K    G + S+  +  L +++  SI G + ++CL D+RPY G  ++  PQR+L
Sbjct  142   ECVKVLEKYDKDGMIISSAGIHGLGSSIKNSIKGRFQVLCLEDLRPYVGGFVADNPQRKL  201

Query  1318  AIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRD  1497
             A+ KP  PNGE P GFL YAVNMI++  ++L   T +GHGLRETLFY L   LQVY  R 
Sbjct  202   ALPKPQFPNGECPHGFLDYAVNMINLDKRNLLSLTTAGHGLRETLFYSLFSRLQVYKTRR  261

Query  1498  CMCMASSCFNNNPAVSLDGVIMRGNGV  1578
              M +A  C N+  A+SLDG +++ +GV
Sbjct  262   EMLLALPCINDG-ALSLDGGMIKPSGV  287



>ref|XP_010426429.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Camelina 
sativa]
Length=419

 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 185/368 (50%), Gaps = 18/368 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--------LSSSQ  903
             I N K L+ ++       +Q E  L+ L ++K+ +   I +L+  +          S + 
Sbjct  56    IFNSKRLQSDLEVMGNKIKQHEDNLKFLKAQKTKLDEAILDLQVQMSKLQSSPAPTSENS  115

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I EQI     SAA +   L+ET   +        K ++ VVA L       L
Sbjct  116   DANLQGEDINEQILRHAKSAAGV-LGLVETSHGAQASQWMQTKGVVGVVAKLAKVNDENL  174

Query  1084  SRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+IL+ YLG + MLAVVC  +   +++ +    G +     L  L  ++  +I   +D+I
Sbjct  175   SQILSNYLGTRLMLAVVCKNYDNVTALESYDNQGNIDRNAGLHGLGASIDRTIEDNFDVI  234

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  235   CLENLRPYVGKHIAHDPQRRLDLLKPRLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  294

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IM  1611
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+      D   + 
Sbjct  295   GLRETLFYSLFSRLQVYKTRVDMVSALPCISDG-AVSLDGGIIRTPGIINLGNRDEVSVR  353

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYV-  1788
             F        M+        +  L++KK +  E   DI+ E++  E     F   ++ +V 
Sbjct  354   FAKPIASGTMDNYNETEKKMKELRWKKDKTLE---DIKREQVLREHAVLNFGKKKEEFVL  410

Query  1789  NLTQGSSS  1812
              LTQ SS+
Sbjct  411   CLTQSSST  418



>ref|XP_006350539.1| PREDICTED: uncharacterized protein LOC102601162 isoform X1 [Solanum 
tuberosum]
Length=390

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 167/297 (56%), Gaps = 9/297 (3%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--LSSSQNCCCTQ  921
             I   K LED V       +  E  ++ L+ +K+ +   I ++E ++G   S+S      +
Sbjct  56    ICKSKKLEDAVKEIGLQIKHHEDNIKFLEGQKNRLDDSISDIEVALGKIYSASGTGSENK  115

Query  922   ESI--MEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             ES     ++  + +     +C+L  T + +   H  + K+++ +VALLG  +   LSR L
Sbjct  116   ESSNGKNELETIEEILTLNSCQL-PTHNGTQITHIPYMKDVIGMVALLGKVDDDNLSRTL  174

Query  1096  AEYLGEKQMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             ++YLG++ MLAVVC  H    ++      G ++ +  L  +  ++G  ++  Y +ICL +
Sbjct  175   SDYLGQETMLAVVCKKHDGLKALQTYDKKGLVNKSSGLHGVGASIGRPLDDRYLVICLEN  234

Query  1270  IRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPYTGE ++  PQRRL+I KP   N E+PPGFLG+AVNMI+I   +L   T++GHGLRE
Sbjct  235   LRPYTGEFIADDPQRRLSIKKPRYLNEETPPGFLGFAVNMINIDTANLYCVTSTGHGLRE  294

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFP  1617
             TLFYRL   LQVY     M M +  F  + A+SLDG I++  G+ +    +  I FP
Sbjct  295   TLFYRLFSRLQVYKTGADM-MQALPFIADGAISLDGGIIKSGGIFSLGKREVQIKFP  350



>ref|XP_010515268.1| PREDICTED: LOW QUALITY PROTEIN: protein DEFECTIVE IN MERISTEM 
SILENCING 3 [Camelina sativa]
Length=418

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 185/368 (50%), Gaps = 18/368 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--------LSSSQ  903
             I N K L+ ++       +Q E  L+ L ++K+ +   I +L+  +          S + 
Sbjct  55    IFNSKRLQSDLEVMGNKIKQHEDNLKFLKAQKTKLDEAILDLQVHMSKLHSSPAPTSENS  114

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I EQI     SAA +   L+ET   +        K ++ VVA L       L
Sbjct  115   DANLHGEDINEQILRHEKSAAGV-LGLVETSHGAQASQWMQTKGVVGVVAKLAKVNDENL  173

Query  1084  SRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+IL+ YLG + MLAVVC  +   +++ +    G +     L  L  ++  +I   +D+I
Sbjct  174   SQILSNYLGTRSMLAVVCKNYDNVTALESYDNQGNIDRNAGLHGLGASIDRTIEDNFDVI  233

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  234   CLENLRPYVGQHIADDPQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  293

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IM  1611
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+      D   + 
Sbjct  294   GLRETLFYSLFSRLQVYKTRVDMISALPCISHG-AVSLDGGIIRTPGIINLGNRDQVNVR  352

Query  1612  FPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYV-  1788
             F        M+        +  L++KK +  E   DI+ E++  E     F   ++ +V 
Sbjct  353   FAKPIASHTMDNYNETEKKMKELRWKKDKTLE---DIKREQVLREHAVLNFGKKKEEFVL  409

Query  1789  NLTQGSSS  1812
              LTQ SS+
Sbjct  410   CLTQSSSA  417



>ref|XP_008783198.1| PREDICTED: uncharacterized protein LOC103702511 isoform X3 [Phoenix 
dactylifera]
Length=389

 Score =   164 bits (415),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 185/360 (51%), Gaps = 32/360 (9%)
 Frame = +1

Query  748   IVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ-  921
             + NH + L+DE+   A   +  E  ++ L ++  NI   I +++ ++G   S +    Q 
Sbjct  17    VKNHTQKLQDELQKLALKVKHHEDNMKFLKTQMDNIDESILDMQVNLGKYHSSSAALEQN  76

Query  922   ---------ESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAE  1071
                      +  + +I     +AA I C++ I     + +L  +  K++L +VA LG   
Sbjct  77    NDVSAMQSEQQTVGKILQQEKAAAGIICQMKIRHGLQASKL--QLTKDVLGIVATLGKVN  134

Query  1072  SYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGG  1245
                LSR+ +EYLG + MLA+VC  +       K    G +     L  L  ++G  +NG 
Sbjct  135   DDNLSRLFSEYLGLETMLAIVCKTYEGIKALEKYDKEGMIDKNAGLHGLGPSIGRLLNGR  194

Query  1246  YDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRT  1422
             + + CL ++RPY GE +   PQ++LA++KP LPNGE P GF+G+AVNMI++   HL   T
Sbjct  195   FLVFCLENLRPYIGEFVPEDPQKKLALLKPRLPNGEIPRGFIGFAVNMINVDHMHLSCLT  254

Query  1423  ASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGD-  1599
              +GHGLRETLFY L   LQVY  R  M  A  C ++  A+SLDG +++ +G+     GD 
Sbjct  255   PNGHGLRETLFYTLFSRLQVYKTRADMQSALPCVSDG-AISLDGGMIKSSGLFN--LGDR  311

Query  1600  -----PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                   F + P  SK   ++ +    + L L+ ++K +L E   D++ E        N F
Sbjct  312   KDVEVKFPISPGISKPADVSEIE---EKLKLMNWQKERLEE---DVQREEALLNNAKNLF  365



>ref|XP_010503580.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X3 [Camelina sativa]
 ref|XP_010503581.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X4 [Camelina sativa]
Length=414

 Score =   164 bits (416),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 154/288 (53%), Gaps = 13/288 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--------LSSSQ  903
             I N K L+ ++       +Q E  L+ L ++K+ +   I +L+  +          S + 
Sbjct  51    IFNSKRLQSDLEVMGNKIKQHEDNLKFLKAQKTKLDEAILDLQVHMSKLHSSPAPTSENS  110

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I EQI     SAA +   L+ET   +        K ++ VVA L       L
Sbjct  111   DANLQGEDINEQILRHEKSAAGV-LGLVETSHGAQASQWMQTKGVVGVVAKLAKVNDENL  169

Query  1084  SRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+IL+ YLG + MLAVVC  +   +++ +    G +     L  L  ++  +I   +D+I
Sbjct  170   SQILSNYLGTRSMLAVVCKNYDNVTALESYDNQGNIDRNAGLHGLGASIDRTIEDNFDVI  229

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  230   CLENLRPYVGQHIADDPQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  289

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+
Sbjct  290   GLRETLFYSLFSRLQVYKTRVDMISALPCISDG-AVSLDGGIIRTPGI  336



>ref|XP_010503576.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X1 [Camelina sativa]
 ref|XP_010503578.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X1 [Camelina sativa]
 ref|XP_010503579.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like isoform 
X2 [Camelina sativa]
Length=418

 Score =   164 bits (416),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 154/288 (53%), Gaps = 13/288 (5%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--------LSSSQ  903
             I N K L+ ++       +Q E  L+ L ++K+ +   I +L+  +          S + 
Sbjct  55    IFNSKRLQSDLEVMGNKIKQHEDNLKFLKAQKTKLDEAILDLQVHMSKLHSSPAPTSENS  114

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I EQI     SAA +   L+ET   +        K ++ VVA L       L
Sbjct  115   DANLQGEDINEQILRHEKSAAGV-LGLVETSHGAQASQWMQTKGVVGVVAKLAKVNDENL  173

Query  1084  SRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMI  1257
             S+IL+ YLG + MLAVVC  +   +++ +    G +     L  L  ++  +I   +D+I
Sbjct  174   SQILSNYLGTRSMLAVVCKNYDNVTALESYDNQGNIDRNAGLHGLGASIDRTIEDNFDVI  233

Query  1258  CLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGH  1434
             CL ++RPY G+ ++  PQRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+
Sbjct  234   CLENLRPYVGQHIADDPQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGY  293

Query  1435  GLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             GLRETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+
Sbjct  294   GLRETLFYSLFSRLQVYKTRVDMISALPCISDG-AVSLDGGIIRTPGI  340



>ref|XP_008783196.1| PREDICTED: uncharacterized protein LOC103702511 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score =   164 bits (415),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 185/360 (51%), Gaps = 32/360 (9%)
 Frame = +1

Query  748   IVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQ-  921
             + NH + L+DE+   A   +  E  ++ L ++  NI   I +++ ++G   S +    Q 
Sbjct  17    VKNHTQKLQDELQKLALKVKHHEDNMKFLKTQMDNIDESILDMQVNLGKYHSSSAALEQN  76

Query  922   ---------ESIMEQISGMGDSAAAIACKL-IETPSSSVELHHEFAKEILVVVALLGFAE  1071
                      +  + +I     +AA I C++ I     + +L  +  K++L +VA LG   
Sbjct  77    NDVSAMQSEQQTVGKILQQEKAAAGIICQMKIRHGLQASKL--QLTKDVLGIVATLGKVN  134

Query  1072  SYELSRILAEYLGEKQMLAVVCNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGG  1245
                LSR+ +EYLG + MLA+VC  +       K    G +     L  L  ++G  +NG 
Sbjct  135   DDNLSRLFSEYLGLETMLAIVCKTYEGIKALEKYDKEGMIDKNAGLHGLGPSIGRLLNGR  194

Query  1246  YDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRT  1422
             + + CL ++RPY GE +   PQ++LA++KP LPNGE P GF+G+AVNMI++   HL   T
Sbjct  195   FLVFCLENLRPYIGEFVPEDPQKKLALLKPRLPNGEIPRGFIGFAVNMINVDHMHLSCLT  254

Query  1423  ASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGD-  1599
              +GHGLRETLFY L   LQVY  R  M  A  C ++  A+SLDG +++ +G+     GD 
Sbjct  255   PNGHGLRETLFYTLFSRLQVYKTRADMQSALPCVSDG-AISLDGGMIKSSGLFN--LGDR  311

Query  1600  -----PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKF  1764
                   F + P  SK   ++ +    + L L+ ++K +L E   D++ E        N F
Sbjct  312   KDVEVKFPISPGISKPADVSEIE---EKLKLMNWQKERLEE---DVQREEALLNNAKNLF  365



>ref|XP_004164774.1| PREDICTED: uncharacterized protein LOC101228579 [Cucumis sativus]
Length=333

 Score =   162 bits (410),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 163/311 (52%), Gaps = 21/311 (7%)
 Frame = +1

Query  703   YKAPKLEHDE---SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
             YK PK E  +   S  D I  H K L+D++       +  E  ++ L + K  +   I +
Sbjct  9     YKVPKDEMQDVALSHEDPISLHSKKLQDDLHTMGMKIQLHEDNIRFLKTLKDKLVDSIID  68

Query  871   LEESIGLSSSQNC--------CCTQE----SIMEQISGMGDSAAAIACKLIETPSSSVEL  1014
             L+ ++G   + N           TQ     S  ++I    ++AA+I C     P   +  
Sbjct  69    LQVTLGKYHASNTPKIENKDGSDTQSEDEPSYQKEILQQENTAASILCHSKTNPKM-LAS  127

Query  1015  HHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLS  1188
                 + ++L VVA LG  +   LS +L+EYLG K MLA+VC  +    S+      G ++
Sbjct  128   DPTLSDDVLGVVAELGHVKDNNLSSLLSEYLGTKTMLAIVCKTYNGVKSLEKYDTEGCIN  187

Query  1189  SADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGF  1365
                 L     +LG ++ G +++I L  +R Y+GE ++  PQRRL I KP LPNG+ P GF
Sbjct  188   KTSGLHGFGTSLGKTLEGRFNVIALETLRSYSGEFVADDPQRRLDIPKPRLPNGDCPDGF  247

Query  1366  LGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVS  1545
             LGYAVNMI I   HL + TASG+GLRETLFY L   LQ+Y  R  M  A  C  +  A+S
Sbjct  248   LGYAVNMIDIDRTHLSFLTASGYGLRETLFYSLFFCLQIYKTRTEMLQAVPCITDG-ALS  306

Query  1546  LDGVIMRGNGV  1578
             LDG I++ +G+
Sbjct  307   LDGGIIKRSGL  317



>gb|ADN33744.1| hypothetical protein [Cucumis melo subsp. melo]
Length=498

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 174/332 (52%), Gaps = 31/332 (9%)
 Frame = +1

Query  703   YKAPKLEHDESEADH----IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
             +K PK E  + E  H     ++ K L+D++       +  E  ++ L + K  +   I +
Sbjct  9     FKVPKDEMQDVELSHEDPINLHSKKLQDDLQTMGMKIQLHEDNIRFLRTLKDKLVDSIID  68

Query  871   LEESIGL----------------SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSS  1002
             L+  +G                 + S++    Q++I++Q     +SAA+I C L   P  
Sbjct  69    LQVILGKYHASNSPKIENKDGSDTQSEDKPSYQKAILQQ----ENSAASILCHLKTNPKM  124

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMH  1176
              +      ++++L VVA LG  E   LS +L+EYLG + M A+VC  +    S+      
Sbjct  125   -LASDPTMSEDVLGVVAELGHVEDDTLSSLLSEYLGTETMSAIVCKTYNGVKSLEKYDTD  183

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G ++    L     +LG ++ G +++I L  +RPY+GE ++  PQRRL I KP LPNG+ 
Sbjct  184   GGINKTSGLHGFGTSLGKTLEGRFNVISLETLRPYSGEFVADDPQRRLDIPKPRLPNGDC  243

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
             P GFLGYAVNMI+I   HL + TASG+GLRETLFY L   LQ+Y  R  M  A  C  + 
Sbjct  244   PAGFLGYAVNMINIDRTHLFFLTASGYGLRETLFYSLFFCLQIYKTRTEMLQAVPCITDG  303

Query  1534  PAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSK  1629
              A+SLDG I++ +G+     G+   M   FSK
Sbjct  304   -ALSLDGGIIKRSGL--FCLGNRGDMKATFSK  332



>ref|XP_003523364.1| PREDICTED: uncharacterized protein LOC100809510 isoform X1 [Glycine 
max]
Length=436

 Score =   164 bits (414),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/365 (33%), Positives = 188/365 (52%), Gaps = 22/365 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----------  915
             LED++       +Q E  L  L+S+K+ +   I +L+ +IG S S +             
Sbjct  63    LEDDLRMLGTKIKQHENNLYHLNSEKNKLDDSILHLQVTIGKSESSSKATIGDMDNPNPT  122

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E + +QI     SAA I C+L +    +   H    K+++ +VA LG  E   LSR+ 
Sbjct  123   NDEEVNKQILQHEKSAAGILCQL-KIRHGAQASHLTLTKDVVGIVATLGKVEDDNLSRLF  181

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +EYLG + MLA+VC  +    ++    M G ++ +  L  L  ++G +++G + +ICL  
Sbjct  182   SEYLGVETMLAIVCKTYEGVKALEMYDMEGCINKSCGLHGLGASIGRALDGRFLVICLEY  241

Query  1270  IRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPY G   +   QR+L  + P LPNGE P GFLG+AVNMI++ + +L   T SG+GLRE
Sbjct  242   LRPYAGNYVVNDAQRKLDFLIPRLPNGELPSGFLGFAVNMINLDSSNLFCVTPSGYGLRE  301

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFP  1617
             TLFY L   LQVY  R  M  A  C +   A+SLDG ++R  GV   + G   D  + FP
Sbjct  302   TLFYNLFSRLQVYKTRAEMIQALPCISEG-ALSLDGGMVRSCGV--FSLGNREDVDVRFP  358

Query  1618  VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLT  1797
                 E+ M L   + ++   LK  K +  ++  +++ E++  +     +   +  Y+   
Sbjct  359   --RPERSMRLDNHHIEIERQLKDVKWKKEKIMEELKREQILLDTTRFNYNKKKADYLKFL  416

Query  1798  QGSSS  1812
               SSS
Sbjct  417   AQSSS  421



>ref|XP_006578904.1| PREDICTED: uncharacterized protein LOC100809510 isoform X2 [Glycine 
max]
Length=449

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 122/376 (32%), Positives = 191/376 (51%), Gaps = 23/376 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----------  915
             LED++       +Q E  L  L+S+K+ +   I +L+ +IG S S +             
Sbjct  63    LEDDLRMLGTKIKQHENNLYHLNSEKNKLDDSILHLQVTIGKSESSSKATIGDMDNPNPT  122

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E + +QI     SAA I C+L +    +   H    K+++ +VA LG  E   LSR+ 
Sbjct  123   NDEEVNKQILQHEKSAAGILCQL-KIRHGAQASHLTLTKDVVGIVATLGKVEDDNLSRLF  181

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +EYLG + MLA+VC  +    ++    M G ++ +  L  L  ++G +++G + +ICL  
Sbjct  182   SEYLGVETMLAIVCKTYEGVKALEMYDMEGCINKSCGLHGLGASIGRALDGRFLVICLEY  241

Query  1270  IRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPY G   +   QR+L  + P LPNGE P GFLG+AVNMI++ + +L   T SG+GLRE
Sbjct  242   LRPYAGNYVVNDAQRKLDFLIPRLPNGELPSGFLGFAVNMINLDSSNLFCVTPSGYGLRE  301

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFP  1617
             TLFY L   LQVY  R  M  A  C +   A+SLDG ++R  GV   + G   D  + FP
Sbjct  302   TLFYNLFSRLQVYKTRAEMIQALPCISEG-ALSLDGGMVRSCGV--FSLGNREDVDVRFP  358

Query  1618  VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVN-L  1794
                 E+ M L   + ++   LK  K +  ++  +++ E++  +     +   +  Y+  L
Sbjct  359   --RPERSMRLDNHHIEIERQLKDVKWKKEKIMEELKREQILLDTTRFNYNKKKADYLKFL  416

Query  1795  TQGSSSVQNTYS*ARP  1842
              Q SS         RP
Sbjct  417   AQSSSDATQFLEDRRP  432



>gb|KGN57665.1| hypothetical protein Csa_3G239290 [Cucumis sativus]
Length=469

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 165/315 (52%), Gaps = 29/315 (9%)
 Frame = +1

Query  703   YKAPKLEHDE---SEADHIVNH-KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFN  870
             YK PK E  +   S  D I  H K L+D++       +  E  ++ L + K  +   I +
Sbjct  70    YKVPKDEMQDVALSHEDPISLHSKKLQDDLQTMGMKIQLHEDNIRFLKTLKDKLVDSIID  129

Query  871   LEESIGL----------------SSSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSS  1002
             L+ ++G                 + S++    Q+ I++Q     ++AA+I C     P  
Sbjct  130   LQVTLGKYHASNTPKIENKDGSDTQSEDEPSYQKGILQQ----ENTAASILCHSKTNPKM  185

Query  1003  SVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMH  1176
              +      + ++L VVA LG  +   LS +L+EYLG K MLA+VC  +    S+      
Sbjct  186   -LASDPTLSDDVLGVVAELGHVKDNNLSSLLSEYLGTKTMLAIVCKTYNGVKSLEKYDTE  244

Query  1177  GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGES  1353
             G ++    L     +LG ++ G +++I L  +R Y+GE ++  PQRRL I KP LPNG+ 
Sbjct  245   GCINKTSGLHGFGTSLGKTLEGRFNVIALETLRSYSGEFVADDPQRRLDIPKPRLPNGDC  304

Query  1354  PPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNN  1533
             P GFLGYAVNMI I   HL + TASG+GLRETLFY L   LQ+Y  R  M  A  C  + 
Sbjct  305   PDGFLGYAVNMIDIDRTHLSFLTASGYGLRETLFYSLFFCLQIYKTRTEMLQAVPCITDG  364

Query  1534  PAVSLDGVIMRGNGV  1578
              A+SLDG I++ +G+
Sbjct  365   -ALSLDGGIIKRSGL  378



>ref|XP_002874182.1| hypothetical protein ARALYDRAFT_351449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50441.1| hypothetical protein ARALYDRAFT_351449 [Arabidopsis lyrata subsp. 
lyrata]
Length=698

 Score =   167 bits (422),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 122/386 (32%), Positives = 201/386 (52%), Gaps = 42/386 (11%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             + D YNNH+ +   + + ++G+C  D      KV+  G ++L G+L+VTA YGK  SLSV
Sbjct  324   VFDGYNNHVAEGTNVLICIEGYCIKDPMGFNRKVNSCGCVDLSGILQVTASYGKSISLSV  383

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
               G   +FK+E  IE REL + +++P+ C  GS+L N+IFEV +S+G +D SIH DEKSG
Sbjct  384   MYGIDEIFKKESLIERRELMLLTKLPDCCAAGSNLTNLIFEVTDSDGAMDTSIHHDEKSG  443

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HT++I+S+   ++  +RY+F H  C V +++LPE EG F F   HSR+ EL L     
Sbjct  444   CFHTMSIESDSRSVESAIRYAFVHESCKVPTLSLPESEGVFSFRVFHSRFPELHL-----  498

Query  565   TKKAVEADSGYFQSQSPERQILNKE------VENFQYRSAQKQIFPYENSSPYKAPKLEH  726
             T   +  +  Y + Q    QI  ++        +    + Q ++    NSS   AP  + 
Sbjct  499   TLNGLSYNMIYLEIQLTPAQIFERDEIGCSTPYSRMSLTPQSKMASTTNSS--VAPTEQT  556

Query  727   DESE-------------------ADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSN  849
               S+                    D     + L++++I Y++   + +  L+ L+++++ 
Sbjct  557   PCSQFRVLAIRASSSALSSQTSLLDMAQFTESLKEKLIRYSEDIVEVDERLKCLEAEQNQ  616

Query  850   IQTEIFNLE---ESIGLSSSQNCCCTQESIMEQI-SGMGDSAAAIACKLIE--TPSSSVE  1011
              + E+  L+   E++G ++   C  T+ES+M+QI     D+AA++ C L     P  S+ 
Sbjct  617   AKEELSTLQASLETLG-ATFPECLSTKESMMKQIEEKHHDTAASVFCCLYRKAPPPQSLF  675

Query  1012  LHHEFAKEILVVVALLGFAESYELSR  1089
             L     K +  +V LLG   S   SR
Sbjct  676   LSK---KGVFGLVELLGSVASTSPSR  698



>ref|XP_010322214.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X3 [Solanum lycopersicum]
Length=427

 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 205/390 (53%), Gaps = 24/390 (6%)
 Frame = +1

Query  694   SSPYKAPK--LEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIF  867
             + PY   +  ++++ +EA  + N K LED V       +  E  +  L + K+ +   I 
Sbjct  31    ADPYSFARDTMQNEAAEA-AVYNTKKLEDAVHEMGLQLKHHEENIIFLKAHKNRLDNSIL  89

Query  868   NLEESIGL------SSSQN----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELH  1017
             +++ ++G       S S+N       ++E  +  I     SAA I  +L +    +   H
Sbjct  90    DMQVALGKYQTASESGSENEELSHVQSEEETLGNIFLHEKSAAGIWYEL-KCHHGTQASH  148

Query  1018  HEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSS  1191
                 K+++ +VA+LG  +   LSR+L++YLG + MLA+VC       ++      G+++ 
Sbjct  149   LPLMKDVVGIVAMLGSVDDDNLSRLLSDYLGLETMLAIVCKTFDGMKALETYDEKGHINK  208

Query  1192  ADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFL  1368
             +  L  L  ++G  ++G + +ICL  +RPY  + ++  PQRRL I+KP LPNG+SPPGFL
Sbjct  209   SLGLHGLGASIGKPLDGRFLVICLEKLRPYAEDFIADDPQRRLDILKPRLPNGDSPPGFL  268

Query  1369  GYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSL  1548
             G+AVNM++I +  L   T++G+GLRETLFY L   L VY  R+ M  +  C  +  A+SL
Sbjct  269   GFAVNMVNIDSVDLYCATSTGYGLRETLFYNLFSRLHVYKTREDMLQSLPCIRHG-AISL  327

Query  1549  DGVIMRGNGVTTHAFGDPFIMFPVFSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDI  1722
             DG +++ +GV +    +  + FP  S+   +  N   +  ++   +K+KK +  E   D+
Sbjct  328   DGGMIKHSGVFSLGKREINVKFPKSSRGSNLPQNYFEIGREIKE-MKWKKERTVE---DM  383

Query  1723  ENERMAYEEINNKFIGFRDAYVNLTQGSSS  1812
             + E++  E     F   +  Y+     SS+
Sbjct  384   QREQVLLERARFNFDLKKQGYMMFLAQSST  413



>dbj|BAJ94830.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   164 bits (414),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 150/282 (53%), Gaps = 10/282 (4%)
 Frame = +1

Query  754   NHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG--LSSSQNCCCTQES  927
             N K+++DE+          E  +  L S+ + I+  I +L   +G  +  S N    QE+
Sbjct  73    NTKVMQDELKKLGLKVNHHEANITFLKSEINAIEASIADLTIKLGKKVVPSNNGTSVQEA  132

Query  928   ---IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
                 +E I     +AA++ C+L +  S+ +       K+I+ VVA LG      LS +L+
Sbjct  133   EQRTIESICNQDKTAASLICQLKKRHSAQISTM-PMMKDIIGVVATLGKVNDDNLSSLLS  191

Query  1099  EYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLG   ML +VC  +    S+      G +     +  L  ++G  ++G + + CL +I
Sbjct  192   EYLGIDNMLGLVCKTYDGIKSLETYDKEGIIDKKSGIHGLGGSIGKFLHGRFTVFCLENI  251

Query  1273  RPYTGELSI-GPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             RP++GE+ I  PQR L + KP LPNGESPPGFLG+AVNMIH+   +L   T  GHGLRET
Sbjct  252   RPFSGEVMIHDPQRYLMLHKPRLPNGESPPGFLGFAVNMIHMDQTYLSCFTPHGHGLRET  311

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             L Y L   LQ Y     +  A    N+  AVSLDG I+R NG
Sbjct  312   LLYSLFSHLQAYKTTADLRRAIPLINDG-AVSLDGSILRPNG  352



>ref|XP_010671901.1| PREDICTED: uncharacterized protein LOC104888577 [Beta vulgaris 
subsp. vulgaris]
Length=1556

 Score =   168 bits (426),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 150/257 (58%), Gaps = 22/257 (9%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             +LD ++NH+Q+  E++LQ+ GF   DQ  L  KVD +GFI+L G+LKVT G+GK  SL+V
Sbjct  910   VLDRHSNHVQQGIEVELQVHGFSFLDQIGLKRKVDDHGFIDLSGLLKVTEGFGKLVSLTV  969

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
              S    V  ++FQ+E RELR+ + +P+ C  GS L+N+ FEV+NS+G+VD +IHD +K G
Sbjct  970   ISNKNVVANKKFQVEKRELRMVTVVPKLCHLGSKLKNLAFEVVNSKGDVDHTIHDSDKHG  1029

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
             +  TL +K++    D+++RY+F  GRC + SITLP  EG F   A H ++ EL  + E+ 
Sbjct  1030  RSDTLRLKTDFPGFDDSLRYAFKLGRCVIPSITLPLTEGTFCIEANHCQHFELCAKFEIR  1089

Query  565   TKKAV-----------EADSGYFQSQSPERQILN--KEVENFQYRSAQKQ---IFPYEN-  693
               ++             +D  Y + +S    + +  K V N + RSA +      PY   
Sbjct  1090  VSRSTCTEKDILSDLRASDQLYLKDRSASGSVSDAVKPVTN-RKRSALRDSEVTVPYVEE  1148

Query  694   ----SSPYKAPKLEHDE  732
                 +SP +   LEH +
Sbjct  1149  ECNFASPLQTQNLEHGD  1165


 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 109/232 (47%), Gaps = 25/232 (11%)
 Frame = +1

Query  604   SQSPERQILNKEVENFQYRSAQKQIFPY------ENSSPYKAPKLEHDESEADHIVNHKM  765
             +Q+P++Q   K   N    ++ + + P+      E + P   P LE  ES          
Sbjct  1248  TQTPDKQPDQKYGLNSDIFNSSEGMMPFADTCTPERAIPSGGPGLEDFES----------  1297

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL--SSSQNCCCTQESIMEQ  939
             +E E+ HY    +  E  LQ    +K  I+ ++  L+ S+ L   S  +C   +E ++ +
Sbjct  1298  IEKEIYHYGSAIKDQEEALQWCLLRKDEIEEDLTQLQASMELLPVSQPDCSSQKEVVLGK  1357

Query  940   ISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQ  1119
             I    DSAA+I   +   P      H +F  +++ +VALL    +  L+  LAEYLGE Q
Sbjct  1358  IEEKVDSAASIYGIVTRNPLLK-NRHPDFIDDVVGLVALLATVSTPALNCSLAEYLGEDQ  1416

Query  1120  MLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIR  1275
             MLA+VC    SSV  +    Y    D L +LA  LG  I     +ICL D++
Sbjct  1417  MLAIVCQ---SSVALTSPEKY---EDILMSLAGELGKCIKNRQLIICLEDLK  1462



>ref|XP_006360207.1| PREDICTED: uncharacterized protein LOC102585332 [Solanum tuberosum]
Length=1280

 Score =   168 bits (425),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 174/323 (54%), Gaps = 18/323 (6%)
 Frame = +1

Query  694   SSPYKAPK--LEHDESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIF  867
             S PY   +  +++  +EA  + N K LED V       +  E  +  L ++K+ +   I 
Sbjct  885   SDPYSFARDTMQNGTAEA-AVYNSKKLEDAVHEMGLKLKHHEENISFLKAQKNRLDNSIL  943

Query  868   NLE------ESIGLSSSQN----CCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELH  1017
             ++       ++   S S+N       ++E  +  I     SAA I  +L     +    H
Sbjct  944   DMHVALCKYQTASESGSENEELSHVQSEEETLGHIFVHEKSAAGIWYELKRHHGTQAS-H  1002

Query  1018  HEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNA--HASSVGASKMHGYLSS  1191
                 K+++ +VA+LG  +   LSR+L++YLG + MLA+VC       ++      G+++ 
Sbjct  1003  LPLMKDVVGIVAMLGNVDDDNLSRLLSDYLGLETMLAIVCKTCDGIKALETYDKEGHINK  1062

Query  1192  ADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFL  1368
                L  L  ++G  ++G + +ICL  +RPY  + ++  PQRRL I+KP LPNG+SPPGFL
Sbjct  1063  TLGLHGLGASIGKPLDGRFLVICLEKLRPYADDFIADDPQRRLDILKPRLPNGDSPPGFL  1122

Query  1369  GYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSL  1548
             G+AVNM++I + +L   T+SGHGLRETLFY L   L VY  R+ M  A  C  +  A+SL
Sbjct  1123  GFAVNMVNIDSVNLYCATSSGHGLRETLFYNLFSRLHVYKTREDMLQALPCIRHG-AISL  1181

Query  1549  DGVIMRGNGVTTHAFGDPFIMFP  1617
             DG +++ NGV +    +  + FP
Sbjct  1182  DGGMIKHNGVFSLGKREINVKFP  1204



>ref|XP_010322215.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X4 [Solanum lycopersicum]
Length=382

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/366 (31%), Positives = 192/366 (52%), Gaps = 21/366 (6%)
 Frame = +1

Query  760   KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL------SSSQN----C  909
             K LED V       +  E  +  L + K+ +   I +++ ++G       S S+N     
Sbjct  9     KKLEDAVHEMGLQLKHHEENIIFLKAHKNRLDNSILDMQVALGKYQTASESGSENEELSH  68

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
               ++E  +  I     SAA I  +L +    +   H    K+++ +VA+LG  +   LSR
Sbjct  69    VQSEEETLGNIFLHEKSAAGIWYEL-KCHHGTQASHLPLMKDVVGIVAMLGSVDDDNLSR  127

Query  1090  ILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +L++YLG + MLA+VC       ++      G+++ +  L  L  ++G  ++G + +ICL
Sbjct  128   LLSDYLGLETMLAIVCKTFDGMKALETYDEKGHINKSLGLHGLGASIGKPLDGRFLVICL  187

Query  1264  NDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
               +RPY  + ++  PQRRL I+KP LPNG+SPPGFLG+AVNM++I +  L   T++G+GL
Sbjct  188   EKLRPYAEDFIADDPQRRLDILKPRLPNGDSPPGFLGFAVNMVNIDSVDLYCATSTGYGL  247

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             RETLFY L   L VY  R+ M  +  C  +  A+SLDG +++ +GV +    +  + FP 
Sbjct  248   RETLFYNLFSRLHVYKTREDMLQSLPCIRHG-AISLDGGMIKHSGVFSLGKREINVKFPK  306

Query  1621  FSKEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNL  1794
              S+   +  N   +  ++   +K+KK +  E   D++ E++  E     F   +  Y+  
Sbjct  307   SSRGSNLPQNYFEIGREIKE-MKWKKERTVE---DMQREQVLLERARFNFDLKKQGYMMF  362

Query  1795  TQGSSS  1812
                SS+
Sbjct  363   LAQSST  368



>ref|XP_006581643.1| PREDICTED: uncharacterized protein LOC100813482 [Glycine max]
Length=335

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/285 (38%), Positives = 156/285 (55%), Gaps = 17/285 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----------  915
             LED++       +Q E  L  L+S+KS +   I +L+ +IG S S +             
Sbjct  14    LEDDLRMLGTKIKQHENNLYHLNSEKSKLDDSILHLQVTIGKSDSSSKATIGDMDNPNPT  73

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E + +QI     SAA I C+L      +   H    K+++ +VA LG  E   LSR+ 
Sbjct  74    NDEEVNKQILQHEKSAAGILCQL-RIHHGAQASHLTLTKDVVGIVATLGKVEDDILSRLF  132

Query  1096  AEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGYDMICLN  1266
             +EYLG + MLA+VC  +   V A +M+   G ++ +  L  L  ++G +++G + +ICL 
Sbjct  133   SEYLGVETMLAIVCRTY-EEVKALEMYDKEGCINKSFDLRRLGASIGRALDGRFLVICLE  191

Query  1267  DIRPYTGELSI-GPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
              +RPY G   +   QR+L I+ P LPNGE P GFLGYAV MI++ + +L   T SG+GLR
Sbjct  192   YLRPYAGNYMLEDAQRKLDILIPRLPNGELPSGFLGYAVTMINLDSSNLFCVTPSGYGLR  251

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             ETLFY L   LQVY  R  M  A  C +   A+SLDG ++R  GV
Sbjct  252   ETLFYNLFSCLQVYKTRAKMIQALPCISEG-ALSLDGGMVRSCGV  295



>gb|KGN65652.1| hypothetical protein Csa_1G478600 [Cucumis sativus]
Length=406

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 158/283 (56%), Gaps = 19/283 (7%)
 Frame = +1

Query  742   DHIVNHKMLEDEVIHYAQLSRQCEIELQ-ILDSKKSNIQTEIFNLEESIGLSSSQNCCCT  918
             D+I   K L+D+++          I+LQ ILD   ++   +I N + S   + S++    
Sbjct  51    DNIRFLKTLKDKLVDSI-------IDLQVILDKHHASNTPKIENKDGSD--TQSEDEPSY  101

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             Q+ I++Q     ++AA+I C     P   +      + ++L VVA LG  E   LS +L+
Sbjct  102   QKGILQQ----ENTAASILCHSKTNPKM-LASDPTLSDDVLGVVAELGHVEDKNLSSLLS  156

Query  1099  EYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLG + MLA+VC  +    S+      G ++    L     +LG ++ G +++I L  +
Sbjct  157   EYLGTETMLAIVCKTYNGVKSLEKYDTEGCINETSGLHGFGTSLGKTLEGRFNVIALETL  216

Query  1273  RPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             R Y+GE ++  PQRRL I KP LPNG+ P GFLGYAVNMI I   HL + TASG+GLRET
Sbjct  217   RSYSGEFVANDPQRRLHIPKPRLPNGDCPAGFLGYAVNMIDIDRTHLFFLTASGYGLRET  276

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LFY L   LQ+Y  R  M  A  C  +  A+SLDG I++ +G+
Sbjct  277   LFYSLFFCLQIYKTRTEMLQAVPCITDG-ALSLDGGIIKRSGL  318



>ref|XP_004309113.1| PREDICTED: uncharacterized protein LOC101308826 [Fragaria vesca 
subsp. vesca]
Length=472

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 128/211 (61%), Gaps = 11/211 (5%)
 Frame = +1

Query  1015  HHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASK--------  1170
             +++F  +++ +VA LG   + +LSR+LAEYLG+ QMLA+VC +  ++    K        
Sbjct  59    NNQFMGDVIGLVAQLGTIGTGDLSRVLAEYLGQDQMLAIVCRSFEAAGALEKFVQKPKKP  118

Query  1171  MHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNG  1347
             M G + S   L   A  L    +G   + CL DIRPYTG+     PQR+LA+  P LP+G
Sbjct  119   MRGEVDSMHFLCEPAL-LQKPTHGRSFVFCLEDIRPYTGDFDRSDPQRKLALPDPVLPSG  177

Query  1348  ESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFN  1527
              +P GFLGYAVNM+ + + H+   T++GHGLRET+ Y LLGELQVY  R+ M  A  C  
Sbjct  178   MAPDGFLGYAVNMVDLDSHHIHTVTSAGHGLRETVLYCLLGELQVYDTREDMLAAHDCIK  237

Query  1528  NNPAVSLDGVIMRGNGVTTHAFGDPFIMFPV  1620
             +  A+SL G I++ NGVT+   GD  I F V
Sbjct  238   HG-AISLGGGILKQNGVTSFGVGDVEICFSV  267


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 7/100 (7%)
 Frame = +1

Query  25   MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
            M D+Y NH+ +  E+ L++DGF   DQ    C V+  G  +L G+LKVTAGY K  S+SV
Sbjct  330  MFDQYGNHVIEGTEVLLKLDGFSIQDQLGTACTVNHQGCNDLSGLLKVTAGYEKSVSISV  389

Query  205  FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIF  324
             +        +FQ E R L + +     C  G+ L ++ F
Sbjct  390  LN-------LQFQTEKRVLIMHTPSEAACGMGTTLGSLKF  422



>gb|KCW60052.1| hypothetical protein EUGRSUZ_H02781 [Eucalyptus grandis]
Length=358

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 158/291 (54%), Gaps = 17/291 (6%)
 Frame = +1

Query  937   QISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEK  1116
             QI     SAA I  +L     +   +    +K+++ +VA LG  +   LSR+L+EYLG +
Sbjct  49    QILKHDKSAAGIWWQLKNIHGTQAPIL-ALSKDVIGIVATLGKVDDENLSRLLSEYLGAE  107

Query  1117  QMLAVVCNAHAS--SVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE  1290
              MLA+VC       ++      G +  +  L  L +++G ++NG +  ICL D+RPY G+
Sbjct  108   NMLAIVCQTRQGLKALETYDRAGSIDESAGLHGLGSSIGRTLNGRFLFICLEDLRPYIGD  167

Query  1291  -LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLL  1467
              ++   QRRL + KP LP+GE P GFL +AVNM++I   HL   T SGHGLRETLFY L 
Sbjct  168   FVADDSQRRLDLFKPRLPSGECPRGFLDFAVNMVNIETTHLVCSTPSGHGLRETLFYHLF  227

Query  1468  GELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFPVFS--KE  1632
                QVY+ R  M  A     +  A+SLDG I+R  G+  ++ G   D  + FPV S    
Sbjct  228   SRTQVYSTRVDMLRARPLITDG-AISLDGGIIRAPGM--YSLGRREDVDVRFPVPSGASS  284

Query  1633  QQMNLMTVNPDVLNLLKYKKVQ----LREVQNDIENERMAYEEINNKFIGF  1773
             +  N   +  + +  LK+K+ +    LR+ +  +++ ++ +E    +F  F
Sbjct  285   RPTNYREIE-NRMKDLKWKREKLLEDLRQERQMLDHAKLDFERKKQEFFMF  334



>ref|XP_010322212.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X1 [Solanum lycopersicum]
Length=455

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/364 (31%), Positives = 191/364 (52%), Gaps = 21/364 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL------SSSQN----CCC  915
             LED V       +  E  +  L + K+ +   I +++ ++G       S S+N       
Sbjct  84    LEDAVHEMGLQLKHHEENIIFLKAHKNRLDNSILDMQVALGKYQTASESGSENEELSHVQ  143

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             ++E  +  I     SAA I  +L +    +   H    K+++ +VA+LG  +   LSR+L
Sbjct  144   SEEETLGNIFLHEKSAAGIWYEL-KCHHGTQASHLPLMKDVVGIVAMLGSVDDDNLSRLL  202

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             ++YLG + MLA+VC       ++      G+++ +  L  L  ++G  ++G + +ICL  
Sbjct  203   SDYLGLETMLAIVCKTFDGMKALETYDEKGHINKSLGLHGLGASIGKPLDGRFLVICLEK  262

Query  1270  IRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPY  + ++  PQRRL I+KP LPNG+SPPGFLG+AVNM++I +  L   T++G+GLRE
Sbjct  263   LRPYAEDFIADDPQRRLDILKPRLPNGDSPPGFLGFAVNMVNIDSVDLYCATSTGYGLRE  322

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFS  1626
             TLFY L   L VY  R+ M  +  C  +  A+SLDG +++ +GV +    +  + FP  S
Sbjct  323   TLFYNLFSRLHVYKTREDMLQSLPCIRHG-AISLDGGMIKHSGVFSLGKREINVKFPKSS  381

Query  1627  KEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQ  1800
             +   +  N   +  ++   +K+KK +  E   D++ E++  E     F   +  Y+    
Sbjct  382   RGSNLPQNYFEIGREIKE-MKWKKERTVE---DMQREQVLLERARFNFDLKKQGYMMFLA  437

Query  1801  GSSS  1812
              SS+
Sbjct  438   QSST  441



>ref|XP_004149061.1| PREDICTED: uncharacterized protein LOC101207120 [Cucumis sativus]
Length=467

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 158/283 (56%), Gaps = 19/283 (7%)
 Frame = +1

Query  742   DHIVNHKMLEDEVIHYAQLSRQCEIELQ-ILDSKKSNIQTEIFNLEESIGLSSSQNCCCT  918
             D+I   K L+D+++          I+LQ ILD   ++   +I N + S   + S++    
Sbjct  55    DNIRFLKTLKDKLVDSI-------IDLQVILDKYHASNTPKIENKDGSD--TQSEDKASY  105

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             Q+ I++Q     ++AA+I C     P   +      + ++L VVA LG  E   LS +L+
Sbjct  106   QKEILQQ----ENTAASILCHSKTNPKM-LASDPTLSDDVLGVVAELGHVEDKNLSSLLS  160

Query  1099  EYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLG + MLA+VC  +    S+      G ++    L     +LG ++ G +++I L  +
Sbjct  161   EYLGTETMLAIVCKTYNGVKSLEKYDTEGCINKTSGLHGFGTSLGKTLEGRFNVIALETL  220

Query  1273  RPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             R Y+GE ++  PQRRL I KP LPNG+ P GFLGYAVNMI I   HL + TASG+GLRET
Sbjct  221   RSYSGEFVADDPQRRLDIPKPRLPNGDCPDGFLGYAVNMIDIDRTHLFFLTASGYGLRET  280

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LFY L   LQ+Y  R  M  A   F  + A+SLDG I++ +G+
Sbjct  281   LFYSLFFCLQIYKTRTEMLQAVP-FITDGALSLDGGIIKRSGL  322



>ref|XP_010322213.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X2 [Solanum lycopersicum]
Length=445

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/364 (31%), Positives = 191/364 (52%), Gaps = 21/364 (6%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL------SSSQN----CCC  915
             LED V       +  E  +  L + K+ +   I +++ ++G       S S+N       
Sbjct  84    LEDAVHEMGLQLKHHEENIIFLKAHKNRLDNSILDMQVALGKYQTASESGSENEELSHVQ  143

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             ++E  +  I     SAA I  +L +    +   H    K+++ +VA+LG  +   LSR+L
Sbjct  144   SEEETLGNIFLHEKSAAGIWYEL-KCHHGTQASHLPLMKDVVGIVAMLGSVDDDNLSRLL  202

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             ++YLG + MLA+VC       ++      G+++ +  L  L  ++G  ++G + +ICL  
Sbjct  203   SDYLGLETMLAIVCKTFDGMKALETYDEKGHINKSLGLHGLGASIGKPLDGRFLVICLEK  262

Query  1270  IRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             +RPY  + ++  PQRRL I+KP LPNG+SPPGFLG+AVNM++I +  L   T++G+GLRE
Sbjct  263   LRPYAEDFIADDPQRRLDILKPRLPNGDSPPGFLGFAVNMVNIDSVDLYCATSTGYGLRE  322

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFS  1626
             TLFY L   L VY  R+ M  +  C  +  A+SLDG +++ +GV +    +  + FP  S
Sbjct  323   TLFYNLFSRLHVYKTREDMLQSLPCIRHG-AISLDGGMIKHSGVFSLGKREINVKFPKSS  381

Query  1627  KEQQM--NLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQ  1800
             +   +  N   +  ++   +K+KK +  E   D++ E++  E     F   +  Y+    
Sbjct  382   RGSNLPQNYFEIGREIKE-MKWKKERTVE---DMQREQVLLERARFNFDLKKQGYMMFLA  437

Query  1801  GSSS  1812
              SS+
Sbjct  438   QSST  441



>gb|KDP28478.1| hypothetical protein JCGZ_14249 [Jatropha curcas]
Length=259

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 127/212 (60%), Gaps = 9/212 (4%)
 Frame = +1

Query  1024  FAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSAD  1197
               K++L VVA L   ++  L+R+L+EYLG + MLA+VC       ++      G ++S  
Sbjct  1     MTKDVLGVVATLASVDNDNLNRLLSEYLGLETMLAIVCKTFEGVKALETYDAEGKINSNI  60

Query  1198  ALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGY  1374
              L  L +++G  ING + +ICL  +RPY G  ++  PQR+L+I  P LP+G  P GFLG+
Sbjct  61    GLHGLGSSIGRKINGRFLVICLEHLRPYAGGFIANDPQRKLSIEMPRLPDGICPTGFLGF  120

Query  1375  AVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDG  1554
             AVNM+++   +L   TA+GHGLRETL Y +   LQVY +R  M +A  C  +  AVSLDG
Sbjct  121   AVNMVNLENANLLLVTANGHGLRETLLYTIFSHLQVYRSRSEMLLALPCITHG-AVSLDG  179

Query  1555  VIMRGNGVTTHAFG---DPFIMFPVFSKEQQM  1641
              ++RGNG    A G   D  + FPV S +  +
Sbjct  180   AMIRGNGF--FALGNRNDAEVKFPVISSKGNL  209



>ref|XP_010493514.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Camelina 
sativa]
Length=281

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 132/231 (57%), Gaps = 14/231 (6%)
 Frame = +1

Query  955   DSAAAIACKLIE--TPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLA  1128
             D+AA++ C L     P  S  L +   K +  +VALLG   S  LSR+L+EYLG+  ML+
Sbjct  11    DTAASVFCCLYREAPPPQSFFLSN---KGMFGIVALLGSVASTSLSRVLSEYLGKDTMLS  67

Query  1129  VVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPY-TGELSIGP  1305
             +VC    SS    K   Y      L + A + G +I   + +ICL+  RP+  G +   P
Sbjct  68    LVCK---SSQFGQKSDEYRK----LQSEAASHGRTITNRFLVICLDATRPWRNGVVKNDP  120

Query  1306  QRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVY  1485
             Q+RLA+  P LPNG+  PGF GY VNMIH++++ L  ++ SGHGLRETLFY + GELQVY
Sbjct  121   QKRLAMDSPYLPNGDPIPGFKGYGVNMIHLNSEELDIQSNSGHGLRETLFYGIFGELQVY  180

Query  1486  ANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQ  1638
                + +  A    N + AVSLDGVI R NG        P + FP+   E+Q
Sbjct  181   ETAEDLEAALPHINGD-AVSLDGVIARENGFIYSGCCTPEVHFPITVTEKQ  230



>gb|EMT05096.1| hypothetical protein F775_04749 [Aegilops tauschii]
Length=504

 Score =   158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/281 (37%), Positives = 147/281 (52%), Gaps = 13/281 (5%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCE-----IELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQES-  927
             +E+ +    + SR  E     + L+ L            N++    + +S N    QE+ 
Sbjct  62    IEESIADLTRASRAIEYFRPMLNLRTLSVTPGKAAVIANNVKRGKKVVASSNGTSVQEAE  121

Query  928   --IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAE  1101
                +E I     +AA++ C+L +  S+ +       K+IL VVA LG      LS +L+E
Sbjct  122   QRTIESICNQDKTAASLICQLKKRHSAKISTM-PMMKDILGVVATLGKTNDDNLSSLLSE  180

Query  1102  YLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIR  1275
             YLG   ML +VC  +    S+      G +     +  L  ++G  ++G + + CL +IR
Sbjct  181   YLGIDNMLGLVCKTYDGIKSLETYGTEGNIDKKSGIHGLGGSIGKLLHGRFTVFCLENIR  240

Query  1276  PYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETL  1452
             P++GE+ I  PQR L + KP LPNGESPPGFLG+AVNMI +   +L   T  GHGLRETL
Sbjct  241   PFSGEVVIDDPQRYLMLRKPRLPNGESPPGFLGFAVNMILMDQAYLSCLTPHGHGLRETL  300

Query  1453  FYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             FY L   LQVY     +  A   F N+ AVSLDG I+R NG
Sbjct  301   FYSLFSHLQVYKTTADLRRAIP-FINDGAVSLDGGILRPNG  340



>ref|XP_004165442.1| PREDICTED: uncharacterized LOC101207120 [Cucumis sativus]
Length=468

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 158/283 (56%), Gaps = 19/283 (7%)
 Frame = +1

Query  742   DHIVNHKMLEDEVIHYAQLSRQCEIELQ-ILDSKKSNIQTEIFNLEESIGLSSSQNCCCT  918
             D+I   K L+D+++          I+LQ ILD   ++   +I N + S   + S++    
Sbjct  55    DNIRFLKTLKDKLVDSI-------IDLQVILDKHHASNTPKIENKDGSD--TQSEDKASF  105

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             Q+ I++Q     ++AA+I C     P   +      + ++L VVA LG  E   LS +L+
Sbjct  106   QKEILQQ----ENTAASILCHSKTNPKM-LASDPTLSDDVLGVVAELGHVEDKNLSSLLS  160

Query  1099  EYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLG + MLA+VC  +    S+      G ++    L     +LG ++ G +++I L  +
Sbjct  161   EYLGTETMLAIVCKTYNGVKSLEKYDTEGCINETSGLHGFGTSLGKTLEGRFNVISLETL  220

Query  1273  RPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             R Y+GE ++  PQRRL I KP LPNG+ P GFLGYAVNMI I   HL + TASG+GLRET
Sbjct  221   RSYSGEFVANDPQRRLHIPKPRLPNGDCPAGFLGYAVNMIDIDRTHLFFLTASGYGLRET  280

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LFY L   LQ+Y  R  M  A   F  + A+SLDG I++ +G+
Sbjct  281   LFYSLFFCLQIYKTRTEMLQAVP-FITDGALSLDGGIIKRSGL  322



>ref|XP_004146267.1| PREDICTED: uncharacterized protein LOC101206394 [Cucumis sativus]
Length=368

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 130/223 (58%), Gaps = 9/223 (4%)
 Frame = +1

Query  919   QESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILA  1098
             Q+ I++Q     ++AA+I C     P   +      + ++L VVA LG  +   LS +L+
Sbjct  61    QKGILQQ----ENTAASILCHSKTNPKM-LASDPTLSDDVLGVVAELGHVKDNNLSSLLS  115

Query  1099  EYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDI  1272
             EYLG K MLA+VC  +    S+      G ++    L     +LG ++ G +++I L  +
Sbjct  116   EYLGTKTMLAIVCKTYNGVKSLEKYDTEGCINKTSGLHGFGTSLGKTLEGRFNVIALETL  175

Query  1273  RPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRET  1449
             R Y+GE ++  PQRRL I KP LPNG+ P GFLGYAVNMI I   HL + TASG+GLRET
Sbjct  176   RSYSGEFVADDPQRRLDIPKPRLPNGDCPDGFLGYAVNMIDIDRTHLFFLTASGYGLRET  235

Query  1450  LFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LFY L   LQ+Y  R  M  A   F  + A+SLDG I++ +G+
Sbjct  236   LFYSLFFCLQIYKTRTEMLQAVP-FITDGALSLDGGIIKRSGL  277



>ref|XP_010322216.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 isoform 
X5 [Solanum lycopersicum]
Length=373

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 122/191 (64%), Gaps = 4/191 (2%)
 Frame = +1

Query  1015  HHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLS  1188
             H    K+++ +VA+LG  +   LSR+L++YLG + MLA+VC       ++      G+++
Sbjct  176   HLPLMKDVVGIVAMLGSVDDDNLSRLLSDYLGLETMLAIVCKTFDGMKALETYDEKGHIN  235

Query  1189  SADALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGF  1365
              +  L  L  ++G  ++G + +ICL  +RPY  + ++  PQRRL I+KP LPNG+SPPGF
Sbjct  236   KSLGLHGLGASIGKPLDGRFLVICLEKLRPYAEDFIADDPQRRLDILKPRLPNGDSPPGF  295

Query  1366  LGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVS  1545
             LG+AVNM++I +  L   T++G+GLRETLFY L   L VY  R+ M  +  C  +  A+S
Sbjct  296   LGFAVNMVNIDSVDLYCATSTGYGLRETLFYNLFSRLHVYKTREDMLQSLPCIRHG-AIS  354

Query  1546  LDGVIMRGNGV  1578
             LDG +++ +GV
Sbjct  355   LDGGMIKHSGV  365



>ref|XP_006852617.1| hypothetical protein AMTR_s00021p00229230 [Amborella trichopoda]
 gb|ERN14084.1| hypothetical protein AMTR_s00021p00229230 [Amborella trichopoda]
Length=390

 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 130/227 (57%), Gaps = 14/227 (6%)
 Frame = +1

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
             ++++ +EQI     +AA + CKL    +S     +    ++L +VA LG      LSR+L
Sbjct  68    SEQNTVEQILRQEKTAAGVLCKLKSLHASP----NLMTSDVLGIVATLGKVHDDNLSRLL  123

Query  1096  AEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLA-NNLGTSI----NGGYDMIC  1260
             AEYLG++ ML +VC  +    G   +  Y S      TL  + LG SI    NG +  IC
Sbjct  124   AEYLGKETMLGIVCKTYD---GVKALEKYDSDGKIDRTLGIHGLGCSIARPINGRFLAIC  180

Query  1261  LNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHG  1437
             L+ +RPY G    G PQ++L +V P L  GE P GF+G+AVNMI I +K+L   TASGHG
Sbjct  181   LDQLRPYHGGTIAGDPQKKLDLVMPRLQTGECPSGFIGFAVNMIAIESKNLSCVTASGHG  240

Query  1438  LRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             LRETLFY L   LQVY   + M  A  C +   A+SLDG +++ NG+
Sbjct  241   LRETLFYCLFSRLQVYRTSNEMRCALPCISEG-AISLDGGLIKSNGI  286



>ref|XP_010230664.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3 [Brachypodium 
distachyon]
Length=465

 Score =   152 bits (384),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/284 (35%), Positives = 152/284 (54%), Gaps = 10/284 (4%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSS--SQNCCCTQ  921
             + N KM+++ +    Q     E  +++L S+   I+  I +L   +G  +  + N    Q
Sbjct  60    VFNTKMMQEGLQKLGQKLNHHEGNIKLLKSEIDVIEQSIADLSIKLGKKAVNANNGTSVQ  119

Query  922   ES---IMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRI  1092
             E+   +++ I     +AA+I C+L    S       +  K++L VVA LG      LS I
Sbjct  120   EADQRVIQSICHQDKTAASIVCELRNRHSVQASKVPQL-KDVLGVVATLGKVNDDNLSSI  178

Query  1093  LAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLN  1266
             L+EYLG + ML +VC  +     +      G +     +  L+ ++G  ++G + +  L 
Sbjct  179   LSEYLGIENMLGLVCKTYDGVKLLETYDKEGTIDKTCGIHGLSRSIGKFLDGRFTVFSLE  238

Query  1267  DIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLR  1443
             ++RP+ G++ I  PQR L + KP LP+GESPPGFL +AVNMI +   +L Y T +G GLR
Sbjct  239   NMRPFPGDVMIDDPQRWLMLHKPRLPSGESPPGFLNFAVNMIQLDQAYLSYLTRNGQGLR  298

Query  1444  ETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             ETLFY L   LQVY     +  A   F N+ A+SLDG I+R NG
Sbjct  299   ETLFYSLFSHLQVYETTADLRHAIP-FINDGAISLDGSILRPNG  341



>ref|XP_010042908.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Eucalyptus 
grandis]
Length=173

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = +1

Query  1120  MLAVVC--NAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGEL  1293
             ML +VC  +  A S+     +G +   +A+   A  LG SI+G + +ICL +I PY GE+
Sbjct  1     MLGIVCTNSETAFSLETYDKNGEVDLQNAVYAKAAELGKSISGEFRVICLEEISPYRGEI  60

Query  1294  -SIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLG  1470
                 PQR+LA   P LP+GE PPGF+GYAVNM+ I   HL  RT  G GLRETLFYRL G
Sbjct  61    EGCDPQRKLAFPHPTLPSGEIPPGFMGYAVNMVDIDFDHLATRTTEGLGLRETLFYRLFG  120

Query  1471  ELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAF  1593
             +LQVY  R+ M  AS C ++  AVSLDG I+R +G+ +  F
Sbjct  121   KLQVYDTREHMKQASVCIDHG-AVSLDGGIIREDGLISLGF  160



>gb|KHN19497.1| hypothetical protein glysoja_027754 [Glycine soja]
Length=427

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 181/365 (50%), Gaps = 31/365 (8%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----------  915
             LED++       +Q E  L  L+S+K+ +   I +L+ +IG S S +             
Sbjct  63    LEDDLRMLGTKIKQHENNLYHLNSEKNKLDDSILHLQVTIGKSESSSKATIGDMDNPNPT  122

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E + +QI     SAA I C+L +    +   H    K+++ +VA LG  E   LSR+ 
Sbjct  123   NDEEVNKQILQHEKSAAGILCQL-KIRHGAQASHLTLTKDVVGIVATLGKVEDDNLSRLF  181

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +EYLG + MLA+VC  +    ++    M G ++ +  L  L  ++G +++G         
Sbjct  182   SEYLGVETMLAIVCKTYEGVKALEMYDMEGCINKSCGLHGLGASIGRALDGRL-------  234

Query  1270  IRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
               PY G   +   QR+L  + P LPNGE P GFLG+AVNMI++ + +L   T SG+GLRE
Sbjct  235   --PYAGNYVVNDAQRKLDFLIPRLPNGELPSGFLGFAVNMINLDSSNLFCVTPSGYGLRE  292

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFP  1617
             TLFY L   LQVY  R  M  A  C +   A+SLDG ++R  GV   + G   D  + FP
Sbjct  293   TLFYNLFSRLQVYKTRAEMIQALPCISEG-ALSLDGGMVRSCGV--FSLGNREDVDVRFP  349

Query  1618  VFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLT  1797
                 E+ M L   + ++   LK  K +  ++  +++ E++  +     +   +  Y+   
Sbjct  350   --RPERSMRLDNHHIEIERQLKDVKWKKEKIMEELKREQILLDTTRFNYNKKKADYLKFL  407

Query  1798  QGSSS  1812
               SSS
Sbjct  408   AQSSS  412



>ref|XP_006852618.1| hypothetical protein AMTR_s00021p00230010 [Amborella trichopoda]
 gb|ERN14085.1| hypothetical protein AMTR_s00021p00230010 [Amborella trichopoda]
Length=311

 Score =   142 bits (357),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 6/186 (3%)
 Frame = +1

Query  1033  EILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADAL  1203
             ++L +VA LG   +  LSR+ AEYLG + MLA+VC  +   V A K +   G +  A  +
Sbjct  111   DVLGIVATLGNLCNDNLSRLFAEYLGIETMLAIVCKTY-DGVNALKKYNNDGMIDQAIGI  169

Query  1204  STLANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIVKPALPNGESPPGFLGYAV  1380
                  +     NG + +ICL D+RPY G    G  Q++L +V+P LP G+ PPGFLG+AV
Sbjct  170   HGHGISKARPTNGRFYVICLEDLRPYQGGTRAGDSQKKLDLVEPRLPTGDYPPGFLGFAV  229

Query  1381  NMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVI  1560
             NMI I +K+L   TA+GH LRETLFY L    QVY  R  M  A  C +   A+SLDG +
Sbjct  230   NMISIQSKNLSRVTANGHNLRETLFYSLFSRSQVYRTRSEMQSAIPCISEG-AISLDGGM  288

Query  1561  MRGNGV  1578
             M+ NG+
Sbjct  289   MKSNGI  294



>dbj|BAB01319.1| unnamed protein product [Arabidopsis thaliana]
Length=258

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 109/175 (62%), Gaps = 20/175 (11%)
 Frame = +1

Query  133  NGFINLGGVLKVTAGYGKKASLSVFSGDKSVFKQEFQIEARELRIASE------------  276
            +G I+L  +LKVT GYGK  SLSV SG++ +F++E QIE RELR+ +E            
Sbjct  27   HGCIDLSDILKVTEGYGKSVSLSVMSGNEVIFRKESQIEERELRLLTEELVSLLAFDPEI  86

Query  277  -----IPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIKSELLKIDETVR  441
                 +P+ C  G++L N+IF+V+  +G +D SIH DEK G  HT++I+S+   I+  +R
Sbjct  87   VCIDQLPDCCAAGTNLMNLIFQVMELDGSLDTSIHHDEKPGCFHTMSIESDSSSIESAIR  146

Query  442  YSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNTKKAVEA---DSGY  597
            Y+F HG C V S++LPE+EG F     HSRY ELQ+ +++    A  +   +SGY
Sbjct  147  YAFVHGSCKVSSLSLPENEGVFSCRVFHSRYPELQMSVKIQVTSAPTSEREESGY  201



>ref|XP_001783359.1| predicted protein [Physcomitrella patens]
 gb|EDQ51804.1| predicted protein [Physcomitrella patens]
Length=1712

 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 155/607 (26%), Positives = 267/607 (44%), Gaps = 90/607 (15%)
 Frame = +1

Query  28    LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
              D++ N ++   EI++ ++G    D+     +V +NG I+LGG+LKVTA Y  + +++V 
Sbjct  1058  FDDFKNVVENGSEIRVGLEGLQLVDKRGSRRQVVENGCIHLGGLLKVTAEYNSRGTITVQ  1117

Query  208   SGD-KSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             S   +S+    F    R LRI  E PE+   GS LE +  +VI+ +G VD  +      G
Sbjct  1118  SDKGRSLLALNFHTVYRSLRILKE-PEEAYTGSQLEGLKVQVIDEDGNVDTKM-----DG  1171

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               H LT+       +  +      G C++  I LP   G ++    H+ + EL   +E N
Sbjct  1172  SLHYLTVD-----WNSKLSIPLVCGVCSLPPINLPLVPGSWYGRVAHAVHPELFCALEAN  1226

Query  565   TKKAVEADSG--------------------YFQSQSPERQ--ILNKEVENFQYR-SAQKQ  675
              ++ +   +                     +    +P  Q  +L    +  Q   + +K+
Sbjct  1227  FEEKLGVSTNQKLVPKLWMVQVVSKLPSDNHLIPATPPNQPCLLMSLPQQLQLNWNVKKE  1286

Query  676   IFPYENSSPYKAPKLEHDESE---ADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKS  846
             I     S P +    + +E E    D I  +  ++ ++    +  ++ E EL IL   K 
Sbjct  1287  IDEKIESYPLRETSTQREEYERQLKDFIDRNTKMQRKLREQGRKVKRAEEELGILKRTKM  1346

Query  847   NI-------QTEIFNLE----------ESIGLSSSQNCCCTQESIMEQISGMGDSAAAIA  975
              +       + E+   E          ++  L  S     T   ++E +   GD   + A
Sbjct  1347  EVDDMEALWKVELKTFESVSKAAEVQKDAKALCPSSQNNNTASQVIELLQKQGDPPGSHA  1406

Query  976   CKLIETPSSSVELHHEFA-----KEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCN  1140
               ++    + V   + FA      +IL +VALL   ++  L+R   E L   + L     
Sbjct  1407  ASVLL--EAVVNNGNVFAAGGPGSDILGIVALLACVDNDILNRS-EEGLKYLEKL----E  1459

Query  1141  AHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYT---GELSIG---  1302
             + +S V    +H +          A +    ING +  + LN+   Y    G  S+    
Sbjct  1460  SQSSMVDDLTLHAF----------ARSRNRRINGTFRALVLNEASFYKRKDGLPSVNEGH  1509

Query  1303  PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQ-YRTASGHGLRETLFYRLLGELQ  1479
             PQ+ L I  P   +   P G++GYAVN++  + + L+ Y T++ H LRE+LF++L   LQ
Sbjct  1510  PQKLLLIPDPWPRDAPCPKGYIGYAVNLLRFNPQQLECYATSAKHSLRESLFFQLFSYLQ  1569

Query  1480  VYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG-DPFIMFPVFSKE----QQMN  1644
             VY  ++ M +A+  F+   AVSLDG ++ G     H FG +P + FPV  +E    QQ +
Sbjct  1570  VYDTKEHM-LAAQQFHTTGAVSLDGGLIHGKTYLEHVFGEEPAVKFPVLREEKHEYQQTD  1628

Query  1645  LMTVNPD  1665
              M  +P+
Sbjct  1629  SMLSSPN  1635



>gb|AFK47522.1| unknown [Lotus japonicus]
Length=246

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 133/238 (56%), Gaps = 14/238 (6%)
 Frame = +1

Query  1120  MLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGE  1290
             M A+VC  +   V A +M+   G ++ +  L  L  ++G  ++G + +ICL  +RPYTG+
Sbjct  1     MRAIVCRTY-EGVKALEMYDKEGCINKSSGLHGLGPSIGRPLDGRFLVICLESLRPYTGK  59

Query  1291  LSIG-PQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLL  1467
               +   +R+L I+KP LPNGE PPGFLG+AVNMI+I + +L   T SG+GLRETLFY L 
Sbjct  60    YFLDDSERKLDILKPRLPNGECPPGFLGFAVNMINIDSWNLFCVTPSGYGLRETLFYNLF  119

Query  1468  GELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFG---DPFIMFPVFSKEQQ  1638
               LQVY  R  M  A  C ++  A+SLDG ++R  GV   + G   D  + FP   +  +
Sbjct  120   SRLQVYKTRAEMIQALPCISDG-ALSLDGGMVRSCGV--FSLGNREDVDVKFPKPDRSTE  176

Query  1639  MNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAYEEINNKFIGFRDAYVNLTQGSSS  1812
             ++        +  +K+KK ++ E   D++ ER   +     F   ++ ++     SSS
Sbjct  177   LDGEIETERQMKDIKWKKEKVLE---DLKRERTLLDMAKFNFSKKKNDFLKFLAQSSS  231



>emb|CAB66404.1| hypothetical protein [Arabidopsis thaliana]
Length=422

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 148/286 (52%), Gaps = 26/286 (9%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIG-LSSS-------Q  903
             + N K LE ++       +Q E  L+ L S+K+ +   I +L+  +  L+SS        
Sbjct  46    MFNSKRLESDLEAMGNKIKQHEDNLKFLKSQKNKMDEAIVDLQVHMSKLNSSPTPRSENS  105

Query  904   NCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYEL  1083
             +     E I  QI    +SAA +   L+ET      LH   A ++++   ++G     +L
Sbjct  106   DNSLQGEDINAQILRHENSAAGV-LSLVET------LHGAQASQLMLTKGVVGVVA--KL  156

Query  1084  SRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
              ++  E L +            +++ A   HG +     L  L +++G  I   +D ICL
Sbjct  157   GKVNDENLSQNY-------ESVTALEAYDNHGNIDINAGLHCLGSSIGREIGDSFDAICL  209

Query  1264  NDIRPYTGE-LSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGL  1440
              ++RPY G+ ++   QRRL ++KP LPNGE PPGFLG+AVNMI I   +L   T+ G+GL
Sbjct  210   ENLRPYVGQHIADDLQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGYGL  269

Query  1441  RETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGV  1578
             RETLFY L   LQVY  R  M  A  C ++  AVSLDG I+R  G+
Sbjct  270   RETLFYNLFSRLQVYKTRADMISALPCISDG-AVSLDGGIIRKTGI  314



>gb|AAZ74717.1| At5g24280-like protein [Arabidopsis lyrata]
Length=162

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC    SS    K   Y      L + A +LG SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCK---SSQFGPKSDEY----RKLQSEAASLGRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
             IRP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI +S++ L  +++SG+GLRE
Sbjct  54    IRPWRNGLVKNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLSSEELNIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY + GELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFGELQVYETGEHLEAALPHINGGDAVSLDGVIARENG  156



>ref|XP_006852616.1| hypothetical protein AMTR_s00021p00227450 [Amborella trichopoda]
 gb|ERN14083.1| hypothetical protein AMTR_s00021p00227450 [Amborella trichopoda]
Length=1485

 Score =   140 bits (354),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 147/528 (28%), Positives = 232/528 (44%), Gaps = 79/528 (15%)
 Frame = +1

Query  256   ELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSGQPHTLTIKSELLKIDET  435
             ++RI+  +     PG  ++ ++ EV+++ G   E+       GQ  +L +    L     
Sbjct  973   KMRISGRLKHQLQPGDVIQELVLEVLDAYGNHVET-------GQEISLDLNGFSLPDQTG  1025

Query  436   VRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVNT--KKAVEADSGYFQSQ  609
              +       C + S  L         V  + +   L +  + N   ++  E  SG FQ+ 
Sbjct  1026  QKCKVNDQGCVILSGMLK--------VTSYGKNARLSVYYDENVLFEEYFEVLSGEFQAI  1077

Query  610   S-------PERQILNKEVENFQYRS----------------AQKQIFPYENSSPYKAPKL  720
             S       P+ +++  E  +F  +S                A   + P+ +S      KL
Sbjct  1078  SKDQLMLAPKTELILAEPTDFGVQSQWTREIMFSPQRSPSVAPDHLLPFMDSIVRDQEKL  1137

Query  721   EHD-ESEADHIVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSS  897
             E D E+    + NH+ + +++ H     +Q EI+  I  + K  I  E++   + +G + 
Sbjct  1138  EKDLENIGVQVKNHETILEKLKH-----QQSEIDNSIC-AIKDEIPPEVYQHIDDLGYA-  1190

Query  898   SQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESY  1077
                    +E+I +QI      AA++  K +  P    E    F ++++ +VALLG   S 
Sbjct  1191  -------KETISKQIERKSKIAASVLSKRV-LPRRVREPQFSFVQDVIGIVALLGSVSSS  1242

Query  1078  ELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGT------SIN  1239
              LSR+LA YLGE  MLA+VC    SS GA  +  +          A +  T       I 
Sbjct  1243  RLSRVLANYLGENHMLAIVCK---SSEGARTLERFAQDGKMDCNRALHGATFSPSKEHIT  1299

Query  1240  GGYDMICLNDIRPYTGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYR  1419
               + +ICL ++R             L +  P LP+   P GF G+AVNMI++  ++L   
Sbjct  1300  SQFHVICLEELR-------------LNLSHPMLPSARKPSGFQGFAVNMINLDVQNLHTV  1346

Query  1420  TASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGD  1599
             T  G GLRETLFY L GELQVY  R  M MAS C +   AVSLDG I+R  G       +
Sbjct  1347  TDDGRGLRETLFYYLFGELQVYRTRADMEMASECADMG-AVSLDGGILRRRGHIVLGTAE  1405

Query  1600  PFIMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQLREVQNDIENERMAY  1743
             P+I FPV S  ++   M      L  ++ K  Q  E+    ++E   Y
Sbjct  1406  PYITFPVASSPKEQWDMERILHSLKEIEEKNTQKAELAARRDDEHARY  1453


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             +LD Y NH++  +EI L ++GF   DQ    CKV+  G + L G+LKVT+ YGK A LSV
Sbjct  997   VLDAYGNHVETGQEISLDLNGFSLPDQTGQKCKVNDQGCVILSGMLKVTS-YGKNARLSV  1055

Query  205   FSGDKSVFKQEFQIEARELRIASE  276
             +  +  +F++ F++ + E +  S+
Sbjct  1056  YYDENVLFEEYFEVLSGEFQAISK  1079



>ref|XP_011023169.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Populus 
euphratica]
Length=350

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 155/292 (53%), Gaps = 12/292 (4%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESI------MEQISGMGDSA  963
             ++ E  L+ L S+ ++I   I +L+  +G   S++       +       +QI     SA
Sbjct  18    KRHEDNLKFLKSQANHIDESILDLQVRLGKYHSKDAANENSDLHPVEESTQQILHQEQSA  77

Query  964   AAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNA  1143
             A I C  +++  +    +    K++L +VA L   ++  LSR+L+EYLG + ML +VC  
Sbjct  78    AGILCN-VKSYHAIHASNLSLIKDVLGIVATLARVDNDTLSRLLSEYLGLETMLGIVCKT  136

Query  1144  HASSVGASKMHGYLSSAD--ALSTLANNLGTSINGGYDMICLNDIRPYTGE-LSIGPQRR  1314
                     K  G     D   L  L +++G  I+G +   CL D+RP+ G  ++  PQ++
Sbjct  137   FDGIKALEKYDGDGKIKDIAGLHGLGSSIGRKIDGRFTAFCLEDLRPFAGGFIANDPQKK  196

Query  1315  LAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANR  1494
             LA++KP LPNG+ P GFL + VNM+++  ++L   TA GHGLRETLFY L   LQVY  R
Sbjct  197   LALLKPKLPNGKCPSGFLDFVVNMVNLDDRNLFCVTAGGHGLRETLFYNLFSYLQVYKTR  256

Query  1495  DCMCMASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPF-IMFPVFSKEQQMNL  1647
               M  A  C  +  A+SLDG ++  NG+      + F + FP+ +    ++L
Sbjct  257   ADMLSALPCITHG-ALSLDGGMITKNGLFLLGSRENFEVKFPLITGRSGLSL  307



>gb|AAZ74706.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74707.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74708.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74711.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 100/163 (61%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC    SS    K   Y      L + A +LG SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCK---SSQFGPKSDEYRK----LQSEAASLGRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENG  156



>gb|AAZ74715.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 99/163 (61%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC +      + +   + S A +L       G SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAASL-------GRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYDTAEYLEAALPHINGGDAVSLDGVIARENG  156



>gb|AAZ74709.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74714.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74716.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 99/163 (61%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC +      + +   + S A +L       G SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAASL-------GRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENG  156



>gb|AAZ74705.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74712.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74713.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 99/163 (61%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC +      + +   + S A +L       G SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAASL-------GRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P LPNG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLPNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYDTAEHLEAALPHINGGDAVSLDGVIARENG  156



>ref|XP_002302636.2| hypothetical protein POPTR_0002s17300g, partial [Populus trichocarpa]
 gb|EEE81909.2| hypothetical protein POPTR_0002s17300g, partial [Populus trichocarpa]
Length=323

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 102/321 (32%), Positives = 170/321 (53%), Gaps = 17/321 (5%)
 Frame = +1

Query  811   EIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCCTQESIMEQISGMGDSAAAIACKLIE  990
             E  L+ L S+ +++   I +L+     +S  +    +E   +QI     SAA I CK ++
Sbjct  5     EDNLKFLKSQANHLDESILDLQ-----ASENSDLHPEEESTQQILHQEQSAAGILCK-VK  58

Query  991   TPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASK  1170
             +  +    +    K++L +VA L   ++  LSR+L+EYLG + ML +VC          K
Sbjct  59    SYHAIHASNLSLIKDVLGIVATLARVDNDTLSRLLSEYLGLETMLGIVCKTFDGIKALEK  118

Query  1171  M--HGYLSSADALSTLANNLGTSINGGYDMICLNDIR-PYTGELSIGPQRRLAIVKPALP  1341
                +G +     L  L +++G  I+G +   CL D+R   T  LS  PQ++LA++KP LP
Sbjct  119   YDGNGKIKDIAGLHGLGSSIGRKIDGRFTAFCLEDLRHKPTCCLSNDPQKKLALLKPKLP  178

Query  1342  NGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSC  1521
             +G+ P GFL + VNM+++  ++L   TA GHGLRETLFY L   LQVY  R  M  A  C
Sbjct  179   DGKCPSGFLDFVVNMVNLDDRNLFCVTAGGHGLRETLFYNLFSYLQVYKTRADMLSALPC  238

Query  1522  FNNNPAVSLDGVIMRGNGVTTHAFGDPF-IMFPVFSKEQQMNLMTVNPDVLNLLKYKKVQ  1698
               +  A+SLDG ++  NG+      + F + FP+ +    ++L          ++ +  +
Sbjct  239   ITHG-ALSLDGGMITKNGLFLLGSRENFEVKFPLITGRSGLSLNYSQ------IETRIRK  291

Query  1699  LREVQNDIENERMAYEEINNK  1761
             LR  Q++IE + +  +++ +K
Sbjct  292   LRWEQHNIEQDMLREQQLLDK  312



>gb|AAZ74703.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 98/163 (60%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC +      + +   + S A +L       G SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCKSXQFGPKSDEYRKFQSEAASL-------GRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P L NG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLLNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENG  156



>gb|AAZ74701.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74702.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74704.1| At5g24280 [Arabidopsis thaliana]
 gb|AAZ74710.1| At5g24280 [Arabidopsis thaliana]
Length=162

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 98/163 (60%), Gaps = 8/163 (5%)
 Frame = +1

Query  1090  ILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             +L+EYLG+  ML++VC +      + +   + S A +L       G SI   + +ICL+ 
Sbjct  1     VLSEYLGKDTMLSLVCKSSQFGPKSDEYRKFQSEAASL-------GRSITNRFLVICLDA  53

Query  1270  IRPY-TGELSIGPQRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRE  1446
              RP+  G +   PQ+RLA+  P L NG+  PGF GYAVNMI ++++ L  +++SG+GLRE
Sbjct  54    TRPWRNGLVRNDPQKRLAMDNPYLLNGDPIPGFKGYAVNMIDLASEELDIQSSSGYGLRE  113

Query  1447  TLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIMRGNG  1575
             TLFY +  ELQVY   + +  A    N   AVSLDGVI R NG
Sbjct  114   TLFYGVFRELQVYETAEHLEAALPHINGGDAVSLDGVIARENG  156



>gb|AAM97146.1| putative protein [Arabidopsis thaliana]
 gb|AAP13380.1| At5g24280 [Arabidopsis thaliana]
Length=218

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +1

Query  205  FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
             SG++ +F++E QIE RELR+ +E+P+ C  G++L N+IF+V+  +G +D SIH DEK G
Sbjct  1    MSGNEVIFRKESQIEERELRLLTELPDCCAAGTNLMNLIFQVMELDGSLDTSIHHDEKPG  60

Query  385  QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
              HT++I+S+   I+  +RY+F HG C V S++LPE+EG F     HSRY ELQ+ +++ 
Sbjct  61   CFHTMSIESDSSSIESAIRYAFVHGSCKVSSLSLPENEGVFSCRVFHSRYPELQMSVKIQ  120

Query  565  TKKAVEA---DSGYFQSQS  612
               A  +   +SGY    S
Sbjct  121  VTSAPTSEREESGYSTPHS  139



>ref|XP_002523333.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39049.1| conserved hypothetical protein [Ricinus communis]
Length=256

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 103/192 (54%), Gaps = 34/192 (18%)
 Frame = +1

Query  1024  FAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKM------HGYL  1185
               K++L  VA L   +   L+  L+EYLG + MLA+VC     +V   K+       G +
Sbjct  79    LTKDVLGKVATLASVDGDNLNWFLSEYLGLETMLAIVCR----TVEGVKLLEKYDEEGKV  134

Query  1186  SSADALSTLANNLGTSINGGYDMICLNDIRP-YTGELSIGPQRRLAIVKPALPNGESPPG  1362
             +S+  L  LA ++G  ING + +ICL D+RP  +G ++  P ++L ++KP LPNG  P G
Sbjct  135   NSSTGLHGLAASMGRKINGRFLVICLEDLRPSASGFIADDPHKKLDLIKPKLPNGMCPTG  194

Query  1363  FLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAV  1542
             FL + +NM ++  ++    TA+G+GLRETLFY L  E                       
Sbjct  195   FLDFEMNMTNLDRENSICLTANGYGLRETLFYTLFSE-----------------------  231

Query  1543  SLDGVIMRGNGV  1578
             SLDG I++ NGV
Sbjct  232   SLDGGIIKRNGV  243



>ref|XP_010100726.1| hypothetical protein L484_023495 [Morus notabilis]
 gb|EXB83888.1| hypothetical protein L484_023495 [Morus notabilis]
Length=310

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 85/287 (30%), Positives = 128/287 (45%), Gaps = 58/287 (20%)
 Frame = +1

Query  802   RQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQN---------CCCTQESIMEQISGMG  954
             +Q E  L  L ++ +++   I +L+ S+G   S N            T+E  +EQI    
Sbjct  22    KQREDNLTFLTAQTNHLDESILDLQVSLGKYHSANGTGTESESGLSWTEEDTIEQILKQE  81

Query  955   DSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVV  1134
             +SAA++ C+L    SS   L   F K++L +VA L       LSR+L+EYLG + MLA+V
Sbjct  82    NSAASVLCRLNSQQSSIQGLDLAFTKDVLGIVATLARVGEDNLSRLLSEYLGMQTMLAIV  141

Query  1135  CNAHASSVGASKM--HGYLSSADALSTLANNLGTSINGGYDMICLNDIRPYTGELSIGPQ  1308
             C  +       K    G ++S  +L    ++ G  ING                      
Sbjct  142   CRTYEGVKALEKYDEEGNINSTSSLHGAGSSAGKRING----------------------  179

Query  1309  RRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYA  1488
                                    +N+I + +++L   TA+G GLRETLFY L   LQ+Y 
Sbjct  180   -----------------------LNLISLDSRNLSCVTANGQGLRETLFYNLFSCLQIYR  216

Query  1489  NRDCMCMASSCFNNNPAVSLDGVIMRGNGV-TTHAFGDPFIMFPVFS  1626
              R  M  A  C  +  A+SLDG ++R +GV    +  D  + FPV S
Sbjct  217   TRTEMLEALPCVTDG-ALSLDGGVIRKSGVFFLGSRKDTEVKFPVAS  262



>ref|XP_010027404.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Eucalyptus 
grandis]
Length=136

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +1

Query  1366  LGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVS  1545
             +GYAVNM+ I   HL  RT  G GLRETLFYRL G+LQVY  R+ M  AS C ++  AVS
Sbjct  1     MGYAVNMVDIDFDHLATRTTEGLGLRETLFYRLFGKLQVYDTREHMKQASVCIDHG-AVS  59

Query  1546  LDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLM  1650
             LDG I+R +G+ +  F  P I+FPV + E  +N +
Sbjct  60    LDGGIIREDGLISLGFWKPDIIFPVVTSEIHINTL  94



>ref|XP_004234924.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Solanum 
lycopersicum]
Length=163

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 66/185 (36%), Positives = 96/185 (52%), Gaps = 31/185 (17%)
 Frame = +1

Query  1030  KEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALST  1209
             K+++ +VALLG  +   LSR                             G ++ +  L  
Sbjct  2     KDVIGIVALLGKVDDDNLSR----------------------------KGPMNKSSGLHG  33

Query  1210  LANNLGTSINGGYDMICLNDIRPYTGELSIG-PQRRLAIV-KPALPNGESPPGFLGYAVN  1383
             +  ++G  ++  Y +I L ++RPY GE  +  PQRRLAI  KP   N E+P  FLG+AVN
Sbjct  34    VGASIGRPLDDRYLVIFLENLRPYAGEFIVDDPQRRLAIRRKPRYVNEETPHVFLGFAVN  93

Query  1384  MIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIM  1563
             MI+I   +L   T +G+GLRETL Y L  +LQVY     M M +  F  + A+SLDG I+
Sbjct  94    MINIDTANLYCVTRTGYGLRETLLYGLFSQLQVYKTSADM-MEALPFIIDGAISLDGGII  152

Query  1564  RGNGV  1578
             +  G+
Sbjct  153   KSGGI  157



>ref|XP_010317981.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Solanum 
lycopersicum]
Length=327

 Score = 98.2 bits (243),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 101/193 (52%), Gaps = 38/193 (20%)
 Frame = +1

Query  1096  AEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLND  1269
             AEYLG + MLAVVC  H    ++  S   G  +++  L  + +++G  ++  Y +ICL +
Sbjct  5     AEYLGLETMLAVVCKTHDGLKALLTSDKKGPTNTSSRLHGVGSSIGGPLHR-YLVICLEN  63

Query  1270  I--------------------------------RPYTGE-LSIGPQRRLAIV-KPALPNG  1347
             +                                RPYTGE ++  P+RRLAI  KP   N 
Sbjct  64    LMFEVMMICSYKCISYSLALPYFLSFSFLGYHFRPYTGEFIADDPKRRLAIRRKPRYVNK  123

Query  1348  ESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFN  1527
             E+ PGFLG+AVNMI+I   +L    ++GH LRETLF  L+ +LQVY  R  M M +  F 
Sbjct  124   ETSPGFLGFAVNMINIDTANLYCVISNGHVLRETLFSGLVAQLQVYKTRADM-MQALPFI  182

Query  1528  NNPAVSLDGVIMR  1566
              N  +SLDG I++
Sbjct  183   TNGDISLDGGIIK  195



>gb|KFK32414.1| hypothetical protein AALP_AA6G239100 [Arabis alpina]
Length=224

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 95/174 (55%), Gaps = 13/174 (7%)
 Frame = +1

Query  955   DSAAAIACKLIET--PSSSVELHHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLA  1128
             D+A++  C + +   P  S+ + +     +  +VAL+G   S  L+R L+EYLGE  MLA
Sbjct  11    DTASSFFCCMCKKALPPWSLIMTY---NGVFGLVALIGSVSSTSLNRELSEYLGEDTMLA  67

Query  1129  VVCNAHASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICLNDIRP-YTGELSIGP  1305
             +VC +      + + +  L S  A+      LGTSI   + ++ L+   P   G +   P
Sbjct  68    LVCKSSRFEPNSVE-YLRLQSKTAM------LGTSITNPFHVLSLDGYMPRVNGRIENDP  120

Query  1306  QRRLAIVKPALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLL  1467
             QR+LA+  P LP+G   PGF GYAVNMI    + L  +T SG+GLRETL Y L 
Sbjct  121   QRKLAMDDPKLPDGGPIPGFKGYAVNMIDFHEEELFIQTVSGYGLRETLIYGLF  174



>ref|XP_002874181.1| hypothetical protein ARALYDRAFT_910454 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50440.1| hypothetical protein ARALYDRAFT_910454 [Arabidopsis lyrata subsp. 
lyrata]
Length=138

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 75/144 (52%), Gaps = 14/144 (10%)
 Frame = +1

Query  1330  PALPNGESPPGFLGYAVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCM  1509
             P L NG+  PGF GYAVNMI ++ + L  +T SG+GLRETLFY L   LQVY  +  +  
Sbjct  4     PKLLNGDHIPGFKGYAVNMIDLAPEELTIQTYSGYGLRETLFYNLFENLQVYETQKQVEA  63

Query  1510  ASSCFNNNPAVSLDGVIMRGNGVTTHAFGDPFIMFPVFSKEQQMNLMTVNPDVLNLLKYK  1689
             A        AVSLDG I + NG        P I FPV  KE +        + L  L+  
Sbjct  64    AH-------AVSLDGFIAKENGFIYSGCSKPEIHFPVTVKEDE-------EEKLRKLEAA  109

Query  1690  KVQLREVQNDIENERMAYEEINNK  1761
             + ++R     IE E+ +  ++ NK
Sbjct  110   RDRVRMAAKKIEEEKCSLRKLENK  133



>ref|XP_004954816.1| PREDICTED: uncharacterized protein LOC101764237 [Setaria italica]
Length=861

 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 111/447 (25%), Positives = 176/447 (39%), Gaps = 118/447 (26%)
 Frame = +1

Query  25    MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
             +LD+++NH+++  ++ + +DG C  D                           KK+S+  
Sbjct  447   VLDQFSNHVEEGTKLNVHVDGLCFLD---------------------------KKSSVQ-  478

Query  205   FSGDKSVFKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
                                    ++PE C  GS LE IIFE+ +S+G VDESI      G
Sbjct  479   -----------------------KVPETCPAGSFLE-IIFEISDSDGLVDESI-----DG  509

Query  385   QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
               HTL I S  L + E  +Y   HGRC V  + LP  +GK        +  +L L    +
Sbjct  510   PLHTLNITSNELSLVEGAQYGIKHGRCVVSHVQLPHQQGKLQI-----QPFDLALTSFED  564

Query  565   TKKAVEADSGYFQSQSPERQILNKEVENFQYRSAQKQIFPYENSSPYKAPKLEHDESEAD  744
               K++ +D            I + +  N        Q+ P E S                
Sbjct  565   GTKSILSDP-----------ISSVDSSNLLIPC---QLAPAEPS----------------  594

Query  745   HIVNH-----KMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNC  909
             H+V +     K  +++V       +  E  L  L S K  ++ EI  L+  +G     + 
Sbjct  595   HLVTYVKDVVKKTKNKVGDTYSKMKSTEKILGTLSSSKDLLEEEIVTLKAEVG-PIVGSF  653

Query  910   CCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSR  1089
                +E I  +I     +AA + C   E+          F + ++ +VALLG     ++ R
Sbjct  654   IDAKELIRNKIREKIGTAAFVLCSSGES----------FMEGVVGIVALLGTVPDRKIGR  703

Query  1090  ILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGYDMICL  1263
             +LA YLG+  ML+VVC     A+ +     HG +     +   A  LG  I   + +ICL
Sbjct  704   MLAVYLGKDGMLSVVCKTMDAANYIEKYNNHGDVDVGFGIHHKAAVLGVPIKSRFSIICL  763

Query  1264  NDIRPYTGELSIGPQRRLAIVKPALPN  1344
             +DI          P+    +V P  PN
Sbjct  764   DDID--------DPKITFPVVSPKTPN  782



>gb|KHG26772.1| Uncharacterized protein F383_01873 [Gossypium arboreum]
Length=341

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  25   MLDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSV  204
            M D Y NH+++  E++ Q++GF          KVD  G I+LGG+LKVTAGYGK+ SLS+
Sbjct  162  MFDVYGNHVEEGLEVQFQLNGFSIPGLIGSKHKVDNLGRIDLGGLLKVTAGYGKQVSLSI  221

Query  205  FSGDKSVFKQEFQIEARELRIASEI  279
              GDK  FKQ FQ E RELRI+S I
Sbjct  222  LHGDKVTFKQAFQTEKRELRISSSI  246



>ref|XP_002994262.1| hypothetical protein SELMODRAFT_432188 [Selaginella moellendorffii]
 gb|EFJ04674.1| hypothetical protein SELMODRAFT_432188 [Selaginella moellendorffii]
Length=1227

 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 89/185 (48%), Gaps = 23/185 (12%)
 Frame = +1

Query  1033  EILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSADALSTL  1212
             +IL  + LL   E  E++R L+ +LG + +L VVC  +            + ++ A    
Sbjct  911   DILGPIVLLARVEKDEINRSLSTFLGARSLLQVVCKTYKGIRWLRSSDANVDNSTAFLAF  970

Query  1213  ANNLGTSINGGYDMICLNDIRPYT---GELSIG---PQRRLAIVKPALPNGESPPGFLGY  1374
               +    I   + +  ++ I+ Y    G  ++    PQ+ L I  P L NGE P GFLGY
Sbjct  971   VRSNKLWIPENFPVFRIDAIKQYKRKDGNAAVDAQHPQKLLNIPPPVLSNGEIPAGFLGY  1030

Query  1375  AVNMIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMC-----MASSCFNNNPA  1539
              VN +++  +HL+        LR++LFY +  +LQVY   + M      M+ SC     A
Sbjct  1031  GVNFLYLRREHLE--------LRQSLFYHVFRKLQVYNTEENMLNAWNEMSLSC----QA  1078

Query  1540  VSLDG  1554
             VSLDG
Sbjct  1079  VSLDG  1083


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 81/184 (44%), Gaps = 18/184 (10%)
 Frame = +1

Query  28   LDEYNNHIQKDEEIKLQMDGFCAYDQGCLMCKVDKNGFINLGGVLKVTAGYGKKASLSVF  207
             DE+ N +++   ++LQ+ G     Q     + D  G + L   L+V   Y    S+ + 
Sbjct  291  FDEWGNSVRQGTRMRLQLSGVHLSQQEV---ETDGAGIVRLSE-LRVAKEYNLTGSIVLS  346

Query  208  SGDKSV-FKQEFQIEARELRIASEIPEDCVPGSHLENIIFEVINSEGEVDESIHDDEKSG  384
            S D  V F+  F+  +R L+ A E P+    G  +  +   V++  G VD +I       
Sbjct  347  SEDDIVMFEIVFKGASRTLKFAFEQPKRSYIGREVTGLNIHVVDEAGNVDTAIGG-----  401

Query  385  QPHTLTIKSELLKIDETVRYSFCHGRCTVRSITLPEDEGKFHFVAVHSRYMELQLRIEVN  564
                 TI    +  D+ + Y    G+C +R +T+P+  G +   A HS Y  + L  E+ 
Sbjct  402  -----TIS---MSWDKDICYVVNKGQCQLRGLTMPKTPGLWEGRAWHSDYQLMSLAFEIQ  453

Query  565  TKKA  576
             + A
Sbjct  454  VELA  457



>gb|ACU20405.1| unknown [Glycine max]
Length=126

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +1

Query  1384  MIHISAKHLQYRTASGHGLRETLFYRLLGELQVYANRDCMCMASSCFNNNPAVSLDGVIM  1563
             MIH+ +K+L + T SG+GLRETLFY L   LQ+Y  R+ M +A  C ++  A+SLDG ++
Sbjct  1     MIHLDSKYLSFLTDSGYGLRETLFYGLFSRLQIYKTRNEMLLALPCIHDG-ALSLDGGMI  59

Query  1564  RGNGVTTHAFG---DPFIMFPVFS  1626
             RG G+   A G   D  + FP+ S
Sbjct  60    RGRGM--FALGSRKDVEVKFPLIS  81



>ref|XP_010314893.1| PREDICTED: protein DEFECTIVE IN MERISTEM SILENCING 3-like [Solanum 
lycopersicum]
Length=166

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 69/142 (49%), Gaps = 35/142 (25%)
 Frame = +1

Query  1015  HHEFAKEILVVVALLGFAESYELSRILAEYLGEKQMLAVVCNAHASSVGASKMHGYLSSA  1194
             H  + K ++ +VALLG      ++RIL++YLG + MLAVVC  +                
Sbjct  59    HIPYTKGVIGIVALLGKFYDDNINRILSDYLGLETMLAVVCKTN----------------  102

Query  1195  DALSTLANNLGTSINGGYDMICLNDIRPYTGEL-SIGPQRRLAIVKPALPNGESPPGFLG  1371
             D L  L           YDM           EL +  PQRRL I KP   + E+PPGF+G
Sbjct  103   DGLKALQT---------YDM---------KDELVAADPQRRLVIRKPRYLHEETPPGFVG  144

Query  1372  YAVNMIHISAKHLQYRTASGHG  1437
             +AVNMI+I   +    +++G G
Sbjct  145   FAVNMINIDTANSYCVSSTGLG  166



>gb|KHN23363.1| hypothetical protein glysoja_015665 [Glycine soja]
Length=364

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 91/183 (50%), Gaps = 15/183 (8%)
 Frame = +1

Query  766   LEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGLSSSQNCCC----------  915
             LED++       +Q E  L  L+S+KS +   I +L+ +IG S S +             
Sbjct  181   LEDDLRMLGTKIKQHENNLYHLNSEKSKLDDSILHLQVTIGKSDSSSKATIGDMDNPNPT  240

Query  916   TQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAESYELSRIL  1095
               E + +QI     SAA I C+L      +   H    K+++ +VA LG  E   LSR+ 
Sbjct  241   NDEEVNKQILQHEKSAAGILCQL-RIHHGAQASHLTLTKDVVGIVATLGKVEDDILSRLF  299

Query  1096  AEYLGEKQMLAVVCNAHASSVGASKMH---GYLSSADALSTLANNLGTSINGGYDMICLN  1266
             +EYLG + MLA+VC  +   V A +M+   G ++ +  L  L  ++G +++G +  ICL 
Sbjct  300   SEYLGVETMLAIVCRTY-EGVKALEMYDKEGCINKSFGLRRLGASIGRALDGRFLEICLE  358

Query  1267  DIR  1275
              +R
Sbjct  359   YLR  361



>ref|XP_006429699.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
 gb|ESR42939.1| hypothetical protein CICLE_v10011757mg [Citrus clementina]
Length=254

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 93/189 (49%), Gaps = 18/189 (10%)
 Frame = +1

Query  748   IVNHKMLEDEVIHYAQLSRQCEIELQILDSKKSNIQTEIFNLEESIGL-----------S  894
             I N K L+D++       +Q E  +++L S+   +   I +L+ ++G            S
Sbjct  58    IYNSKRLQDDLQMIGLKIKQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHS  117

Query  895   SSQNCCCTQESIMEQISGMGDSAAAIACKLIETPSSSVELHHEFAKEILVVVALLGFAES  1074
             + QN    +E    QI     SAA + C+L +T   +   H  F K++L +VA LG  E 
Sbjct  118   NHQN----EEETTGQILQHEKSAAGVLCQL-KTRHCTQASHLTFTKDVLGIVASLGQLED  172

Query  1075  YELSRILAEYLGEKQMLAVVCNAH--ASSVGASKMHGYLSSADALSTLANNLGTSINGGY  1248
               LS +L+EYLG   MLA+VC       ++      G++  +  L  L  ++G +I+G +
Sbjct  173   ENLSSLLSEYLGVDTMLAIVCKTFECVKALETYDKEGHIIKSSGLHGLGASIGRAIDGRF  232

Query  1249  DMICLNDIR  1275
              +ICL ++R
Sbjct  233   LVICLENLR  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6399908556066