BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22040_g1_i1 len=1015 path=[2369:0-325 2695:326-1014]

Length=1015
                                                                      Score     E

ref|XP_009621141.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       435   3e-145   
ref|XP_010312293.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       429   4e-143   
ref|XP_006339007.1|  PREDICTED: probable peptide/nitrate transpor...    429   5e-143   
ref|XP_009771569.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       427   5e-142   
ref|XP_009799129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       423   2e-140   
ref|XP_009590467.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       422   3e-140   
ref|XP_006339008.1|  PREDICTED: probable peptide/nitrate transpor...    419   4e-139   
ref|XP_010312294.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       415   4e-137   
gb|EYU41789.1|  hypothetical protein MIMGU_mgv1a003424mg                405   2e-133   
ref|XP_009620626.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            403   1e-132   
ref|XP_009772498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       402   2e-132   
ref|XP_006340981.1|  PREDICTED: probable peptide/nitrate transpor...    401   3e-132   
ref|XP_011094926.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       401   4e-132   
emb|CDP06560.1|  unnamed protein product                                398   6e-131   
ref|XP_004246394.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       394   2e-129   
ref|XP_008240176.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            393   6e-129   
ref|XP_007208297.1|  hypothetical protein PRUPE_ppa003260mg             392   2e-128   
ref|XP_002309091.2|  proton-dependent oligopeptide transport fami...    391   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011019211.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            391   4e-128   
ref|XP_010088558.1|  Putative peptide/nitrate transporter               389   3e-127   
ref|XP_004302697.1|  PREDICTED: putative peptide/nitrate transpor...    388   5e-127   
ref|XP_009358790.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       388   5e-127   
ref|XP_008388083.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       387   1e-126   
ref|XP_011006629.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    384   2e-126   
ref|XP_002323528.1|  proton-dependent oligopeptide transport fami...    385   5e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011006628.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like...    384   2e-125   
ref|XP_009378859.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       384   3e-125   
ref|XP_010654232.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            382   6e-125   
ref|XP_007026877.1|  Major facilitator superfamily protein isoform 1    380   5e-124   
ref|XP_008359699.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            380   7e-124   
ref|XP_010256764.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            379   2e-123   
gb|KHG09490.1|  hypothetical protein F383_15518                         377   5e-123   
ref|XP_006602614.1|  PREDICTED: putative peptide/nitrate transpor...    378   5e-123   
ref|XP_011077621.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       377   1e-122   
gb|KEH28963.1|  peptide/nitrate transporter plant                       377   1e-122   
ref|XP_004172301.1|  PREDICTED: putative peptide/nitrate transpor...    372   2e-122   
gb|KHN05104.1|  Putative peptide/nitrate transporter                    374   3e-122   
gb|KDP24539.1|  hypothetical protein JCGZ_25103                         371   3e-122   
gb|KHN06992.1|  Putative peptide/nitrate transporter                    375   4e-122   
gb|EYU26617.1|  hypothetical protein MIMGU_mgv1a003329mg                375   7e-122   
ref|XP_003529111.1|  PREDICTED: putative peptide/nitrate transpor...    375   1e-121   
ref|XP_004507194.1|  PREDICTED: putative peptide/nitrate transpor...    373   3e-121   
ref|XP_003516904.1|  PREDICTED: putative peptide/nitrate transpor...    373   5e-121   
gb|KHN11892.1|  Putative peptide/nitrate transporter                    373   6e-121   
ref|XP_004147936.1|  PREDICTED: putative peptide/nitrate transpor...    372   1e-120   
ref|XP_008442499.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            370   3e-120   
gb|KDP24538.1|  hypothetical protein JCGZ_25102                         370   4e-120   
ref|XP_008448441.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            370   6e-120   
ref|XP_010037784.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       369   1e-119   
ref|XP_007140460.1|  hypothetical protein PHAVU_008G114200g             367   6e-119   
gb|KHN22623.1|  Putative peptide/nitrate transporter                    359   4e-118   
ref|XP_007133987.1|  hypothetical protein PHAVU_010G009400g             362   8e-118   
gb|KDO57957.1|  hypothetical protein CISIN_1g012514mg                   360   9e-118   
ref|XP_002312125.1|  hypothetical protein POPTR_0008s06140g             364   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011036947.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       364   2e-117   
ref|XP_010262662.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            363   2e-117   
ref|XP_007133986.1|  hypothetical protein PHAVU_010G009400g             362   1e-116   
ref|XP_006480900.1|  PREDICTED: probable peptide/nitrate transpor...    358   2e-115   
ref|XP_006429216.1|  hypothetical protein CICLE_v10011341mg             358   2e-115   
ref|XP_004492370.1|  PREDICTED: putative peptide/nitrate transpor...    358   2e-115   
ref|XP_010033212.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       358   3e-115   
ref|XP_009380625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    357   6e-115   
ref|XP_002534074.1|  Peptide transporter, putative                      370   9e-115   Ricinus communis
gb|KEH23046.1|  peptide/nitrate transporter plant                       353   1e-114   
ref|XP_009380623.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like...    357   6e-114   
ref|XP_003623153.1|  Peptide transporter PTR3-B                         354   8e-114   
ref|XP_004507202.1|  PREDICTED: probable peptide/nitrate transpor...    353   3e-113   
ref|XP_008391631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       352   4e-113   
ref|XP_008233505.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       352   7e-113   
ref|XP_007220930.1|  hypothetical protein PRUPE_ppa023730mg             350   2e-112   
ref|XP_009351271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       349   1e-111   
ref|XP_002277582.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            346   2e-110   Vitis vinifera
ref|XP_008785490.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       342   7e-109   
ref|XP_009380626.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       342   7e-109   
gb|AAK32755.1|AF361587_1  AT3g53960/F5K20_260                           328   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007009172.1|  Major facilitator superfamily protein              336   1e-106   
emb|CAN73118.1|  hypothetical protein VITISV_002486                     347   6e-106   Vitis vinifera
ref|XP_010905398.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       334   7e-106   
ref|XP_009103887.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       333   9e-106   
emb|CDY07568.1|  BnaC06g14960D                                          333   1e-105   
ref|XP_006403634.1|  hypothetical protein EUTSA_v10010224mg             333   2e-105   
ref|XP_009409715.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       332   3e-105   
emb|CDX73514.1|  BnaC08g24890D                                          325   3e-105   
ref|XP_008811508.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       332   7e-105   
emb|CDY13156.1|  BnaC04g26790D                                          325   1e-103   
emb|CDY07763.1|  BnaA03g17480D                                          327   2e-103   
ref|XP_006290772.1|  hypothetical protein CARUB_v10016878mg             328   2e-103   
emb|CDX76182.1|  BnaA04g04460D                                          327   2e-103   
ref|XP_010509262.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            327   4e-103   
ref|XP_010517068.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       326   4e-103   
emb|CDY14503.1|  BnaC03g20920D                                          326   5e-103   
ref|XP_009139278.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       326   6e-103   
ref|XP_006293895.1|  hypothetical protein CARUB_v10022888mg             325   1e-102   
ref|XP_010427058.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       325   1e-102   
ref|NP_190964.2|  probable peptide/nitrate transporter                  325   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143444.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    325   2e-102   
ref|XP_003600799.1|  Peptide transporter PTR1                           314   2e-102   
ref|XP_010505388.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       324   3e-102   
emb|CAB88358.1|  transporter-like protein                               325   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504184.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       325   3e-102   
ref|XP_010515904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       324   4e-102   
gb|KFK36688.1|  hypothetical protein AALP_AA4G156500                    322   4e-102   
ref|XP_004308908.1|  PREDICTED: putative peptide/nitrate transpor...    324   6e-102   
ref|XP_009116086.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       323   6e-102   
ref|XP_009133215.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            322   2e-101   
ref|XP_010515905.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    323   2e-101   
ref|XP_010515906.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    322   2e-101   
ref|XP_002877949.1|  proton-dependent oligopeptide transport fami...    322   5e-101   
ref|XP_008372883.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       320   1e-100   
ref|XP_006290774.1|  hypothetical protein CARUB_v10016879mg             320   2e-100   
ref|XP_006290773.1|  hypothetical protein CARUB_v10016879mg             320   2e-100   
ref|XP_010427059.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       320   2e-100   
ref|XP_010504182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7            320   3e-100   
ref|XP_002881551.1|  hypothetical protein ARALYDRAFT_482796             318   4e-100   
ref|XP_010553272.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7 isof...    317   8e-100   
ref|NP_181326.1|  putative peptide/nitrate transporter                  317   9e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923254.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            318   1e-99    
ref|XP_004503208.1|  PREDICTED: putative peptide/nitrate transpor...    317   2e-99    
ref|XP_009419917.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       317   3e-99    
ref|XP_010553271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6 isof...    317   3e-99    
gb|EEC76434.1|  hypothetical protein OsI_14122                          314   3e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_006591363.1|  PREDICTED: putative peptide/nitrate transpor...    313   3e-98    
gb|KHN17876.1|  Putative peptide/nitrate transporter                    313   6e-98    
ref|NP_001051743.1|  Os03g0823500                                       313   9e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591796.1|  PREDICTED: probable peptide/nitrate transpor...    312   9e-98    
gb|AES71051.2|  peptide/nitrate transporter plant                       312   1e-97    
ref|XP_006591795.1|  PREDICTED: probable peptide/nitrate transpor...    310   7e-97    
ref|XP_010691634.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       310   9e-97    
ref|XP_006410988.1|  hypothetical protein EUTSA_v10016423mg             309   2e-96    
gb|KHN17878.1|  Putative peptide/nitrate transporter                    308   2e-96    
ref|XP_007163476.1|  hypothetical protein PHAVU_001G2373000g            299   5e-96    
ref|XP_009345590.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       308   5e-96    
gb|KHN17877.1|  Putative peptide/nitrate transporter                    307   1e-95    
ref|XP_006601977.1|  PREDICTED: probable peptide/nitrate transpor...    305   9e-95    
ref|XP_003600795.1|  Peptide transporter PTR3-A                         302   1e-94    
ref|XP_010692129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       304   4e-94    
ref|XP_010668156.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       303   4e-94    
gb|AES71046.2|  peptide/nitrate transporter plant                       301   2e-93    
ref|XP_006651971.1|  PREDICTED: probable peptide/nitrate transpor...    301   2e-93    
emb|CDP00147.1|  unnamed protein product                                301   2e-93    
ref|XP_006601976.1|  PREDICTED: putative peptide/nitrate transpor...    301   2e-93    
ref|XP_004981230.1|  PREDICTED: probable peptide/nitrate transpor...    301   3e-93    
ref|XP_002463617.1|  hypothetical protein SORBIDRAFT_01g002990          301   4e-93    Sorghum bicolor [broomcorn]
ref|XP_003600793.1|  Peptide transporter PTR3-B                         300   7e-93    
gb|KHN07608.1|  Putative peptide/nitrate transporter                    298   3e-92    
gb|KHN07607.1|  Putative peptide/nitrate transporter                    298   3e-92    
ref|XP_003563511.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       298   4e-92    
ref|XP_006603100.1|  PREDICTED: putative peptide/nitrate transpor...    296   1e-91    
ref|XP_008644373.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       294   8e-91    
ref|XP_010108380.1|  putative peptide/nitrate transporter               282   1e-90    
ref|XP_010687909.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       292   2e-90    
ref|XP_007163474.1|  hypothetical protein PHAVU_001G237200g             292   4e-90    
ref|XP_006603101.1|  PREDICTED: probable peptide/nitrate transpor...    291   2e-89    
ref|XP_006850438.1|  hypothetical protein AMTR_s00165p00058610          291   3e-89    
gb|KHN07605.1|  Putative peptide/nitrate transporter                    287   1e-88    
emb|CDX74927.1|  BnaA05g06730D                                          287   2e-88    
emb|CDX91390.1|  BnaC04g07600D                                          287   3e-88    
tpg|DAA52235.1|  TPA: hypothetical protein ZEAMMB73_814932              287   4e-88    
ref|NP_001130610.1|  uncharacterized protein LOC100191709               287   5e-88    Zea mays [maize]
emb|CCI55655.1|  putative NRT1/PTR-like transporter                     285   2e-87    
dbj|BAK06776.1|  predicted protein                                      284   5e-87    
gb|KFK36689.1|  hypothetical protein AALP_AA4G156500                    281   2e-86    
gb|EPS63901.1|  hypothetical protein M569_10881                         281   4e-86    
ref|XP_006591362.1|  PREDICTED: putative peptide/nitrate transpor...    277   4e-84    
gb|KHN17880.1|  Putative peptide/nitrate transporter                    277   5e-84    
ref|XP_007163482.1|  hypothetical protein PHAVU_001G237800g             264   4e-82    
gb|KHN07609.1|  Putative peptide/nitrate transporter                    270   2e-81    
gb|ABR17798.1|  unknown                                                 262   2e-80    Picea sitchensis
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      264   2e-79    
ref|XP_010245117.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    259   5e-78    
ref|XP_010245114.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      260   8e-78    
ref|XP_010245116.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    259   3e-77    
ref|XP_010245115.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    259   3e-77    
ref|XP_008437001.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      257   2e-76    
ref|XP_007163479.1|  hypothetical protein PHAVU_001G237500g             256   4e-76    
gb|ABK25104.1|  unknown                                                 256   5e-76    Picea sitchensis
ref|XP_006387190.1|  hypothetical protein POPTR_1576s00200g             246   1e-75    
ref|XP_008783395.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      254   1e-75    
gb|ABR17733.1|  unknown                                                 254   2e-75    Picea sitchensis
gb|KFK34643.1|  hypothetical protein AALP_AA5G172400                    253   2e-75    
ref|XP_002304796.2|  hypothetical protein POPTR_0003s19700g             245   3e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008339153.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    255   5e-75    
ref|XP_003546719.1|  PREDICTED: probable peptide/nitrate transpor...    252   1e-74    
ref|XP_008437003.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      251   1e-74    
ref|XP_010095904.1|  putative peptide/nitrate transporter               251   2e-74    
ref|XP_009362432.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   1e-73    
ref|XP_008375473.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       244   1e-73    
gb|KHN37667.1|  Putative peptide/nitrate transporter                    249   1e-73    
gb|EMT07135.1|  Peptide transporter PTR5                                243   1e-73    
emb|CDX68284.1|  BnaA07g23240D                                          240   1e-73    
ref|XP_004143744.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    256   2e-73    
ref|XP_003542826.1|  PREDICTED: probable peptide/nitrate transpor...    248   3e-73    
ref|XP_004499763.1|  PREDICTED: probable peptide/nitrate transpor...    247   4e-73    
ref|XP_008240575.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      248   4e-73    
ref|XP_009362428.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      248   4e-73    
emb|CDM85179.1|  unnamed protein product                                247   5e-73    
gb|ABK24896.1|  unknown                                                 247   6e-73    Picea sitchensis
ref|XP_008437711.1|  PREDICTED: uncharacterized protein LOC103483057    254   7e-73    
ref|XP_007204887.1|  hypothetical protein PRUPE_ppa003472mg             246   1e-72    
ref|XP_008375318.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       244   1e-72    
gb|KDP27339.1|  hypothetical protein JCGZ_20271                         246   1e-72    
emb|CDP10687.1|  unnamed protein product                                246   2e-72    
ref|XP_003597990.1|  Peptide transporter PTR3-A                         246   2e-72    
ref|XP_008347002.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       243   2e-72    
ref|XP_010272859.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      246   2e-72    
ref|XP_002456711.1|  hypothetical protein SORBIDRAFT_03g041200          245   3e-72    Sorghum bicolor [broomcorn]
ref|XP_011031497.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      245   3e-72    
ref|XP_010062425.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      246   3e-72    
ref|XP_002325970.2|  proton-dependent oligopeptide transport fami...    246   3e-72    Populus trichocarpa [western balsam poplar]
ref|XP_002441154.1|  hypothetical protein SORBIDRAFT_09g021330          245   4e-72    Sorghum bicolor [broomcorn]
gb|ACJ85853.1|  unknown                                                 244   4e-72    Medicago truncatula
ref|XP_007218954.1|  hypothetical protein PRUPE_ppa003507mg             245   4e-72    
ref|XP_007011003.1|  Major facilitator superfamily protein              245   5e-72    
ref|XP_009363640.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       245   5e-72    
ref|XP_009415773.1|  PREDICTED: uncharacterized protein LOC103996574    251   5e-72    
gb|AGT17393.1|  hypothetical protein SHCRBa_189_K21_R_20                244   6e-72    
gb|AGT17133.1|  peptide/nitrate transporter                             244   7e-72    
gb|EMT32230.1|  Peptide transporter PTR2                                240   8e-72    
ref|XP_004308589.1|  PREDICTED: probable peptide/nitrate transpor...    244   9e-72    
ref|XP_009361962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       244   1e-71    
ref|XP_004172151.1|  PREDICTED: probable peptide/nitrate transpor...    241   1e-71    
ref|XP_010272857.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      244   1e-71    
ref|XP_004514886.1|  PREDICTED: probable peptide/nitrate transpor...    243   1e-71    
ref|XP_010095905.1|  putative peptide/nitrate transporter               244   2e-71    
gb|KHG09768.1|  hypothetical protein F383_13158                         244   2e-71    
ref|XP_002297740.2|  hypothetical protein POPTR_0001s06440g             243   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_006376225.1|  hypothetical protein POPTR_0013s11120g             243   3e-71    
ref|XP_010418901.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      242   3e-71    
ref|XP_011000563.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       243   3e-71    
ref|XP_009361960.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       243   3e-71    
ref|XP_008375319.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            243   3e-71    
ref|XP_002887416.1|  proton-dependent oligopeptide transport fami...    242   4e-71    
ref|XP_004172150.1|  PREDICTED: probable peptide/nitrate transpor...    242   4e-71    
ref|NP_001044939.2|  Os01g0871600                                       241   4e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011001076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      242   4e-71    
gb|KDP27340.1|  hypothetical protein JCGZ_20272                         242   4e-71    
ref|XP_009361961.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       242   5e-71    
dbj|BAB86542.1|  OSJNBb0008G24.12                                       242   5e-71    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03342.1|  predicted protein                                      241   8e-71    
gb|EAY76648.1|  hypothetical protein OsI_04604                          241   9e-71    Oryza sativa Indica Group [Indian rice]
gb|ACL52999.1|  unknown                                                 241   9e-71    Zea mays [maize]
gb|KEH29311.1|  proton-dependent oligopeptide transport family pr...    238   9e-71    
gb|EYU38280.1|  hypothetical protein MIMGU_mgv1a021345mg                241   1e-70    
gb|AFW78190.1|  hypothetical protein ZEAMMB73_551902                    241   1e-70    
ref|NP_001055628.2|  Os05g0431700                                       233   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579530.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      241   1e-70    
gb|KHG04630.1|  hypothetical protein F383_29596                         242   1e-70    
ref|XP_007020112.1|  Major facilitator superfamily protein              241   1e-70    
ref|XP_006470865.1|  PREDICTED: probable peptide/nitrate transpor...    241   1e-70    
gb|KDP40528.1|  hypothetical protein JCGZ_24527                         241   1e-70    
gb|KEH29310.1|  proton-dependent oligopeptide transport family pr...    238   2e-70    
ref|XP_008246054.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       241   2e-70    
ref|XP_010683004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      241   2e-70    
ref|XP_002444787.1|  hypothetical protein SORBIDRAFT_07g028040          239   2e-70    Sorghum bicolor [broomcorn]
emb|CDP10685.1|  unnamed protein product                                238   3e-70    
gb|KDP35100.1|  hypothetical protein JCGZ_10942                         240   3e-70    
ref|XP_006416187.1|  hypothetical protein EUTSA_v10007248mg             234   3e-70    
ref|XP_002890519.1|  proton-dependent oligopeptide transport fami...    240   3e-70    
ref|XP_002521809.1|  oligopeptide transporter, putative                 247   3e-70    Ricinus communis
ref|XP_006420719.1|  hypothetical protein CICLE_v10006572mg             240   3e-70    
emb|CAN70960.1|  hypothetical protein VITISV_025055                     240   3e-70    Vitis vinifera
ref|XP_010534099.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           240   4e-70    
ref|NP_173670.2|  probable peptide/nitrate transporter                  239   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521163.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      240   4e-70    
ref|XP_003598531.1|  Peptide transporter PTR5                           239   4e-70    
ref|XP_006434673.1|  hypothetical protein CICLE_v10000719mg             240   4e-70    
gb|KFK35753.1|  hypothetical protein AALP_AA4G032000                    236   5e-70    
gb|AAF18524.1|AC006551_10  Similar to peptide transporter               239   5e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299817.1|  PREDICTED: uncharacterized protein LOC101298022    246   6e-70    
dbj|BAJ86454.1|  predicted protein                                      239   7e-70    
ref|XP_009104876.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      238   7e-70    
ref|XP_007133765.1|  hypothetical protein PHAVU_011G207100g             240   7e-70    
gb|KFK41633.1|  hypothetical protein AALP_AA2G153000                    245   8e-70    
gb|AAV84496.1|  At3g54450                                               232   8e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301425.1|  PREDICTED: probable peptide/nitrate transpor...    238   9e-70    
ref|XP_008339154.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    241   9e-70    
ref|XP_004143743.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    245   1e-69    
ref|XP_010665397.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      239   1e-69    
ref|XP_007131295.1|  hypothetical protein PHAVU_011G001900g             239   1e-69    
tpg|DAA56612.1|  TPA: hypothetical protein ZEAMMB73_385814              238   1e-69    
ref|XP_004301426.1|  PREDICTED: uncharacterized protein LOC101310523    246   1e-69    
gb|KHN47085.1|  Putative peptide/nitrate transporter                    238   1e-69    
ref|XP_003523479.1|  PREDICTED: probable peptide/nitrate transpor...    238   1e-69    
gb|KEH29314.1|  peptide/nitrate transporter plant-like protein          236   1e-69    
ref|XP_009104871.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      237   2e-69    
gb|KEH29309.1|  proton-dependent oligopeptide transport family pr...    238   2e-69    
ref|XP_006473248.1|  PREDICTED: probable peptide/nitrate transpor...    238   2e-69    
ref|XP_007020106.1|  Major facilitator superfamily protein isoform 1    238   2e-69    
ref|NP_001147980.1|  LOC100281589                                       238   2e-69    
ref|XP_007020107.1|  Major facilitator superfamily protein isoform 2    238   2e-69    
gb|KEH16161.1|  proton-dependent oligopeptide transport family pr...    238   2e-69    
ref|XP_010428076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      237   2e-69    
ref|XP_006416186.1|  hypothetical protein EUTSA_v10007248mg             234   3e-69    
ref|XP_011020391.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            238   3e-69    
ref|XP_006390695.1|  hypothetical protein EUTSA_v10018388mg             237   3e-69    
ref|XP_010937976.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       238   3e-69    
ref|XP_006856672.1|  hypothetical protein AMTR_s00054p00083290          238   3e-69    
gb|EMT00830.1|  Peptide transporter PTR2                                236   4e-69    
emb|CDX68280.1|  BnaA07g23200D                                          236   4e-69    
ref|XP_009104874.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      236   4e-69    
ref|XP_007220562.1|  hypothetical protein PRUPE_ppa003298mg             238   4e-69    
dbj|BAF02114.1|  peptide transporter like protein                       230   5e-69    
ref|XP_011091838.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       236   5e-69    
gb|KHF99635.1|  hypothetical protein F383_18770                         237   6e-69    
emb|CAN75422.1|  hypothetical protein VITISV_011767                     237   6e-69    
gb|EMT01235.1|  Peptide transporter PTR2                                234   6e-69    
emb|CDP10688.1|  unnamed protein product                                237   7e-69    
ref|XP_007020108.1|  Major facilitator superfamily protein, putat...    243   7e-69    
ref|XP_002266676.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            236   1e-68    
gb|EYU22787.1|  hypothetical protein MIMGU_mgv1a003626mg                236   1e-68    
gb|ACN26535.1|  unknown                                                 229   1e-68    
dbj|BAK01134.1|  predicted protein                                      233   1e-68    
ref|XP_004959949.1|  PREDICTED: probable peptide/nitrate transpor...    235   1e-68    
emb|CDM85180.1|  unnamed protein product                                235   2e-68    
ref|XP_009362004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       236   2e-68    
ref|XP_002456710.1|  hypothetical protein SORBIDRAFT_03g041190          235   2e-68    
gb|ACF84448.1|  unknown                                                 231   2e-68    
ref|XP_010665406.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    234   2e-68    
emb|CDY21370.1|  BnaA09g30570D                                          235   2e-68    
gb|KFK44349.1|  hypothetical protein AALP_AA1G246100                    235   2e-68    
gb|AAT47044.1|  hypothetical protein                                    233   2e-68    
dbj|BAJ93952.1|  predicted protein                                      236   2e-68    
ref|XP_011096129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      235   2e-68    
gb|KEH29305.1|  proton-dependent oligopeptide transport family pr...    233   2e-68    
ref|XP_008375317.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       235   3e-68    
ref|XP_010095893.1|  putative peptide/nitrate transporter               235   3e-68    
ref|XP_003627833.1|  Peptide transporter PTR1                           235   3e-68    
ref|XP_008339202.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   3e-68    
ref|XP_010477514.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   3e-68    
gb|ACR38185.1|  unknown                                                 231   3e-68    
ref|XP_010911915.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    239   3e-68    
ref|XP_008245631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       234   4e-68    
ref|XP_011031498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      235   4e-68    
ref|XP_011096252.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   4e-68    
ref|XP_010498728.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           234   4e-68    
gb|EMT01236.1|  Peptide transporter PTR1                                236   5e-68    
ref|XP_010414835.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      234   5e-68    
ref|XP_009361963.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       233   6e-68    
ref|XP_007020110.1|  Major facilitator superfamily protein              234   6e-68    
emb|CDY24388.1|  BnaCnng04550D                                          233   6e-68    
ref|XP_010428077.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      233   7e-68    
ref|XP_008781530.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   7e-68    
ref|XP_003634604.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    234   7e-68    
ref|XP_009115625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           234   8e-68    
ref|XP_010095974.1|  putative peptide/nitrate transporter               234   8e-68    
ref|XP_010921100.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            234   8e-68    
ref|XP_010665405.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    234   9e-68    
ref|XP_002887414.1|  hypothetical protein ARALYDRAFT_316182             233   9e-68    
ref|XP_006390699.1|  hypothetical protein EUTSA_v10019829mg             232   9e-68    
ref|XP_006830432.1|  hypothetical protein AMTR_s00118p00128710          225   1e-67    
ref|XP_008446958.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            234   1e-67    
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...    233   1e-67    
ref|XP_006416188.1|  hypothetical protein EUTSA_v10007248mg             233   1e-67    
ref|XP_010683224.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   1e-67    
gb|KEH29306.1|  proton-dependent oligopeptide transport family pr...    233   1e-67    
ref|XP_010322772.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    231   1e-67    
ref|XP_003579529.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      233   1e-67    
ref|XP_008782623.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            234   1e-67    
ref|NP_974431.2|  probable peptide/nitrate transporter                  233   1e-67    
dbj|BAD82718.1|  oligopeptide transporter-like protein                  226   1e-67    
ref|XP_010095972.1|  putative peptide/nitrate transporter               234   2e-67    
emb|CDY36098.1|  BnaA08g19500D                                          232   2e-67    
gb|KHG19841.1|  hypothetical protein F383_03296                         233   2e-67    
ref|XP_002319378.2|  hypothetical protein POPTR_0013s11110g             233   2e-67    
ref|NP_974129.1|  putative peptide/nitrate transporter                  229   2e-67    
ref|XP_009109895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15-like      232   2e-67    
ref|XP_009127904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           233   2e-67    
ref|XP_006376224.1|  hypothetical protein POPTR_0013s11100g             232   3e-67    
ref|XP_008231698.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       231   3e-67    
ref|XP_010427147.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       232   4e-67    
emb|CDY03656.1|  BnaA02g15810D                                          232   4e-67    
gb|EEC79279.1|  hypothetical protein OsI_20070                          232   4e-67    
emb|CDX96376.1|  BnaA07g29870D                                          231   4e-67    
ref|XP_010460012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      232   4e-67    
ref|XP_010665403.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      232   5e-67    
ref|XP_003566212.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      232   5e-67    
ref|XP_009357420.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       232   5e-67    
ref|XP_010419160.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      231   5e-67    
emb|CAN63512.1|  hypothetical protein VITISV_031693                     232   5e-67    
gb|ACG29580.1|  POT family protein                                      231   6e-67    
ref|XP_009127903.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    228   7e-67    
gb|EYU22785.1|  hypothetical protein MIMGU_mgv1a004125mg                231   7e-67    
ref|XP_006376230.1|  hypothetical protein POPTR_0013s11170g             229   7e-67    
ref|XP_010515972.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            231   8e-67    
gb|KFK41643.1|  hypothetical protein AALP_AA2G154400                    231   8e-67    
gb|KFK41632.1|  hypothetical protein AALP_AA2G152900                    224   9e-67    
ref|XP_007131296.1|  hypothetical protein PHAVU_011G002000g             231   1e-66    
ref|XP_010415947.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      231   1e-66    
ref|XP_010233562.1|  PREDICTED: uncharacterized protein LOC100831418    238   1e-66    
ref|XP_004511030.1|  PREDICTED: probable peptide/nitrate transpor...    231   1e-66    
ref|XP_004241845.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    231   1e-66    
emb|CDY04807.1|  BnaC05g17820D                                          230   1e-66    
ref|XP_006645087.1|  PREDICTED: probable peptide/nitrate transpor...    230   1e-66    
ref|XP_006292507.1|  hypothetical protein CARUB_v10018737mg             230   1e-66    
emb|CAH68100.1|  B0518A01.5                                             229   1e-66    
ref|XP_010504249.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            230   2e-66    
emb|CDX82183.1|  BnaC02g21070D                                          230   2e-66    
ref|XP_002513061.1|  Peptide transporter, putative                      231   2e-66    
ref|XP_009783108.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      231   2e-66    
emb|CBI39334.3|  unnamed protein product                                234   2e-66    
ref|XP_010683110.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      230   2e-66    
ref|XP_009104872.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      229   2e-66    
gb|EYU22786.1|  hypothetical protein MIMGU_mgv11b021031mg               229   2e-66    
emb|CDX68281.1|  BnaA07g23210D                                          230   2e-66    
ref|NP_001054358.1|  Os04g0691400                                       229   2e-66    
ref|XP_002887417.1|  proton-dependent oligopeptide transport fami...    229   2e-66    
ref|XP_009104873.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      229   2e-66    
emb|CDY58917.1|  BnaCnng33920D                                          229   2e-66    
emb|CAN71099.1|  hypothetical protein VITISV_000973                     230   2e-66    
emb|CAN66299.1|  hypothetical protein VITISV_013344                     230   3e-66    
ref|NP_177359.1|  putative peptide/nitrate transporter                  229   3e-66    
ref|XP_010665399.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      229   3e-66    
dbj|BAD43310.1|  putative peptide transporter PTR2-B                    229   3e-66    
ref|XP_006356504.1|  PREDICTED: probable peptide/nitrate transpor...    229   3e-66    
ref|XP_010665402.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      229   4e-66    
ref|XP_006845418.1|  hypothetical protein AMTR_s00019p00083970          229   4e-66    
ref|NP_177358.2|  putative peptide/nitrate transporter                  228   4e-66    
ref|XP_010521165.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      229   4e-66    
ref|XP_006301502.1|  hypothetical protein CARUB_v10021928mg             226   4e-66    
ref|XP_007011004.1|  Major facilitator superfamily protein              228   5e-66    
ref|XP_002266023.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           229   5e-66    
ref|XP_002265901.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       229   5e-66    
ref|XP_004963750.1|  PREDICTED: uncharacterized protein LOC101758083    236   6e-66    
ref|XP_009788012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      229   7e-66    
dbj|BAC42330.1|  putative peptide transporter PTR2-B                    227   7e-66    
emb|CDY24387.1|  BnaCnng04540D                                          228   7e-66    
ref|XP_006307141.1|  hypothetical protein CARUB_v10008731mg             228   8e-66    
emb|CDY58920.1|  BnaCnng33940D                                          227   1e-65    
emb|CDY58918.1|  BnaCnng33930D                                          228   1e-65    
ref|XP_004308593.1|  PREDICTED: probable peptide/nitrate transpor...    228   1e-65    
ref|XP_008776452.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       228   1e-65    
ref|XP_009127902.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    227   1e-65    
ref|XP_002876254.1|  hypothetical protein ARALYDRAFT_348537             227   2e-65    
ref|NP_001168010.1|  uncharacterized protein LOC100381733               228   2e-65    
emb|CBI39329.3|  unnamed protein product                                228   2e-65    
ref|XP_009105872.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    224   2e-65    
ref|XP_010471232.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           227   2e-65    
emb|CBI39330.3|  unnamed protein product                                228   2e-65    
ref|XP_006295948.1|  hypothetical protein CARUB_v10025090mg             225   2e-65    
gb|EMT06581.1|  Peptide transporter PTR3-A                              227   3e-65    
ref|XP_010521166.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      227   3e-65    
emb|CDM85183.1|  unnamed protein product                                225   3e-65    
ref|XP_009593533.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      227   3e-65    
gb|AAO42884.1|  At1g22550                                               227   3e-65    
emb|CAN63511.1|  hypothetical protein VITISV_031692                     226   3e-65    
gb|AFK47483.1|  unknown                                                 221   3e-65    
ref|NP_173671.1|  putative peptide/nitrate transporter                  227   4e-65    
ref|XP_006829376.1|  hypothetical protein AMTR_s00256p00011920          227   4e-65    
emb|CBI40153.3|  unnamed protein product                                235   4e-65    
ref|NP_001044938.2|  Os01g0871500                                       226   5e-65    
ref|XP_009386938.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       224   5e-65    
ref|XP_001781231.1|  predicted protein                                  227   6e-65    
emb|CBI39331.3|  unnamed protein product                                231   6e-65    
ref|XP_002440906.1|  hypothetical protein SORBIDRAFT_09g016180          225   6e-65    
ref|XP_010665396.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      226   7e-65    
ref|XP_010251739.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       226   8e-65    
ref|XP_010269378.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    226   9e-65    
emb|CDX72873.1|  BnaC06g33210D                                          225   9e-65    
ref|XP_002325969.2|  proton-dependent oligopeptide transport fami...    231   1e-64    
gb|EEE55745.1|  hypothetical protein OsJ_04246                          219   1e-64    
ref|XP_009593536.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      226   1e-64    
ref|XP_002265992.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      226   1e-64    
gb|KHN32469.1|  Putative peptide/nitrate transporter                    223   1e-64    
dbj|BAJ96287.1|  predicted protein                                      224   1e-64    
ref|XP_010555577.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            226   1e-64    
ref|XP_007026879.1|  Major facilitator superfamily protein isoform 3    223   1e-64    
ref|XP_010269377.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    226   1e-64    
ref|XP_008352804.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      219   1e-64    
ref|XP_009391687.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       225   2e-64    
dbj|BAJ98126.1|  predicted protein                                      224   2e-64    
ref|XP_004516135.1|  PREDICTED: probable peptide/nitrate transpor...    225   2e-64    
dbj|BAB86541.1|  OSJNBb0008G24.11                                       226   2e-64    
ref|XP_010665398.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      224   2e-64    
ref|XP_004972267.1|  PREDICTED: probable peptide/nitrate transpor...    224   2e-64    
dbj|BAB86548.1|  OSJNBb0008G24.20                                       224   3e-64    
ref|XP_006415889.1|  hypothetical protein EUTSA_v10007254mg             224   4e-64    
ref|XP_009613182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      224   4e-64    
ref|XP_006306225.1|  hypothetical protein CARUB_v10011935mg             224   4e-64    
dbj|BAJ96362.1|  predicted protein                                      223   4e-64    
gb|EYU27212.1|  hypothetical protein MIMGU_mgv1a017651mg                223   5e-64    
ref|XP_006434674.1|  hypothetical protein CICLE_v10000738mg             223   6e-64    
ref|XP_009105871.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    223   6e-64    
ref|NP_001149880.1|  peptide transporter PTR2-B                         223   6e-64    
ref|XP_010498731.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...    223   6e-64    
ref|XP_010665401.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      223   6e-64    
gb|EMT03675.1|  Peptide transporter PTR2                                220   6e-64    
gb|EMT01237.1|  Peptide transporter PTR5                                222   7e-64    
ref|XP_010498730.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...    223   7e-64    
emb|CDP00908.1|  unnamed protein product                                223   8e-64    
emb|CDX82184.1|  BnaC02g21060D                                          222   8e-64    
ref|XP_009415622.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      218   8e-64    
ref|XP_004168265.1|  PREDICTED: probable peptide/nitrate transpor...    224   8e-64    
gb|ABR32184.1|  peptide transporter                                     223   9e-64    
gb|AGT17132.1|  peptide/nitrate transporter                             221   9e-64    
ref|XP_009116130.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            223   9e-64    
emb|CDM83970.1|  unnamed protein product                                222   9e-64    
ref|XP_009782735.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      223   1e-63    
gb|AAG51788.1|AC067754_4  peptide transporter PTR2-B, putative; 1...    227   1e-63    
dbj|BAE99752.1|  oligopeptide like transporter                          220   1e-63    
ref|XP_002447379.1|  hypothetical protein SORBIDRAFT_06g034030          221   1e-63    



>ref|XP_009621141.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana tomentosiformis]
Length=597

 Score =   435 bits (1119),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 230/260 (88%), Gaps = 2/260 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLTTLPFG+CVAQ ATFFIKQG T++RKII+ FEIPPA+IY+L A+GM
Sbjct  338  EELKLLINMIPIWLTTLPFGICVAQAATFFIKQGVTMNRKIIHNFEIPPASIYALTAVGM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SVTIYD+ILVP +R+ATGNERG++ILQRIGIGMIFSV+TM VAALVE+KRLN V +N 
Sbjct  398  IISVTIYDKILVPFMRRATGNERGISILQRIGIGMIFSVSTMVVAALVERKRLNVVHKNL  457

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPD+MRSLGIA YLSV GAANF+
Sbjct  458  FAGSASMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDTMRSLGIALYLSVIGAANFI  517

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T  SG+SWFGKDLNSSRLDYFYWLL  ITA NLCVYV VAR+YTYKNV 
Sbjct  518  SSLLITIVDHITENSGKSWFGKDLNSSRLDYFYWLLATITAVNLCVYVFVARSYTYKNVH  577

Query  716  SKTTMAVADCDDDGGRDAMV  775
            S TTMAVADCDD   R AMV
Sbjct  578  SMTTMAVADCDDGDNRKAMV  597



>ref|XP_010312293.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=591

 Score =   429 bits (1104),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 233/259 (90%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVINMVPIWLTT+PFG+CVAQ  TFFIKQG TLDRKI++ FEIPPA+I++LAAIGM
Sbjct  332  EELKLVINMVPIWLTTIPFGICVAQTTTFFIKQGVTLDRKILHDFEIPPASIFALAAIGM  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIYD++LVPVLR+ATGNERG++ILQRIGIGMIFSV+TM VAALVE+KRLN VQ++ 
Sbjct  392  IISLTIYDKVLVPVLRRATGNERGISILQRIGIGMIFSVSTMVVAALVERKRLNLVQKDP  451

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+
Sbjct  452  LEGSSRMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFV  511

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T ++G+SWFGKDLNSSRLDYFYWLL  +TA NLCVYV+VARNY+YKNV 
Sbjct  512  SSLLITIVDHITEKNGKSWFGKDLNSSRLDYFYWLLAIMTAVNLCVYVIVARNYSYKNVH  571

Query  716  SKTTMAVADCDDDGGRDAM  772
            SK TM+VA C+D   R+AM
Sbjct  572  SKATMSVAVCNDTDDREAM  590



>ref|XP_006339007.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Solanum tuberosum]
Length=589

 Score =   429 bits (1103),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 201/259 (78%), Positives = 232/259 (90%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVINM+PIWLTT+PFG+CVAQ  TFFIKQG TLDRKI++ FEIPPA+I++LAAIGM
Sbjct  330  EELKLVINMIPIWLTTIPFGICVAQTTTFFIKQGVTLDRKIVHNFEIPPASIFALAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIYD+ILVPVLR+ATGNERG++ILQRIG GMIFSV+TM VAALVE+KRLN V +N 
Sbjct  390  IISITIYDKILVPVLRRATGNERGISILQRIGFGMIFSVSTMIVAALVERKRLNLVHKNP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S +MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+
Sbjct  450  LKGSSTMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFV  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T ++G+SWFGKDLN+SRLDYFYWLL  +TA NLCVYV+VARNY+YKNV 
Sbjct  510  SSLLITIVDHITEKNGKSWFGKDLNNSRLDYFYWLLAIMTAVNLCVYVIVARNYSYKNVH  569

Query  716  SKTTMAVADCDDDGGRDAM  772
             K T++VADC+D   R+AM
Sbjct  570  CKATISVADCNDTDDREAM  588



>ref|XP_009771569.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana sylvestris]
Length=595

 Score =   427 bits (1097),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 202/260 (78%), Positives = 228/260 (88%), Gaps = 2/260 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLTTLPFG+CVAQ ATFFIKQG T++RKII+ FEIPPA+IY+L A+GM
Sbjct  336  EELKLLINMIPIWLTTLPFGICVAQAATFFIKQGVTMNRKIIHNFEIPPASIYALTAVGM  395

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SVTIYD+ILVP++R+ATGNERG++ILQRIGIGMIFSV++M VAALVE+KRLN V +N 
Sbjct  396  IISVTIYDKILVPIMRRATGNERGISILQRIGIGMIFSVSSMVVAALVERKRLNVVHKNP  455

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPD+MRSLGIA YLSV GAANF+
Sbjct  456  FEGSASMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDTMRSLGIALYLSVIGAANFI  515

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T  SG+SWFGKDLNSSRLDYFYWLL  ITA NLCVYV  AR+YTYKN  
Sbjct  516  SSLLITIVDHITKNSGKSWFGKDLNSSRLDYFYWLLATITAVNLCVYVFAARSYTYKNEH  575

Query  716  SKTTMAVADCDDDGGRDAMV  775
            S TT+AVADCDD   R  MV
Sbjct  576  STTTIAVADCDDGDNRKGMV  595



>ref|XP_009799129.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana sylvestris]
Length=595

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 227/253 (90%), Gaps = 3/253 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVIN  PIWLTT+PFG+C+AQ ATFFIKQG TL+RKI++ FEIPPA+I++LAA+GM
Sbjct  338  EELKLVINTTPIWLTTIPFGICIAQAATFFIKQGVTLNRKIVHNFEIPPASIFALAAVGM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT+Y++ILVPVLR+ATGNERG++ILQRIGIGMIFSV+TM VAALVE+KRLN V EN 
Sbjct  398  IISVTMYEKILVPVLRRATGNERGISILQRIGIGMIFSVSTMIVAALVERKRLNIVHENP  457

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV GAANF+
Sbjct  458  LEGSASMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGAANFI  517

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY-KNV  712
            SSLLIT VD  T +SG+SWFGKDLNSSRLDYFYWLL  ITA NLCVYV VARNY+Y KNV
Sbjct  518  SSLLITIVDHITEKSGKSWFGKDLNSSRLDYFYWLLATITAVNLCVYVFVARNYSYKKNV  577

Query  713  QSKTTMAVADCDD  751
              +TT+AVADCDD
Sbjct  578  HGRTTIAVADCDD  590



>ref|XP_009590467.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana tomentosiformis]
Length=590

 Score =   422 bits (1085),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVIN +PIWLTT+PFG+CVAQ ATFFIKQG TL+RKI++ FEIPPA+I++LAA GM
Sbjct  334  EELKLVINTIPIWLTTIPFGICVAQAATFFIKQGVTLNRKIVHNFEIPPASIFALAAFGM  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVTIY++ILVPVLR+ATGNERG++ILQRIGIGMIFSV+TM VAALVE+KRLN V +N 
Sbjct  394  IISVTIYEKILVPVLRRATGNERGISILQRIGIGMIFSVSTMIVAALVERKRLNIVNKNP  453

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV GAANF+
Sbjct  454  LEGSASMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGAANFI  513

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLNSSRLDYFYWLL  ITA NLCVYV VARNY+YKNV 
Sbjct  514  SSLLITIVDHITEKGGKSWFGKDLNSSRLDYFYWLLATITAVNLCVYVFVARNYSYKNVH  573

Query  716  SKTTMAVADCDD  751
             + T+AVADCDD
Sbjct  574  GRKTIAVADCDD  585



>ref|XP_006339008.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Solanum tuberosum]
Length=597

 Score =   419 bits (1078),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 226/260 (87%), Gaps = 2/260 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLTTLPFG+CVAQ ATFF+KQG T++R+II+ FEIPPA+IY+L A+GM
Sbjct  338  EELKLIINMIPIWLTTLPFGICVAQAATFFLKQGVTMNRRIIHNFEIPPASIYALTAVGM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV  YD+ILVP LR+ TGNERG+ ILQRIGIGMIFS++TM VAALVE+KRLN V +N 
Sbjct  398  IISVAFYDKILVPFLRRTTGNERGINILQRIGIGMIFSISTMIVAALVERKRLNLVDKNP  457

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLI+GI DGF LVGLQE+FYDQVPDSMRSLGIA YLSV GAANF+
Sbjct  458  LEGSSSMSVFWLAPQFLILGIADGFALVGLQEFFYDQVPDSMRSLGIALYLSVIGAANFI  517

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T +SG+SWFGKD NSSRLDYFYWLL  ITA NLCVYV+VARNY+YKNV+
Sbjct  518  SSLLITIVDHITEKSGKSWFGKDPNSSRLDYFYWLLAIITAVNLCVYVIVARNYSYKNVR  577

Query  716  SKTTMAVADCDDDGGRDAMV  775
             K TM+VADCDD   R+AMV
Sbjct  578  CKATMSVADCDDRDNREAMV  597



>ref|XP_010312294.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=604

 Score =   415 bits (1066),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLTTLPFG+CVAQ ATFF+KQG T++RKII+ FEIP A+IY+L A+GM
Sbjct  328  EEVKLIINMIPIWLTTLPFGICVAQAATFFLKQGFTMNRKIIHNFEIPTASIYALTAVGM  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV  YD+ILVP LR+ TGNERG+TILQRIGIGMIFSV+TM VAALVE KRLN V  N+
Sbjct  388  IISVAFYDKILVPFLRRTTGNERGITILQRIGIGMIFSVSTMIVAALVESKRLNLVHRNS  447

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLI+GI DGF LVGLQEYFYDQ+PDSMRSLGIA YLSV GAANF+
Sbjct  448  LEGSSRMSVFWLAPQFLILGIADGFALVGLQEYFYDQIPDSMRSLGIALYLSVIGAANFI  507

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T RSG+SWFGKD NSSRLDYFYWLL  ITA NLCVYV+VARNY+YKNV 
Sbjct  508  SSLLITIVDHVTERSGKSWFGKDPNSSRLDYFYWLLAIITAVNLCVYVVVARNYSYKNVH  567

Query  716  SKTTMAVADCDD  751
            SK TM+VADCDD
Sbjct  568  SKATMSVADCDD  579



>gb|EYU41789.1| hypothetical protein MIMGU_mgv1a003424mg [Erythranthe guttata]
Length=586

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/250 (79%), Positives = 215/250 (86%), Gaps = 3/250 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIWLTTLPFG+CVAQ ATFFIKQG TLDRKI + F IPPA+IY+LAAIGM
Sbjct  333  EEMKLIINMIPIWLTTLPFGICVAQAATFFIKQGTTLDRKITDEFTIPPASIYALAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SVT+YDR L+P LR+ T NERG+ ILQRIGIGM+FSV TM VAALVEKKRLN V+EN 
Sbjct  393  IFSVTVYDRALIPFLRRVTKNERGINILQRIGIGMVFSVITMVVAALVEKKRLNLVRENP  452

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV G ANFL
Sbjct  453  IKGSVSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGVANFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VDR T + G+SWFGKDLNSSRLDYFYWLL GIT  NL VY  VA  Y+YKNV+
Sbjct  513  SSLLITVVDRLTEKGGKSWFGKDLNSSRLDYFYWLLAGITGVNLVVYAFVASRYSYKNVK  572

Query  716  SKTTMAVADC  745
             KTT+AV+DC
Sbjct  573  -KTTLAVSDC  581



>ref|XP_009620626.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nicotiana tomentosiformis]
Length=593

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 224/259 (86%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM PIWLTTLPFG+C+AQ +TFFIKQG TL+RKI + F+IPPA++Y + AIGM
Sbjct  334  EELKLLINMTPIWLTTLPFGICIAQASTFFIKQGVTLNRKITHNFDIPPASMYGIGAIGM  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            IV+VTIYD+ILVP+LRKAT NERG++ILQRIGIGM+FS+ TM +AALVE+KRL  V++N 
Sbjct  394  IVTVTIYDKILVPILRKATRNERGISILQRIGIGMMFSIITMIIAALVERKRLRIVEKNL  453

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF ++GIGDGF LVGLQEYFYDQVPD+MRSLGIAFYLSV GAANFL
Sbjct  454  LEGSISMSVFWLAPQFFLVGIGDGFALVGLQEYFYDQVPDTMRSLGIAFYLSVVGAANFL  513

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLDYFY LL  ITAA+LC+YV VAR+Y+YKNVQ
Sbjct  514  SSMLITIVDHITEKSGKSWFGKDLNSSRLDYFYLLLATITAASLCIYVFVARSYSYKNVQ  573

Query  716  SKTTMAVADCDDDGGRDAM  772
            SK T  VA+C D   R+AM
Sbjct  574  SKRTADVANCQDGDDREAM  592



>ref|XP_009772498.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana sylvestris]
Length=593

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 223/259 (86%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM PIWLTTLPFG+C+AQ +TFFIKQG TL+RKI   FEIPPA++Y + AIGM
Sbjct  334  EEMKLLINMTPIWLTTLPFGICIAQASTFFIKQGVTLNRKITYDFEIPPASMYGIGAIGM  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            IV+VTIYD+ILVP+LRKATGNERG+ ILQRIGIGM+FS+TTM +AALVE+KRL  V++N 
Sbjct  394  IVTVTIYDKILVPLLRKATGNERGIGILQRIGIGMMFSITTMIIAALVERKRLRIVEKNL  453

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMS+FWLAPQF ++GIGDGF LVGLQEYFYDQVPD+MRSLGIAFYLSV GAANFL
Sbjct  454  LEGSISMSIFWLAPQFFLVGIGDGFALVGLQEYFYDQVPDTMRSLGIAFYLSVVGAANFL  513

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLDYFY LL  ITA +LC+YV VAR+Y+YKNVQ
Sbjct  514  SSMLITIVDHITEKSGKSWFGKDLNSSRLDYFYLLLATITAVSLCIYVFVARSYSYKNVQ  573

Query  716  SKTTMAVADCDDDGGRDAM  772
            S+ T  VA+C +   R+AM
Sbjct  574  SRRTADVANCHNRDNREAM  592



>ref|XP_006340981.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Solanum tuberosum]
Length=590

 Score =   401 bits (1031),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 225/259 (87%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLTTLPFG+C+AQ +TFFIKQGATL+RKI + F+IPPA++Y+L AIGM
Sbjct  331  EELKLLINMIPIWLTTLPFGICIAQSSTFFIKQGATLNRKISHDFQIPPASMYALGAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V IYD+ILVP+LR+ATGNERG++ILQRIGIGMI SV +M VAALVE+KRLN VQEN 
Sbjct  391  IATVIIYDKILVPLLRRATGNERGISILQRIGIGMILSVASMIVAALVERKRLNIVQENL  450

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLI+GIGDGF LVGLQEYFYDQVPD++RSLGIAFYLSV GAANFL
Sbjct  451  PKGSMSMSVFWLAPQFLIVGIGDGFALVGLQEYFYDQVPDTIRSLGIAFYLSVLGAANFL  510

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLNSSRLDYFY+LL  ITA NL +YV+VAR+Y+YKNV 
Sbjct  511  SSLLITIVDHVTEKGGKSWFGKDLNSSRLDYFYYLLATITAVNLFIYVVVARSYSYKNVH  570

Query  716  SKTTMAVADCDDDGGRDAM  772
            S+ T  VA+C D   R+AM
Sbjct  571  SRRTADVANCYDGDDREAM  589



>ref|XP_011094926.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Sesamum indicum]
Length=588

 Score =   401 bits (1031),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/259 (75%), Positives = 221/259 (85%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWLTTLPFG+CVAQ +TFFIKQG TLDRKI   F IPPA+IY+LAAIGM
Sbjct  330  EEMKLVVNMIPIWLTTLPFGICVAQASTFFIKQGTTLDRKITRDFMIPPASIYALAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVTIYD++L P+LR+ TG+ERG+ +LQRIGIGMIFSV TM VAALVE+KRLN V+ N 
Sbjct  390  IISVTIYDKLLEPILRRVTGHERGIKVLQRIGIGMIFSVLTMVVAALVERKRLNVVERNP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIGIGDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAANFL
Sbjct  450  LEGSVSMSVFWLAPQFLIIGIGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAANFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLN+SRLDYFYWLL GITA N+C++  VA  Y+YKNV+
Sbjct  510  SSLLITLVDHLTEKGGKSWFGKDLNTSRLDYFYWLLAGITAGNICIFAFVASRYSYKNVR  569

Query  716  SKTTMAVADCDDDGGRDAM  772
             KTT+AVADC +    +AM
Sbjct  570  -KTTVAVADCYEGDHIEAM  587



>emb|CDP06560.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   398 bits (1023),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 221/259 (85%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVINM+PIWLTTL FG+CVAQ +TFFIKQG  L+RKII GF IPPA+IY +AAIGM
Sbjct  333  EELKLVINMIPIWLTTLQFGICVAQASTFFIKQGTVLNRKIIGGFLIPPASIYCIAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV++YDRIL+P LR+  GNERG+ IL RIGIGM+FS+ TM VAALVE+KRL  V+EN 
Sbjct  393  LVSVSVYDRILIPFLRRLRGNERGIQILPRIGIGMVFSLLTMVVAALVERKRLGVVEENP  452

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            +  S SM+VFWL PQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV G ANFL
Sbjct  453  SKASTSMTVFWLVPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGVANFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS LIT VDR T R+G+SWFGKD+NSS LDYFYWLL G+TA NL +YVLVAR Y+YKNVQ
Sbjct  513  SSALITMVDRITERTGKSWFGKDINSSHLDYFYWLLAGMTAVNLAIYVLVARQYSYKNVQ  572

Query  716  SKTTMAVADCDDDGGRDAM  772
             +TT+ VADC + GG + M
Sbjct  573  -RTTVVVADCYEGGGVEEM  590



>ref|XP_004246394.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=587

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 221/257 (86%), Gaps = 1/257 (0%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVINM+PIWLTTLPFG+C+AQ +TFFIKQ ATL+RKI + F IPPA++Y+L AIGM
Sbjct  331  EELKLVINMIPIWLTTLPFGICIAQSSTFFIKQSATLNRKITHDFMIPPASMYALGAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V +YD+ILVP+LR+ATGNERG++ILQRIGIGMI SV +M VAALVE+KRLN VQ   
Sbjct  391  IATVIVYDKILVPLLRRATGNERGISILQRIGIGMILSVASMIVAALVERKRLNIVQVKG  450

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
             S SMSVFWLAPQFLI+GIGDGF LVGLQEYFYDQVPD+MRSLGIAFYLSV GAANFLSS
Sbjct  451  -SMSMSVFWLAPQFLIVGIGDGFALVGLQEYFYDQVPDTMRSLGIAFYLSVIGAANFLSS  509

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
            LLIT VD  T + G+SWFGKDLNSSRLDYFY+LL  ITA NL +YV+VAR+Y+YKNV S+
Sbjct  510  LLITIVDHVTEKGGKSWFGKDLNSSRLDYFYYLLATITAVNLFIYVIVARSYSYKNVHSR  569

Query  722  TTMAVADCDDDGGRDAM  772
             T  VA+C +   R+AM
Sbjct  570  RTADVANCYECDDREAM  586



>ref|XP_008240176.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Prunus mume]
Length=589

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 213/250 (85%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWL TLPFGMCVAQ +TFFIKQGAT++R I NGFEIPPA+I+SLAAIGM
Sbjct  330  EEMKLVLNMIPIWLATLPFGMCVAQASTFFIKQGATMNRNIGNGFEIPPASIFSLAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y+++LVP+LR+ TGNERG+ ILQRIGIGM+FS+ TM  AALVEKKRL  V+ + 
Sbjct  390  IISVTFYEKLLVPILRRTTGNERGINILQRIGIGMVFSIATMVAAALVEKKRLGAVESDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQF+IIG+GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NFL
Sbjct  450  VKGSHSMSVLWLAPQFVIIGLGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITAVD  T + G+SWFGKDLNSSRLD FYW+L  I AANLCVYV +AR Y+YKNVQ
Sbjct  510  SSLLITAVDHITEKDGKSWFGKDLNSSRLDRFYWVLACIVAANLCVYVFLARRYSYKNVQ  569

Query  716  SKTTMAVADC  745
                  VADC
Sbjct  570  K--VAVVADC  577



>ref|XP_007208297.1| hypothetical protein PRUPE_ppa003260mg [Prunus persica]
 gb|EMJ09496.1| hypothetical protein PRUPE_ppa003260mg [Prunus persica]
Length=589

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/250 (75%), Positives = 212/250 (85%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWL TLPFGMCVAQ +TFFIKQGAT++R I NGFEIPPA+I+SLAAIGM
Sbjct  330  EEMKLVLNMIPIWLATLPFGMCVAQASTFFIKQGATMNRNIGNGFEIPPASIFSLAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y+++LVP+LR+ TGNERG+ ILQRIGIGM+FS+ TM  AALVEKKRL  V+ + 
Sbjct  390  IISVTFYEKLLVPILRRTTGNERGINILQRIGIGMVFSIATMVAAALVEKKRLGAVESDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQF+IIG+GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NFL
Sbjct  450  VKGSHSMSVLWLAPQFVIIGLGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLNSSRLD FYW+L  I AANLCVYV +AR Y+YKNVQ
Sbjct  510  SSLLITVVDHITEKGGKSWFGKDLNSSRLDRFYWVLACIVAANLCVYVFLARRYSYKNVQ  569

Query  716  SKTTMAVADC  745
                  VADC
Sbjct  570  K--VAVVADC  577



>ref|XP_002309091.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE92614.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=587

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 222/259 (86%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL  LPFG+ VAQ ATFFIKQG TLDR I NG +IPPA++Y+LAAIGM
Sbjct  330  EEMKLILNLIPIWLAMLPFGISVAQTATFFIKQGTTLDRNIGNGLQIPPASVYALAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVTIY++ILVPVLR+ATGNERG+ ILQRIG GM+FS++TM V+ALVE+KRL  V ++ 
Sbjct  390  IVSVTIYEKILVPVLRRATGNERGIKILQRIGFGMLFSISTMVVSALVERKRLGVVAKDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG+GD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  450  VKGSLSMSVFWLAPQFIIIGVGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITAVD  T ++G+SWFGKDLNSSRLD FYWLL G+TAANL +YV +A+ Y YKNVQ
Sbjct  510  SSLLITAVDHVTEKTGKSWFGKDLNSSRLDNFYWLLAGMTAANLILYVFLAQRYPYKNVQ  569

Query  716  SKTTMAVADCDDDGGRDAM  772
            S  ++AVADC  DG   +M
Sbjct  570  S--SVAVADCYKDGLEGSM  586



>ref|XP_011019211.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Populus euphratica]
Length=587

 Score =   391 bits (1004),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 221/259 (85%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL  LPFG+ VAQ ATFFIKQG TLDR I NGF+IPPA++Y+LAAIGM
Sbjct  330  EEMKLILNLIPIWLAMLPFGISVAQTATFFIKQGTTLDRNIGNGFQIPPASVYALAAIGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVTIY++ILVPVLR+ATGNERG+ ILQRIG GM+FS++TM V+ALVE+KRL  V ++ 
Sbjct  390  IVSVTIYEKILVPVLRRATGNERGIKILQRIGFGMLFSISTMVVSALVERKRLGVVAKDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG+GD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  450  VKGSLSMSVFWLAPQFIIIGVGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITAVD  T ++G+SWFGKDLNSSRLD FYWLL G+TAAN  +YV +AR Y YKNVQ
Sbjct  510  SSLLITAVDHVTEKTGKSWFGKDLNSSRLDNFYWLLAGMTAANSILYVFLARRYPYKNVQ  569

Query  716  SKTTMAVADCDDDGGRDAM  772
               ++AVADC  DG   +M
Sbjct  570  R--SVAVADCYKDGLEGSM  586



>ref|XP_010088558.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB36699.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=583

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 219/261 (84%), Gaps = 7/261 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++NM+PIW+  +PFG+CVAQG+TFFIKQG T+DRKI NGFEIPPA+I++LAA+GM
Sbjct  325  EEMKLILNMIPIWIAAIPFGICVAQGSTFFIKQGVTMDRKIANGFEIPPASIFALAALGM  384

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVT+Y+++LVP+LRK TGNERG+ ILQRIGIGM FS  TM V+ALVEKKRL  V+EN 
Sbjct  385  IVSVTLYEKLLVPLLRKLTGNERGINILQRIGIGMFFSAVTMVVSALVEKKRLEDVRENA  444

Query  362  TSD---SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
             +     MSVFWLAPQF+I+G GDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF
Sbjct  445  GTKGWKPMSVFWLAPQFVIVGFGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANF  504

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            +SSLLIT VD  T +SG+SWFGKDLNSSRLD FYWLL  +T  NL  YVL+AR Y+YKNV
Sbjct  505  ISSLLITIVDHVTEKSGKSWFGKDLNSSRLDKFYWLLAAMTTVNLFFYVLLARRYSYKNV  564

Query  713  QSKTTMAVADC-DDDGGRDAM  772
            Q    +AVADC + DG + +M
Sbjct  565  QK---VAVADCYEGDGDKSSM  582



>ref|XP_004302697.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Fragaria vesca subsp. vesca]
Length=591

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 186/252 (74%), Positives = 213/252 (85%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWL TLPFG+CVAQ +TFFIKQG  ++R I N FE+PPA+IYSLAAIGM
Sbjct  333  EEMKLVLNIIPIWLATLPFGICVAQASTFFIKQGVAMNRSISNSFELPPASIYSLAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SVT Y++ILVPVLR+ TGNERG+ ILQRIGIGM+F + TM  AALVEKKRL  V+++ 
Sbjct  393  IISVTFYEKILVPVLRRTTGNERGINILQRIGIGMLFLIGTMVAAALVEKKRLGIVEKDP  452

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NFL
Sbjct  453  LKGSHSMSVFWLAPQFVIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITA+D  T + G+SWFGKDLNSSRLD FYWLL  +TAAN CVYV +AR Y+YKNVQ
Sbjct  513  SSLLITAIDHITEKRGKSWFGKDLNSSRLDKFYWLLACMTAANWCVYVFLARRYSYKNVQ  572

Query  716  SKTTMAVADCDD  751
                +AVADC D
Sbjct  573  K---VAVADCYD  581



>ref|XP_009358790.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
Length=589

 Score =   388 bits (996),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 212/253 (84%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWL TLPFGMCVAQ  TFFIKQGAT++R++ NGF +PPA+I++LAAIGM
Sbjct  331  EEMKLVLNLIPIWLATLPFGMCVAQSTTFFIKQGATMNREVANGFVVPPASIFALAAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SVTIY+++LVP+LR+ TGNERG+ ILQRIGIGMIF + TM  AALVEKKRL FV+ + 
Sbjct  391  IASVTIYEKLLVPILRRTTGNERGINILQRIGIGMIFCIATMVAAALVEKKRLGFVKSDP  450

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQFLI+G GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NF+
Sbjct  451  IKGSHSMSVLWLAPQFLIVGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFV  510

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS +ITAVD  T   G+SWFGKDLNSSRLD FYWLL  + AANLCVYV VAR Y+YKNVQ
Sbjct  511  SSFVITAVDHITDNGGKSWFGKDLNSSRLDRFYWLLACVAAANLCVYVFVARRYSYKNVQ  570

Query  716  SKTTMAVADCDDD  754
                +AVADC  D
Sbjct  571  K---VAVADCFGD  580



>ref|XP_008388083.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Malus domestica]
Length=589

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 213/253 (84%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWL TLPFG+CVAQ  TFFIKQGAT++R++ NGF +PPA+I++LAAIGM
Sbjct  331  EEMKLVLNLIPIWLATLPFGVCVAQSTTFFIKQGATMNREVANGFVVPPASIFALAAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SVTIY+++LVP+LR+ TGNERG+ ILQRIGIGMIFS+ TM  AALVEKKRL FV+ + 
Sbjct  391  IASVTIYEKLLVPILRRTTGNERGINILQRIGIGMIFSIATMVAAALVEKKRLGFVKGDP  450

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQFLI+G GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NF+
Sbjct  451  IKGSHSMSVLWLAPQFLIVGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFV  510

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS +ITAVD  T   G+SWFGKDLNSSRLD FYWLL  + AANLCVYV VAR Y+YKNVQ
Sbjct  511  SSFVITAVDHITDNGGKSWFGKDLNSSRLDRFYWLLACVAAANLCVYVFVARRYSYKNVQ  570

Query  716  SKTTMAVADCDDD  754
                +AVADC  D
Sbjct  571  K---VAVADCFGD  580



>ref|XP_011006629.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X2 [Populus 
euphratica]
Length=497

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/259 (71%), Positives = 218/259 (84%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL TLPFG+ VAQ ATFF+KQG  LDR + NG EIPPA+I++L+A GM
Sbjct  240  EEMKLILNLIPIWLATLPFGISVAQTATFFVKQGTMLDRNVGNGLEIPPASIFALSAFGM  299

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV+V IY++ILVPVLR+ATGNERG+ ILQRIG GM+FS++ M V+ALVE+KRL  V+++ 
Sbjct  300  IVAVAIYEKILVPVLRRATGNERGIKILQRIGFGMLFSISAMVVSALVERKRLGVVEKDP  359

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG+GD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+
Sbjct  360  VKGSLSMSVFWLAPQFIIIGVGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFI  419

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITA D  T R G+SWFGKDLNSSRLDYFYWL+ G+ AANL VYV +AR Y+YKNVQ
Sbjct  420  SSLLITATDHVTGRFGKSWFGKDLNSSRLDYFYWLIAGMIAANLMVYVFLARRYSYKNVQ  479

Query  716  SKTTMAVADCDDDGGRDAM  772
               +M VADC +DG   +M
Sbjct  480  R--SMVVADCCEDGFEVSM  496



>ref|XP_002323528.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF05289.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=587

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 220/259 (85%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL TLPFG+ VAQ ATFF+KQG  LDR I NG EIPPA+I++L+A GM
Sbjct  330  EEMKLILNLIPIWLATLPFGISVAQTATFFVKQGTMLDRNIGNGVEIPPASIFALSAFGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV+V IY++ILVPVLR+ATGNERG+ ILQRIG GM+FS++TM V+ALVE+KRL  V+++ 
Sbjct  390  IVAVAIYEKILVPVLRRATGNERGIKILQRIGFGMLFSISTMVVSALVERKRLGVVEKDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG+GD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+
Sbjct  450  VKGSLSMSVFWLAPQFIIIGVGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFI  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT +D  T R G+SWFGKDLNSSRLDYFYWL+ G+TAANL VYV +AR Y+YKNVQ
Sbjct  510  SSLLITTIDHVTGRFGKSWFGKDLNSSRLDYFYWLIAGMTAANLIVYVFLARRYSYKNVQ  569

Query  716  SKTTMAVADCDDDGGRDAM  772
               ++ VADC +DG   +M
Sbjct  570  R--SVVVADCCEDGFEVSM  586



>ref|XP_011006628.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like isoform X1 [Populus 
euphratica]
Length=587

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/259 (71%), Positives = 218/259 (84%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL TLPFG+ VAQ ATFF+KQG  LDR + NG EIPPA+I++L+A GM
Sbjct  330  EEMKLILNLIPIWLATLPFGISVAQTATFFVKQGTMLDRNVGNGLEIPPASIFALSAFGM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV+V IY++ILVPVLR+ATGNERG+ ILQRIG GM+FS++ M V+ALVE+KRL  V+++ 
Sbjct  390  IVAVAIYEKILVPVLRRATGNERGIKILQRIGFGMLFSISAMVVSALVERKRLGVVEKDP  449

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG+GD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+
Sbjct  450  VKGSLSMSVFWLAPQFIIIGVGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFI  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITA D  T R G+SWFGKDLNSSRLDYFYWL+ G+ AANL VYV +AR Y+YKNVQ
Sbjct  510  SSLLITATDHVTGRFGKSWFGKDLNSSRLDYFYWLIAGMIAANLMVYVFLARRYSYKNVQ  569

Query  716  SKTTMAVADCDDDGGRDAM  772
               +M VADC +DG   +M
Sbjct  570  R--SMVVADCCEDGFEVSM  586



>ref|XP_009378859.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
 ref|XP_009378872.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
Length=589

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 215/253 (85%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWL TLPFG+CVAQ +TFFIKQGAT++R++ NGFE+PPA+IY++AAIGM
Sbjct  331  EEMKLVLNLIPIWLATLPFGLCVAQTSTFFIKQGATMNREVANGFEVPPASIYAIAAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVT+Y+++LVP+LR+ TGNERG+ ILQRIGIGMIFS+ TM  AALVEKKRL  V+ + 
Sbjct  391  IVSVTLYEKLLVPILRRTTGNERGINILQRIGIGMIFSIATMIAAALVEKKRLGLVKIDP  450

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV GA NFL
Sbjct  451  IKGSHSMSVLWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGAGNFL  510

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITAVD  T   G+SWFGKDLNSSRLD FYWLL  + AANLCVYV VA+ Y+YK+VQ
Sbjct  511  SSLLITAVDHITDDVGKSWFGKDLNSSRLDRFYWLLACVAAANLCVYVFVAQRYSYKSVQ  570

Query  716  SKTTMAVADCDDD  754
                +AVAD  +D
Sbjct  571  K---VAVADSYED  580



>ref|XP_010654232.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Vitis vinifera]
Length=587

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 217/259 (84%), Gaps = 2/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++NM+PIWL+ LPFG+CVAQ +TFFIKQGAT++RKI N F IP A+IYSLAAIGM
Sbjct  328  EEMKLILNMIPIWLSCLPFGICVAQASTFFIKQGATMNRKIDNDFLIPAASIYSLAAIGM  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I SVTIY++ILVPVLR+ATG ERG+ ILQRIGIGM+FS+  M VAALVEKKRL  V++N 
Sbjct  388  IASVTIYEKILVPVLRQATGTERGIKILQRIGIGMVFSMIGMIVAALVEKKRLGVVEKNP  447

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
             T S SMSVFWLAPQF+I+GIGDGF+LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  448  QTGSLSMSVFWLAPQFVILGIGDGFSLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  507

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFG DLN+SRLD FYWLL  +   NL VYV+VAR Y+YKNVQ
Sbjct  508  SSLLITIVDHVTEKHGKSWFGVDLNTSRLDKFYWLLAIMNMLNLWVYVIVARRYSYKNVQ  567

Query  716  SKTTMAVADCDDDGGRDAM  772
                +AVADC +  G  +M
Sbjct  568  RSAAVAVADCYNGDGVGSM  586



>ref|XP_007026877.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007026878.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07379.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07380.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=589

 Score =   380 bits (977),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 189/258 (73%), Positives = 218/258 (84%), Gaps = 9/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWL TLPFG+CVAQ +TFFIKQGAT++R I N F IPPA+I+SLAAIGM
Sbjct  333  EEMKLVLNMIPIWLATLPFGICVAQASTFFIKQGATMNRNIGN-FVIPPASIFSLAAIGM  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVTIY+++LVP LRK TGNERG+ ILQRIGIGM FSV TM VAALVE+KRL  V+++ 
Sbjct  392  IISVTIYEKVLVPALRKTTGNERGIKILQRIGIGMAFSVATMVVAALVERKRLAAVKKDP  451

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQF+IIG GDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  452  VHGSLSMSVFWLAPQFVIIGAGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  511

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLNSSRLD FYWLL  +T ANLCVY+ +A+ Y+YKN+Q
Sbjct  512  SSLLITLVDHVTEKGGKSWFGKDLNSSRLDNFYWLLAIMTMANLCVYMFLAKRYSYKNIQ  571

Query  716  SKTTMAVADC---DDDGG  760
            S   +AVA+C   DD+ G
Sbjct  572  S---LAVANCNEEDDNAG  586



>ref|XP_008359699.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Malus domestica]
Length=589

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/253 (73%), Positives = 214/253 (85%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWL TLPFG+CVAQ +TFFIKQ AT++R++ NGFE+PPA+IY++AAIGM
Sbjct  331  EEMKLVLNLIPIWLATLPFGVCVAQTSTFFIKQSATMNREVANGFEVPPASIYAIAAIGM  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVT+Y+++LVP+LR+ T NERG+ ILQRIGIGMIFS+ TM  AALVEKKRL FV+ + 
Sbjct  391  IVSVTLYEKLLVPILRRTTRNERGINILQRIGIGMIFSIATMIAAALVEKKRLGFVKSDP  450

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSV WLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV GA NFL
Sbjct  451  IKGSYSMSVLWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGAGNFL  510

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLITAVD  T   G+SWFGKDLNSSRLD FYWLL  + AANLCVYV VA+ Y+YK+VQ
Sbjct  511  SSLLITAVDHITDNVGKSWFGKDLNSSRLDRFYWLLACVAAANLCVYVFVAQRYSYKSVQ  570

Query  716  SKTTMAVADCDDD  754
                +AVAD  +D
Sbjct  571  K---VAVADSYED  580



>ref|XP_010256764.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nelumbo nucifera]
Length=598

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 212/259 (82%), Gaps = 8/259 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWLT L FGM VAQ +TFFIKQG++++RKI +GFEIPPA+IY++AAIGM
Sbjct  340  EEMKLVVNMIPIWLTCLTFGMGVAQASTFFIKQGSSMNRKIGHGFEIPPASIYTVAAIGM  399

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SVTIYD+ILVPVLR+ TGNERG+ ILQRIGIGM+FSV +M  AALVE+KRL  V++  
Sbjct  400  ITSVTIYDKILVPVLRRVTGNERGIKILQRIGIGMVFSVVSMVAAALVERKRLQVVRKEI  459

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              +      SMSVFWL PQF+IIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYL V G 
Sbjct  460  VEEGRIGGISMSVFWLTPQFIIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLGVIGV  519

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             NFLSSLLITAVD  T + GRSWF KDLNSSRLD F+WLL  + A NLCVYV +AR Y+Y
Sbjct  520  GNFLSSLLITAVDHLTEKWGRSWFAKDLNSSRLDNFFWLLAAMNAVNLCVYVFIARRYSY  579

Query  704  KNVQSKTTMAVADCDDDGG  760
            KNVQ +  +A ADC D  G
Sbjct  580  KNVQRR--VAAADCYDGDG  596



>gb|KHG09490.1| hypothetical protein F383_15518 [Gossypium arboreum]
Length=554

 Score =   377 bits (967),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/253 (74%), Positives = 214/253 (85%), Gaps = 6/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWL TLPFG+CVAQ ATFFIKQG  ++R I  GF IPPA+IYSLAAIGM
Sbjct  297  EEMKLVLNMIPIWLATLPFGICVAQAATFFIKQGVIMNRNI-GGFLIPPASIYSLAAIGM  355

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SV IY++ILVP+LRKATGNERG+ ILQRIGIGM+FS+ TM VAALVEKKRL  V+++ 
Sbjct  356  ITSVIIYEKILVPILRKATGNERGIKILQRIGIGMLFSIATMIVAALVEKKRLGAVKKDP  415

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIG GDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  416  VNGSLSMSVFWLAPQFLIIGAGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  475

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T + G+SWFGKDLNSSRLD FYWLL  +T ANL ++V VA+ Y+YKNVQ
Sbjct  476  SSLLITLVDHITEKGGKSWFGKDLNSSRLDNFYWLLAIMTMANLLLFVFVAKRYSYKNVQ  535

Query  716  SKTTMAVADCDDD  754
            S   +AVA+ ++D
Sbjct  536  S---LAVANYNED  545



>ref|XP_006602614.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=593

 Score =   378 bits (970),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 211/250 (84%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+IN++PIW++T+PFGMCVAQ ATFF+KQG  L+RKI NGFEIPPA+I+++AA+GM
Sbjct  333  EEMKLIINIIPIWVSTIPFGMCVAQTATFFVKQGTQLNRKIGNGFEIPPASIFTVAALGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV IYD+ILVPVLR+ T NERG+ ILQRIG GM+FS+ TM VAALVEKKRL  V+ + 
Sbjct  393  VVSVAIYDKILVPVLRRLTQNERGINILQRIGFGMLFSIATMIVAALVEKKRLEAVERDP  452

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  453  FKGSLTMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLD FYWLL  I   NL ++V VAR Y+YKNVQ
Sbjct  513  SSMLITVVDHMTKKSGKSWFGKDLNSSRLDKFYWLLAAIATVNLFLFVFVARRYSYKNVQ  572

Query  716  SKTTMAVADC  745
                +AVADC
Sbjct  573  K---LAVADC  579



>ref|XP_011077621.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Sesamum indicum]
Length=588

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/259 (71%), Positives = 215/259 (83%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++NM+PIWLTTLPFG+CVAQ +TFFIKQ  TL+RKI   F IPPA+IY+LAAIG+
Sbjct  330  EEMKLIVNMIPIWLTTLPFGVCVAQSSTFFIKQSTTLNRKITQDFTIPPASIYALAAIGL  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +V + IYDR+LVP LR+ TGN+RG+ ILQRIGIGMIFSV TM  AALVE+KRL+ V+++ 
Sbjct  390  VVFIAIYDRVLVPSLRRVTGNDRGIGILQRIGIGMIFSVLTMITAALVERKRLHVVEKDP  449

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
              +S SMSVFWLAPQ+LII I D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA++FL
Sbjct  450  LKSSVSMSVFWLAPQYLIIAIADSFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGASSFL  509

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS LIT VD  T + G+SWFGKDLNSSRLDYFY LL  ITA NL VY  VAR Y+YKNV+
Sbjct  510  SSFLITLVDHLTEKGGKSWFGKDLNSSRLDYFYSLLAAITAMNLFVYTFVARRYSYKNVR  569

Query  716  SKTTMAVADCDDDGGRDAM  772
             +TT+AVADC ++ G   M
Sbjct  570  -RTTVAVADCYEESGTKTM  587



>gb|KEH28963.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=593

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/264 (71%), Positives = 216/264 (82%), Gaps = 9/264 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW+ TLPFGMC AQ +TFFIKQG  ++RKI +GFEIPPA+I++++AIGM
Sbjct  333  EEMKLMINMIPIWIFTLPFGMCAAQTSTFFIKQGNIMNRKIGHGFEIPPASIFTISAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYD+ILVPVLRK +GNERG+ ILQRIGIGM+FSV TM VAALVEKKRL  V+ N 
Sbjct  393  IISVAIYDKILVPVLRKISGNERGMNILQRIGIGMVFSVLTMIVAALVEKKRLKVVEMNP  452

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            +  S SMSVFWLAPQFLIIG GDG  LVGLQEYFYDQVPDSMRSLGI  YLSV GAANFL
Sbjct  453  SHGSLSMSVFWLAPQFLIIGFGDGLALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAANFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T++SG+SWFG+DLNSSRLD FYWLL  IT  ++ V+VL A+ YTYKNVQ
Sbjct  513  SSLLITIVDHVTSKSGKSWFGEDLNSSRLDKFYWLLAAITTLSVFVFVLFAQRYTYKNVQ  572

Query  716  SKTTMAVADC----DDDGGRDAMV  775
            +     VADC     DDGG   MV
Sbjct  573  NNV---VADCYDGKCDDGGAGRMV  593



>ref|XP_004172301.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like, 
partial [Cucumis sativus]
Length=479

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 219/260 (84%), Gaps = 7/260 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIING-FEIPPATIYSLAAIG  178
            EEMKL++NM+PIWL+TLPFG+ +AQ +TFFIKQ + ++RKI +G   +PP TI+ LAAIG
Sbjct  216  EEMKLILNMIPIWLSTLPFGVTIAQTSTFFIKQASNMNRKIGDGGLILPPTTIFCLAAIG  275

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MIVS+TIYD++LVP+LR+ TGNERG+ ILQRIGIGM+F + TM +AALVE KRL  V EN
Sbjct  276  MIVSITIYDKVLVPMLRRTTGNERGINILQRIGIGMLFVIATMIIAALVEHKRLQVVAEN  335

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              T S +MSVFWLAPQFLIIG GDGFT+VGLQEYFYDQVPDSMRSLGIAFYLSV GA +F
Sbjct  336  PKTGSLTMSVFWLAPQFLIIGFGDGFTIVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGSF  395

Query  533  LSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            LSS LIT VD+ T RSG  SWFGK+LN+SRLD FYWLL  ++AANLCVYVL+AR Y+YKN
Sbjct  396  LSSFLITVVDKITGRSGHTSWFGKNLNTSRLDKFYWLLAAVSAANLCVYVLIARRYSYKN  455

Query  710  VQSKTTMAVADC-DDDGGRD  766
            VQ +  +AVADC +D+ GR+
Sbjct  456  VQRR--VAVADCYEDEKGRE  473



>gb|KHN05104.1| Putative peptide/nitrate transporter [Glycine soja]
Length=522

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 209/250 (84%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+IN++PIW++T+PFGMCVAQ ATFF+KQG  L+RKI  GFEIPPA+I+++AA+GM
Sbjct  262  EEMKLIINIIPIWVSTIPFGMCVAQTATFFVKQGTQLNRKIGEGFEIPPASIFTVAALGM  321

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV IYD+ILVP LR+ T NERG+ ILQRIG GM+FS+ TM VAALVEKKRL  V+ + 
Sbjct  322  VVSVAIYDKILVPALRRVTQNERGINILQRIGFGMLFSIATMIVAALVEKKRLEAVERDP  381

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  382  LKGSLTMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFL  441

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLD FYWLL  I   NL ++V VAR Y+YKNVQ
Sbjct  442  SSMLITVVDHITKKSGKSWFGKDLNSSRLDKFYWLLAAIATVNLFLFVFVARRYSYKNVQ  501

Query  716  SKTTMAVADC  745
                +AVADC
Sbjct  502  K---LAVADC  508



>gb|KDP24539.1| hypothetical protein JCGZ_25103 [Jatropha curcas]
Length=461

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 211/258 (82%), Gaps = 7/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++NM+PIWL TLPFG+CVAQ  TFFIKQG TL+RK    FEIPPA+IYSLAAIGM
Sbjct  204  EEMKLILNMIPIWLATLPFGICVAQAPTFFIKQGTTLNRKF-GSFEIPPASIYSLAAIGM  262

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y++IL+P++R+ TGNERG+ ILQRIGIGM FS+ TM V+ALVEKKRL+ V+++ 
Sbjct  263  IISVTFYEKILIPIVRRVTGNERGINILQRIGIGMCFSILTMVVSALVEKKRLSVVEKDP  322

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  323  LQGSVSMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAADFL  382

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            +SL+I  +D  T + G+SWFGKDLNSSRLD FYWLL G+ A NL +Y+L+AR Y+YKN  
Sbjct  383  ASLIIIVLDHVTEKYGKSWFGKDLNSSRLDNFYWLLAGMAATNLIIYILLARRYSYKNAH  442

Query  716  SKTTMAVADCDDDGGRDA  769
                  VADC   GG D 
Sbjct  443  KNVI--VADC--PGGLDC  456



>gb|KHN06992.1| Putative peptide/nitrate transporter [Glycine soja]
Length=577

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 210/250 (84%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+IN++PIW++T+PFGMCVAQ ATFF+KQG  L+RKI NGFEIPPA+I+++AA+GM
Sbjct  317  EEMKLIINIIPIWVSTIPFGMCVAQTATFFVKQGTQLNRKIGNGFEIPPASIFTVAALGM  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV IYD+ILVPVLR+ T NERG+ ILQRIG GM+FS+ TM VAALVEKKRL  V+ + 
Sbjct  377  VVSVAIYDKILVPVLRRLTQNERGINILQRIGFGMLFSIATMIVAALVEKKRLEAVERDP  436

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F 
Sbjct  437  FKGSLTMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFP  496

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLD FYWLL  I   NL ++V VAR Y+YKNVQ
Sbjct  497  SSMLITVVDHMTKKSGKSWFGKDLNSSRLDKFYWLLAAIATVNLFLFVFVARRYSYKNVQ  556

Query  716  SKTTMAVADC  745
                +AVADC
Sbjct  557  K---LAVADC  563



>gb|EYU26617.1| hypothetical protein MIMGU_mgv1a003329mg [Erythranthe guttata]
Length=592

 Score =   375 bits (963),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 209/250 (84%), Gaps = 2/250 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWLTTLPFG+CVAQ  TFFIKQ  TL+RKI N F IPPA++ +L AI +
Sbjct  332  EEVKLILNMIPIWLTTLPFGICVAQTNTFFIKQSTTLNRKITNSFTIPPASVSALTAISL  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            IVSV IYD+ILVP LR+ T NERG+ IL RIGIGMIFSV TM VAALVE+KRL+ V+++ 
Sbjct  392  IVSVAIYDKILVPTLRRITRNERGINILVRIGIGMIFSVLTMVVAALVERKRLSIVEKDP  451

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
              +S SMSVFWLAPQF+II IGD FTLVGLQEYFYDQVPDSMRSLGIA YLSV GA+NFL
Sbjct  452  LHSSLSMSVFWLAPQFIIIAIGDCFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGASNFL  511

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LI  VDR T +SGRSWFGKDLNSSRLDYFYWLLG ITA N+ VY  VAR Y+YKNV 
Sbjct  512  SSVLIILVDRLTEKSGRSWFGKDLNSSRLDYFYWLLGSITAVNIFVYAFVARKYSYKNVV  571

Query  716  SKTTMAVADC  745
              T +AVADC
Sbjct  572  RNTNVAVADC  581



>ref|XP_003529111.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=593

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 209/250 (84%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+IN++PIW++T+PFGMCVAQ ATFF+KQG  L+RKI  GFEIPPA+I+++AA+GM
Sbjct  333  EEMKLIINIIPIWVSTIPFGMCVAQTATFFVKQGTQLNRKIGEGFEIPPASIFTVAALGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV IYD+ILVP LR+ T NERG+ ILQRIG GM+FS+ TM VAALVEKKRL  V+ + 
Sbjct  393  VVSVAIYDKILVPALRRVTQNERGINILQRIGFGMLFSIATMIVAALVEKKRLEAVERDP  452

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  453  LKGSLTMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG+SWFGKDLNSSRLD FYWLL  I   NL ++V VAR Y+YKNVQ
Sbjct  513  SSMLITVVDHITKKSGKSWFGKDLNSSRLDKFYWLLAAIATVNLFLFVFVARRYSYKNVQ  572

Query  716  SKTTMAVADC  745
                +AVADC
Sbjct  573  K---LAVADC  579



>ref|XP_004507194.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cicer arietinum]
Length=593

 Score =   373 bits (958),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 216/264 (82%), Gaps = 9/264 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW+ TLPFG+C AQ +TFFIKQG  ++RKI NGFEIPPA+IY+LAAIGM
Sbjct  333  EEMKLMINMIPIWVFTLPFGVCAAQTSTFFIKQGVIMNRKIGNGFEIPPASIYTLAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYD+ILVP+LRK TGNERG++ILQRIG GM+FSV TM VAALVEKKRL  V  N 
Sbjct  393  IISVAIYDKILVPILRKMTGNERGMSILQRIGFGMLFSVFTMIVAALVEKKRLQVVGMNP  452

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            T  S SMSVFWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGI  YLSV GA++FL
Sbjct  453  TKGSLSMSVFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIGLYLSVIGASSFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSLLIT VD  T+++G+SWFGKDLNSS LD FYWLL  IT  N+ ++V  A+ Y+YKN Q
Sbjct  513  SSLLITIVDNVTSKNGKSWFGKDLNSSSLDKFYWLLAAITTLNMFMFVFFAQRYSYKNEQ  572

Query  716  SKTTMAVADCDD----DGGRDAMV  775
                +AVADC D    DGG + +V
Sbjct  573  K---VAVADCFDGKSNDGGVERIV  593



>ref|XP_003516904.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=594

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 188/265 (71%), Positives = 211/265 (80%), Gaps = 10/265 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW+ TLPFG+C +Q +TFFIKQGA ++RKI NGF +PPA+I++LAAIGM
Sbjct  333  EELKLIINMIPIWVFTLPFGICASQTSTFFIKQGAIMNRKIGNGFVVPPASIFTLAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            IVSV IYD++LVPVLRK TGNERG+ ILQRIGIGMIFSV TM  AALVEKKRL  V+ N 
Sbjct  393  IVSVIIYDKLLVPVLRKLTGNERGINILQRIGIGMIFSVITMIAAALVEKKRLEAVEMNG  452

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
                S SMS  WLAPQFLIIG GDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAA+F
Sbjct  453  PLKGSLSMSALWLAPQFLIIGFGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAASF  512

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            LSSLLIT VD  T +SG+SW GKDLNSSRLD FYWLL  IT  NL V+V  AR Y YKNV
Sbjct  513  LSSLLITIVDHVTGKSGKSWIGKDLNSSRLDKFYWLLAAITTLNLFVFVFFARRYNYKNV  572

Query  713  QSKTTMAVADC----DDDGGRDAMV  775
            Q    +AVADC     DDGG +  V
Sbjct  573  QK---VAVADCYEGKSDDGGPETKV  594



>gb|KHN11892.1| Putative peptide/nitrate transporter [Glycine soja]
Length=594

 Score =   373 bits (957),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 188/265 (71%), Positives = 211/265 (80%), Gaps = 10/265 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW+ TLPFG+C +Q +TFFIKQGA ++RKI NGF +PPA+I++LAAIGM
Sbjct  333  EELKLIINMIPIWVFTLPFGICASQTSTFFIKQGAIMNRKIGNGFVVPPASIFTLAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            IVSV IYD++LVPVLRK TGNERG+ ILQRIGIGMIFSV TM  AALVEKKRL  V+ N 
Sbjct  393  IVSVIIYDKLLVPVLRKLTGNERGINILQRIGIGMIFSVITMIAAALVEKKRLEAVEMNG  452

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
                S SMS  WLAPQFLIIG GDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAA+F
Sbjct  453  PLKGSLSMSALWLAPQFLIIGFGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAASF  512

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            LSSLLIT VD  T +SG+SW GKDLNSSRLD FYWLL  IT  NL V+V  AR Y YKNV
Sbjct  513  LSSLLITIVDHVTGKSGKSWIGKDLNSSRLDKFYWLLAAITTLNLFVFVFFARRYNYKNV  572

Query  713  QSKTTMAVADC----DDDGGRDAMV  775
            Q    +AVADC     DDGG +  V
Sbjct  573  QK---VAVADCYEGKSDDGGPETKV  594



>ref|XP_004147936.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cucumis sativus]
 gb|KGN54305.1| hypothetical protein Csa_4G303040 [Cucumis sativus]
Length=607

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 219/260 (84%), Gaps = 7/260 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIING-FEIPPATIYSLAAIG  178
            EEMKL++NM+PIWL+TLPFG+ +AQ +TFFIKQ + ++RKI +G   +PP TI+ LAAIG
Sbjct  344  EEMKLILNMIPIWLSTLPFGVTIAQTSTFFIKQASNMNRKIGDGGLILPPTTIFCLAAIG  403

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MIVS+TIYD++LVP+LR+ TGNERG+ ILQRIGIGM+F + TM +AALVE KRL  V EN
Sbjct  404  MIVSITIYDKVLVPMLRRTTGNERGINILQRIGIGMLFVIATMIIAALVEHKRLQVVAEN  463

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              T S +MSVFWLAPQFLIIG GDGFT+VGLQEYFYDQVPDSMRSLGIAFYLSV GA +F
Sbjct  464  PKTGSLTMSVFWLAPQFLIIGFGDGFTIVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGSF  523

Query  533  LSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            LSS LIT VD+ T RSG  SWFGK+LN+SRLD FYWLL  ++AANLCVYVL+AR Y+YKN
Sbjct  524  LSSFLITVVDKITGRSGHTSWFGKNLNTSRLDKFYWLLAAVSAANLCVYVLIARRYSYKN  583

Query  710  VQSKTTMAVADC-DDDGGRD  766
            VQ +  +AVADC +D+ GR+
Sbjct  584  VQRR--VAVADCYEDEKGRE  601



>ref|XP_008442499.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Cucumis melo]
Length=588

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 211/257 (82%), Gaps = 9/257 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+NM+PIW+T+LPF +CVAQ +TFFIKQ  TLDRKI N F IP +++Y LAA GM
Sbjct  336  EELKLVLNMIPIWITSLPFSICVAQASTFFIKQCGTLDRKIGNTFVIPVSSMYCLAAAGM  395

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYD++LVP+LRK TGNERG++ILQRIGIGM+FS TTM V+ALVE+KRL+      
Sbjct  396  IISVAIYDKLLVPLLRKTTGNERGISILQRIGIGMVFSFTTMVVSALVERKRLSH-----  450

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            T+  MSVFWLAPQF IIGIGDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV+GAANFLSS
Sbjct  451  TTHPMSVFWLAPQFFIIGIGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVNGAANFLSS  510

Query  542  LLITAVDRATAR-SGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             +IT VDR T + SG+SWFG DLNSSRLD FYWL+ GI A +LCVYV +A  YTYK+VQ 
Sbjct  511  FIITIVDRITKKSSGKSWFGDDLNSSRLDNFYWLIAGIVAVDLCVYVFLAHRYTYKSVQK  570

Query  719  KTTMAVADCDDDGGRDA  769
                AV DC DD G +A
Sbjct  571  T---AVGDCYDDKGPNA  584



>gb|KDP24538.1| hypothetical protein JCGZ_25102 [Jatropha curcas]
Length=587

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/260 (70%), Positives = 214/260 (82%), Gaps = 5/260 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI-INGFEIPPATIYSLAAIG  178
            EEMKL+INM+PIWL TLPFG+CVAQ +TFFIKQ  TLDRKI  NGF IPPA++YSLAAIG
Sbjct  329  EEMKLIINMIPIWLATLPFGVCVAQASTFFIKQSTTLDRKIGNNGFLIPPASVYSLAAIG  388

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +++SVT +++IL PVLR+ TGNERG+ ILQRIGIGM+FS+ TM +AALVEK+RL  ++++
Sbjct  389  ILISVTFFEKILAPVLRRVTGNERGINILQRIGIGMVFSILTMVIAALVEKRRLGIMEKD  448

Query  359  TT--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
                S S+SVFWLAPQ LIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA +F
Sbjct  449  PLKGSLSVSVFWLAPQLLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGSF  508

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            LS+LLIT  D  T + G+SWFGKDLNSSRLD FYWLL GI+AANL VY+ +AR Y+YKNV
Sbjct  509  LSNLLITITDHVTEKYGKSWFGKDLNSSRLDNFYWLLAGISAANLIVYIWLARRYSYKNV  568

Query  713  QSKTTMAVADCDDDGGRDAM  772
                 +AVADC  D    +M
Sbjct  569  NR--NVAVADCSGDDWATSM  586



>ref|XP_008448441.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Cucumis melo]
Length=605

 Score =   370 bits (951),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 218/262 (83%), Gaps = 8/262 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIING-FEIPPATIYSLAAIG  178
            EEMKL++NM+PIWL+TLPFG+ +AQ +TFFIKQ + ++RKI +G   +PP TI+ LAAIG
Sbjct  342  EEMKLILNMIPIWLSTLPFGVTIAQTSTFFIKQASNMNRKIGDGGLILPPTTIFCLAAIG  401

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MIVS+TIYD++LVP+LR+ TGNERG+ ILQRIGIGM+F + TM +AALVE KRL  V EN
Sbjct  402  MIVSITIYDKVLVPMLRRTTGNERGINILQRIGIGMLFVIATMIIAALVENKRLQVVAEN  461

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              T S +MSVFWLAPQFLIIG GDGFT+VGLQEYFYDQVPDSMRSLGIAFYLSV GA +F
Sbjct  462  PKTGSLTMSVFWLAPQFLIIGFGDGFTIVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGSF  521

Query  533  LSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            LSS LIT VD+ T RSG  SWFGK+LN+SRLD FYWLL  ++AANLCVYVL+AR Y+YKN
Sbjct  522  LSSFLITVVDKITGRSGHTSWFGKNLNTSRLDKFYWLLAAVSAANLCVYVLIARRYSYKN  581

Query  710  VQSKTTMAVADC--DDDGGRDA  769
            VQ +  +AVADC  D+ GG + 
Sbjct  582  VQRR--VAVADCYEDEKGGENG  601



>ref|XP_010037784.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Eucalyptus grandis]
 gb|KCW49519.1| hypothetical protein EUGRSUZ_K03045 [Eucalyptus grandis]
Length=595

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 215/250 (86%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL++N++PIWL TLPFG+CVAQ ATFFIKQG TL+R +  GF IPPA+IY+LAAIGM
Sbjct  339  EEMKLILNIIPIWLATLPFGICVAQSATFFIKQGTTLNRNV-GGFLIPPASIYALAAIGM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SVT+Y+++LVP+LR  TG+ERG+ ILQRIGIGM+FSV TM VAA+VE +RL  V++N 
Sbjct  398  IISVTLYEKVLVPILRHTTGSERGINILQRIGIGMLFSVATMVVAAVVEHRRLAVVRQNP  457

Query  359  -TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
             T S SMSVFWLAPQFLI+G GDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV GAANFL
Sbjct  458  LTGSMSMSVFWLAPQFLIVGFGDGFTLVGLQEYFYDQVPDSMRSLGIALYLSVIGAANFL  517

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SSL+ITAVDR T + GRSWFGKDLNSSRLD FYWLL G+ A NL VY L+AR YTYKNVQ
Sbjct  518  SSLMITAVDRLTEQHGRSWFGKDLNSSRLDKFYWLLAGMAAVNLIVYTLLARRYTYKNVQ  577

Query  716  SKTTMAVADC  745
               ++AVADC
Sbjct  578  R--SVAVADC  585



>ref|XP_007140460.1| hypothetical protein PHAVU_008G114200g [Phaseolus vulgaris]
 gb|ESW12454.1| hypothetical protein PHAVU_008G114200g [Phaseolus vulgaris]
Length=592

 Score =   367 bits (943),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 209/253 (83%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW++T+PFG+CVAQ ATFF+KQG TL+R I NGFEIPPA+I++++A+GM
Sbjct  332  EEMKLIINMIPIWVSTIPFGICVAQTATFFVKQGTTLNRNIGNGFEIPPASIFTVSALGM  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV IYD+ILVPVLR+ T NERG+ ILQRIG GM+FS+ TM VAALVE+KRL  V+ + 
Sbjct  392  VVSVAIYDKILVPVLRRVTQNERGINILQRIGFGMLFSIATMIVAALVERKRLEAVERDP  451

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MS+FWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  452  LKGSLTMSIFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFL  511

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T +SG SWFGKDLNSSRLD FYWLL  ++  NL ++  VA  Y+YK VQ
Sbjct  512  SSMLITIVDHLTKKSGESWFGKDLNSSRLDKFYWLLAAMSTLNLFLFAFVASRYSYKRVQ  571

Query  716  SKTTMAVADCDDD  754
                + VADC +D
Sbjct  572  K---VVVADCYED  581



>gb|KHN22623.1| Putative peptide/nitrate transporter [Glycine soja]
Length=404

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 210/263 (80%), Gaps = 12/263 (5%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI-INGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW+ TLPFG+C +Q +TFFIKQGA ++R I  NGF +PPA+I++LAA+G
Sbjct  142  EELKLIINMIPIWVFTLPFGICASQTSTFFIKQGAIMNRNIGNNGFVVPPASIFTLAAVG  201

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MI+SVTIYD++LVPVLRK TGN+RG++ILQRIGIGM+FSV TM VAALVEKKRL  V+ N
Sbjct  202  MILSVTIYDKLLVPVLRKLTGNDRGISILQRIGIGMVFSVITMIVAALVEKKRLEAVEMN  261

Query  359  ---TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAAN  529
                 S SMS  WLAPQF+IIG GDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAA+
Sbjct  262  GPLKGSLSMSALWLAPQFMIIGFGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAAS  321

Query  530  FLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            FLSSLLIT VD  T + G+SW GKDLNSSRLD FYWLL  IT  NL ++V+ AR Y YKN
Sbjct  322  FLSSLLITIVDHVTGKIGKSWIGKDLNSSRLDKFYWLLAAITTLNLFMFVIFARKYNYKN  381

Query  710  VQSKTTMAVADC-----DDDGGR  763
            VQ    +A ADC     +DDG  
Sbjct  382  VQK---VAAADCYEGKSEDDGSE  401



>ref|XP_007133987.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
 gb|ESW05981.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
Length=508

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 210/258 (81%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW+ TLPFG+C AQ +TFFIKQGA ++RKI +GFE+PPA+I++LAAIGM
Sbjct  241  EELKLIINMIPIWVFTLPFGICAAQTSTFFIKQGAIMNRKIGSGFEVPPASIFTLAAIGM  300

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SV +YD ILVP  RK TGNERG++ILQRIGIGM+FSV +M VAALVE+KRL+ V+ N 
Sbjct  301  IISVILYDNILVPTFRKLTGNERGISILQRIGIGMVFSVLSMIVAALVERKRLHAVEMNG  360

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
                S SMS FWLAPQF+IIG GDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAA+F
Sbjct  361  PIKGSTSMSAFWLAPQFVIIGFGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAASF  420

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            LSSLLIT VD  T ++G+SWFGKDLN+SRLD F+WL+  IT+ NL ++V  A  Y YKNV
Sbjct  421  LSSLLITIVDDVTGKNGKSWFGKDLNTSRLDKFFWLMAVITSVNLFMFVFFAHKYNYKNV  480

Query  713  QSKTTMAVADCDDDGGRD  766
            Q    +AVADC +    D
Sbjct  481  QK---LAVADCYEGKNED  495



>gb|KDO57957.1| hypothetical protein CISIN_1g012514mg [Citrus sinensis]
Length=462

 Score =   360 bits (924),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 211/250 (84%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++P+WL +LPFG+ VAQ  TFFIKQ AT++R+I NGF IPPA+++ L A+GM
Sbjct  205  EEMKLVLNVIPVWLASLPFGISVAQSTTFFIKQAATMNREIGNGFLIPPASVFGLTAVGM  264

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y++ILVPVLR+ATGNERG+ ILQRIGIGM+FS+ TM  AALVEKKRL  V+EN 
Sbjct  265  IISVTFYEKILVPVLRRATGNERGIQILQRIGIGMLFSIATMVFAALVEKKRLGVVEENP  324

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            T  S SMSVFWLAPQ +I G+ DGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  325  TKGSLSMSVFWLAPQSIISGVADGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  384

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS LIT VD  T +SGRSWFGKD+NSSRLD FYWLL  + AANL VYV+VAR Y+YKNVQ
Sbjct  385  SSFLITVVDHVTDKSGRSWFGKDMNSSRLDKFYWLLAALVAANLFVYVVVARRYSYKNVQ  444

Query  716  SKTTMAVADC  745
               ++AVADC
Sbjct  445  R--SVAVADC  452



>ref|XP_002312125.1| hypothetical protein POPTR_0008s06140g [Populus trichocarpa]
 gb|EEE89492.1| hypothetical protein POPTR_0008s06140g [Populus trichocarpa]
Length=598

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/258 (67%), Positives = 208/258 (81%), Gaps = 8/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWLT+LPFG+CV Q ATFF+KQGATL+RKI + FEIPPA+I+SL+A+GM
Sbjct  335  EEMKLVLNIIPIWLTSLPFGLCVVQTATFFVKQGATLNRKIGHNFEIPPASIFSLSAVGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SV IYD+ILVP LR+ATGNERG+++L+RIG G+IFSV  M+VAALVE+KR    +E+ 
Sbjct  395  IISVVIYDKILVPFLRRATGNERGISVLKRIGSGLIFSVVAMSVAALVERKRQKIAEEDI  454

Query  359  -------TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVS  517
                        MSVFWLAPQFLI+G+GDGFTLVGLQE+FYDQVPDSMRSLG+AF+LSV 
Sbjct  455  DVLDGEKNVELPMSVFWLAPQFLILGLGDGFTLVGLQEFFYDQVPDSMRSLGMAFFLSVL  514

Query  518  GAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
            GA NFLSS LITAVDR T + G+ W GKDLNSSRLD FYWLL  I + N+ VYVL AR Y
Sbjct  515  GAGNFLSSFLITAVDRITEKDGKGWIGKDLNSSRLDKFYWLLAAINSVNIFVYVLFARRY  574

Query  698  TYKNVQSKTTMAVADCDD  751
            TYK VQ + T    + DD
Sbjct  575  TYKTVQRRLTATHLNKDD  592



>ref|XP_011036947.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Populus euphratica]
 ref|XP_011037018.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Populus euphratica]
Length=598

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 211/265 (80%), Gaps = 10/265 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++PIWLT+LPFG+CV Q ATFF+KQGATL+RKI + FEIPPA+I+SL+A+GM
Sbjct  335  EEMKLVLNIIPIWLTSLPFGLCVVQTATFFVKQGATLNRKIGHNFEIPPASIFSLSAVGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SV IYD+ILVP LR+ATGNERG++IL+RIG GMIFSV +M+VAALVE+KR    +E+ 
Sbjct  395  IISVVIYDKILVPFLRRATGNERGISILKRIGSGMIFSVASMSVAALVERKRQKIAEEDI  454

Query  359  -------TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVS  517
                        MSVFWLAPQFLI+G+GDGFTLVGLQE+FYDQVPDSMRSLG+AF+LSV 
Sbjct  455  NVLAGEKNVELPMSVFWLAPQFLILGLGDGFTLVGLQEFFYDQVPDSMRSLGMAFFLSVL  514

Query  518  GAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
            GA NFLSS LIT VD  T + G+ W GKDLNSSRLD FYWLL  I + N+ VYVL AR Y
Sbjct  515  GAGNFLSSFLITTVDHITEKDGKGWIGKDLNSSRLDKFYWLLAAINSVNIFVYVLFARRY  574

Query  698  TYKNVQSKTTMAVADCDDDGGRDAM  772
            TYK VQ +  +A  + + D G + M
Sbjct  575  TYKTVQRR--LAATNLNKDDGMELM  597



>ref|XP_010262662.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nelumbo nucifera]
Length=593

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 204/249 (82%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+NM+PIWL TL FG+ VAQ  TFFIKQ ++++RKI +GFEIPPA+IYS+AAIGM
Sbjct  338  EEVKLVVNMIPIWLATLTFGIGVAQATTFFIKQASSMNRKIGHGFEIPPASIYSVAAIGM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVSVT+Y++IL P LRKATGNERG+ ILQRIGIGM FS   M  AALVE++RL  VQ  T
Sbjct  398  IVSVTVYEKILEPALRKATGNERGIKILQRIGIGMAFSCVAMVAAALVERRRLEIVQGGT  457

Query  362  TSD-SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
                SMSVFWL PQF+IIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GA NFLS
Sbjct  458  GGGMSMSVFWLTPQFVIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAGNFLS  517

Query  539  SLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            SLLIT VD  T + GRSWF KDLN SRLD FYWLL  + A NLCVYV +AR Y+YKNV+ 
Sbjct  518  SLLITVVDILTEKKGRSWFAKDLNHSRLDNFYWLLVVMQAVNLCVYVFIARRYSYKNVKR  577

Query  719  KTTMAVADC  745
            +  +AV DC
Sbjct  578  R--VAVVDC  584



>ref|XP_007133986.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
 gb|ESW05980.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
Length=600

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 210/258 (81%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW+ TLPFG+C AQ +TFFIKQGA ++RKI +GFE+PPA+I++LAAIGM
Sbjct  333  EELKLIINMIPIWVFTLPFGICAAQTSTFFIKQGAIMNRKIGSGFEVPPASIFTLAAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+SV +YD ILVP  RK TGNERG++ILQRIGIGM+FSV +M VAALVE+KRL+ V+ N 
Sbjct  393  IISVILYDNILVPTFRKLTGNERGISILQRIGIGMVFSVLSMIVAALVERKRLHAVEMNG  452

Query  359  --TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
                S SMS FWLAPQF+IIG GDGF LVGLQEYFYDQVPDSMRSLGIA YLSV GAA+F
Sbjct  453  PIKGSTSMSAFWLAPQFVIIGFGDGFALVGLQEYFYDQVPDSMRSLGIALYLSVIGAASF  512

Query  533  LSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            LSSLLIT VD  T ++G+SWFGKDLN+SRLD F+WL+  IT+ NL ++V  A  Y YKNV
Sbjct  513  LSSLLITIVDDVTGKNGKSWFGKDLNTSRLDKFFWLMAVITSVNLFMFVFFAHKYNYKNV  572

Query  713  QSKTTMAVADCDDDGGRD  766
            Q    +AVADC +    D
Sbjct  573  QK---LAVADCYEGKNED  587



>ref|XP_006480900.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Citrus sinensis]
Length=592

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 211/250 (84%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++P+WL +LPFG+ VAQ  TFFIKQ  T++R+I NGF IPPA+++ L A+GM
Sbjct  335  EEMKLVLNVIPVWLASLPFGISVAQSTTFFIKQATTMNREIGNGFLIPPASVFGLTAVGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y++ILVPVLR+ATGNERG+ ILQRIGIGM+FS+ TM VAALVE+KRL  V+EN 
Sbjct  395  IISVTFYEKILVPVLRRATGNERGIQILQRIGIGMLFSIATMVVAALVEEKRLGVVEENP  454

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            T  S SMSVFWLAPQ +I G+ DGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  455  TKGSLSMSVFWLAPQSIISGVADGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  514

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS LIT VD  T +SGRSWFGKD+NSSRLD FYWLL  + AANL VYV+VAR Y+YKNVQ
Sbjct  515  SSFLITVVDHVTDKSGRSWFGKDMNSSRLDKFYWLLAALVAANLFVYVVVARRYSYKNVQ  574

Query  716  SKTTMAVADC  745
               ++AVADC
Sbjct  575  R--SVAVADC  582



>ref|XP_006429216.1| hypothetical protein CICLE_v10011341mg [Citrus clementina]
 gb|ESR42456.1| hypothetical protein CICLE_v10011341mg [Citrus clementina]
Length=592

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 211/250 (84%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+N++P+WL +LPFG+ VAQ  TFFIKQ  T++R+I NGF IPPA+++ L A+GM
Sbjct  335  EEMKLVLNVIPVWLASLPFGISVAQSTTFFIKQATTMNREIGNGFLIPPASVFGLTAVGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT Y++ILVPVLR+ATGNERG+ ILQRIGIGM+FS+ TM VAALVE+KRL  V+EN 
Sbjct  395  IISVTFYEKILVPVLRRATGNERGIQILQRIGIGMLFSIATMVVAALVEEKRLGVVEENP  454

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            T  S SMSVFWLAPQ +I G+ DGF LVGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  455  TKGSLSMSVFWLAPQSIISGVADGFALVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  514

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS LIT VD  T +SGRSWFGKD+NSSRLD FYWLL  + AANL VYV+VAR Y+YKNVQ
Sbjct  515  SSFLITVVDHVTDKSGRSWFGKDMNSSRLDKFYWLLAALVAANLFVYVVVARRYSYKNVQ  574

Query  716  SKTTMAVADC  745
               ++AVADC
Sbjct  575  R--SVAVADC  582



>ref|XP_004492370.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cicer arietinum]
Length=595

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 208/257 (81%), Gaps = 5/257 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW+ TLPFG+CVAQ +TFFIKQ A ++RKI  GFEIPPA+I+++ A+GM
Sbjct  334  EEMKLIINMIPIWIFTLPFGICVAQTSTFFIKQSAIMNRKIGEGFEIPPASIFTITALGM  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV  +D+ILVP+LRK   NERG+ ILQRIG GMIF++TTM +AALVEKKRL  +++++
Sbjct  394  IISVVTFDKILVPMLRKINKNERGINILQRIGFGMIFTITTMIIAALVEKKRLEAIEKDS  453

Query  362  --TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S SMSVFWLAPQFLIIG GDGFTLVGLQEYFY QVPDSMRSLGIAFYLSV GA+NFL
Sbjct  454  LKASLSMSVFWLAPQFLIIGFGDGFTLVGLQEYFYGQVPDSMRSLGIAFYLSVIGASNFL  513

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SS+LIT VD  T ++G+SWFGKDLNSSRLD FYWLL  I   NL ++V  AR Y+YKNVQ
Sbjct  514  SSILITIVDHMTKKNGKSWFGKDLNSSRLDKFYWLLAVIATLNLFLFVFFARRYSYKNVQ  573

Query  716  SKTTMAVADCDDDGGRD  766
                + V D   +G  D
Sbjct  574  K---IVVVDDTYEGKND  587



>ref|XP_010033212.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Eucalyptus grandis]
 gb|KCW52791.1| hypothetical protein EUGRSUZ_J02126 [Eucalyptus grandis]
Length=600

 Score =   358 bits (919),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 208/261 (80%), Gaps = 11/261 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIWLT LPFG+CVAQ +TFF+KQG  +DR+I   FEIP A+ Y+LAA+GM
Sbjct  335  EEMKLVLNMIPIWLTALPFGVCVAQASTFFVKQGVAMDRRI-GSFEIPAASTYALAAVGM  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLN------  343
            I SVT+Y+++LVP+LRK+TGNERG+ ILQRIG G+IFSV  M+VAALVE KRL       
Sbjct  394  IFSVTVYEKLLVPILRKSTGNERGINILQRIGFGLIFSVVAMSVAALVEAKRLRTWKHDA  453

Query  344  FVQENTTSD-SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSG  520
             VQ+  T   SMSVFWLAPQ+LI+G+GDGFTLVGLQEYFYDQVPDSMRSLGIA YLSV G
Sbjct  454  LVQKRATPKPSMSVFWLAPQYLILGLGDGFTLVGLQEYFYDQVPDSMRSLGIAIYLSVIG  513

Query  521  AANFLSSLLITAVDRATARS--GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARN  694
              +FLSS LIT VD  T R+  G+ W GKDLNSSRLD FYWLL  I  AN+C+YV VAR 
Sbjct  514  GGSFLSSFLITIVDHITGRADGGQVWVGKDLNSSRLDRFYWLLAAINLANICIYVAVARR  573

Query  695  YTYKNVQSKTTMAVADCDDDG  757
            YTYKNVQ +  +A +DC +DG
Sbjct  574  YTYKNVQRRAVVA-SDCREDG  593



>ref|XP_009380625.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=580

 Score =   357 bits (915),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 204/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+++MVPIWL  LPFG+CVAQ  TFFIKQG+ +DR++ N F+IPPA++YSL+AIGM
Sbjct  328  EELKLILSMVPIWLAALPFGICVAQANTFFIKQGSVMDRQVTNSFKIPPASVYSLSAIGM  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNF-VQEN  358
            IVSVT YD++LVP LRKATGNERG++IL+RIGIGM  +   M  AALVE+KRL   V E 
Sbjct  388  IVSVTFYDKLLVPFLRKATGNERGISILKRIGIGMAITTVAMISAALVERKRLRVAVTEQ  447

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T+  SMSVFWL PQF+I+GIGDGF LVGLQEYFYDQVPD MRSLGIAFYLSV GAANFLS
Sbjct  448  TSVVSMSVFWLLPQFVIMGIGDGFALVGLQEYFYDQVPDGMRSLGIAFYLSVLGAANFLS  507

Query  539  SLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLIT VD  T+R G+ SWF KDLN SRLD +YWL+  I+A NLC YV +AR Y+YK VQ
Sbjct  508  SLLITIVDHITSREGKGSWFAKDLNKSRLDLYYWLIATISAVNLCGYVYLARRYSYKKVQ  567

Query  716  SKTTMAVAD  742
             K  +AVAD
Sbjct  568  RK--VAVAD  574



>ref|XP_002534074.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF28309.1| Peptide transporter, putative [Ricinus communis]
Length=1133

 Score =   370 bits (950),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 187/260 (72%), Positives = 220/260 (85%), Gaps = 5/260 (2%)
 Frame = +2

Query  2     EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             EE+KL+INM+PIWL TLPFG+CVAQ +TFFIKQG  L+RKI NGFEIP A+I++L A+GM
Sbjct  875   EELKLIINMIPIWLATLPFGICVAQTSTFFIKQGTMLNRKIGNGFEIPSASIFALGAVGM  934

Query  182   IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
             I+SVTIY++IL+P +RKAT NERG+TILQRIGIGM FS+ TM VAALVEKKRL+ V++N 
Sbjct  935   IISVTIYEKILIPTVRKATANERGITILQRIGIGMGFSIATMVVAALVEKKRLDVVEQNP  994

Query  362   T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
                S SMSVFWLAPQF+I+GIGDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV+GAANFL
Sbjct  995   LKGSLSMSVFWLAPQFVIMGIGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVNGAANFL  1054

Query  536   SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             SSLLIT VD  T R+G+SWFGKDLN+SRLD FYWLL  + AANL +YV +AR Y+YKNVQ
Sbjct  1055  SSLLITVVDDVTERNGKSWFGKDLNTSRLDNFYWLLAAMAAANLIIYVFLARRYSYKNVQ  1114

Query  716   SKTTMAVADCDDDG-GRDAM  772
                 + VADC +   G D+M
Sbjct  1115  GG--VVVADCPEHNIGGDSM  1132


 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 185/219 (84%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWL TLPFG+ VAQ ATFFIKQ  TL R + NGF IPPA++Y++ AIGM
Sbjct  333  EEVKLILNMIPIWLVTLPFGISVAQTATFFIKQSTTLGRNVGNGFLIPPASVYAICAIGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT+Y++ILVP+LR+ TGNERG+ ILQRIGIGM+FSV  M  +ALVE+KRL+ V++N 
Sbjct  393  IISVTVYEKILVPILRRVTGNERGIKILQRIGIGMVFSVAAMVTSALVERKRLSVVEKNG  452

Query  362  TSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               S  MSVFWL PQFLI GIGDGFT+VGLQEYFYDQVPDSMRSLGIAFYLSV GAANFL
Sbjct  453  AKGSLTMSVFWLGPQFLIFGIGDGFTIVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGI  652
            SS+LIT VD  T + GRSWFGKDLNSSRLD FYWLL  +
Sbjct  513  SSVLITVVDHVTKKYGRSWFGKDLNSSRLDNFYWLLAAM  551



>gb|KEH23046.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=496

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 205/255 (80%), Gaps = 7/255 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW+ T+PFG+ VAQ +TFFIKQ A ++RKI   FE+PPA+I+++AA+GM
Sbjct  241  EEMKLIINMIPIWVFTIPFGISVAQTSTFFIKQSAIMNRKIGERFELPPASIFTVAALGM  300

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYD+ILVP+LRK   NERG+ ILQRIG GM F++ TM VAAL+EKKRL  V++  
Sbjct  301  IISVAIYDKILVPMLRKINQNERGINILQRIGFGMFFTIITMIVAALIEKKRLEAVEK--  358

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
              D +S+FWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+SS
Sbjct  359  --DPLSIFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFISS  416

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
            +LIT VD  T ++G+SWFGKDLNSSRLD FYWLL  IT  NL ++V  AR Y+YKNVQ  
Sbjct  417  VLITIVDHITKKNGKSWFGKDLNSSRLDKFYWLLAAITTVNLFLFVFFARRYSYKNVQK-  475

Query  722  TTMAVADCDDDGGRD  766
              +AV D    G  D
Sbjct  476  --VAVIDDSCKGKND  488



>ref|XP_009380623.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=681

 Score =   357 bits (916),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 204/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+++MVPIWL  LPFG+CVAQ  TFFIKQG+ +DR++ N F+IPPA++YSL+AIGM
Sbjct  429  EELKLILSMVPIWLAALPFGICVAQANTFFIKQGSVMDRQVTNSFKIPPASVYSLSAIGM  488

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNF-VQEN  358
            IVSVT YD++LVP LRKATGNERG++IL+RIGIGM  +   M  AALVE+KRL   V E 
Sbjct  489  IVSVTFYDKLLVPFLRKATGNERGISILKRIGIGMAITTVAMISAALVERKRLRVAVTEQ  548

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T+  SMSVFWL PQF+I+GIGDGF LVGLQEYFYDQVPD MRSLGIAFYLSV GAANFLS
Sbjct  549  TSVVSMSVFWLLPQFVIMGIGDGFALVGLQEYFYDQVPDGMRSLGIAFYLSVLGAANFLS  608

Query  539  SLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLIT VD  T+R G+ SWF KDLN SRLD +YWL+  I+A NLC YV +AR Y+YK VQ
Sbjct  609  SLLITIVDHITSREGKGSWFAKDLNKSRLDLYYWLIATISAVNLCGYVYLARRYSYKKVQ  668

Query  716  SKTTMAVAD  742
             K  +AVAD
Sbjct  669  RK--VAVAD  675



>ref|XP_003623153.1| Peptide transporter PTR3-B [Medicago truncatula]
 gb|AES79371.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=583

 Score =   354 bits (908),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 205/255 (80%), Gaps = 7/255 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKL+INM+PIW+ T+PFG+ VAQ +TFFIKQ A ++RKI   FE+PPA+I+++AA+GM
Sbjct  328  EEMKLIINMIPIWVFTIPFGISVAQTSTFFIKQSAIMNRKIGERFELPPASIFTVAALGM  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYD+ILVP+LRK   NERG+ ILQRIG GM F++ TM VAAL+EKKRL  V++  
Sbjct  388  IISVAIYDKILVPMLRKINQNERGINILQRIGFGMFFTIITMIVAALIEKKRLEAVEK--  445

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
              D +S+FWLAPQFLIIG GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAANF+SS
Sbjct  446  --DPLSIFWLAPQFLIIGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAANFISS  503

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
            +LIT VD  T ++G+SWFGKDLNSSRLD FYWLL  IT  NL ++V  AR Y+YKNVQ  
Sbjct  504  VLITIVDHITKKNGKSWFGKDLNSSRLDKFYWLLAAITTVNLFLFVFFARRYSYKNVQK-  562

Query  722  TTMAVADCDDDGGRD  766
              +AV D    G  D
Sbjct  563  --VAVIDDSCKGKND  575



>ref|XP_004507202.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Cicer arietinum]
Length=595

 Score =   353 bits (905),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 208/260 (80%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW+ TLPFG+C  Q ATFFIKQG  ++RKI N FEIP A+IY+LAA GM
Sbjct  333  EELKLIINMLPIWVLTLPFGVCATQQATFFIKQGVIMNRKIGNNFEIPAASIYALAAFGM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV IYD+ILVP LR+ TGNERG++ILQRIG GMIF++ TM VAALVE+KRL+ V+ N 
Sbjct  393  MISVAIYDKILVPTLRRITGNERGISILQRIGFGMIFAIFTMIVAALVERKRLHIVEMNP  452

Query  362  T--SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            +  S SMSVFWLAPQ+LI G GDGF LVGLQEYFYDQVP+SMRSLGI  YLSV G A+FL
Sbjct  453  SKGSLSMSVFWLAPQYLIFGFGDGFALVGLQEYFYDQVPESMRSLGIGLYLSVIGVASFL  512

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            S+LLIT VD  T++SG+SWFGKDLN+SRLD FYWLL  I+  N+ ++ L A+ Y+YKNVQ
Sbjct  513  SNLLITIVDHVTSKSGKSWFGKDLNTSRLDKFYWLLAVISTLNVLMFGLFAQRYSYKNVQ  572

Query  716  SKTTMAVADCDDDGGRDAMV  775
             K      +  DDGG + M+
Sbjct  573  -KVVKNCEEKSDDGGAERMI  591



>ref|XP_008391631.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Malus domestica]
Length=597

 Score =   352 bits (904),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 196/244 (80%), Gaps = 4/244 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWLT+L FG+CVAQ +TFF+KQ AT+D  I + F+IPPA+IYSL AI M
Sbjct  344  EEVKLILNMIPIWLTSLTFGLCVAQASTFFVKQAATMDLHITDNFKIPPASIYSLGAIAM  403

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SVT+YD+ILVP+LRKATGNERG+ IL RIGIGMIFSV  M+ AALVE KRL   Q   
Sbjct  404  LISVTVYDKILVPILRKATGNERGINILTRIGIGMIFSVIAMSAAALVETKRLKADQPQ-  462

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               SMSVFWLAPQ++I+G GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV    +F+SS
Sbjct  463  ---SMSVFWLAPQYIILGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIAVGSFISS  519

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  VD  T + G SWFGKDLNSSRLD FYWLL  +   NLCVY L+AR YTYKNV+ +
Sbjct  520  FLIIVVDHVTGKGGNSWFGKDLNSSRLDNFYWLLAAMNGLNLCVYGLLARGYTYKNVERR  579

Query  722  TTMA  733
              +A
Sbjct  580  VVVA  583



>ref|XP_008233505.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Prunus mume]
Length=579

 Score =   352 bits (902),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 200/247 (81%), Gaps = 5/247 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++NM+PIWLT+L FG+C+AQ  TFF+KQ AT++  I + F+IPPA+IYSL AI M
Sbjct  337  EEAKLILNMIPIWLTSLAFGVCLAQAPTFFVKQAATMNLNITDNFKIPPASIYSLGAIAM  396

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SVT+YD+ILVP+LRKATGNERG+ ILQRIG GMIFSV  M+ AALVE++RL    +  
Sbjct  397  LISVTVYDKILVPILRKATGNERGINILQRIGFGMIFSVMAMSAAALVERRRL----KAD  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               SMSVFWLAPQ++I+G+GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV G  +F+SS
Sbjct  453  EPQSMSVFWLAPQYIILGLGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGVGSFISS  512

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI AVD  T + GRSWFGKDLNSSRLD FYWLL  +   NLC Y L+AR YTYKNV+ +
Sbjct  513  FLIMAVDHVTEKGGRSWFGKDLNSSRLDNFYWLLAAMNGLNLCFYGLLARGYTYKNVERR  572

Query  722  TTMAVAD  742
              + VAD
Sbjct  573  AVV-VAD  578



>ref|XP_007220930.1| hypothetical protein PRUPE_ppa023730mg [Prunus persica]
 gb|EMJ22129.1| hypothetical protein PRUPE_ppa023730mg [Prunus persica]
Length=575

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 197/240 (82%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWLT+L FG+C+AQ +TFF+KQ AT++  I + F+IPPA+IYSL AI M
Sbjct  333  EEVKLILNMIPIWLTSLTFGVCLAQASTFFVKQAATMNLNITDNFKIPPASIYSLGAIAM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SVT+YD+ILVP+LRKATGNERG+ IL RIG GMIFSV  M+ AALVE++RL    +  
Sbjct  393  LISVTVYDKILVPILRKATGNERGINILHRIGFGMIFSVMAMSAAALVERRRL----KAD  448

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               SMSVFWLAPQ++I+G+GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV G  +F+SS
Sbjct  449  EPQSMSVFWLAPQYIILGLGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGVGSFISS  508

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI AVD  T + GRSWFGKDLNSSRLD FYWLL  +   NLC Y L+AR YTYKNV+ +
Sbjct  509  FLIMAVDHVTEKGGRSWFGKDLNSSRLDNFYWLLAAMNGLNLCFYGLLARGYTYKNVERR  568



>ref|XP_009351271.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
 ref|XP_009334761.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
Length=597

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 195/244 (80%), Gaps = 4/244 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWLT+L FG+CVAQ +TFF+KQ A +D  I + F+IPPA+IYSL AI M
Sbjct  344  EEVKLILNMIPIWLTSLTFGLCVAQASTFFVKQAAIMDLHITDNFKIPPASIYSLGAIAM  403

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SVT+YD+ILVP+LRKATGNERG+ IL RIGIGMIFSV  M+ AALVE KRL    +  
Sbjct  404  LISVTVYDKILVPILRKATGNERGINILTRIGIGMIFSVVAMSAAALVETKRL----KAD  459

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               SMSVFWLAPQ++I+G GDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSV    +F+SS
Sbjct  460  RPQSMSVFWLAPQYIILGFGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIAVGSFISS  519

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  VD  T + G SWFGKDLNSSRLD FYWLL  +   NLCVY L+AR YTYKNV+ +
Sbjct  520  FLIIVVDHVTGKGGNSWFGKDLNSSRLDNFYWLLAAMNGLNLCVYGLLARGYTYKNVERR  579

Query  722  TTMA  733
              +A
Sbjct  580  VVVA  583



>ref|XP_002277582.2| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Vitis vinifera]
Length=597

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 204/258 (79%), Gaps = 8/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIW TTL FG+CVAQ  TFFIKQ  T++ +II    IP A+IYS++A+GM
Sbjct  340  EEMKLVLNMIPIWFTTLTFGLCVAQATTFFIKQSDTMNLEIIKDVSIPSASIYSISAVGM  399

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVTIY++ILVP+LR+ATG ERG+ ILQRIG GMIFSV +M+ AALVE+KRL   +E  
Sbjct  400  IISVTIYEKILVPLLRRATGTERGIKILQRIGFGMIFSVLSMSTAALVERKRLRVAEEEL  459

Query  362  TSD-----SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAA  526
            T       SMSV WLAPQ+LI+G GDGFTLVGLQEYFY QVPDSMRSLGIAFYLSV G  
Sbjct  460  TGGKTGPVSMSVLWLAPQYLILGFGDGFTLVGLQEYFYGQVPDSMRSLGIAFYLSVIGVG  519

Query  527  NFLSSLLITAVDRATARS-GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
            NF SSLLIT VD AT +S G SWF KDLN SRLD FYWLL  ++  NLCV+V +A+ Y+Y
Sbjct  520  NFYSSLLITVVDHATEKSNGTSWFRKDLNKSRLDNFYWLLAAMSGLNLCVFVFLAKRYSY  579

Query  704  KNVQSKTTMAVADCDDDG  757
            K+V+ +  + VADC+++G
Sbjct  580  KSVEGR--VVVADCEENG  595



>ref|XP_008785490.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Phoenix dactylifera]
Length=607

 Score =   342 bits (877),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 197/244 (81%), Gaps = 3/244 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE KLV++MVPIWL +LPFGMCVAQ  TFFIKQG+ +DR++  + FEIPPA+IYSL A+G
Sbjct  339  EEAKLVLSMVPIWLVSLPFGMCVAQAPTFFIKQGSIMDRRLGGSSFEIPPASIYSLGAMG  398

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-E  355
            MI+SV  Y++ILVP LR+ATG+ERG++IL+RIGIGM+FSV  M VAA+VE KRL   Q E
Sbjct  399  MIISVCFYEKILVPFLRRATGDERGISILRRIGIGMVFSVLAMIVAAIVESKRLKAAQGE  458

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               + SMSVFWLAPQF I+G+GDGF LVGLQEYFYDQVPD+MRSLGIAFYLSV GA+NFL
Sbjct  459  QANAVSMSVFWLAPQFTILGVGDGFALVGLQEYFYDQVPDNMRSLGIAFYLSVIGASNFL  518

Query  536  SSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            SSLLITA D  T + GR+ WF KDLN SRLD FYWLL  I A +LC YV +A  Y+YK V
Sbjct  519  SSLLITAADHLTEKGGRAGWFAKDLNKSRLDLFYWLLAVIDAVSLCGYVYLACRYSYKTV  578

Query  713  QSKT  724
            Q K 
Sbjct  579  QRKN  582



>ref|XP_009380626.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   342 bits (876),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 201/253 (79%), Gaps = 2/253 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV++MVPIW+T LPFG+C+AQ  TFF+KQG+ +DR+I NGF IP A+I+SL A+GM
Sbjct  335  EELKLVLSMVPIWITVLPFGICIAQTNTFFVKQGSVMDRQIGNGFIIPAASIFSLGALGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-EN  358
            ++SVT Y+R+LVP+LR+ TG+ERG++IL+RIGIGM  +   M  AALVE KRL   + E 
Sbjct  395  VISVTFYERMLVPILRRVTGDERGVSILRRIGIGMAITTVGMISAALVEMKRLKVAENEG  454

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T + SMSV WLAPQF+IIG+GDGF LVGLQEYFYDQVPDSMRSLGIAFYLSV G ANF+S
Sbjct  455  TIAVSMSVLWLAPQFVIIGVGDGFALVGLQEYFYDQVPDSMRSLGIAFYLSVLGVANFIS  514

Query  539  SLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            S+LIT VDR T+R GR SWF KD+N SRLD FYWLL  + A NLC YV +AR+Y+YK V 
Sbjct  515  SVLITVVDRITSRGGRGSWFAKDVNKSRLDLFYWLLAIMGALNLCCYVFLARSYSYKKVH  574

Query  716  SKTTMAVADCDDD  754
             +    +   +DD
Sbjct  575  QRRVGVIDSSEDD  587



>gb|AAK32755.1|AF361587_1 AT3g53960/F5K20_260 [Arabidopsis thaliana]
Length=310

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 201/255 (79%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q +T FIKQ   +DR I    F +PPA+++SL A+ 
Sbjct  43   EEVKLLINMIPIWFFTLAFGVCATQSSTLFIKQAIIMDRHITGTSFIVPPASLFSLIALS  102

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP+LR+ATGNERG++ILQRIG+GM+FS+  M +AAL+EKKRL++ +E+
Sbjct  103  IIITVTIYEKLLVPLLRRATGNERGISILQRIGVGMVFSLFAMIIAALIEKKRLDYAKEH  162

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              + +M  S  WLAPQFL++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  163  HMNKTMTLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  222

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW+L  +TAAN+C +V+VA  YTYK 
Sbjct  223  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTAANICCFVIVAMRYTYKT  282

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  283  VQPSLAV-VADGGDD  296



>ref|XP_007009172.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY17982.1| Major facilitator superfamily protein [Theobroma cacao]
Length=596

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 194/254 (76%), Gaps = 8/254 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV++M+PIWLT+L FG+ VAQ +TFF+KQ AT+DR+I + F+IPPA+IYSL A+GM
Sbjct  335  EEMKLVLSMIPIWLTSLIFGVGVAQASTFFVKQAATMDRRITHNFDIPPASIYSLTAVGM  394

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSVTIY++ILVP LRK T NERG+ ILQRIGIGMIFS  +M  AA VE KRL  V++  
Sbjct  395  MVSVTIYEKILVPFLRKVTSNERGINILQRIGIGMIFSTLSMVAAACVEMKRLKAVEKEI  454

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                     SMSVFWLAPQ+LI G+GDGF LVGLQEYFYDQ PDSMRSLGIAFYLSV G 
Sbjct  455  MQGGKQVALSMSVFWLAPQYLINGLGDGFALVGLQEYFYDQAPDSMRSLGIAFYLSVIGV  514

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS LI  VD  T + G+SW GKDLN SRLD FYW+L  I   N C Y+ +AR+YTY
Sbjct  515  GSFLSSFLIIIVDHITRKGGKSWIGKDLNISRLDNFYWMLAAINLLNFCAYIFLARSYTY  574

Query  704  KNVQSKTTMAVADC  745
            KNV+    + V DC
Sbjct  575  KNVER--GILVPDC  586



>emb|CAN73118.1| hypothetical protein VITISV_002486 [Vitis vinifera]
Length=1164

 Score =   347 bits (889),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 204/258 (79%), Gaps = 8/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EEMKLV+NM+PIW TTL FG+CVAQ  TFFIKQ  T++ +II    IP A+IYS++A+GM
Sbjct  352  EEMKLVLNMIPIWFTTLTFGLCVAQATTFFIKQSDTMNLEIIKDVSIPSASIYSISAVGM  411

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVTIY++ILVP+LR+ATG ERG+ ILQRIG GMIFSV +M+ AALVE+KRL   +E  
Sbjct  412  IISVTIYEKILVPLLRRATGTERGIKILQRIGFGMIFSVLSMSTAALVERKRLRVAEEEL  471

Query  362  TSD-----SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAA  526
            T       SMSV WLAPQ+LI+G GDGFTLVGLQEYFY QVPDSMRSLGIAFYLSV G  
Sbjct  472  TGGKTGPVSMSVLWLAPQYLILGFGDGFTLVGLQEYFYGQVPDSMRSLGIAFYLSVIGVG  531

Query  527  NFLSSLLITAVDRATARS-GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
            NF SSLLIT VD AT +S G SWF KDLN SRLD FYWLL  ++  NLCV+V +A+ Y+Y
Sbjct  532  NFYSSLLITVVDHATEKSNGTSWFRKDLNKSRLDNFYWLLAAMSGLNLCVFVFLAKRYSY  591

Query  704  KNVQSKTTMAVADCDDDG  757
            K+V+ +  + VADC+++G
Sbjct  592  KSVEGR--VVVADCEENG  607



>ref|XP_010905398.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Elaeis guineensis]
Length=604

 Score =   334 bits (856),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 196/246 (80%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++ MVPIWL +LPFG+ +AQ +TFFIKQ + +DRK+  GF+IPPA++YSLAAI M
Sbjct  349  EETKLILAMVPIWLASLPFGISIAQTSTFFIKQASIMDRKLAGGFDIPPASVYSLAAISM  408

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-EN  358
            I++V+ YD+ILVP LR+ATGNERG++IL+RIGIGM FS+  MA AA+VE+KRL   + E 
Sbjct  409  IITVSCYDKILVPFLRRATGNERGISILRRIGIGMGFSIVAMAAAAIVERKRLRVAEAEQ  468

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T+  SMSVFWLAPQF+I+G  DGFT+VGLQEYFY QVPDSMRSLG+AFYLSV G ANFLS
Sbjct  469  TSVVSMSVFWLAPQFIILGFADGFTVVGLQEYFYGQVPDSMRSLGLAFYLSVLGTANFLS  528

Query  539  SLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLIT VD  T   GR+ WF KDLN SRLD FYWLL  I A NLC YV  A  Y+YKNVQ
Sbjct  529  SLLITVVDHLTGEGGRAGWFSKDLNKSRLDLFYWLLAAINAVNLCGYVYQASRYSYKNVQ  588

Query  716  SKTTMA  733
             K  +A
Sbjct  589  RKVGIA  594



>ref|XP_009103887.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Brassica rapa]
 ref|XP_009103888.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Brassica rapa]
 emb|CDX67578.1| BnaA07g16180D [Brassica napus]
Length=596

 Score =   333 bits (855),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 204/252 (81%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  Q +TFFIKQ   +DR I + F IPP++ ++L A+ M
Sbjct  336  EELKLLINMIPIWFFTLAFGICATQSSTFFIKQAIVMDRHIGHNFIIPPSSTFALVALSM  395

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+T+Y+R+LVP+LR+ T NERG++IL+RIGIGM+FS+ TM +AAL+E+KRL++ + + 
Sbjct  396  IISLTVYERLLVPLLRRVTRNERGISILKRIGIGMVFSLITMIIAALIERKRLDYTKHHH  455

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MS  WLAPQF++IGI D  TLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  456  M--VMSALWLAPQFIVIGIADALTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  513

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A A SG+SWFGKDLNSSRLD FYW+L  +TA N+C +V+VA+ YTYK+VQS
Sbjct  514  LLMTVSDRLAEAISGKSWFGKDLNSSRLDRFYWMLAALTAVNICFFVIVAKRYTYKSVQS  573

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  574  --SVAVADGGDD  583



>emb|CDY07568.1| BnaC06g14960D [Brassica napus]
Length=596

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 203/252 (81%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  Q +TFFIKQ   +DR I + F +PP++++SL A+ M
Sbjct  336  EELKLLINMIPIWFFTLAFGICATQSSTFFIKQAIVMDRHIGHNFIVPPSSMFSLVALSM  395

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+T+Y+R+LVP+LR+ T NERG++IL+RIGIGM+FS+  M +AAL E+KRL++ + + 
Sbjct  396  IISLTVYERLLVPILRRVTRNERGISILKRIGIGMVFSLIAMIIAALTERKRLDYTKHHH  455

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MS  WLAPQF++IGI D  TLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  456  M--VMSALWLAPQFIVIGIADALTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  513

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A A SG+SWFGKDLNSSRLD FYW+L  +TA N+C +V+VA+ YTYK+VQS
Sbjct  514  LLMTVSDRLAEAISGKSWFGKDLNSSRLDRFYWMLAALTAVNICFFVIVAKRYTYKSVQS  573

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  574  --SVAVADGGDD  583



>ref|XP_006403634.1| hypothetical protein EUTSA_v10010224mg [Eutrema salsugineum]
 gb|ESQ45087.1| hypothetical protein EUTSA_v10010224mg [Eutrema salsugineum]
Length=596

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 200/252 (79%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  Q  TFFIKQ   +DR I   F +PP++++SL A+ M
Sbjct  336  EEVKLLINMIPIWFFTLAFGICATQSTTFFIKQAIIMDRHIGQSFIVPPSSMFSLVALSM  395

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+T+Y++ LVP+LR+ TGNERG++ILQR+G GM+FS+  M  AALVEKKRL++ ++N 
Sbjct  396  IISITVYEKFLVPLLRRVTGNERGISILQRVGTGMVFSLIAMITAALVEKKRLDYTKQNH  455

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MS  WLAPQF++IGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  456  V--AMSAIWLAPQFIVIGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  513

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A   SG+SW GKDLNSSRLD +YW L  +TAANLC +V+VA+ YTYK+VQ 
Sbjct  514  LLMTVTDRIAEEISGKSWLGKDLNSSRLDRYYWTLAALTAANLCFFVIVAKRYTYKSVQP  573

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  574  --SLAVADGGDD  583



>ref|XP_009409715.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 199/254 (78%), Gaps = 2/254 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+++MVPIWLT LPF +CV Q  TFFIKQG+ ++R+++NGF+IP A+I++L A+G+
Sbjct  328  EELKLILSMVPIWLTALPFSICVVQANTFFIKQGSIMNREVVNGFKIPAASIFALGAVGI  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-EN  358
            I+SV IYD++LVP LR+ATG+ERG++IL+RIGIGM+FS   M  AALVE++RL   + E 
Sbjct  388  IISVAIYDKVLVPFLRRATGSERGISILKRIGIGMVFSTMGMVTAALVERRRLRVAEVEQ  447

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T+  SMSVFWL PQF+++GIGDGF LVGLQEYFYDQVPD MRSLGIAFYLS  G A+FLS
Sbjct  448  TSVVSMSVFWLVPQFMMLGIGDGFALVGLQEYFYDQVPDGMRSLGIAFYLSALGVASFLS  507

Query  539  SLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLITAVD  T++  R SWF KDLN SRLD +YWL+  I+  NL  YV +A  Y+YK VQ
Sbjct  508  SLLITAVDHLTSKEARGSWFAKDLNKSRLDLYYWLVAAISGVNLFGYVFLASRYSYKRVQ  567

Query  716  SKTTMAVADCDDDG  757
            ++     +  + D 
Sbjct  568  TEAVGVASSPEADA  581



>emb|CDX73514.1| BnaC08g24890D [Brassica napus]
Length=364

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 198/252 (79%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  Q  TFFIKQ   +DR I + F +PP+++++L A+ M
Sbjct  104  EELKLLINMIPIWFFTLAFGICATQSTTFFIKQAIIMDRHIGHSFIVPPSSMFALVALSM  163

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT+Y++ILVP+ R+ TG ERG++ILQRIG GM+FS+  M +AALVE+KRL++ +++ 
Sbjct  164  IISVTVYEKILVPLSRRLTGKERGISILQRIGTGMVFSLLAMIIAALVERKRLDYTKQHH  223

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                M+  WLAPQF++IGI D FTLVGLQEYFYDQVPDSMRSLGI  YLSV GAA+F+++
Sbjct  224  V--PMNAIWLAPQFIVIGIADAFTLVGLQEYFYDQVPDSMRSLGIGLYLSVVGAASFVNN  281

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A   SG++ FGKDLNSSRLD FYW L  +TAAN+CV+V VAR YTYK+VQS
Sbjct  282  LLMTVTDRLAEEISGKTLFGKDLNSSRLDRFYWTLAALTAANICVFVFVARRYTYKSVQS  341

Query  719  KTTMAVADCDDD  754
              ++ VAD  DD
Sbjct  342  --SVVVADGGDD  351



>ref|XP_008811508.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Phoenix dactylifera]
Length=602

 Score =   332 bits (850),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 197/253 (78%), Gaps = 2/253 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++ MVPIW  +LPFG+CVAQ +TFFIKQ + +DRK+  GF++PPA+++SLAAI M
Sbjct  344  EETKLILAMVPIWSASLPFGICVAQTSTFFIKQASIMDRKLAGGFDVPPASVFSLAAISM  403

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-EN  358
            I+SV+ YD+ILVP LR+ATGNERG++IL+RIGIGM+F +  MA AA+VE+KRL   + E 
Sbjct  404  IISVSFYDKILVPFLRRATGNERGMSILRRIGIGMVFCIVAMAAAAIVERKRLRVAEAEQ  463

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            T+  SMSV WL PQF+I+G GDGFT+VGLQEYFYDQVPD MRSLG+AFYLSV G  +FLS
Sbjct  464  TSVVSMSVLWLVPQFMIMGFGDGFTIVGLQEYFYDQVPDCMRSLGLAFYLSVIGTGSFLS  523

Query  539  SLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLIT  D  T + GR+ WF KDLN SRLD FYWLL  + A  LC YV +A  Y+YKNVQ
Sbjct  524  SLLITVADHLTGKGGRAGWFAKDLNESRLDLFYWLLAAMAAVGLCGYVYLASRYSYKNVQ  583

Query  716  SKTTMAVADCDDD  754
             K  +A    +DD
Sbjct  584  RKVGIANFPQEDD  596



>emb|CDY13156.1| BnaC04g26790D [Brassica napus]
Length=495

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 202/252 (80%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  QG TFFIKQ   +DR I + F +PP+++++L A+ M
Sbjct  235  EELKLLINMIPIWFFTLAFGICATQGTTFFIKQAIIMDRHIGHNFIVPPSSMFALVALSM  294

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ +T Y+++LVP+LR+ TGNERG++IL+RIG GM+FS+TTM +AAL+E+KRL++ +++ 
Sbjct  295  IIFLTFYEKLLVPILRRVTGNERGISILKRIGTGMVFSLTTMIIAALIERKRLDYTKQHH  354

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               ++SV WLAPQF++IGI D  TLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  355  M--ALSVIWLAPQFIVIGIADALTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  412

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LIT  DR A   S +S FGKDLNSSRLD FYW L  +TA N+C +V+VA+ YTYK+VQS
Sbjct  413  FLITVTDRLAEEISEKSLFGKDLNSSRLDRFYWTLAALTAVNICFFVIVAKRYTYKSVQS  472

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  473  --SLAVADGGDD  482



>emb|CDY07763.1| BnaA03g17480D [Brassica napus]
Length=584

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 195/241 (81%), Gaps = 6/241 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI--INGFEIPPATIYSLAAI  175
            EE KL+IN++PIWL+TL FG+C  Q  TFFIKQ A +DR I   N F +PPA+++SL A+
Sbjct  334  EEAKLIINVIPIWLSTLVFGICATQTNTFFIKQAAIMDRHIAGTNSFTVPPASMFSLTAL  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+S+TIYD+ILVP+LR+ T N+RG+ ILQRIG GM+FS+TTM +AALVEKKRL+  + 
Sbjct  394  SLIISLTIYDKILVPLLRRVTRNQRGINILQRIGTGMLFSLTTMIIAALVEKKRLDRSEN  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            N   + MSV WLAPQF++IG+ D FTLVGLQEYFYDQVPDSMRSLGIA YLSV GAA+FL
Sbjct  454  N---EPMSVIWLAPQFIVIGVADAFTLVGLQEYFYDQVPDSMRSLGIAIYLSVLGAASFL  510

Query  536  SSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            ++LLITAVD  A   S +SWFGKDLNSSRLD FYW L G+TAAN+CV+V+VA+   YK V
Sbjct  511  NNLLITAVDTLADDFSAKSWFGKDLNSSRLDRFYWFLAGVTAANICVFVVVAKRCPYKKV  570

Query  713  Q  715
            Q
Sbjct  571  Q  571



>ref|XP_006290772.1| hypothetical protein CARUB_v10016878mg [Capsella rubella]
 gb|EOA23670.1| hypothetical protein CARUB_v10016878mg [Capsella rubella]
Length=603

 Score =   328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 197/255 (77%), Gaps = 4/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DRKII   F +PPA+++SL A+ 
Sbjct  335  EEVKLLINMIPIWFFTLAFGVCATQSGTLFIKQAIVMDRKIIGTTFIVPPASLFSLVALS  394

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R++VP+LR+ TGNERG++ILQRIG GM+FS+  M  AALVEKKRL++ +++
Sbjct  395  IIITVTIYERVIVPLLRRTTGNERGISILQRIGTGMVFSLIAMITAALVEKKRLDYAKQH  454

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S SM  S  WLAPQFL++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  455  HMSTSMTLSAIWLAPQFLVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  514

Query  533  LSSLLITAVDRATAR-SGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  +   SG+ WFGKDLNSSRLD FYW+L  +T AN+C +V+VA  YTYK+
Sbjct  515  VNNLLITVSDHLSEEISGKGWFGKDLNSSRLDRFYWMLAALTGANMCFFVMVAMKYTYKS  574

Query  710  VQSKTTMAVADCDDD  754
            VQ    +     DDD
Sbjct  575  VQPIVAVVADGSDDD  589



>emb|CDX76182.1| BnaA04g04460D [Brassica napus]
Length=597

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 202/252 (80%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  QG TFFIKQ   +DR I + F +PP+++++L A+ M
Sbjct  337  EELKLLINMIPIWFFTLAFGICATQGTTFFIKQAIIMDRHIGHNFIVPPSSMFALVALSM  396

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ +T Y+++LVP+LR+ TGNERG++IL+RIG GM+FS+ TM +AAL+E+KRL++ +++ 
Sbjct  397  IIFLTFYEKLLVPILRRVTGNERGISILKRIGTGMVFSLITMIIAALIERKRLDYTKQHH  456

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSV WLAPQF++IGI D  TLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  457  M--AMSVIWLAPQFIVIGIADALTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  514

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LIT  DR A   SG+S FGKDLNSSRLD FYW L  +TA N+C +V+VA+ YTYK+VQS
Sbjct  515  FLITVTDRLAEEISGKSLFGKDLNSSRLDRFYWTLAALTAVNMCFFVIVAKKYTYKSVQS  574

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  575  --SLAVADGGDD  584



>ref|XP_010509262.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Camelina sativa]
Length=583

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 197/239 (82%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ  T+DR I  GF +PPA+++SL A+ +
Sbjct  334  EETKLIINVIPIWLSTLAFGICATQTSTFFIKQAVTMDRHI-AGFTLPPASMFSLTALTL  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIY+++L+P+LR+ T N+RG+ ILQRIG GM+FS+ TM +AALVEK+RL+    N 
Sbjct  393  IISITIYEKLLIPLLRRITRNQRGINILQRIGTGMLFSLITMIIAALVEKQRLDRTNNNH  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSV WLAPQF+IIGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL++
Sbjct  453  -KPTMSVIWLAPQFIIIGIADSFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFLNN  511

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            LLITAVD  A   SG+SWFGKDLNSSRLD FYW L G+TAAN+CV+++VA+   YK+VQ
Sbjct  512  LLITAVDTLAEDFSGKSWFGKDLNSSRLDRFYWFLAGLTAANICVFMVVAKRCPYKSVQ  570



>ref|XP_010517068.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Camelina sativa]
Length=583

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 197/240 (82%), Gaps = 3/240 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ  T+DR I  GF +PPA+++SL A+ +
Sbjct  334  EETKLIINVIPIWLSTLAFGICATQTSTFFIKQAVTMDRHI-AGFTLPPASMFSLTALTL  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIY+++L+P+LR+ T N+RG+ ILQRIG GM+FS+ TM +AALVEK+RL+    N 
Sbjct  393  IISITIYEKLLIPLLRRITRNQRGINILQRIGTGMLFSLITMIIAALVEKQRLDRTNNNN  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               ++ V WLAPQF+IIGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL++
Sbjct  453  -KPALRVIWLAPQFIIIGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFLNN  511

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LLITAVD  A   SG+SWFGKDLNSSRLD FYW L G+TAAN+CV+++VA+   YK+VQS
Sbjct  512  LLITAVDTLAEDFSGKSWFGKDLNSSRLDRFYWFLAGVTAANICVFIVVAKRCPYKSVQS  571



>emb|CDY14503.1| BnaC03g20920D [Brassica napus]
Length=584

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 194/241 (80%), Gaps = 6/241 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII--NGFEIPPATIYSLAAI  175
            EE KL+IN++PIWL+TL FG+C  Q  TFFIKQ   +DR I   N F +PPA+++SL A+
Sbjct  334  EEAKLIINVIPIWLSTLVFGICATQTNTFFIKQATIMDRHITGNNSFTVPPASMFSLTAL  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+S+TIYD+I VP+LR+ T N+RG+ ILQRIG GM+FS+TTM +AALVEKKRL+  + 
Sbjct  394  SLIISLTIYDKIFVPLLRRVTRNQRGINILQRIGTGMLFSLTTMIIAALVEKKRLDRSEN  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            N   + MSV WLAPQF++IG+ D FTLVGLQEYFYDQVPDSMRSLGIA YLSV GAANFL
Sbjct  454  N---EPMSVIWLAPQFIVIGVADAFTLVGLQEYFYDQVPDSMRSLGIAIYLSVLGAANFL  510

Query  536  SSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            ++LLITAVD  A   S +SWFGKDLNSSRLD FYW L G+TAAN+CV+V+VA+   YK+V
Sbjct  511  NNLLITAVDTLADDFSAKSWFGKDLNSSRLDRFYWFLAGVTAANICVFVVVAKRCPYKSV  570

Query  713  Q  715
            Q
Sbjct  571  Q  571



>ref|XP_009139278.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Brassica rapa]
Length=597

 Score =   326 bits (836),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 202/252 (80%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  QG TFFIKQ   +DR I + F +PP+++++L A+ M
Sbjct  337  EELKLLINMIPIWFFTLAFGICATQGTTFFIKQAIIMDRHIGHNFIVPPSSMFALVALSM  396

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ +T Y+++LVP+LR+ TGNERG++IL+RIG GM+FS+ TM +AAL+E+KRL++ +++ 
Sbjct  397  IIFLTFYEKLLVPILRRVTGNERGISILKRIGTGMVFSLITMIIAALIERKRLDYTKQHH  456

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSV WLAPQF++IGI D  TL+GLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  457  M--AMSVIWLAPQFIVIGIADALTLLGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNN  514

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LIT  DR A   SG+S FGKDLNSSRLD FYW L  +TA N+C +V+VA+ YTYK+VQS
Sbjct  515  FLITVTDRLAEEISGKSLFGKDLNSSRLDRFYWTLAALTAVNMCFFVIVAKKYTYKSVQS  574

Query  719  KTTMAVADCDDD  754
              ++AVAD  DD
Sbjct  575  --SLAVADGGDD  584



>ref|XP_006293895.1| hypothetical protein CARUB_v10022888mg [Capsella rubella]
 gb|EOA26793.1| hypothetical protein CARUB_v10022888mg [Capsella rubella]
Length=583

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 197/239 (82%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ  T+DR I  GF +PPA+++SL A+ +
Sbjct  334  EETKLIINVIPIWLSTLAFGICATQTSTFFIKQAVTMDRHI-AGFTLPPASMFSLTALTL  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIY+++L+P+LR+ T N+RG+ ILQRIG GM+FS+ TM +AALVEK+RLN    N 
Sbjct  393  IISITIYEKLLIPLLRRITRNQRGINILQRIGTGMLFSLITMIIAALVEKQRLNRTINN-  451

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSV WLAPQF+IIGI D FTLVGLQEYFY+QVPDSMRSLGIAFYLSV GAA+FL++
Sbjct  452  -KPAMSVIWLAPQFIIIGIADAFTLVGLQEYFYEQVPDSMRSLGIAFYLSVIGAASFLNN  510

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            LLITAVD  A   SG+SWFGKDLNSSRLD FYW L G+TAAN+CV+++VA+   YK+VQ
Sbjct  511  LLITAVDTLAEDFSGKSWFGKDLNSSRLDRFYWFLAGVTAANICVFMVVAKRCPYKSVQ  569



>ref|XP_010427058.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Camelina sativa]
Length=602

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 199/255 (78%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSTTLFIKQAIIMDRHIIGTKFIVPPASMFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I +VTIY+R+LVP+LR+ATGNERG++ILQRIG GM+FS+  M +AAL+EKKRL++ +E+
Sbjct  396  IIFTVTIYERVLVPLLRRATGNERGISILQRIGTGMVFSLFAMIIAALIEKKRLDYAKEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLIT  D  A   SG+ WFGKDLN+SRLD FYW+L  +TAAN+C +V+VA  YTYK+
Sbjct  516  ANNLLITVSDHLAEEISGKGWFGKDLNTSRLDRFYWMLAALTAANICFFVIVAMRYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  576  VQPSMAV-VADGGDD  589



>ref|NP_190964.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9M331.2|PTR45_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.7; Short=AtNPF5.7 [Arabidopsis 
thaliana]
 gb|AEE79164.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=602

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 201/255 (79%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q +T FIKQ   +DR I    F +PPA+++SL A+ 
Sbjct  335  EEVKLLINMIPIWFFTLAFGVCATQSSTLFIKQAIIMDRHITGTSFIVPPASLFSLIALS  394

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP+LR+ATGNERG++ILQRIG+GM+FS+  M +AAL+EKKRL++ +E+
Sbjct  395  IIITVTIYEKLLVPLLRRATGNERGISILQRIGVGMVFSLFAMIIAALIEKKRLDYAKEH  454

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              + +M  S  WLAPQFL++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  455  HMNKTMTLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  514

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW+L  +TAAN+C +V+VA  YTYK 
Sbjct  515  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTAANICCFVIVAMRYTYKT  574

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  575  VQPSLAV-VADGGDD  588



>ref|XP_009143444.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.6 
[Brassica rapa]
Length=585

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 197/253 (78%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI--INGFEIPPATIYSLAAI  175
            EE KL+INM+PIWL+ L FG+C AQ +TFFIKQ   +DR +   N F IPPA+IY L AI
Sbjct  334  EETKLIINMIPIWLSVLVFGICAAQASTFFIKQATVMDRHVSGKNSFTIPPASIYCLTAI  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+ VT+YD++LVP LR+ T N+RG+ ILQR+GIGM F+V TM +AALVEKKRL+ + E
Sbjct  394  TLIMYVTVYDKLLVPFLRRNTQNQRGINILQRVGIGMFFAVITMIIAALVEKKRLDLLTE  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               +  MSVFWLAPQF+++G+ +GFTLVGLQEYFYDQVPDSMRSLGIAF LSV GA +FL
Sbjct  454  Q--NRPMSVFWLAPQFIVLGVAEGFTLVGLQEYFYDQVPDSMRSLGIAFXLSVLGAGSFL  511

Query  536  SSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            ++LLIT VD  A   S + WFGK LNSSRLD+FYWLL G+ AAN+CV+++VA+ + YK+V
Sbjct  512  NNLLITVVDSLAEDFSDKRWFGKTLNSSRLDWFYWLLAGLAAANMCVFMIVAKRFPYKSV  571

Query  713  QSKTTMAVADCDD  751
            QS   +A +   D
Sbjct  572  QSSQVLADSSVSD  584



>ref|XP_003600799.1| Peptide transporter PTR1 [Medicago truncatula]
Length=283

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 191/251 (76%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N++PIWLT+L  G+CVAQG+T F+KQ A+++ KI + F IPPA++ + AAIG 
Sbjct  32   EETKLILNVIPIWLTSLTTGICVAQGSTLFVKQAASMNLKISDSFTIPPASVSTAAAIGT  91

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV IYD+I+VP+LRK TGNERG++IL+RI IG   SV  M VAALVE KRL   ++ T
Sbjct  92   LISVPIYDKIIVPMLRKITGNERGISILRRISIGFTSSVIVMIVAALVEAKRLRMHEQET  151

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSVFWL PQ+LI+GIGD F+LVGLQEYFY QVPDSM+SLG+A YLSV G  +FLSS
Sbjct  152  ----MSVFWLVPQYLILGIGDSFSLVGLQEYFYGQVPDSMKSLGMALYLSVIGVGSFLSS  207

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LIT VD+ T ++G+SW GKD+NSSRLD FYW+L  I A NLC Y+ +A+ YTYK+VQ K
Sbjct  208  FLITIVDQVTEKNGKSWIGKDINSSRLDRFYWMLAIINALNLCAYLFLAKRYTYKSVQ-K  266

Query  722  TTMAVADCDDD  754
                   C  D
Sbjct  267  IGNETDGCKSD  277



>ref|XP_010505388.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Camelina sativa]
Length=583

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 196/239 (82%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ  T+DR I  GF +PPA+++SL A+ +
Sbjct  334  EETKLIINVIPIWLSTLAFGICATQTSTFFIKQAVTMDRHI-AGFTLPPASMFSLTALTL  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+TIY+++L+P+LR+ T N+RG+ ILQRIG GM+FS+ TM +AALVEK+RL+   +N 
Sbjct  393  IISITIYEKLLIPLLRRITRNQRGINILQRIGTGMLFSLITMIIAALVEKQRLDRTNDNN  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               ++ V WLAPQF+IIGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV G A+FL++
Sbjct  453  -KPALRVIWLAPQFIIIGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGVASFLNN  511

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            LLITAVD  A   SG+SWFGKDLNSSRLD FYW L G+TAAN+CV+V+VA+   YK+VQ
Sbjct  512  LLITAVDTLAEDFSGKSWFGKDLNSSRLDRFYWFLAGVTAANICVFVVVAKRCPYKSVQ  570



>emb|CAB88358.1| transporter-like protein [Arabidopsis thaliana]
Length=620

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 201/255 (79%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q +T FIKQ   +DR I    F +PPA+++SL A+ 
Sbjct  335  EEVKLLINMIPIWFFTLAFGVCATQSSTLFIKQAIIMDRHITGTSFIVPPASLFSLIALS  394

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP+LR+ATGNERG++ILQRIG+GM+FS+  M +AAL+EKKRL++ +E+
Sbjct  395  IIITVTIYEKLLVPLLRRATGNERGISILQRIGVGMVFSLFAMIIAALIEKKRLDYAKEH  454

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              + +M  S  WLAPQFL++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  455  HMNKTMTLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  514

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW+L  +TAAN+C +V+VA  YTYK 
Sbjct  515  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTAANICCFVIVAMRYTYKT  574

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  575  VQPSLAV-VADGGDD  588



>ref|XP_010504184.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Camelina sativa]
Length=605

 Score =   325 bits (832),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 197/255 (77%), Gaps = 4/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR+II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSGTLFIKQAMIMDRQIIGTNFIVPPASLFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+L +ATGNERG++ILQRIG GM+FS+  M +AALVEKKRL++ +E+
Sbjct  396  IIITVTIYERVLVPLLIRATGNERGISILQRIGTGMVFSLIAMIIAALVEKKRLDYAKEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV G+A+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGSASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLIT  D  A   SG+ WFGKDLNSSRLD FYW+L  +T AN+C +V+VA  YTYK+
Sbjct  516  ANNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTGANMCFFVMVAMKYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    +     DDD
Sbjct  576  VQPSLAVVADRGDDD  590



>ref|XP_010515904.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Camelina sativa]
Length=602

 Score =   324 bits (831),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 200/255 (78%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSTTLFIKQAIIMDRHIIGTKFIVPPASMFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+LR+ATGNERG++ILQRIG GM+FS+  M +AAL+EKKRL++ +E+
Sbjct  396  IIITVTIYERVLVPLLRRATGNERGISILQRIGTGMVFSLFAMIIAALIEKKRLDYAKEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLIT  D  A   SG+ WFGKDL++SRLD FYW+L  +TAAN+C +V+VA  YTYK+
Sbjct  516  ANNLLITVSDHLAEEISGKGWFGKDLSTSRLDRFYWMLAALTAANICFFVIVAMRYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  576  VQPSLAV-VADGGDD  589



>gb|KFK36688.1| hypothetical protein AALP_AA4G156500, partial [Arabis alpina]
Length=543

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 194/239 (81%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ   +DR I   F IPPA+++SL A+ +
Sbjct  289  EEAKLIINVIPIWLSTLAFGICATQTSTFFIKQSVLMDRHINKSFTIPPASMFSLTALSL  348

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+ +Y++++VP+LR+ TGN+RG++ILQRIG GMIFS+ TM +AALVEK+RL+  + N 
Sbjct  349  IISIILYEKLIVPLLRRVTGNQRGISILQRIGTGMIFSLITMVIAALVEKQRLDRTENN-  407

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WLAPQF+IIGIGD FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL++
Sbjct  408  --KPMSVIWLAPQFIIIGIGDAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASFLNN  465

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            LLIT VD  A   S +SWFGK+LN+SRLD FYWLL G+TAAN+CV+V+VA+    K VQ
Sbjct  466  LLITIVDTIADDFSVKSWFGKNLNTSRLDRFYWLLAGVTAANICVFVIVAKRCPDKTVQ  524



>ref|XP_004308908.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Fragaria vesca subsp. vesca]
Length=595

 Score =   324 bits (830),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 196/258 (76%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++NM+PIWLT LP  +C+AQ +TFF+KQ AT++R I N F+IPPA+I+SL AI M
Sbjct  343  EELKLILNMIPIWLTLLPNTVCLAQASTFFVKQAATMNRNITNDFKIPPASIFSLGAIAM  402

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VSV +YD++LVP+LRKATGNERG+ IL RIG+GMI  V  MAV ALVE+KRL +     
Sbjct  403  LVSVMVYDKVLVPMLRKATGNERGMNILHRIGVGMILVVIAMAVTALVERKRLQYAD---  459

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSVFWLAPQ++I+GIGD F LVGLQEYFYDQVPDSMRSLG+A YLSV G  +FLSS
Sbjct  460  -PQAMSVFWLAPQYIILGIGDAFALVGLQEYFYDQVPDSMRSLGVALYLSVIGVGSFLSS  518

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI+ +D  TA+ GRSWFGKDL+ SRLD F+WLL  +   NLCVY   AR YTYKNV  +
Sbjct  519  FLISVLDHVTAKYGRSWFGKDLSGSRLDNFFWLLAALNGLNLCVYGYFARGYTYKNVDRR  578

Query  722  TTMAVADCDDDGGRDAMV  775
              +A+ D     G D  +
Sbjct  579  --VALGDHSVRNGNDQSI  594



>ref|XP_009116086.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Brassica rapa]
 emb|CDY54030.1| BnaA09g54940D [Brassica napus]
Length=582

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 199/253 (79%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIW  TL FG+C  Q  TFFIKQ   +DR I + F +PP+++++L A+ M
Sbjct  333  EELKLLINMIPIWFFTLAFGICATQSTTFFIKQAIIMDRHIGHNFIVPPSSMFALVALSM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SVT+Y++ILVP+ R+ TG ERG++ILQRIG GM+FS+  M +AALVE+KRL++ +++ 
Sbjct  393  IISVTVYEKILVPLSRRLTGKERGISILQRIGTGMVFSLLAMIIAALVERKRLDYTKQHH  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                M+V WLAPQF++IGI D FTLVGLQEYFYDQVPDSMRSLGI  YLSV GAA+F+++
Sbjct  453  I--PMNVIWLAPQFIVIGIADAFTLVGLQEYFYDQVPDSMRSLGIGLYLSVVGAASFVNN  510

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A   SG++ FGKDLNSSRLD FYW L  +TAAN+C +V VAR YTYK+VQS
Sbjct  511  LLMTVTDRLAEEISGKTLFGKDLNSSRLDRFYWTLAALTAANICFFVFVARRYTYKSVQS  570

Query  719  KTTMAVADCDDDG  757
              ++ VAD  DDG
Sbjct  571  --SVVVADGGDDG  581



>ref|XP_009133215.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Brassica rapa]
Length=584

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 194/241 (80%), Gaps = 6/241 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII--NGFEIPPATIYSLAAI  175
            EE KL+IN++PIW +TL FG+C  Q  TFFIKQ A +DR I   N F +PPA+++SL A+
Sbjct  334  EEAKLIINVIPIWFSTLVFGICATQTNTFFIKQAAIMDRHIAGNNSFTVPPASMFSLTAL  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+S+TIYD+ILV +LR+ T N+RG+ ILQRIG GM+FS+TTM +AALVEKKRL+  + 
Sbjct  394  SLIISLTIYDKILVALLRRVTRNQRGINILQRIGTGMLFSLTTMIIAALVEKKRLDRSEN  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            N   + MSV WLAPQF++IG+ D FTLVGLQEYFYDQVPDSMRSLGIA YLSV GAA+FL
Sbjct  454  N---EPMSVIWLAPQFIVIGVADAFTLVGLQEYFYDQVPDSMRSLGIAIYLSVLGAASFL  510

Query  536  SSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            ++LLITAVD  A   S +SWFGKDLNSSRLD FYW L G+TAAN+CV+V+VA+   YK+V
Sbjct  511  NNLLITAVDTLADDFSAKSWFGKDLNSSRLDRFYWFLAGVTAANICVFVVVAKRCPYKSV  570

Query  713  Q  715
            Q
Sbjct  571  Q  571



>ref|XP_010515905.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X1 [Camelina 
sativa]
Length=605

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 196/255 (77%), Gaps = 4/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   ++R+II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSGTLFIKQAMIMERQIIGTNFIVPPASLFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+L +ATGNERG++ILQRIG GM+FS+  M +AALVEKKRL++ +E+
Sbjct  396  IIITVTIYERVLVPLLIRATGNERGISILQRIGTGMVFSLIAMIIAALVEKKRLDYAKEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLI   D  A   SG+ WFGKDLNSSRLD FYW+L  +T AN+C +V+VA  YTYK+
Sbjct  516  ANNLLIVVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTGANMCFFVMVAMKYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    +     DDD
Sbjct  576  VQPSLAVVADRGDDD  590



>ref|XP_010515906.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X2 [Camelina 
sativa]
Length=605

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 196/255 (77%), Gaps = 4/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   ++R+II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSGTLFIKQAMIMERQIIGTNFIVPPASLFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+L +ATGNERG++ILQRIG GM+FS+  M +AALVEKKRL++ +E+
Sbjct  396  IIITVTIYERVLVPLLIRATGNERGISILQRIGTGMVFSLIAMIIAALVEKKRLDYAKEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLI   D  A   SG+ WFGKDLNSSRLD FYW+L  +T AN+C +V+VA  YTYK+
Sbjct  516  ANNLLIVVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTGANMCFFVMVAMKYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    +     DDD
Sbjct  576  VQPSLAVVADRGDDD  590



>ref|XP_002877949.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54208.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=602

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 199/255 (78%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q +T FIKQ   +DR I    F +PPA+++SL A+ 
Sbjct  335  EEVKLLINMIPIWFFTLAFGVCATQSSTLFIKQAIIMDRHITGTSFIVPPASLFSLIALS  394

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP+LR ATGNERG++ILQRIGIGM+FS+  M +AAL+EKKRL++ +E+
Sbjct  395  IIITVTIYEKLLVPLLRPATGNERGISILQRIGIGMVFSLFAMIIAALIEKKRLDYAKEH  454

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQFL++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  455  HMSKTMTLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  514

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW+L  +TAAN+  +V+VA  YTYK+
Sbjct  515  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWMLAALTAANIFCFVIVAMRYTYKS  574

Query  710  VQSKTTMAVADCDDD  754
            VQ    + V D  DD
Sbjct  575  VQPSLAV-VPDSGDD  588



>ref|XP_008372883.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Malus domestica]
Length=594

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 191/250 (76%), Gaps = 6/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+ NM+PIW+T++PFG+CVAQ  TFF+KQ AT++  I + F+IPPA I SLAAI M
Sbjct  341  EEVKLLFNMIPIWITSIPFGLCVAQAPTFFVKQAATMNLNITDNFKIPPAAINSLAAIAM  400

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV +YD++LVPVL+K  GNERG+TILQRIG+GM+FS  +M  AAL E KRL       
Sbjct  401  LISVAVYDKVLVPVLKKINGNERGMTILQRIGVGMVFSTASMTAAALAETKRLGV----H  456

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               S+SV WLAPQ++I+G GDGFTLVGLQEYFYD+VPD+MRS+GIA YLSV G  +F+SS
Sbjct  457  NPKSLSVLWLAPQYIILGFGDGFTLVGLQEYFYDEVPDNMRSIGIALYLSVIGTGSFISS  516

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI AVD  T ++G+SWFGKDL SSRLD FYWLL  + A N   +V V+  YTYKNV+ +
Sbjct  517  FLIMAVDGITGKAGKSWFGKDLRSSRLDNFYWLLAAVNAVNFFAHVWVSIRYTYKNVERR  576

Query  722  TTMA--VADC  745
              +   V++C
Sbjct  577  RVVPDNVSEC  586



>ref|XP_006290774.1| hypothetical protein CARUB_v10016879mg [Capsella rubella]
 gb|EOA23672.1| hypothetical protein CARUB_v10016879mg [Capsella rubella]
Length=602

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 197/255 (77%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGICATQSTTLFIKQAIIMDRHIIGTKFIVPPASMFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP  R+ATGNERG++ILQRIG GM+FS+  M +AAL+E KRL++ +++
Sbjct  396  IILTVTIYEKLLVPFFRRATGNERGISILQRIGTGMVFSLFAMIIAALIENKRLDYAKQH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW L  +TAAN+C +V+VA  YTYK+
Sbjct  516  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWTLAALTAANICFFVIVAMRYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  576  VQPSLAV-VADGGDD  589



>ref|XP_006290773.1| hypothetical protein CARUB_v10016879mg [Capsella rubella]
 gb|EOA23671.1| hypothetical protein CARUB_v10016879mg [Capsella rubella]
Length=594

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 197/255 (77%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGICATQSTTLFIKQAIIMDRHIIGTKFIVPPASMFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+++LVP  R+ATGNERG++ILQRIG GM+FS+  M +AAL+E KRL++ +++
Sbjct  396  IILTVTIYEKLLVPFFRRATGNERGISILQRIGTGMVFSLFAMIIAALIENKRLDYAKQH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            +++LLIT  D  A   SG+ WFGKDLNSSRLD FYW L  +TAAN+C +V+VA  YTYK+
Sbjct  516  VNNLLITVSDHLAEEISGKGWFGKDLNSSRLDRFYWTLAALTAANICFFVIVAMRYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  576  VQPSLAV-VADGGDD  589



>ref|XP_010427059.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like [Camelina sativa]
Length=604

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 196/255 (77%), Gaps = 4/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  +  T FIKQ   +DR+II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATRSGTLFIKQAMIMDRRIIGTTFIVPPASLFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+L +ATGNERG++ILQRIG GM+FS+  M +AALVEKKRL++ +++
Sbjct  396  IIITVTIYERVLVPLLIRATGNERGISILQRIGTGMVFSLIAMIIAALVEKKRLDYTKQH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQFL++G+ D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLIT  D  A   SG+ WFGKDLNSS LD FYW+L  +T AN+C +V+VA  YTYK+
Sbjct  516  ANNLLITVSDHLAEEISGKGWFGKDLNSSHLDRFYWMLAALTGANMCFFVMVAMKYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    +     DDD
Sbjct  576  VQPGFAVVADRGDDD  590



>ref|XP_010504182.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7 [Camelina sativa]
Length=602

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 197/255 (77%), Gaps = 5/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIW  TL FG+C  Q  T FIKQ   +DR II   F +PPA+++SL A+ 
Sbjct  336  EEVKLLINMIPIWFFTLAFGVCATQSTTLFIKQAIIMDRHIIGTKFIVPPASMFSLVALS  395

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            +I++VTIY+R+LVP+LR+AT NERG++ILQRIG GM+FS+  M +AAL+EKKRL++  E+
Sbjct  396  IIITVTIYERVLVPLLRRATRNERGISILQRIGTGMVFSLFAMIIAALIEKKRLDYAMEH  455

Query  359  TTSDSM--SVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
              S +M  S  WLAPQF+++GI D FTLVGLQEYFYDQVP SMRSLGIAFYLSV GAA+F
Sbjct  456  HMSKTMTLSAIWLAPQFIVLGIADAFTLVGLQEYFYDQVPGSMRSLGIAFYLSVLGAASF  515

Query  533  LSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
             ++LLIT  D  A   SG+ WFGKDLN+SRLD FYW+L  +TAAN+C +V+VA  YTYK+
Sbjct  516  ANNLLITISDHLAEEISGKGWFGKDLNTSRLDRFYWMLAALTAANICFFVIVAMRYTYKS  575

Query  710  VQSKTTMAVADCDDD  754
            VQ    + VAD  DD
Sbjct  576  VQPSLAV-VADGGDD  589



>ref|XP_002881551.1| hypothetical protein ARALYDRAFT_482796 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57810.1| hypothetical protein ARALYDRAFT_482796 [Arabidopsis lyrata subsp. 
lyrata]
Length=582

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 200/252 (79%), Gaps = 9/252 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  QG+TFFIKQ  T+DR I  GF++PPA +++L A+ +
Sbjct  334  EETKLIINVIPIWLSTLAFGICATQGSTFFIKQAMTMDRHI-AGFKLPPAAMFTLTALTL  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+T+Y++ILVP+LR  T N+RG+ ILQRIGIGM+FS+ TM +AALVEK+RL+    N 
Sbjct  393  IISLTLYEKILVPILRSITQNQRGINILQRIGIGMVFSLITMIIAALVEKQRLD--STNN  450

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
             +  MSV WLAPQF++IG  D FTLVGLQEYFY QVPDSMRSLGIA YLSV G A+FL++
Sbjct  451  NNKPMSVTWLAPQFMVIGFADAFTLVGLQEYFYHQVPDSMRSLGIALYLSVIGVASFLNN  510

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ-  715
            LLITA+D  A   SG+SWFGKDLNSSRLD FYW L G+ +AN+CV+V+VA+   +K+VQ 
Sbjct  511  LLITAIDTLAEDFSGKSWFGKDLNSSRLDRFYWFLAGVISANICVFVIVAKRCPFKSVQP  570

Query  716  ----SKTTMAVA  739
                + ++M+VA
Sbjct  571  SQGSADSSMSVA  582



>ref|XP_010553272.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010553273.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7 isoform X2 [Tarenaya 
hassleriana]
Length=546

 Score =   317 bits (811),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 195/257 (76%), Gaps = 9/257 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIWL+TL FG+C AQ  TFFIKQ   LDR+II + F +PPA++  L A+ 
Sbjct  273  EEVKLIINMIPIWLSTLAFGICAAQTTTFFIKQAIVLDRRIIGHSFIVPPASMLCLTALA  332

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MI+SVTIY++ILVP+LR+ TGN RG++ILQR+G GMIFS+ TM +AALVEKKRL+     
Sbjct  333  MIISVTIYEKILVPMLRRITGNARGISILQRVGTGMIFSLITMIIAALVEKKRLDTTARG  392

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            +    MS  WLAPQF++IG+ D +TLVGLQE+FYDQVPD MRSLGIAFYLSV GAA+F +
Sbjct  393  SVP--MSAIWLAPQFIVIGVADSYTLVGLQEFFYDQVPDLMRSLGIAFYLSVIGAASFAN  450

Query  539  SLLITAVDRATAR-SGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            +LLIT VD      SG+SWFGKDLN SRLD FYWLL G+TAAN+ V+  +A  Y+YKNVQ
Sbjct  451  NLLITVVDHLGEDISGKSWFGKDLNGSRLDRFYWLLAGLTAANIFVFAALASRYSYKNVQ  510

Query  716  SKTTMAVADCDDDGGRD  766
                +      D  GRD
Sbjct  511  QNMVIV-----DSYGRD  522



>ref|NP_181326.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|P0CI03.1|PTR28_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.6; Short=AtNPF5.6 [Arabidopsis 
thaliana]
 gb|AEC09463.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=575

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIW +TL FG+C  Q +TFFIKQ  T+DR I  GF +PPA++++L A+ +
Sbjct  335  EETKLIINVIPIWFSTLAFGICATQASTFFIKQAITMDRHI-GGFTVPPASMFTLTALTL  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+T+Y+++LVP+LR  T N+RG+ ILQRIG GMIFS+ TM +AALVEK+RL+    N 
Sbjct  394  IISLTVYEKLLVPLLRSITRNQRGINILQRIGTGMIFSLITMIIAALVEKQRLDRTNNN-  452

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WLAPQF++IG  D FTLVGLQEYFY QVPDSMRSLGIAFYLSV GAA+FL++
Sbjct  453  --KPMSVIWLAPQFMVIGFADAFTLVGLQEYFYHQVPDSMRSLGIAFYLSVIGAASFLNN  510

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            LLITAVD  A   SG+SWFGKDLNSSRLD FYW L G+ AAN+CV+V+VA+   YK+VQ
Sbjct  511  LLITAVDTLAENFSGKSWFGKDLNSSRLDRFYWFLAGVIAANICVFVIVAKRCPYKSVQ  569



>ref|XP_010923254.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Elaeis guineensis]
Length=606

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 182/224 (81%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIWL +LPFG+C+AQ +TFF+KQG+ +DRK+   FEIP A+IYSL+A+GM
Sbjct  339  EEAKLVLAMVPIWLFSLPFGICLAQASTFFVKQGSIMDRKLSRSFEIPAASIYSLSAMGM  398

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV  YD+ILVP LR+ATG+ERG++IL+RIGIGM+FSV  M VAA+VE KRL       
Sbjct  399  IISVCFYDKILVPFLRRATGDERGISILRRIGIGMVFSVLAMIVAAIVESKRLKAAPGEQ  458

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSVFWLAPQF+I+G+GDGFTLVGLQEYFYDQVPD+MRSLGIAFYLSV G +NFLSS
Sbjct  459  A--EMSVFWLAPQFIILGVGDGFTLVGLQEYFYDQVPDNMRSLGIAFYLSVIGVSNFLSS  516

Query  542  LLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLC  670
            LLIT VD  T + GR+ WF +DLN SRLD FYWLL  + A +LC
Sbjct  517  LLITVVDHVTEKGGRAGWFARDLNKSRLDLFYWLLAVMDALSLC  560



>ref|XP_004503208.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cicer arietinum]
Length=581

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/257 (59%), Positives = 190/257 (74%), Gaps = 8/257 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWLT+L  G+CVAQG+T F+KQ A+++ K+ + F IPPA++ S AA G 
Sbjct  332  EETKLIINIIPIWLTSLTTGICVAQGSTLFVKQAASMNLKLSDNFTIPPASVSSAAAFGT  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ V IYD+I+VP +RK TGNERG++IL+RI IG+ FS+  M VAAL+E KRL       
Sbjct  392  IICVPIYDKIIVPFMRKVTGNERGISILRRISIGLTFSIILMIVAALIEAKRLKM-----  446

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               SMSVFWL PQ+LI+G GD F+LVGLQEYFYDQVPDSMRSLG+A YLSV G  +FLSS
Sbjct  447  -QKSMSVFWLVPQYLILGFGDAFSLVGLQEYFYDQVPDSMRSLGMALYLSVIGVGSFLSS  505

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LIT VD  T ++G+SW GKD+NSSRLD FYW+L  I A NLCVY+ +A+ YTYK+V   
Sbjct  506  FLITIVDHVTKKNGKSWIGKDINSSRLDKFYWMLAVINALNLCVYIFLAKRYTYKSVH--  563

Query  722  TTMAVADCDDDGGRDAM  772
             T    D    GG + M
Sbjct  564  LTNNEIDGSKSGGEEMM  580



>ref|XP_009419917.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   317 bits (811),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 186/242 (77%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL++ MVPIWLT LP G+C++Q ATFFIKQ +T++R +   FEIP A++Y+ +AI M
Sbjct  341  EELKLILAMVPIWLTALPLGICISQTATFFIKQASTMNRSLGGSFEIPAASVYAFSAIAM  400

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQ-EN  358
            I+SVT YD IL P LR+ATG ERG++IL+RIGIG  FSV  M  AALVE+KRL   + E 
Sbjct  401  IISVTFYDTILEPSLRRATGRERGISILKRIGIGFAFSVAAMVSAALVERKRLRVAEAEQ  460

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            ++  SMSVFWL PQF+I+G GDGF LVG+QEYFYDQVPD MRSLGI FYLSV G +NFLS
Sbjct  461  SSVISMSVFWLVPQFMIMGFGDGFALVGMQEYFYDQVPDGMRSLGIGFYLSVFGVSNFLS  520

Query  539  SLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            SLLIT VD  T+R  + SWF KDL  SRLD +YWL+  ++A NLC YV +A  Y+YK VQ
Sbjct  521  SLLITVVDHITSRGEKGSWFAKDLIRSRLDCYYWLISAMSAVNLCGYVYIATRYSYKRVQ  580

Query  716  SK  721
             K
Sbjct  581  RK  582



>ref|XP_010553271.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 isoform X1 [Tarenaya 
hassleriana]
Length=610

 Score =   317 bits (812),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 195/257 (76%), Gaps = 9/257 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII-NGFEIPPATIYSLAAIG  178
            EE+KL+INM+PIWL+TL FG+C AQ  TFFIKQ   LDR+II + F +PPA++  L A+ 
Sbjct  337  EEVKLIINMIPIWLSTLAFGICAAQTTTFFIKQAIVLDRRIIGHSFIVPPASMLCLTALA  396

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            MI+SVTIY++ILVP+LR+ TGN RG++ILQR+G GMIFS+ TM +AALVEKKRL+     
Sbjct  397  MIISVTIYEKILVPMLRRITGNARGISILQRVGTGMIFSLITMIIAALVEKKRLDTTARG  456

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
            +    MS  WLAPQF++IG+ D +TLVGLQE+FYDQVPD MRSLGIAFYLSV GAA+F +
Sbjct  457  SVP--MSAIWLAPQFIVIGVADSYTLVGLQEFFYDQVPDLMRSLGIAFYLSVIGAASFAN  514

Query  539  SLLITAVDRATAR-SGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            +LLIT VD      SG+SWFGKDLN SRLD FYWLL G+TAAN+ V+  +A  Y+YKNVQ
Sbjct  515  NLLITVVDHLGEDISGKSWFGKDLNGSRLDRFYWLLAGLTAANIFVFAALASRYSYKNVQ  574

Query  716  SKTTMAVADCDDDGGRD  766
                +      D  GRD
Sbjct  575  QNMVIV-----DSYGRD  586



>gb|EEC76434.1| hypothetical protein OsI_14122 [Oryza sativa Indica Group]
Length=585

 Score =   314 bits (804),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 192/257 (75%), Gaps = 11/257 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFG+  AQ +TFFIKQG+ +DR++   F +PPA+ +++AAIGM
Sbjct  326  EETKLVLAMVPIWVATLPFGITAAQVSTFFIKQGSVMDRRMGPHFTLPPASTFAMAAIGM  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV+V +YD++L P LR+ TG ERGL+IL+RIG+G+ F++  MAVAA VE++RL     + 
Sbjct  386  IVAVAVYDKVLEPYLRRLTGGERGLSILKRIGVGIAFTIVAMAVAATVERRRLR----SA  441

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            +  SMSVFWL PQFL++GIGDGF LVGLQEYFYDQVPDSMRSLGI  YLSV GA +FLSS
Sbjct  442  SPASMSVFWLVPQFLLMGIGDGFALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAGSFLSS  501

Query  542  LLITAVDRATARSGRS--WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             LITAVDR T+  G +  WFGKDLNSSRLD FYWLL  I  ANL  YV+VA  Y+Y    
Sbjct  502  QLITAVDRVTSHGGGAAGWFGKDLNSSRLDLFYWLLACIGVANLVFYVVVATRYSY----  557

Query  716  SKTTMAVADCDDDGGRD  766
             KT MA     DD   D
Sbjct  558  -KTVMAGGKVVDDKAGD  573



>ref|XP_006591363.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=584

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 190/252 (75%), Gaps = 4/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+CV QG T F+KQ A  + +I + F+IPPA++ S+AA+G 
Sbjct  332  EETKLVLNIIPIWLTSLTIGVCVGQGQTLFVKQAAATNLEISDSFKIPPASMASVAAVGT  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDRI+VP+LRK TGNERG+ IL+RIGIGM  SV  M VAALVEKKRL  +    
Sbjct  392  LIAVPIYDRIVVPILRKVTGNERGINILRRIGIGMTLSVILMVVAALVEKKRLRLM---V  448

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
              ++MSV WL PQ+LI+G+GD F+LVGLQEYFYD+VPDSMRS+G+A YLSV G   FLSS
Sbjct  449  GHETMSVLWLIPQYLILGVGDSFSLVGLQEYFYDEVPDSMRSIGMALYLSVLGVGFFLSS  508

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A  LCV++LV++ YTYK VQ +
Sbjct  509  FLIIIVEHVTGKTGKSWIGKDINSSRLDKFYWMLAVINAFVLCVFLLVSKRYTYKTVQRR  568

Query  722  TTMAVADCDDDG  757
              M    C  DG
Sbjct  569  -AMETDSCKSDG  579



>gb|KHN17876.1| Putative peptide/nitrate transporter, partial [Glycine soja]
Length=596

 Score =   313 bits (803),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 190/252 (75%), Gaps = 4/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+CV QG T F+KQ A  + +I + F+IPPA++ S+AA+G 
Sbjct  344  EETKLVLNIIPIWLTSLTIGVCVGQGQTLFVKQAAATNLEISDSFKIPPASMASVAAVGT  403

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDRI+VP+LRK TGNERG+ IL+RIGIGM  SV  M VAALVEKKRL  +    
Sbjct  404  LIAVPIYDRIVVPILRKVTGNERGINILRRIGIGMTLSVILMVVAALVEKKRLRLM---V  460

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
              ++MSV WL PQ+LI+G+GD F+LVGLQEYFYD+VPDSMRS+G+A YLSV G   FLSS
Sbjct  461  GHETMSVLWLIPQYLILGVGDSFSLVGLQEYFYDEVPDSMRSIGMALYLSVLGVGFFLSS  520

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A  LCV++LV++ YTYK VQ +
Sbjct  521  FLIIIVEHVTGKTGKSWIGKDINSSRLDKFYWMLAVINAFVLCVFLLVSKRYTYKTVQRR  580

Query  722  TTMAVADCDDDG  757
              M    C  DG
Sbjct  581  -AMETDSCKSDG  591



>ref|NP_001051743.1| Os03g0823500 [Oryza sativa Japonica Group]
 gb|AAO18439.1| putative peptide transport protein [Oryza sativa Japonica Group]
 gb|ABF99617.1| POT family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF13657.1| Os03g0823500 [Oryza sativa Japonica Group]
 gb|EAZ29112.1| hypothetical protein OsJ_13171 [Oryza sativa Japonica Group]
 dbj|BAG93987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   313 bits (801),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 192/257 (75%), Gaps = 11/257 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFG+  AQ +TFFIKQG+ +DR++   F +PPA+ +++AAIGM
Sbjct  326  EETKLVLAMVPIWVATLPFGITAAQVSTFFIKQGSVMDRRMGPHFTLPPASTFAMAAIGM  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV+V +YD++L P LR+ TG ERGL+IL+RIG+G+ F++  MAVAA VE++RL     + 
Sbjct  386  IVAVAVYDKVLEPYLRRLTGGERGLSILKRIGVGIAFTIVAMAVAATVERQRLR----SA  441

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            +  SMSVFWL PQFL++GIGDGF LVGLQEYFYDQVPDSMRSLGI  YLSV GA +FLSS
Sbjct  442  SPASMSVFWLVPQFLLMGIGDGFALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAGSFLSS  501

Query  542  LLITAVDRATARSGRS--WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             LITAVDR T+  G +  WFGKDLNSSRLD FYWLL  I  ANL  YV++A  Y+Y    
Sbjct  502  QLITAVDRVTSHGGAAAGWFGKDLNSSRLDLFYWLLACIGVANLVFYVVIATRYSY----  557

Query  716  SKTTMAVADCDDDGGRD  766
             KT MA     DD   D
Sbjct  558  -KTVMAGGKVVDDKAGD  573



>ref|XP_006591796.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Glycine max]
Length=576

 Score =   312 bits (800),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 191/253 (75%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N+VPIWLT+L  G+C AQ +T F+KQ  T++ K+   F +PPA++ S+AAIG+
Sbjct  323  EETKLVLNVVPIWLTSLTTGVCWAQASTLFVKQATTMNLKMTESFTLPPASLVSVAAIGV  382

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDR++VP+LRK TGNERG++IL+RI IGM FSV  M  AALVE KRL  V + T
Sbjct  383  LISLPIYDRVIVPILRKVTGNERGISILRRISIGMTFSVIVMVAAALVEAKRLRIVGQRT  442

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GI + F+LVGLQEYFYDQVPDSMRS+G+A YLSV+G  NFLSS
Sbjct  443  ----MSVMWLIPQYLILGIANSFSLVGLQEYFYDQVPDSMRSIGMALYLSVTGVGNFLSS  498

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A +LC ++ +AR+YTYK VQ +
Sbjct  499  FLIIIVNHVTGKNGKSWIGKDINSSRLDRFYWMLAVINALDLCAFLFLARSYTYKTVQRR  558

Query  722  TTMAVADCDDDGG  760
             TM    C+   G
Sbjct  559  -TMDTDGCNKSDG  570



>gb|AES71051.2| peptide/nitrate transporter plant [Medicago truncatula]
Length=581

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 191/251 (76%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N++PIWLT+L  G+CVAQG+T F+KQ A+++ KI + F IPPA++ + AAIG 
Sbjct  330  EETKLILNVIPIWLTSLTTGICVAQGSTLFVKQAASMNLKISDSFTIPPASVSTAAAIGT  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV IYD+I+VP+LRK TGNERG++IL+RI IG   SV  M VAALVE KRL   ++ T
Sbjct  390  LISVPIYDKIIVPMLRKITGNERGISILRRISIGFTSSVIVMIVAALVEAKRLRMHEQET  449

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSVFWL PQ+LI+GIGD F+LVGLQEYFY QVPDSM+SLG+A YLSV G  +FLSS
Sbjct  450  ----MSVFWLVPQYLILGIGDSFSLVGLQEYFYGQVPDSMKSLGMALYLSVIGVGSFLSS  505

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LIT VD+ T ++G+SW GKD+NSSRLD FYW+L  I A NLC Y+ +A+ YTYK+VQ K
Sbjct  506  FLITIVDQVTEKNGKSWIGKDINSSRLDRFYWMLAIINALNLCAYLFLAKRYTYKSVQ-K  564

Query  722  TTMAVADCDDD  754
                   C  D
Sbjct  565  IGNETDGCKSD  575



>ref|XP_006591795.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Glycine max]
Length=576

 Score =   310 bits (794),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 190/253 (75%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N+VPIWLT+L  G+C AQ +T F+KQ  T++ K+   F +PPA++ S+AAIG+
Sbjct  323  EETKLVLNVVPIWLTSLTTGVCWAQASTLFVKQATTMNLKMTESFTLPPASLVSVAAIGV  382

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDR++VP+LRK TGNERG++IL+RI IGM FSV  M  AALVE KRL  V + T
Sbjct  383  LISLPIYDRVIVPILRKVTGNERGISILRRISIGMTFSVIVMVAAALVEAKRLRIVGQRT  442

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GI + F+LVGLQEYFYDQVPDSMRS+G+A YLSV G  NFLSS
Sbjct  443  ----MSVMWLIPQYLILGIANSFSLVGLQEYFYDQVPDSMRSIGMALYLSVIGVGNFLSS  498

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A +LC ++ +A +YTYK VQ +
Sbjct  499  FLIIIVNHVTGKNGKSWIGKDINSSRLDRFYWMLAVINALDLCAFLFLASSYTYKTVQ-R  557

Query  722  TTMAVADCDDDGG  760
            TTM    C+   G
Sbjct  558  TTMDTDGCNKSDG  570



>ref|XP_010691634.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   310 bits (795),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 191/255 (75%), Gaps = 6/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+I M+PIWLT L FG+ +AQG+TFFIKQG+ +DR+I   FEIP A++Y+L A+GM
Sbjct  346  EELKLIITMIPIWLTCLVFGIGIAQGSTFFIKQGSAMDRRIFKNFEIPAASVYTLTAVGM  405

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I SV  YD++L+P LR++TGNERG+ IL RIGIGM+  + +M ++ALVE+ RL   + + 
Sbjct  406  ITSVAFYDKVLLPYLRRSTGNERGINILTRIGIGMVILIISMMISALVERARL---KASL  462

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                + VFWLAPQFL+IGIGDGF+LVG+QEYFYDQVPDSMRSLG+AFYLS  G  +FLS+
Sbjct  463  QGKIIHVFWLAPQFLVIGIGDGFSLVGMQEYFYDQVPDSMRSLGMAFYLSTIGVGSFLST  522

Query  542  LLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LI  VD  T  + G+ W GKDLN SRLDYFYWLL  I   N+ V+V + +NY YKNV  
Sbjct  523  FLIIMVDSITGMKGGKIWIGKDLNHSRLDYFYWLLMIIFVLNIFVFVFLVKNYKYKNVHR  582

Query  719  KTTMAVADCDDDGGR  763
              ++AV D  +D  +
Sbjct  583  --SVAVGDSGEDDKK  595



>ref|XP_006410988.1| hypothetical protein EUTSA_v10016423mg [Eutrema salsugineum]
 gb|ESQ52441.1| hypothetical protein EUTSA_v10016423mg [Eutrema salsugineum]
Length=583

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 193/241 (80%), Gaps = 6/241 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKII--NGFEIPPATIYSLAAI  175
            EE KL+I+++PIWL+TL FG+C AQ  TFFIKQ   +DR I   + F +PPA+++SL A+
Sbjct  335  EEAKLIIHVIPIWLSTLAFGICAAQTTTFFIKQAIIMDRHIAGNSSFTVPPASMFSLTAL  394

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+S+T+YD++L+P+LR+ T N+RG+ ILQRIG GM+FS+ TM +AALVEK+RL+  + 
Sbjct  395  ALIISITLYDKLLLPLLRRITRNQRGINILQRIGTGMVFSIITMVIAALVEKQRLDRTEN  454

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            N T   +SV WLAPQF++IGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+FL
Sbjct  455  NKT---LSVIWLAPQFIVIGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFL  511

Query  536  SSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            ++LLITAVD  A   S +SWFGKDLNSSRLD FYW L  + AAN+CV+V+VA+   YK V
Sbjct  512  NNLLITAVDTLAEDFSAKSWFGKDLNSSRLDRFYWFLASVMAANICVFVVVAKRCPYKTV  571

Query  713  Q  715
            Q
Sbjct  572  Q  572



>gb|KHN17878.1| Putative peptide/nitrate transporter [Glycine soja]
Length=572

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 189/253 (75%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N+VPIWLT+L  G+C AQ +T F+KQ  T++ K+   F +PPA++ S+AAIG+
Sbjct  319  EETKLVLNVVPIWLTSLTTGVCWAQASTLFVKQATTMNLKMTESFTLPPASLVSVAAIGV  378

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDR++VP+L K TGNERG++IL+RI IGM FSV  M  AALVE KRL  V + T
Sbjct  379  LISLPIYDRVIVPILSKVTGNERGISILRRISIGMTFSVIVMVAAALVEAKRLRIVGQRT  438

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GI + F+LVGLQEYFYDQVPDSMRS+G+A YLSV G  NFLSS
Sbjct  439  ----MSVMWLIPQYLILGIANSFSLVGLQEYFYDQVPDSMRSIGMALYLSVIGVGNFLSS  494

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A +LC ++ +AR+YTYK VQ +
Sbjct  495  FLIIIVNHVTGKNGKSWIGKDINSSRLDRFYWMLAVINALDLCAFLFLARSYTYKTVQRR  554

Query  722  TTMAVADCDDDGG  760
             TM    C+   G
Sbjct  555  -TMDTDGCNKSDG  566



>ref|XP_007163476.1| hypothetical protein PHAVU_001G2373000g, partial [Phaseolus vulgaris]
 gb|ESW35470.1| hypothetical protein PHAVU_001G2373000g, partial [Phaseolus vulgaris]
Length=301

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 184/258 (71%), Gaps = 7/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLVIN+VPIWLT+L  G+CVAQG T F+KQ A ++ +I + F+IP A++ S++A+G 
Sbjct  40   EETKLVINLVPIWLTSLTVGVCVAQGTTLFVKQAAAMNLRISDNFKIPAASMSSISAVGT  99

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            ++ V IYDRI+VP+LRK TGNERG+ IL RI IGM   V  M VAA+VE KRL     + 
Sbjct  100  LIIVPIYDRIIVPILRKVTGNERGINILTRISIGMALFVILMVVAAIVEAKRLRMATHDA  159

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  +SMSV WL PQ+LI+G G+ F++VGLQEYFYDQVPD+MRSLG+  YLSV G 
Sbjct  160  LSVWETDHNSMSVLWLIPQYLILGFGNSFSIVGLQEYFYDQVPDTMRSLGMGSYLSVIGT  219

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FLSS LI  VD  T ++G+SW GKD+NSS L+ FYW+L  I A NLC+++  A+ YTY
Sbjct  220  GYFLSSFLIIIVDHVTGKNGKSWIGKDINSSHLNRFYWMLAIINALNLCLFLFFAKRYTY  279

Query  704  KNVQSKTTMAVADCDDDG  757
            K V  +T +    C +DG
Sbjct  280  KTVH-RTVIETDGCKNDG  296



>ref|XP_009345590.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Pyrus x bretschneideri]
Length=594

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 189/250 (76%), Gaps = 6/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+ NM+PIW+T++PFG+CVAQ  TFF+KQ AT++  I + F+IPPATI SLAAI M
Sbjct  341  EEVKLLFNMIPIWITSIPFGLCVAQAPTFFVKQAATMNLNITDNFKIPPATINSLAAIAM  400

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV +YD++LVPVLRK  GNERG+TILQRIG+GM+FS   M  AAL E KRL       
Sbjct  401  LISVAVYDKVLVPVLRKINGNERGMTILQRIGVGMVFSTAAMTAAALTETKRLGV----H  456

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               S+SV WLAPQ++I+G GDGFTLVGLQEYFYD+VPD+MRS+GIA YLSV G  +F+SS
Sbjct  457  NPKSLSVLWLAPQYIILGFGDGFTLVGLQEYFYDEVPDNMRSIGIALYLSVIGTGSFVSS  516

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI AVD  T + G+SWFGKDL SSRLD FYWLL  + A N   +V V+  YTYK V+ +
Sbjct  517  FLIMAVDSITGKGGKSWFGKDLRSSRLDNFYWLLAAVNAVNFFAHVWVSIRYTYKTVERR  576

Query  722  TTMA--VADC  745
              +   V++C
Sbjct  577  RVVPDNVSEC  586



>gb|KHN17877.1| Putative peptide/nitrate transporter [Glycine soja]
Length=576

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 189/253 (75%), Gaps = 5/253 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N+VPIWLT+L  G+C AQ +T F+KQ  T++ K+   F +PPA++ S+AAIG+
Sbjct  323  EETKLVLNVVPIWLTSLTTGVCWAQASTLFVKQATTMNLKMTESFTLPPASLVSVAAIGV  382

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDR++VP+LRK TGNERG++IL+RI IGM FSV  M  AALVE KRL  V + T
Sbjct  383  LISLPIYDRVIVPILRKVTGNERGISILRRISIGMTFSVIVMVAAALVEAKRLRIVGQRT  442

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GI + F+LVGLQEYFY QVPDSMRS+G+A YLSVSG  NFLSS
Sbjct  443  ----MSVMWLIPQYLILGIANSFSLVGLQEYFYYQVPDSMRSIGMALYLSVSGVGNFLSS  498

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  V+  T ++G+SW GKD+NSSRLD FYW+L  I A +LC ++ +A +YTYK VQ +
Sbjct  499  FLIIIVNHVTGKNGKSWIGKDINSSRLDRFYWMLAVINALDLCAFLFLASSYTYKTVQRR  558

Query  722  TTMAVADCDDDGG  760
             TM    C+   G
Sbjct  559  -TMDTDGCNKSDG  570



>ref|XP_006601977.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Glycine max]
Length=589

 Score =   305 bits (781),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 186/257 (72%), Gaps = 7/257 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+CV QG T F+KQ A  + KI + F+IPPA++ S+AA+G 
Sbjct  328  EETKLVLNIIPIWLTSLTVGVCVGQGQTLFVKQAAATNLKISDSFKIPPASMASVAAVGT  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +++V IYDR++VP+LRK TGNERG++IL+RI IGM  SV  M VAALVE K+L       
Sbjct  388  LIAVPIYDRVVVPILRKVTGNERGISILRRISIGMTLSVLLMVVAALVESKKLRMAAHEV  447

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSV WL PQ+LI+GIGD F+LVGLQEYFYDQVPDSMRS+G+A YLSV G 
Sbjct  448  LTVGETRHETMSVMWLIPQYLILGIGDSFSLVGLQEYFYDQVPDSMRSIGMALYLSVLGV  507

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FL S LI  V+  T ++G SW GKD+NSSRLD FYW+L  I A  LCV++LV++ YTY
Sbjct  508  GFFLCSFLIIIVEHITGKTGNSWIGKDINSSRLDKFYWMLAVINALVLCVFLLVSKRYTY  567

Query  704  KNVQSKTTMAVADCDDD  754
            K VQ +  M    C  D
Sbjct  568  KAVQRR-AMETDCCKSD  583



>ref|XP_003600795.1| Peptide transporter PTR3-A [Medicago truncatula]
Length=501

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 188/258 (73%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWL +L  G+ +AQ  T F+KQ A+++ K+ + F IPP ++ S+ AIG 
Sbjct  239  EETKLVLNIIPIWLASLTTGITLAQATTLFVKQAASMNLKLSDNFTIPPGSVVSVTAIGT  298

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            ++ V +YD++LVP++RK TGNERG++IL+RI IG+ FSV  M VAALVE KRL   ++  
Sbjct  299  LIFVPLYDKVLVPIMRKITGNERGISILRRIAIGLAFSVMVMIVAALVEAKRLRMHEQEI  358

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSVFWL PQ+LI+G GD F+LVGLQEYFYDQVPDSMRSLG+A YLSV G 
Sbjct  359  LRSGETGKNTMSVFWLVPQYLILGFGDSFSLVGLQEYFYDQVPDSMRSLGMALYLSVIGV  418

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS LIT V   T ++G+SW GKD+NSSRLD FYW+L  I A NLC Y+ +A+ YTY
Sbjct  419  GSFLSSFLITIVAHVTEKNGKSWIGKDINSSRLDRFYWMLAIINALNLCAYLFLAKRYTY  478

Query  704  KNVQSKTTMAVADCDDDG  757
            K+VQ       A   DDG
Sbjct  479  KSVQRIGNEIDAGKSDDG  496



>ref|XP_010692129.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Beta vulgaris subsp. 
vulgaris]
Length=606

 Score =   304 bits (778),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 189/251 (75%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+I M PIWL++L FG+ VAQG TFFIKQG+ +DRKI   FEIP A++ +L A+GM
Sbjct  350  EEFKLIIAMAPIWLSSLVFGIGVAQGTTFFIKQGSAMDRKISKHFEIPAASMATLIALGM  409

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I ++  YD++L+P LR+ TGNERG+ IL RIGIGM+  +  M VAALVE++RL   + + 
Sbjct  410  ITTIAFYDKVLLPYLRRVTGNERGINILTRIGIGMVVLIIVMIVAALVERRRL---EASM  466

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV+WL PQFLI+GIGDGF+LVG+QEYFYDQVP+SMRSLG+AFYLSV G  +F++S
Sbjct  467  DGRIMSVYWLIPQFLILGIGDGFSLVGMQEYFYDQVPNSMRSLGMAFYLSVIGIGSFMTS  526

Query  542  LLITAVDRAT-ARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LI  V++ +    G+ W GKDL  SRLDYFYW L  I   NLCV+VL+A+NY YK+VQ 
Sbjct  527  FLIMVVNQVSRMNGGKKWIGKDLKHSRLDYFYWFLMVIFVMNLCVFVLLAKNYRYKSVQ-  585

Query  719  KTTMAVADCDD  751
            ++ + V DC D
Sbjct  586  RSVVIVEDCFD  596



>ref|XP_010668156.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Beta vulgaris subsp. 
vulgaris]
Length=603

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 193/250 (77%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+I M PIWLT+L FG+ +AQG TFFIKQG+ ++RK+ N FEIP A++ +L A+GM
Sbjct  348  EELKLIITMAPIWLTSLIFGIGIAQGHTFFIKQGSAMNRKVWNHFEIPAASMAALTALGM  407

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I ++  YD++L+P LR+ATG +RG++IL+RIGIGM+  + ++ ++ALVE KRL   + + 
Sbjct  408  IATIAFYDKVLLPYLRRATGKDRGISILKRIGIGMVILIISILISALVESKRL---KASL  464

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                M+VFWLAPQ+LI+GIGDGF+LVGLQEYFYDQVPD+MRSLG+AF+LSV G  +FL+S
Sbjct  465  KGKKMNVFWLAPQYLILGIGDGFSLVGLQEYFYDQVPDTMRSLGMAFFLSVIGVGSFLTS  524

Query  542  LLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
             LIT V+  T    G+ W GKDLN SRL+YFYWLL  I   +LC +VL+A+NY YKNVQ 
Sbjct  525  FLITIVNYVTTMNGGKKWIGKDLNHSRLEYFYWLLTVIFVLDLCAFVLLAKNYKYKNVQ-  583

Query  719  KTTMAVADCD  748
            +T +    CD
Sbjct  584  RTVVEDNSCD  593



>gb|AES71046.2| peptide/nitrate transporter plant [Medicago truncatula]
Length=590

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 188/258 (73%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWL +L  G+ +AQ  T F+KQ A+++ K+ + F IPP ++ S+ AIG 
Sbjct  328  EETKLVLNIIPIWLASLTTGITLAQATTLFVKQAASMNLKLSDNFTIPPGSVVSVTAIGT  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            ++ V +YD++LVP++RK TGNERG++IL+RI IG+ FSV  M VAALVE KRL   ++  
Sbjct  388  LIFVPLYDKVLVPIMRKITGNERGISILRRIAIGLAFSVMVMIVAALVEAKRLRMHEQEI  447

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSVFWL PQ+LI+G GD F+LVGLQEYFYDQVPDSMRSLG+A YLSV G 
Sbjct  448  LRSGETGKNTMSVFWLVPQYLILGFGDSFSLVGLQEYFYDQVPDSMRSLGMALYLSVIGV  507

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS LIT V   T ++G+SW GKD+NSSRLD FYW+L  I A NLC Y+ +A+ YTY
Sbjct  508  GSFLSSFLITIVAHVTEKNGKSWIGKDINSSRLDRFYWMLAIINALNLCAYLFLAKRYTY  567

Query  704  KNVQSKTTMAVADCDDDG  757
            K+VQ       A   DDG
Sbjct  568  KSVQRIGNEIDAGKSDDG  585



>ref|XP_006651971.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Oryza brachyantha]
Length=582

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 189/255 (74%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFG+  AQ +TFFIKQG+ +DR++   F +PPA+ +++AAIGM
Sbjct  326  EETKLVLAMVPIWVATLPFGITAAQVSTFFIKQGSVMDRRMGPHFVLPPASTFAMAAIGM  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I++V +YD++L P LR+ TG ERG++IL+RIG+G+ F++  MA AA    +RL     + 
Sbjct  386  IIAVAVYDKVLEPYLRRLTGGERGISILKRIGVGIAFTIVAMAGAAQGGTRRLR----SP  441

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            +  SMSVFWL PQF+++GIGDGF LVGLQEYFYDQVPDSMRSLGI  YLSV GA +FLSS
Sbjct  442  SPASMSVFWLVPQFMLMGIGDGFALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAGSFLSS  501

Query  542  LLITAVDRATARSGRS--WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             LITAVDR T+  GR+  WFGKDLNSSRLD FYWLL  I  ANL  YV+V   Y+YK V+
Sbjct  502  QLITAVDRITSHGGRAAGWFGKDLNSSRLDLFYWLLACIGVANLVFYVVVTARYSYKTVK  561

Query  716  SKTTMAVADCDDDGG  760
            +   +     DD  G
Sbjct  562  AGRVV-----DDKAG  571



>emb|CDP00147.1| unnamed protein product [Coffea canephora]
Length=600

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 184/260 (71%), Gaps = 9/260 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++NM PIW T+L FG+C +   T F+KQ + +DRKI + FEIPPAT+  L A+ M
Sbjct  338  EETKLIMNMFPIWFTSLIFGVCNSPAVTLFVKQSSAMDRKIGSKFEIPPATVGFLGALTM  397

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++++T Y++ILVPVLR+A GNERG+ ILQRIG+GM+F V  MA+AALVE +RL   +   
Sbjct  398  LLTITSYEKILVPVLRRARGNERGIKILQRIGVGMVFPVLGMAIAALVESRRLRMAETEA  457

Query  362  T-------SDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSG  520
                    S  MSVFWLAPQ +I+  GD F+LVGLQEYFY+QVPDSMRSLG+AF+LS  G
Sbjct  458  VLQGKAGESAPMSVFWLAPQIMILASGDAFSLVGLQEYFYEQVPDSMRSLGLAFFLSAMG  517

Query  521  AANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             + F+SS LIT V   T +SG SW  KDLNSSRLD FYWLL  +   NLC+Y+  AR ++
Sbjct  518  VSQFISSFLITIVAHVTQKSGVSWLSKDLNSSRLDKFYWLLTAMAGLNLCLYIFFARRHS  577

Query  701  YKNVQSKTTMAVADCDDDGG  760
            YK ++   T  VADC    G
Sbjct  578  YKIIKGNVT--VADCQGGDG  595



>ref|XP_006601976.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=589

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 184/258 (71%), Gaps = 7/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+ V QG T F+KQ A  + KI + F+IPPA++ S+ A+G 
Sbjct  328  EETKLVLNIIPIWLTSLTVGVTVGQGQTLFVKQAAATNLKISHSFKIPPASMASVTAVGT  387

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +++V IYDRI VP++RK TGNERG++IL+RI IGM  SV  M VAALVE KRL       
Sbjct  388  LIAVPIYDRITVPIMRKFTGNERGISILRRISIGMALSVIVMVVAALVEGKRLRMATHEV  447

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSV WL PQ+LI+G+GD F+LVGLQEYFY QVPDSMRSLG+A YLSV G 
Sbjct  448  LTVGETRHETMSVVWLIPQYLILGVGDSFSLVGLQEYFYSQVPDSMRSLGMALYLSVLGV  507

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FLSS LI  VDR T ++G SW GKD+NSSRLD FYW+L  I A  LCV++LV + YTY
Sbjct  508  GFFLSSFLIIIVDRVTGKTGNSWIGKDINSSRLDRFYWMLAVINALVLCVFLLVIKRYTY  567

Query  704  KNVQSKTTMAVADCDDDG  757
            K VQ +  +    C  DG
Sbjct  568  KAVQRR-AIETDCCKSDG  584



>ref|XP_004981230.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Setaria italica]
Length=574

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/251 (61%), Positives = 192/251 (76%), Gaps = 5/251 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFGM  AQ +TFFIKQG+ +DR++   F +PPA+I++L+AI M
Sbjct  321  EETKLVLAMVPIWVATLPFGMAAAQVSTFFIKQGSMMDRRMGPHFVLPPASIFALSAISM  380

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V +YD++LVP LR+ATG ERG++IL+R+GIGM+ +V  +AVAA+VE++RL     + 
Sbjct  381  IATVAVYDKVLVPFLRRATGGERGISILRRVGIGMVLAVVALAVAAVVERRRL----LSP  436

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            +  SMSVFWL PQF++IG+GDGF LVGLQEYFYDQVPD+MRSLGI  YLSV GA +FLSS
Sbjct  437  SPASMSVFWLLPQFVLIGVGDGFALVGLQEYFYDQVPDNMRSLGIGLYLSVIGAGSFLSS  496

Query  542  LLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            L+ITA DRA++R G  SWF KDLN SRLD FYWLL  I AANL  Y LV+  Y+YK V  
Sbjct  497  LVITAADRASSRGGHASWFAKDLNRSRLDLFYWLLACIGAANLVFYALVSTKYSYKTVSG  556

Query  719  KTTMAVADCDD  751
               + V    D
Sbjct  557  AGKVGVDKSGD  567



>ref|XP_002463617.1| hypothetical protein SORBIDRAFT_01g002990 [Sorghum bicolor]
 gb|EER90615.1| hypothetical protein SORBIDRAFT_01g002990 [Sorghum bicolor]
Length=616

 Score =   301 bits (771),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 177/237 (75%), Gaps = 2/237 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFGM VAQ +TFFIKQG+ +DR +   FE+PPA+I++L+AI M
Sbjct  358  EETKLVLAMVPIWVCTLPFGMAVAQVSTFFIKQGSVMDRHLGPHFELPPASIFALSAIAM  417

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V  YD+ LVP LR+ATG ERG++IL+R+GIGM F++  M VAA VE++RL       
Sbjct  418  IATVAAYDKALVPYLRRATGGERGISILRRVGIGMAFAIAGMGVAAAVERRRL-LSSAEA  476

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
             +   SV WL PQF ++G+ DGF LVGLQEYFY+QVPD MRSLGI  YLSV GA +FLSS
Sbjct  477  AAQPPSVLWLVPQFALMGVADGFALVGLQEYFYEQVPDGMRSLGIGLYLSVIGAGSFLSS  536

Query  542  LLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            L+ITA DRA++R GR SWF KDLN SRLD FYWLL  I A NL  Y +VA   +YK 
Sbjct  537  LVITAADRASSRGGRASWFAKDLNHSRLDLFYWLLACIGAVNLAFYAVVATKCSYKQ  593



>ref|XP_003600793.1| Peptide transporter PTR3-B [Medicago truncatula]
 gb|AES71044.1| peptide/nitrate transporter [Medicago truncatula]
Length=594

 Score =   300 bits (768),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 189/263 (72%), Gaps = 7/263 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N+VPIWLT L  G C AQG+TF++KQ A  D  I NGFEIPPA++ +++AIG 
Sbjct  329  EETKLVLNIVPIWLTLLASGACAAQGSTFYVKQAAATDLNIGNGFEIPPASLNAISAIGT  388

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            ++ + IYD+I VP++RK TGNERG++IL RI IG+  S   M ++ALVE KRL  ++   
Sbjct  389  LIGIPIYDKIFVPIMRKITGNERGISILSRINIGLTLSAIIMVLSALVEVKRLRMLENEI  448

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T   +MSV+WL PQ L+ G  D F +VG+QEYFYD+VPDSMRSLG+A Y SV G 
Sbjct  449  LRTGETGQVTMSVYWLLPQNLLAGFADAFLMVGIQEYFYDEVPDSMRSLGLALYFSVFGI  508

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             NFLS+ +I  VD  TA+SG+SW GKD+NSSRLD FYW+L  I++ N+CV++++++ YTY
Sbjct  509  GNFLSNFIIVVVDHVTAKSGKSWIGKDINSSRLDNFYWMLAAISSLNVCVFLVISKRYTY  568

Query  704  KNVQSKTTMAVA-DCDDDGGRDA  769
            K VQ +TT       DD+  ++A
Sbjct  569  KTVQRRTTETNGYKSDDESMKEA  591



>gb|KHN07608.1| Putative peptide/nitrate transporter [Glycine soja]
Length=593

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 183/258 (71%), Gaps = 7/258 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+ V QG T F+KQ A  + KI + F+IPPA++ S+ A+G 
Sbjct  332  EETKLVLNIIPIWLTSLTVGVTVGQGQTLFVKQAAATNLKISHSFKIPPASMASVTAVGT  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +++V IYDRI VP++RK TGNERG++IL+RI IGM  SV  M VAALVE KRL       
Sbjct  392  LIAVPIYDRITVPIMRKFTGNERGISILRRISIGMALSVIVMVVAALVEGKRLRMATHEV  451

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSV WL PQ+LI+G+GD F+LVGLQEYFY QVPDSMRSLG+A YLSV G 
Sbjct  452  LTVGETRHETMSVVWLIPQYLILGVGDSFSLVGLQEYFYSQVPDSMRSLGMALYLSVLGV  511

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FLSS LI  VDR T ++G SW GKD+NSSRLD FYW+L  I A  LCV++LV + YTY
Sbjct  512  GFFLSSFLIIIVDRVTGKTGNSWIGKDINSSRLDRFYWMLAVINALVLCVFLLVIKRYTY  571

Query  704  KNVQSKTTMAVADCDDDG  757
            K  Q +  +    C  DG
Sbjct  572  KTDQRR-AIETDCCKSDG  588



>gb|KHN07607.1| Putative peptide/nitrate transporter [Glycine soja]
Length=585

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 186/255 (73%), Gaps = 6/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N+VPIWLT+L  G+C+AQG+T F+KQ A ++ KI + F+IPPA++ SL+A G 
Sbjct  334  EETKLILNVVPIWLTSLMIGVCIAQGSTLFVKQAAAMNLKISDNFKIPPASMASLSAFGT  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYDRI+VP+LRK  GNERG++IL RIGIG+IF V  M VAALVE  RL      T
Sbjct  394  IISVPIYDRIIVPILRKVRGNERGISILGRIGIGLIFLVILMVVAALVENMRLRMPGHET  453

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GIG+ F L+ LQEYFYD+VPDSMRS+G+A YLSV G   FLSS
Sbjct  454  ----MSVMWLIPQYLILGIGNSFYLIALQEYFYDEVPDSMRSVGMALYLSVIGIGFFLSS  509

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  VD  T ++G+ W  KD+NSSRLD FYW+L  I+A NLC+++ +A+ +TYK  + K
Sbjct  510  FLIIIVDHVTGKNGKGWIAKDVNSSRLDKFYWMLAVISALNLCLFLFLAKRFTYKTARRK  569

Query  722  TTMAVADCDDDGGRD  766
             T    DC +  G D
Sbjct  570  ATE--IDCSNCDGVD  582



>ref|XP_003563511.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Brachypodium distachyon]
Length=588

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 185/247 (75%), Gaps = 7/247 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIWLTTL FG+  AQ +TFFIKQG+ +DR++   FEIPPA++++LAA+GM
Sbjct  327  EETKLVLAMVPIWLTTLAFGVTAAQVSTFFIKQGSVMDRRLGPSFEIPPASVFALAAVGM  386

Query  182  IVSVTIYDRILVPVLRKATGN--ERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
            I++V  YD++L P +R+A G   ERG++ILQRIG+GM F +  MAVAA VE++RL     
Sbjct  387  ILAVAAYDKLLEPYVRRAKGAAAERGISILQRIGVGMGFGILAMAVAAAVERRRLR----  442

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
            + +  SMSVFWL PQF+++G+GDGF LVGLQEYFY+QVPD+MRSLGI  YLSV GA +FL
Sbjct  443  SPSPASMSVFWLVPQFVLMGVGDGFALVGLQEYFYEQVPDNMRSLGIGLYLSVIGAGSFL  502

Query  536  SSLLITAVDRATARSG-RSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNV  712
            S ++I A DRAT+  G   WFGKDL  SRLD FYWLL  I A NL  YVLVA  Y+YK  
Sbjct  503  SGVIIAAADRATSGGGSEGWFGKDLAHSRLDLFYWLLAVIGAINLGFYVLVATRYSYKQT  562

Query  713  QSKTTMA  733
             +K   A
Sbjct  563  VAKAATA  569



>ref|XP_006603100.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=585

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 185/255 (73%), Gaps = 6/255 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N+VPIWLT+L  G+C+AQG+T F+KQ A ++ KI + F+IPPA++ SL+A   
Sbjct  334  EETKLILNVVPIWLTSLMIGVCIAQGSTLFVKQAAAMNLKISDNFKIPPASMASLSAFST  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+SV IYDRI+VP+LRK  GNERG++IL RIGIG+IF V  M VAALVE  RL      T
Sbjct  394  IISVPIYDRIIVPILRKVRGNERGISILGRIGIGLIFLVILMVVAALVENMRLRMPGHET  453

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WL PQ+LI+GIG+ F L+ LQEYFYD+VPDSMRS+G+A YLSV G   FLSS
Sbjct  454  ----MSVMWLIPQYLILGIGNSFYLIALQEYFYDEVPDSMRSVGMALYLSVIGIGFFLSS  509

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
             LI  VD  T ++G+ W  KD+NSSRLD FYW+L  I+A NLC+++ +A+ +TYK  + K
Sbjct  510  FLIIIVDHVTGKNGKGWIAKDVNSSRLDKFYWMLAVISALNLCLFLFLAKRFTYKTARRK  569

Query  722  TTMAVADCDDDGGRD  766
             T    DC +  G D
Sbjct  570  ATE--IDCSNCDGVD  582



>ref|XP_008644373.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Zea mays]
 gb|AFW67130.1| hypothetical protein ZEAMMB73_312856 [Zea mays]
Length=579

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFGM VAQ +TFFIKQ + +DR++   FE PPA++++L+A+ M
Sbjct  330  EETKLVLAMVPIWVCTLPFGMAVAQVSTFFIKQSSVMDRRLGPHFEPPPASVFALSAVAM  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V  YD+ LVP LR+ATG ERG++IL R+GIGM F++  + VAA VE++RL  +    
Sbjct  390  IGTVAAYDKALVPYLRRATGGERGISILGRVGIGMAFAIAGLGVAAAVERRRL--LSAGA  447

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               S SV WL PQF ++G+ DGF LVGLQEYFY+QVPD MRSLGI  YLSV GA +FLSS
Sbjct  448  ARPSTSVLWLVPQFALMGVADGFALVGLQEYFYEQVPDGMRSLGIGLYLSVIGAGSFLSS  507

Query  542  LLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            L+ITA DRA++R GR+ WF KDLN SRLD FYWLL  I+A NL  Y LVA   +YK 
Sbjct  508  LVITAADRASSRGGRAGWFAKDLNRSRLDLFYWLLACISAVNLAFYALVATKCSYKQ  564



>ref|XP_010108380.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXC19371.1| putative peptide/nitrate transporter [Morus notabilis]
Length=214

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 167/216 (77%), Gaps = 6/216 (3%)
 Frame = +2

Query  110  LDRKIINGFEIPPATIYSLAAIGMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMI  289
            ++  I N F+IPPA++++L AI MI+SV +YDRI+VP LRK+TGNERGL ILQRIG GMI
Sbjct  1    MNLNITNNFKIPPASVFTLGAIAMIISVVVYDRIIVPFLRKSTGNERGLNILQRIGFGMI  60

Query  290  FSVTTMAVAALVEKKRLNFVQENTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQV  469
            F V  M+VAALVE+KRL     +   + MS  WLAPQ +I GIGD FTLVGLQEYFYDQV
Sbjct  61   FPVVAMSVAALVERKRL----RSAGQEPMSALWLAPQLIIFGIGDSFTLVGLQEYFYDQV  116

Query  470  PDSMRSLGIAFYLSVSGAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGG  649
            PDSMRSLG+A YLSV G  +FLSS LI  VD+ T +SGRSW GKDL++SRLD FYWLL  
Sbjct  117  PDSMRSLGMALYLSVIGVGSFLSSFLIFVVDQITEKSGRSWIGKDLSTSRLDNFYWLLAA  176

Query  650  ITAANLCVYVLVARNYTYKNVQSKTTMAVADCDDDG  757
            I+A NLC YV+VAR YTYKNV  +T +AVA  D +G
Sbjct  177  ISALNLCFYVVVARGYTYKNVD-RTKVAVA-YDSNG  210



>ref|XP_010687909.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Beta vulgaris subsp. 
vulgaris]
Length=545

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 186/252 (74%), Gaps = 5/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+I M+PIWL TL FG+  AQG TFFIKQG  ++RK+I  FEIP A++  L+A+GM
Sbjct  290  EELKLIIVMLPIWLITLVFGIGNAQGTTFFIKQGYAMNRKVIKHFEIPAASMGILSALGM  349

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
              S+T+YD++L+P LR+  GNERG++IL RIGIGM   + +M ++ALVE++RLN    + 
Sbjct  350  TASITMYDKLLLPYLRRVRGNERGISILTRIGIGMFILIISMVISALVERERLN---ASL  406

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                M +FWL PQ  I+G+GDGF+LVGLQEYFY+QVPD MRSLG+AFYLSV G  +FL+S
Sbjct  407  QGKIMHIFWLVPQIFIMGVGDGFSLVGLQEYFYEQVPDLMRSLGMAFYLSVIGVGSFLTS  466

Query  542  LLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LLI  VD  T   +G+ W G D+N SRL+YFYWLL  I   NLCV++++A+NY YKNV+S
Sbjct  467  LLIIVVDYVTGLNNGKRWIGPDVNHSRLEYFYWLLVVIFVLNLCVFMMLAKNYRYKNVES  526

Query  719  KTTMAVADCDDD  754
              T     CD +
Sbjct  527  SVTNG-DFCDGE  537



>ref|XP_007163474.1| hypothetical protein PHAVU_001G237200g [Phaseolus vulgaris]
 gb|ESW35468.1| hypothetical protein PHAVU_001G237200g [Phaseolus vulgaris]
Length=574

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 183/257 (71%), Gaps = 8/257 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN+VPIWLT+L  G+C+AQG T F+KQ A ++ KI + F+IP A++ SL+A+G+
Sbjct  321  EETKLIINLVPIWLTSLTVGVCIAQGTTLFVKQAAAMNLKISDNFKIPAASMSSLSAVGI  380

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ V IYDRI+VP++RK TGNERG+ IL RI IGM   V  M VAALVE KRL    +N 
Sbjct  381  LIIVPIYDRIIVPLMRKITGNERGIDILTRISIGMALYVILMIVAALVETKRLRMETDN-  439

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
              +SMSV WL PQ+LI+G+GD F +VGLQEYFYDQVP SM+SLG+  YLSV GA  FLS+
Sbjct  440  --NSMSVLWLIPQYLILGVGDSFCIVGLQEYFYDQVPHSMKSLGMGLYLSVIGAGYFLSN  497

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQSK  721
              I  VD  T + G+SW GKD+NSS LD FYWLL  I A NLC+++ +A+ +TYK V   
Sbjct  498  FFIIIVDHVTGKKGKSWIGKDINSSHLDKFYWLLTIINALNLCLFLFLAKMHTYKTVHRD  557

Query  722  TTMAVADCDDDGGRDAM  772
                 A+  D   RD +
Sbjct  558  -----AEEIDGSNRDGV  569



>ref|XP_006603101.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Glycine max]
Length=591

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 189/255 (74%), Gaps = 8/255 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N++PIWLT+L  G+C+AQG+T F+ Q A+++ KIIN F+IPPA++ S++AI  
Sbjct  330  EETKLILNVIPIWLTSLIIGICIAQGSTLFVNQAASMNLKIINSFKIPPASMTSVSAISP  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+++ IYD+I+VP++RK  GNERG+++L R+GIG+ F V  M VAALVE KRL  V+ + 
Sbjct  390  IIAIPIYDKIIVPIMRKVKGNERGISVLWRVGIGLAFLVIAMVVAALVETKRLRMVEHDE  449

Query  359  ------TTSDSMSVFWLAPQFLIIGIG-DGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVS  517
                  T  ++MSV WL PQ+LI+GIG D  +L+GLQEYFYDQVPDS+RSLG+  YLSV 
Sbjct  450  VITVGGTRHETMSVLWLIPQYLILGIGADSLSLIGLQEYFYDQVPDSVRSLGVGLYLSVV  509

Query  518  GAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
            G   FLSS LI  VD  T ++G+SW  KD+NSSRLD FYW+L  I A NLC ++ +A+ Y
Sbjct  510  GVGFFLSSFLIITVDHVTGKNGKSWIAKDINSSRLDKFYWMLAVINAFNLCFFLFLAKGY  569

Query  698  TYKNVQSKTTMAVAD  742
            TYK VQ KT    +D
Sbjct  570  TYKTVQRKTREICSD  584



>ref|XP_006850438.1| hypothetical protein AMTR_s00165p00058610 [Amborella trichopoda]
 gb|ERN12019.1| hypothetical protein AMTR_s00165p00058610 [Amborella trichopoda]
Length=594

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++++ PIWL+ L FG+C+ QG TFFIKQG+T+DRK+   FE+PPA+++  +A  M
Sbjct  333  EETKLILSLTPIWLSCLIFGICINQGITFFIKQGSTMDRKMGPHFEMPPASLFGFSAFFM  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ ++IYD+ILVP +R+ TGNERG++ILQRIGIGM FSV  M  AAL E+KRLN  +++T
Sbjct  393  VILISIYDKILVPSIRRVTGNERGISILQRIGIGMFFSVVCMITAALTERKRLNIAKKHT  452

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
               S      MSVFWL PQFL+IG+ D FTLVGLQEYFYDQVPD+MRSLGIA YLSV G 
Sbjct  453  MLGSLNGPLPMSVFWLLPQFLLIGVTDVFTLVGLQEYFYDQVPDNMRSLGIALYLSVIGV  512

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
            ++FLSSLLI+ VD+ T   G  WF K +N SRLD FYWLLG + A NL +Y+ VA  Y+Y
Sbjct  513  SSFLSSLLISIVDKITTGRGHPWFAKSINGSRLDLFYWLLGTMGALNLGIYMYVASKYSY  572

Query  704  KNVQSK  721
            KNV  +
Sbjct  573  KNVGKR  578



>gb|KHN07605.1| Putative peptide/nitrate transporter [Glycine soja]
Length=528

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 187/255 (73%), Gaps = 8/255 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N++PIWLT+L  G+C+AQG+T F+ Q A ++ KI N F+IPPA++ S++AI  
Sbjct  267  EETKLILNVIPIWLTSLIIGVCIAQGSTLFVNQAAAMNLKISNSFKIPPASMTSVSAISP  326

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            I+++ IYD+I+VP++RK  GNERG+++L R+GIG+ F V  M VAALVE KRL  V+ + 
Sbjct  327  IIAIPIYDKIIVPIMRKVKGNERGISVLWRVGIGLAFLVIAMVVAALVETKRLRMVEHDE  386

Query  359  ------TTSDSMSVFWLAPQFLIIGIG-DGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVS  517
                  T  ++MSV WL PQ+LI+GIG D  +L+GLQEYFYDQVPDS+RSLG+  YLSV 
Sbjct  387  VITVGGTRHETMSVLWLIPQYLILGIGADSLSLIGLQEYFYDQVPDSVRSLGVGLYLSVV  446

Query  518  GAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
            G   FLSS LI  VD  T ++G+SW  KD+NSSRLD FYW+L  I A NLC ++ +A+ Y
Sbjct  447  GVGFFLSSFLIITVDHVTGKNGKSWIAKDINSSRLDKFYWMLAVINAFNLCFFLFLAKGY  506

Query  698  TYKNVQSKTTMAVAD  742
            TYK VQ KT    +D
Sbjct  507  TYKTVQRKTRENCSD  521



>emb|CDX74927.1| BnaA05g06730D [Brassica napus]
Length=559

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 177/252 (70%), Gaps = 29/252 (12%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI--INGFEIPPATIYSLAAI  175
            EE KL+INM+PIWL+ L FG+C AQ +TFFIKQ   +DR +   N F IPPA+IY L AI
Sbjct  334  EETKLIINMIPIWLSVLVFGICAAQASTFFIKQATVMDRHVSGKNSFTIPPASIYCLTAI  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+ VT+YD++LVP LR+ T N+RG+ ILQR+GIGM F+V TM +AALVEKKRL+ + E
Sbjct  394  TLIMYVTVYDKLLVPFLRRNTQNQRGINILQRVGIGMFFAVITMIIAALVEKKRLDLLTE  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               +  MSVFWLAPQF+++G+ +GFTLVGLQEYFYDQVPDSMRSL   F           
Sbjct  454  Q--NRPMSVFWLAPQFIVLGVAEGFTLVGLQEYFYDQVPDSMRSLAEDF-----------  500

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
                          S + WFGK LNSSRLD+FYWLL G+ AAN+CV+++VA+ + YK+VQ
Sbjct  501  --------------SDKRWFGKTLNSSRLDWFYWLLAGLAAANMCVFMIVAKRFPYKSVQ  546

Query  716  SKTTMAVADCDD  751
            S   +A +   D
Sbjct  547  SSQVLADSSVSD  558



>emb|CDX91390.1| BnaC04g07600D [Brassica napus]
Length=559

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 177/252 (70%), Gaps = 29/252 (12%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI--INGFEIPPATIYSLAAI  175
            EE KL+INM+PIWL+ L FG+C AQ +TFFIKQ   +DR +   N F IPPA+IY L AI
Sbjct  334  EETKLIINMIPIWLSVLVFGICAAQASTFFIKQATVMDRHVSGKNSFTIPPASIYCLTAI  393

Query  176  GMIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
             +I+ VT+YD++LVP LR+ T N+RG+ ILQR+GIGM F+V TM +AALVEK RL+ + E
Sbjct  394  TLIMYVTVYDKLLVPFLRRNTQNQRGINILQRVGIGMFFAVITMIIAALVEKNRLDLLTE  453

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
               +  MSVFWLAPQF+++G+ +GFTLVGLQEYFYDQVPDSMRSL   F           
Sbjct  454  Q--NRPMSVFWLAPQFIVLGVAEGFTLVGLQEYFYDQVPDSMRSLAEDF-----------  500

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
                          S + WFGK LNSSRLD+FYWLL G+TAAN+CV+++VA+ + YK+VQ
Sbjct  501  --------------SDKRWFGKTLNSSRLDWFYWLLAGLTAANMCVFMIVAKRFPYKSVQ  546

Query  716  SKTTMAVADCDD  751
            S   +A +   D
Sbjct  547  SSQVLADSSVSD  558



>tpg|DAA52235.1| TPA: hypothetical protein ZEAMMB73_814932 [Zea mays]
Length=588

 Score =   287 bits (735),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 188/261 (72%), Gaps = 14/261 (5%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFGM VAQ +TFFIKQ + +DR++   F++PPA++++LAA+ M
Sbjct  326  EETKLVVAMVPIWVCTLPFGMEVAQVSTFFIKQASVMDRRLGPHFDLPPASVFALAAVAM  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRL---NFVQ  352
            I +V  YD++LVP LR+ATG ERG++IL+R+GIGM  +V  M VAA VE++RL   +   
Sbjct  386  IATVAAYDKVLVPYLRRATGGERGISILRRVGIGMALAVVGMGVAAAVERRRLLAASAAA  445

Query  353  ENTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
             + +  S SV WL PQF ++G+ DGF +VGLQEYFY+QVPD MRSLGI  YLSV GA +F
Sbjct  446  GSGSGSSPSVLWLVPQFALMGVADGFAVVGLQEYFYEQVPDGMRSLGIGLYLSVIGAGSF  505

Query  533  LSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            LSSL+ITA DRA++R GR+ WF KDL+ SRLD FYWLL  I A NL  Y LVA   +Y  
Sbjct  506  LSSLVITAADRASSRGGRAGWFAKDLDRSRLDLFYWLLTCIGAVNLAFYALVATKCSY--  563

Query  710  VQSKTTMAVAD------CDDD  754
              +K T+ V D       DDD
Sbjct  564  --NKQTVRVGDDKFAAAGDDD  582



>ref|NP_001130610.1| uncharacterized protein LOC100191709 [Zea mays]
 gb|ACF78899.1| unknown [Zea mays]
Length=581

 Score =   287 bits (734),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 188/261 (72%), Gaps = 14/261 (5%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ MVPIW+ TLPFGM VAQ +TFFIKQ + +DR++   F++PPA++++LAA+ M
Sbjct  319  EETKLVVAMVPIWVCTLPFGMEVAQVSTFFIKQASVMDRRLGPHFDLPPASVFALAAVAM  378

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRL---NFVQ  352
            I +V  YD++LVP LR+ATG ERG++IL+R+GIGM  +V  M VAA VE++RL   +   
Sbjct  379  IATVAAYDKVLVPYLRRATGGERGISILRRVGIGMALAVVGMGVAAAVERRRLLAASAAA  438

Query  353  ENTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANF  532
             + +  S SV WL PQF ++G+ DGF +VGLQEYFY+QVPD MRSLGI  YLSV GA +F
Sbjct  439  GSGSGSSPSVLWLVPQFALMGVADGFAVVGLQEYFYEQVPDGMRSLGIGLYLSVIGAGSF  498

Query  533  LSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKN  709
            LSSL+ITA DRA++R GR+ WF KDL+ SRLD FYWLL  I A NL  Y LVA   +Y  
Sbjct  499  LSSLVITAADRASSRGGRAGWFAKDLDRSRLDLFYWLLTCIGAVNLAFYALVATKCSY--  556

Query  710  VQSKTTMAVAD------CDDD  754
              +K T+ V D       DDD
Sbjct  557  --NKQTVRVGDDKFAAAGDDD  575



>emb|CCI55655.1| putative NRT1/PTR-like transporter [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 184/242 (76%), Gaps = 8/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV++MVPIW+ TLPFG+  AQ +TFFIKQG  +DR +   F +PPA+I++LAAI M
Sbjct  324  EETKLVVSMVPIWVATLPFGIAAAQVSTFFIKQGMAMDRHLGPHFVLPPASIFALAAIAM  383

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V +YD++L P LR+ATG ERGL++L+RIG+GM  +V  +AVAA+VE++R    Q +T
Sbjct  384  IATVALYDKVLEPCLRRATGTERGLSVLRRIGVGMAVAVVALAVAAVVERRR----QHST  439

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSVFWL PQF ++G+ DGF LVGLQEYFYDQVP++MRSLGI  YLSV GA +FLSS
Sbjct  440  A--TMSVFWLVPQFALMGVADGFALVGLQEYFYDQVPETMRSLGIGLYLSVIGAGSFLSS  497

Query  542  LLITAVDRATARSGRS--WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             +I A  R ++  GR   WFGKDL+ SRLD FYWLL GI+AANL  YVLVA  Y+YK   
Sbjct  498  QVIAAASRVSSHGGRQDGWFGKDLSRSRLDLFYWLLAGISAANLGFYVLVATRYSYKEQT  557

Query  716  SK  721
            +K
Sbjct  558  AK  559



>dbj|BAK06776.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=578

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 184/242 (76%), Gaps = 8/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV++MVPIW+ TLPFG+  AQ +TFFIKQG  +DR +   F +PPA+I++LAAI M
Sbjct  325  EETKLVVSMVPIWVATLPFGIAAAQVSTFFIKQGMAMDRHLGPHFVLPPASIFALAAIAM  384

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I +V +YD++L P LR+ATG ERGL++L+RIG+GM  +V  +AVAA+VE++R    Q +T
Sbjct  385  IATVALYDKVLEPCLRRATGTERGLSVLRRIGVGMGVAVVALAVAAVVERRR----QHST  440

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
               +MSVFWL PQF ++G+ DGF LVGLQEYFYDQVP++MRSLGI  YLSV GA +FLSS
Sbjct  441  A--TMSVFWLVPQFALMGVADGFALVGLQEYFYDQVPETMRSLGIGLYLSVIGAGSFLSS  498

Query  542  LLITAVDRATARSGRS--WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             +I A  R ++  GR   WFGKDL+ SRLD FYWLL GI+AANL  YVLVA  Y+YK   
Sbjct  499  QVIAAASRVSSHGGRQDGWFGKDLSRSRLDLFYWLLAGISAANLGFYVLVATRYSYKEQT  558

Query  716  SK  721
            +K
Sbjct  559  AK  560



>gb|KFK36689.1| hypothetical protein AALP_AA4G156500, partial [Arabis alpina]
Length=517

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%), Gaps = 28/238 (12%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+IN++PIWL+TL FG+C  Q +TFFIKQ   +DR I   F IPPA+++SL A+ +
Sbjct  289  EEAKLIINVIPIWLSTLAFGICATQTSTFFIKQSVLMDRHINKSFTIPPASMFSLTALSL  348

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+ +Y++++VP+LR+ TGN+RG++ILQRIG GMIFS+ TM +AALVEK+RL+  + N 
Sbjct  349  IISIILYEKLIVPLLRRVTGNQRGISILQRIGTGMIFSLITMVIAALVEKQRLDRTENN-  407

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MSV WLAPQF+IIGIGD FTLVGLQEYFYDQVPDSMRSL   F             
Sbjct  408  --KPMSVIWLAPQFIIIGIGDAFTLVGLQEYFYDQVPDSMRSLADDF-------------  452

Query  542  LLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
                        S +SWFGK+LN+SRLD FYWLL G+TAAN+CV+V+VA+    K VQ
Sbjct  453  ------------SVKSWFGKNLNTSRLDRFYWLLAGVTAANICVFVIVAKRCPDKTVQ  498



>gb|EPS63901.1| hypothetical protein M569_10881, partial [Genlisea aurea]
Length=526

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KL+INM+PIWLT LPFG+C++Q +TFFIKQ   +DR+I + F +PPA+IY+L+A+GM
Sbjct  308  EELKLIINMIPIWLTALPFGICISQTSTFFIKQSTIMDRRIGHAFVVPPASIYALSAVGM  367

Query  182  IVSVTIYDRILVPVLRKATGN-ERG-LTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE  355
            I +V  +DR+LVPVLR++TG+ ERG + IL+RIGIGM FS  +MAVAA VE++RL F   
Sbjct  368  IATVVFFDRVLVPVLRRSTGDGERGGIGILRRIGIGMAFSAASMAVAAAVERRRLRFSAA  427

Query  356  NTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFL  535
                   SV WLAPQF+I+GIGDGF LVGLQEYFYDQVPDSMR LGIA YLSV GA NFL
Sbjct  428  GGGDGGGSVLWLAPQFVIMGIGDGFALVGLQEYFYDQVPDSMRGLGIALYLSVIGAGNFL  487

Query  536  SSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLL  643
            S +LI  VDR T ++G+SWFG DLNSSR+D FYWLL
Sbjct  488  SGVLIGVVDRVTRKTGKSWFGFDLNSSRIDRFYWLL  523



>ref|XP_006591362.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=584

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 184/254 (72%), Gaps = 6/254 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N+ PIWLT+L  G+C+A G+T F+KQ A ++ KI N F+IPPA++ S+++I +
Sbjct  330  EETKLILNVFPIWLTSLMTGVCIANGSTLFVKQAAAMNLKINNNFKIPPASMASVSSISI  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFV-QEN  358
            I+SV IYDRI+VP LRK TGNERG++IL+RIGIG+ FSV  M VAA VE  RL     EN
Sbjct  390  IISVPIYDRIIVPNLRKVTGNERGISILRRIGIGLAFSVIVMVVAAFVENMRLRMSGHEN  449

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
                 MSV WL PQ+LI+GIG+ F  +GLQE+FYDQVPDSMRSLG+A YLSV G   FLS
Sbjct  450  L----MSVMWLIPQYLILGIGNSFYSIGLQEFFYDQVPDSMRSLGMALYLSVLGIGFFLS  505

Query  539  SLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            S LI  VD  TA ++G+SW  +D+NSSRLD FYW+L  I A N C+++ + + +TYK VQ
Sbjct  506  SFLIIVVDHVTAGKNGKSWIAEDVNSSRLDKFYWMLAVINALNFCLFLFLTKRHTYKTVQ  565

Query  716  SKTTMAVADCDDDG  757
             K T     C  DG
Sbjct  566  RKATEIDDGCHSDG  579



>gb|KHN17880.1| Putative peptide/nitrate transporter [Glycine soja]
Length=588

 Score =   277 bits (708),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 184/254 (72%), Gaps = 6/254 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N+ PIWLT+L  G+C+A G+T F+KQ A ++ KI N F+IPPA++ S+++I +
Sbjct  334  EETKLILNVFPIWLTSLMTGVCIANGSTLFVKQAAAMNLKINNNFKIPPASMASVSSISI  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFV-QEN  358
            I+SV IYDRI+VP LRK TGNERG++IL+RIGIG+ FSV  M VAA VE  RL     EN
Sbjct  394  IISVPIYDRIIVPNLRKVTGNERGISILRRIGIGLAFSVIVMVVAAFVENMRLRMSGHEN  453

Query  359  TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLS  538
                 MSV WL PQ+LI+GIG+ F  +GLQE+FYDQVPDSMRSLG+A YLSV G   FLS
Sbjct  454  L----MSVMWLIPQYLILGIGNSFYSIGLQEFFYDQVPDSMRSLGMALYLSVLGIGFFLS  509

Query  539  SLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            S LI  VD  TA ++G+SW  +D+NSSRLD FYW+L  I A N C+++ + + +TYK VQ
Sbjct  510  SFLIIVVDHVTAGKNGKSWIAEDVNSSRLDKFYWMLAVINALNFCLFLFLTKRHTYKTVQ  569

Query  716  SKTTMAVADCDDDG  757
             K T     C  DG
Sbjct  570  RKATEIDDGCHSDG  583



>ref|XP_007163482.1| hypothetical protein PHAVU_001G237800g [Phaseolus vulgaris]
 gb|ESW35476.1| hypothetical protein PHAVU_001G237800g [Phaseolus vulgaris]
Length=315

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 169/258 (66%), Gaps = 29/258 (11%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLVIN+VPIWLT+L  G+CVAQG T F+KQ A ++ +I + F+IP A++ S++A+G 
Sbjct  76   EETKLVINLVPIWLTSLTVGVCVAQGTTLFVKQAAAMNLRISDNFKIPAASMSSISAVGT  135

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            ++ V IYDRI+VP+LRK TGNERG+ IL RI IGM   V  M VAA+VE KRL     + 
Sbjct  136  LIIVPIYDRIIVPILRKVTGNERGINILTRISIGMALFVILMVVAAIVEAKRLRMATHDA  195

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  +SMSV WL PQ+LI+G G+ F++VGLQEYFYDQVPD+MRSLG+  YLSV G 
Sbjct  196  LSVWETDHNSMSVLWLIPQYLILGFGNSFSIVGLQEYFYDQVPDTMRSLGMGLYLSVIGT  255

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FLSS LI  VD  T ++G+SW GKD+NSS L+                       YTY
Sbjct  256  GYFLSSFLIIIVDHVTGKNGKSWIGKDINSSHLN----------------------RYTY  293

Query  704  KNVQSKTTMAVADCDDDG  757
            K V  +T +    C +DG
Sbjct  294  KTVH-RTIVETDGCKNDG  310



>gb|KHN07609.1| Putative peptide/nitrate transporter [Glycine soja]
Length=574

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 176/257 (68%), Gaps = 22/257 (9%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+N++PIWLT+L  G+CV QG T F+KQ A++                S+AA+G 
Sbjct  328  EETKLVLNIIPIWLTSLTVGVCVGQGQTLFVKQAASMA---------------SVAAVGT  372

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +++V IYDR++VP+LRK TGNERG++IL+RI IGM  SV  M VAALVE KRL       
Sbjct  373  LIAVPIYDRVVVPILRKVTGNERGISILRRISIGMTLSVLLMVVAALVEAKRLRMAAHEV  432

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T  ++MSV WL PQ+LI+GIGD F+LVGLQEYFYDQVPDSMRS+G+A YLSV G 
Sbjct  433  LTVGETRHETMSVMWLIPQYLILGIGDSFSLVGLQEYFYDQVPDSMRSIGMALYLSVLGV  492

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FL S LI  V+  T ++G SW GKD+NSSRLD FYW+L  I A  LCV++LV++ YTY
Sbjct  493  GFFLCSFLIIIVEHITGKTGNSWIGKDINSSRLDKFYWMLAVINALVLCVFLLVSKRYTY  552

Query  704  KNVQSKTTMAVADCDDD  754
            K VQ +  M    C  D
Sbjct  553  KAVQRR-AMETDCCKSD  568



>gb|ABR17798.1| unknown [Picea sitchensis]
Length=407

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 172/246 (70%), Gaps = 8/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMC-VAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIG  178
            EE KL++ MVPIW ++L FG+  V+Q ATFFI+QG T+DR + + F+IP  ++   + I 
Sbjct  160  EETKLILRMVPIWFSSLTFGLAAVSQNATFFIRQGHTMDRSMGSHFKIPAVSLGVFSTIF  219

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
             +  V IYDR +VP+ R+ TGNERG+T+LQRIGIG+ FS+  M +AAL EKKR++  + +
Sbjct  220  GLAFVIIYDRCMVPLARRITGNERGITVLQRIGIGLFFSLLCMVIAALTEKKRIHAAETH  279

Query  359  ------TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSG  520
                  TT+  MS FWL PQF++ GI D FTLVGLQEYFY++ PDSMRSLGIAFY+SV G
Sbjct  280  GLLDSPTTTIPMSAFWLVPQFVLAGIADVFTLVGLQEYFYNEAPDSMRSLGIAFYVSVLG  339

Query  521  AANFLSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
             A+FL+ L+IT V+  + R G   W   +LN  +L+YFYWLL   +A NLC YV +A  Y
Sbjct  340  VASFLNGLVITLVESMSKRGGHEGWLVNNLNRCKLEYFYWLLAIFSAINLCCYVFIANIY  399

Query  698  TYKNVQ  715
             YK V 
Sbjct  400  NYKKVN  405



>ref|XP_010911895.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Elaeis guineensis]
Length=558

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 174/249 (70%), Gaps = 6/249 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             E K ++ + PIW T L + +  AQ +TFF KQG+TLDR+I + FE+PPA + S  +  +
Sbjct  310  HEAKAILRLFPIWATCLIYAVVFAQSSTFFTKQGSTLDRRIGSNFEVPPAALQSFISASI  369

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +  + IYDRILVP++RK +    G T+LQRIG GM+ S+ +M +AALVE KRL   +E  
Sbjct  370  VAFIPIYDRILVPIVRKYSKKPAGFTMLQRIGTGMVISLISMVIAALVELKRLETAREFG  429

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ GI D FT+VGLQE+FYDQ+PD++RSLG+A YLS+ G 
Sbjct  430  LVDQPAATIPMSLWWLIPQYVLYGIADVFTMVGLQEFFYDQIPDALRSLGLALYLSIFGI  489

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +D+ATA+SG SWF  +LN + LDYFYWLL G++A  L +Y+ +AR Y Y
Sbjct  490  GSFISSFLVSMIDKATAKSGESWFSNNLNRAHLDYFYWLLAGLSALELIIYLYLARVYVY  549

Query  704  KNVQSKTTM  730
            KN +S   +
Sbjct  550  KNKESSAVV  558



>ref|XP_010245117.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X3 [Nelumbo 
nucifera]
Length=530

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K+V+++VPIW T L + +  AQ +TFF KQG T++R I  GFEIPPAT+ S  +I +
Sbjct  284  EEAKVVLSLVPIWATCLIYAVVFAQSSTFFTKQGLTMERSITPGFEIPPATLQSFISIAI  343

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDRI+VP+ R  TG   G+T+LQRIG GM  S+ +M VAA+VEK+RL   +++ 
Sbjct  344  VVFIPIYDRIIVPIARAYTGKPSGITMLQRIGTGMFLSLISMVVAAIVEKERLKVARDSG  403

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D FT+VGLQE+FYDQVP+ +RS+G++ YLS+ G 
Sbjct  404  LVDMPQVTLPMSVWWLVPQYVLFGVSDVFTMVGLQEFFYDQVPNGLRSMGLSLYLSIFGI  463

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+ +++AT+R G+ SWF  +LN + LD+FYWLL G++   L +Y+  A++Y 
Sbjct  464  GNFLSSFLISVIEKATSRGGQDSWFANNLNRAHLDWFYWLLAGLSVIELILYLYFAKSYI  523

Query  701  YKNVQS  718
            Y  V +
Sbjct  524  YNRVSA  529



>ref|XP_010245114.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=577

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K+V+++VPIW T L +G+  AQ +TFFIKQG T+DR I +GFEIPPA++ SL    +
Sbjct  331  EEAKVVLSLVPIWATCLMYGVVFAQSSTFFIKQGLTMDRSITSGFEIPPASLQSLIGAAI  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV + IYDRI+VP+ R  TG   G+T+LQRIG GM  S+ +M VAA+VEK+RL   +++ 
Sbjct  391  IVFIPIYDRIIVPIARAYTGKPSGITMLQRIGTGMFLSLISMVVAAIVEKERLKVARDSG  450

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ GI D FT+VGLQE+FYDQVP+ +RS+G++ YLS+ G 
Sbjct  451  LVDMPQVTLPMSVWWLVPQYVLFGISDVFTMVGLQEFFYDQVPNGLRSMGLSLYLSIFGI  510

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+ +++ T+R G+ SWF  +LN + LD+FYWLL G++   L +Y+  +++Y 
Sbjct  511  GNFLSSFLISVIEKETSRGGQDSWFANNLNRAHLDWFYWLLSGLSVIELVLYLYFSKSYI  570

Query  701  YKNVQS  718
            Y    +
Sbjct  571  YNRASA  576



>ref|XP_010245116.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K+V+++VPIW T L + +  AQ +TFF KQG T++R I  GFEIPPAT+ S  +I +
Sbjct  332  EEAKVVLSLVPIWATCLIYAVVFAQSSTFFTKQGLTMERSITPGFEIPPATLQSFISIAI  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDRI+VP+ R  TG   G+T+LQRIG GM  S+ +M VAA+VEK+RL   +++ 
Sbjct  392  VVFIPIYDRIIVPIARAYTGKPSGITMLQRIGTGMFLSLISMVVAAIVEKERLKVARDSG  451

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D FT+VGLQE+FYDQVP+ +RS+G++ YLS+ G 
Sbjct  452  LVDMPQVTLPMSVWWLVPQYVLFGVSDVFTMVGLQEFFYDQVPNGLRSMGLSLYLSIFGI  511

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+ +++AT+R G+ SWF  +LN + LD+FYWLL G++   L +Y+  A++Y 
Sbjct  512  GNFLSSFLISVIEKATSRGGQDSWFANNLNRAHLDWFYWLLAGLSVIELILYLYFAKSYI  571

Query  701  YKNVQS  718
            Y  V +
Sbjct  572  YNRVSA  577



>ref|XP_010245115.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Nelumbo 
nucifera]
Length=580

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K+V+++VPIW T L + +  AQ +TFF KQG T++R I  GFEIPPAT+ S  +I +
Sbjct  334  EEAKVVLSLVPIWATCLIYAVVFAQSSTFFTKQGLTMERSITPGFEIPPATLQSFISIAI  393

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDRI+VP+ R  TG   G+T+LQRIG GM  S+ +M VAA+VEK+RL   +++ 
Sbjct  394  VVFIPIYDRIIVPIARAYTGKPSGITMLQRIGTGMFLSLISMVVAAIVEKERLKVARDSG  453

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D FT+VGLQE+FYDQVP+ +RS+G++ YLS+ G 
Sbjct  454  LVDMPQVTLPMSVWWLVPQYVLFGVSDVFTMVGLQEFFYDQVPNGLRSMGLSLYLSIFGI  513

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+ +++AT+R G+ SWF  +LN + LD+FYWLL G++   L +Y+  A++Y 
Sbjct  514  GNFLSSFLISVIEKATSRGGQDSWFANNLNRAHLDWFYWLLAGLSVIELILYLYFAKSYI  573

Query  701  YKNVQS  718
            Y  V +
Sbjct  574  YNRVSA  579



>ref|XP_008437001.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437002.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=585

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 177/261 (68%), Gaps = 14/261 (5%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ ++PIW+T L + + ++Q +TFF KQG T+DR I+ GFE+P A++     +G+
Sbjct  321  EEAKAVLRLIPIWVTCLAYAIVLSQISTFFTKQGVTMDRSIVVGFEVPAASLQCFTGLGI  380

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+ IYDRIL+P+ RK TG   G+T+LQRIG GM+ S+ +M +AALVE KRL   QE  
Sbjct  381  IISLLIYDRILIPIARKFTGKPSGITMLQRIGFGMLLSIISMVIAALVEGKRLKTAQEYG  440

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ+++ G+ D FTLVGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  441  LVDLPKAIIPLSIWWLVPQYILFGVADTFTLVGLQEFFYDQVPSGLRSIGLSLYLSILGI  500

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+A+++ T+  G+ SWF  +LN + LDYFYWLL  ++A  L  ++  AR Y 
Sbjct  501  GNFLSSFLISAIEKLTSGDGKQSWFDNNLNKAHLDYFYWLLVVLSAVGLAAFLFSARTYI  560

Query  701  YKNVQSKTTMAVADCDDDGGR  763
            Y   +  TT      +DD GR
Sbjct  561  YN--KGNTTK-----EDDRGR  574



>ref|XP_007163479.1| hypothetical protein PHAVU_001G237500g [Phaseolus vulgaris]
 gb|ESW35473.1| hypothetical protein PHAVU_001G237500g [Phaseolus vulgaris]
Length=591

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 171/258 (66%), Gaps = 10/258 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL++N VP+WLT+L  G C+A G T ++KQ A+++ KI + F++PPA++ SL A   
Sbjct  333  EETKLILNAVPVWLTSLLIGACIAYGTTLYVKQAASMNLKINDSFKVPPASMLSLTAFST  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN-  358
            +VSV IYDRI VP+LRK TGNERG++IL+RIGIG+      M VAALVE KRL  V    
Sbjct  393  LVSVPIYDRI-VPILRKVTGNERGISILRRIGIGLALLTIDMVVAALVETKRLRMVGHEV  451

Query  359  -----TTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
                 T   +M V WL PQ+ I+GIG+ F L GLQEYFY  VPDSM+SLG+A YLS  GA
Sbjct  452  LTRGGTKPVTMHVMWLIPQYSILGIGNSFYLTGLQEYFYHHVPDSMKSLGVALYLSGIGA  511

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              FLS+ +I  V   T  +G+ W  KD+NSSRLD FY L+ G+   NLC++ L+AR  +Y
Sbjct  512  GFFLSTFIINIVAYVTEINGKGWIAKDVNSSRLDKFYGLVAGLNVLNLCIFELLARRESY  571

Query  704  KNVQSKTTMAVADCDDDG  757
            K   ++    +   + DG
Sbjct  572  K---TRKATEIDGSNSDG  586



>gb|ABK25104.1| unknown [Picea sitchensis]
Length=604

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 169/246 (69%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ ++PIW+  L +G+  AQ  TFF KQG+T+DRKI   FEIP A++ S  ++ +
Sbjct  350  EEAKLVLRLLPIWVACLMYGVVFAQSPTFFTKQGSTMDRKIGENFEIPAASLQSFISLSI  409

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V V +YDRI VPV R  T NERG+T+LQRIGIG+  S+ +M VAAL E KRL   ++  
Sbjct  410  LVLVPVYDRIFVPVARSITKNERGITLLQRIGIGIFISILSMTVAALTEMKRLQVAKDYG  469

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S+FWL PQ+++ GI D FT++GLQEYFYDQ+PD+MRS+GIA YLSV G 
Sbjct  470  FEDMPHATIPLSIFWLLPQYILFGISDVFTMIGLQEYFYDQMPDTMRSVGIALYLSVFGI  529

Query  524  ANFLSSLLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS  I+ ++  ++    +SWF  +LN + LDYFYW L  ++A  LC+YV  A  + 
Sbjct  530  GSFLSSFFISIIEELSSGGKEQSWFADNLNRAHLDYFYWFLAALSALFLCIYVTFASCFI  589

Query  701  YKNVQS  718
            YK V++
Sbjct  590  YKKVET  595



>ref|XP_006387190.1| hypothetical protein POPTR_1576s00200g, partial [Populus trichocarpa]
 gb|ERP46104.1| hypothetical protein POPTR_1576s00200g, partial [Populus trichocarpa]
Length=271

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 162/242 (67%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K ++ +VPIW+T+L +    AQ  TFF KQGATLDR I++GF+IP A++       +
Sbjct  25   EDTKALLKLVPIWITSLAYATVFAQTTTFFTKQGATLDRTIVSGFKIPAASLQIFIGFAI  84

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ + +YDRI+VP+ R  T    G+T+LQRIG GM+FS  +M  AALVE KRL   +E+ 
Sbjct  85   ILFIPVYDRIVVPISRGLTRKPSGITMLQRIGTGMVFSAISMVTAALVEMKRLETAKEHG  144

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ GI D  T+VGLQE+ YDQVP  +RSLGI+ YLS+ G 
Sbjct  145  LVDLPNVTVPMSIWWLVPQYILCGIADVLTIVGLQEFCYDQVPKELRSLGISLYLSILGV  204

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS L++ +D AT+  G+ SWF  +LN + LDYFYWLL G++A     Y+  AR+Y 
Sbjct  205  GNFLSSFLVSVIDEATSGDGQESWFANNLNRAHLDYFYWLLAGLSAVGFIAYLYFARSYI  264

Query  701  YK  706
            Y 
Sbjct  265  YS  266



>ref|XP_008783395.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Phoenix dactylifera]
Length=558

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 167/242 (69%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             E K ++ + PIW T L + +  AQ +TFF KQG+TLDR+I +  E+ PA + S  +  +
Sbjct  310  NEAKGILQLFPIWATCLIYAVVFAQSSTFFTKQGSTLDRRIGSNLEVSPAALQSFISASI  369

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLN------  343
            +  + IYDRILVP+ RK T    G T+LQRIG GM+ S+ +M VAALVE KRL       
Sbjct  370  VAFIPIYDRILVPIARKFTKKPAGFTMLQRIGTGMVISLISMVVAALVELKRLETARDFG  429

Query  344  FVQENTTSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
             V + T +  MS++WL PQ+++ GI D FT+VGLQE+FYDQ+PD++RSLG+A YLS+ G 
Sbjct  430  LVDQPTATIPMSLWWLVPQYVLYGIADVFTMVGLQEFFYDQIPDALRSLGLALYLSIFGI  489

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +D+ATA SG SWF  +LN + LDYFYWLL G++A  L +Y+ +A+ Y Y
Sbjct  490  GSFISSFLVSMIDKATAESGESWFSNNLNRAHLDYFYWLLAGLSAVELVIYLYLAQVYAY  549

Query  704  KN  709
            K 
Sbjct  550  KK  551



>gb|ABR17733.1| unknown [Picea sitchensis]
Length=573

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 172/256 (67%), Gaps = 10/256 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ + PIW++ L FG+  AQ +TFF KQGAT+DRKI   FEIPPA++ S   + +
Sbjct  316  EEVKAVLGLSPIWMSCLIFGVVFAQSSTFFTKQGATMDRKI-GKFEIPPASLQSFINLTI  374

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ + +YDRI VP+ R  TGNERG+T LQRIG GM  S+ +M VAAL E +R+   ++N 
Sbjct  375  ILLLPVYDRIFVPIARNLTGNERGITFLQRIGTGMFISILSMIVAALAEIRRIKAAKDNG  434

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S+  L PQ+++ G+ D FT+VG+QEYFYDQ+PD+M++LGIA YLSV G 
Sbjct  435  LIDMPKATIPLSISLLLPQYILFGLADVFTMVGMQEYFYDQMPDTMKTLGIAVYLSVLGV  494

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS++I  +++     G  WF  +LN + LDYFYWLL  ++A N C+Y+ +A  Y Y
Sbjct  495  GSFLSSIIILVIEKL---GGSHWFVNNLNKAHLDYFYWLLASLSAINFCIYMFLASRYKY  551

Query  704  KNVQSKTTMAVADCDD  751
            KN Q+  +     C +
Sbjct  552  KNAQNNISYQEESCRE  567



>gb|KFK34643.1| hypothetical protein AALP_AA5G172400 [Arabis alpina]
Length=549

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 164/252 (65%), Gaps = 53/252 (21%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KL+INM+PIW  TL F                                         
Sbjct  337  EEAKLLINMIPIWFFTLAF-----------------------------------------  355

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
                 +Y+++LVP+LR  TGNERG++ILQRIG GM+FS+ TM +AAL+E++RL+     T
Sbjct  356  -----VYEKLLVPLLRHITGNERGISILQRIGTGMVFSLITMIIAALIERRRLDHYNNMT  410

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
                MS  WLAPQF+IIGI D FTLVGLQEYFYDQVPDSMRSLGIAFYLSV GAA+F+++
Sbjct  411  ----MSAIWLAPQFIIIGIADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVIGAASFVNT  466

Query  542  LLITAVDR-ATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQS  718
            LL+T  DR A   SG+SWFGKDLNSSRLD FYW L  +TA N+C +V+VA+ YTYK+VQ 
Sbjct  467  LLMTVCDRLAEEISGKSWFGKDLNSSRLDRFYWTLASLTAVNICFFVVVAKRYTYKSVQP  526

Query  719  KTTMAVADCDDD  754
              ++AV D  DD
Sbjct  527  --SLAVVDGGDD  536



>ref|XP_002304796.2| hypothetical protein POPTR_0003s19700g [Populus trichocarpa]
 gb|EEE79775.2| hypothetical protein POPTR_0003s19700g [Populus trichocarpa]
Length=291

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 173/261 (66%), Gaps = 6/261 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+   F   + Q  T FIKQG+T+ R I   F++PPA+  SL  + +
Sbjct  25   EEVKLVLRLLPIWLSCFMFTAVLVQTHTLFIKQGSTMIRSIGPNFQVPPASFQSLVGLTI  84

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + ++ IYDRI VP  RK TG+  G+T+LQRIGIG+  S+  M VAA VE KR++  +E+ 
Sbjct  85   LFTIPIYDRIFVPAARKLTGHRSGITMLQRIGIGLFLSIVEMVVAAQVEAKRVSIAREHG  144

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV+W+ PQ++I GI D FT+VGLQE FYDQ+P+SMRSLG A ++SV G 
Sbjct  145  LMDTPKATIPMSVWWILPQYMISGISDVFTVVGLQELFYDQMPESMRSLGAAAHISVIGV  204

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+++ +ITAV   TARS     G +LN + +DYFYW++  ++A N CVY+ +A  + Y
Sbjct  205  GSFINTAIITAVQAITARSIGILLGDNLNRAHVDYFYWVMAALSALNFCVYLWIASGFVY  264

Query  704  KNVQSKTTMAVADCDDDGGRD  766
            K V++   +  +   D G RD
Sbjct  265  KKVEAWDRVWTSYQKDRGKRD  285



>ref|XP_008339153.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Malus 
domestica]
Length=684

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 171/243 (70%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K V+ + PIW+T L + +  AQ +TFF KQGAT+DR I+ GF +P A++ +  +I +
Sbjct  312  EDAKAVLRLFPIWVTCLAYAVVFAQYSTFFTKQGATMDRTIVPGFNVPAASLQTFISIAI  371

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDRI VP+ R  TG   G+T+LQRIG GM+ S+  M +AALVE KRL   ++  
Sbjct  372  VIFLPIYDRIFVPIARYVTGKPAGITMLQRIGTGMVLSIILMVIAALVEMKRLKXAKDYG  431

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MS++WLAPQ+L+ GI DGFT+VGLQE+FYDQVP+ +RS+G+A YLS+ G 
Sbjct  432  LLDTPSATVPMSIWWLAPQYLLAGIADGFTMVGLQEFFYDQVPNELRSVGLALYLSIFGV  491

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ +D  T+ +G  SWF  +LN + LDYFYWLLGGI+   L +Y+  A++Y 
Sbjct  492  GSFLSSFLISIIDDITSLAGESSWFSSNLNRAHLDYFYWLLGGISLVQLVIYLYFAKSYI  551

Query  701  YKN  709
            YK+
Sbjct  552  YKS  554



>ref|XP_003546719.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Glycine max]
Length=576

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 169/245 (69%), Gaps = 6/245 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F +  AQ  TFFIKQGAT+ R I   F++PPA++  L  + +
Sbjct  313  EEVKLVLRLIPIWLSCLMFTVVQAQVHTFFIKQGATMVRTIGPHFQVPPASLQGLVGVTI  372

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + +V  YDR+ VP+ RK TG   G+T+LQRIG+G+  S+  M V+ALVE KR+   +E+ 
Sbjct  373  LFAVPFYDRVFVPLARKITGKPTGITVLQRIGVGLFLSILNMVVSALVEAKRVGVAKESG  432

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ++I GI D FT+VGLQE FYDQ+P+++RSLG A Y+S+ G 
Sbjct  433  LIDDPKAVLPISIWWLLPQYMITGISDAFTIVGLQELFYDQMPEALRSLGAAAYISIVGV  492

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+ +++I  V+  T+R+G  W G +LN + LDYFYW+L G++A NLCVYV +A  Y Y
Sbjct  493  GSFVGNIVIVVVEGVTSRAGEKWLGNNLNRAHLDYFYWVLAGLSAVNLCVYVWLAIVYVY  552

Query  704  KNVQS  718
            K V  
Sbjct  553  KKVDE  557



>ref|XP_008437003.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=563

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 166/243 (68%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L F +  +Q +TFF KQG T+DR I  GFE+P A++ S  ++ +
Sbjct  317  EEAKAVLRLVPIWVTCLAFAIVFSQSSTFFTKQGVTMDRSIAFGFEVPAASLQSFISLAI  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDRIL+P+ R  TG   G+T LQRIG GM+ S  +M +AALVE KRL   QE  
Sbjct  377  VISLMIYDRILIPIARNFTGKPSGITTLQRIGFGMLLSAISMVIAALVEIKRLKTAQEYG  436

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  437  LVDLPKATVPLSIWWLVPQYVLFGVADAFTMVGLQEFFYDQVPSGLRSIGLSLYLSIFGI  496

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+A+++ T+ +G+ SWF  +LN + LDYFYWLL G++A  L  ++   R Y 
Sbjct  497  GNFLSSFLISAIEKLTSGNGKQSWFDNNLNKAHLDYFYWLLVGLSALGLAAFLFSTRTYI  556

Query  701  YKN  709
            Y  
Sbjct  557  YNK  559



>ref|XP_010095904.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62498.1| putative peptide/nitrate transporter [Morus notabilis]
Length=561

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 170/243 (70%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L +G+  AQ  TFF KQGAT++R I+ GF+IPPA++ S  ++ +
Sbjct  317  EEAKAVLRLVPIWVTCLVYGIVFAQCPTFFTKQGATMERTIVPGFDIPPASLQSTVSLAV  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDR++VPV R  TG   G+T+LQRIG GM  SV +M +AALVE KRL   +E  
Sbjct  377  LVFIPIYDRVVVPVARAFTGKPSGITMLQRIGTGMFLSVLSMIIAALVEIKRLQTAREYD  436

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV+WL PQ+++ GI D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  437  LVDTPGMTVPMSVWWLLPQYILSGISDVFTMVGLQEFFYDQVPTELRSIGLSLYLSIFGV  496

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ ++ AT   GR SWF  +LN + LDY+YWLL G+++  L +Y   AR+Y 
Sbjct  497  GSFLSSFLISIIEEATGGDGRHSWFSNNLNKAHLDYYYWLLTGLSSVALFLYWYFARSYI  556

Query  701  YKN  709
            Y+ 
Sbjct  557  YRK  559



>ref|XP_009362432.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 168/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K V+ + PIW+T L + +  AQ +TFF KQGAT+DR I+ GF +P A++ +  +  +
Sbjct  312  EDAKAVLRLFPIWVTCLAYAVVFAQYSTFFTKQGATMDRTIVPGFNVPAASLQTFISFAI  371

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDRI VP+ R  TG   G+T+LQRIG GM+ S+  M +AALVE KRL   ++  
Sbjct  372  VIFLPIYDRIFVPIARSVTGKPAGITMLQRIGTGMVLSIILMVIAALVEMKRLKTAKDYG  431

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MS++WL PQ+L+ GI D FT+VGLQE+FYDQVP+ +RS+G+A YLS+ G 
Sbjct  432  LLDTPSATVPMSIWWLVPQYLLAGIADVFTMVGLQEFFYDQVPNELRSVGLALYLSIFGV  491

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ +D  T+ +G  SWF  +LN + LDYFYWLLGGI+   L +Y+  A++Y 
Sbjct  492  GSFLSSFLISVIDDITSLAGESSWFSSNLNRAHLDYFYWLLGGISLVQLVIYLYFAKSYI  551

Query  701  YKN  709
            YK+
Sbjct  552  YKS  554



>ref|XP_008375473.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Malus domestica]
Length=394

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 172/262 (66%), Gaps = 8/262 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++P+WL+ L FG+  AQ  TFF KQ +T  R I   F++P A++  L  I +
Sbjct  132  EEVKLVLRLIPLWLSCLMFGVIEAQLHTFFTKQSSTTIRSISPHFQVPAASLQGLVGIAI  191

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR  VP+ RK TG+  G+T+LQRIGIG+  S+  M V+ALVE KRLN  ++  
Sbjct  192  LIAVPIYDRFFVPIARKYTGHPSGITVLQRIGIGLALSILVMVVSALVEAKRLNIAKDYN  251

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+LI+G+ + FT VGLQE FYDQ+P+ MRS+G A  +SV G 
Sbjct  252  LIDKAKAMVPMRVWWLLPQYLILGLANAFTTVGLQELFYDQMPEQMRSMGAAASMSVVGV  311

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+S+ +I+  +  T+R+G  W G ++N + LDYFYW+L  ++  NLCVYVL+A  + Y
Sbjct  312  GSFISNWIISVAELITSRNGDKWLGDNINRAHLDYFYWVLAVLSTLNLCVYVLIANAFVY  371

Query  704  KNV--QSKTTMAVADCDDDGGR  763
            K V  + K    ++  ++ GG 
Sbjct  372  KKVGREVKVKTDLSFANNHGGE  393



>gb|KHN37667.1| Putative peptide/nitrate transporter [Glycine soja]
Length=561

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 169/247 (68%), Gaps = 8/247 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F +  +Q  TFFIKQGAT++R I   F++PPA++  L  + +
Sbjct  295  EEVKLVLRLIPIWLSCLMFTVVQSQVHTFFIKQGATMERSIGPHFQVPPASLQGLVGVTI  354

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + +V  YDR+ VP+ RK TG   G+T+LQRIG+G+  S+  M V+ALVE KR+   +E  
Sbjct  355  LFAVPFYDRVFVPLARKITGKPTGITVLQRIGVGLFLSILNMVVSALVEDKRVGVAKEFG  414

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ++I GI D FT+VGLQE FYDQ+P+S+RSLG A Y+S+ G 
Sbjct  415  LIDDPKAVLPISIWWLLPQYMITGISDAFTIVGLQELFYDQMPESLRSLGAAAYISIVGV  474

Query  524  ANFLSSLLITAVDRATARS--GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
             +F+ +++I  V+  T+R+  G  W G +LN + LDYFYW+L G++A NLCVYV +A  Y
Sbjct  475  GSFVGNIVIIVVEAVTSRAGDGEKWLGNNLNRAHLDYFYWVLAGLSAVNLCVYVWLAIAY  534

Query  698  TYKNVQS  718
             YK V  
Sbjct  535  VYKKVDE  541



>gb|EMT07135.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=358

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 166/251 (66%), Gaps = 28/251 (11%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV++MVPIW+ TLPFG+  AQ +TFF+KQG+ +DR++   F +PPA+I + A    
Sbjct  127  EETKLVVSMVPIWVATLPFGITTAQVSTFFVKQGSVMDRRMGPHFVLPPASILAPA----  182

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
                            + TG ERGL++L+RIG+GM  +V  MAVAA VE++RL       
Sbjct  183  ----------------RVTGTERGLSVLRRIGVGMALAVVAMAVAAGVERRRL------P  220

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            ++  MSV WL PQF ++G+ DGF LVGLQEYFYDQVPDSMRSLGI  YLSV GA +FLS 
Sbjct  221  STAPMSVCWLLPQFALMGVADGFALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAGSFLSG  280

Query  542  LLITAVDRATARSGR--SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
            L+I A D  ++  GR   WFGKDL+ SRLD FYWLL  I+A NL  YVLVA  Y+YK   
Sbjct  281  LVIAAADHVSSHGGRRAGWFGKDLSRSRLDLFYWLLAAISAVNLGFYVLVAARYSYKQTV  340

Query  716  SKTTMAVADCD  748
                ++ +D +
Sbjct  341  KAKRVSASDVE  351



>emb|CDX68284.1| BnaA07g23240D [Brassica napus]
Length=261

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 159/236 (67%), Gaps = 2/236 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW++ L + +  AQ +TFFIKQGAT+DR I  GF +P AT  S   I +
Sbjct  22   EETKAVLRLVPIWMSCLVYAIVNAQASTFFIKQGATMDRSISPGFLVPSATFQSFINISI  81

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR+LVP  R  T    G+T+LQRIG G+  S+  M VAALVE KRL   +++ 
Sbjct  82   VIFIPIYDRVLVPAARSFTQIPSGITMLQRIGTGIFLSIIAMVVAALVETKRLQTAKDDL  141

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            T   MSV+WL PQ++I G+ D FT+ GLQE+FYDQVP  +RS+G+A  LS+ GA NFLSS
Sbjct  142  TI-PMSVWWLVPQYVIYGVADVFTMAGLQEFFYDQVPSELRSVGMALNLSIFGAGNFLSS  200

Query  542  LLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYK  706
             +I+ +DR T++SG+ SWF  +LN   LDYFYWLL  ++      Y+   ++Y Y 
Sbjct  201  FMISVIDRVTSQSGQTSWFDNNLNKGHLDYFYWLLASLSLIGFAFYLGFTKSYVYN  256



>ref|XP_004143744.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101218147 
[Cucumis sativus]
Length=1122

 Score =   256 bits (654),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 172/261 (66%), Gaps = 9/261 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+  L F +  +Q +TFFIKQG T+DR I  GFE+P A++ S  ++ +
Sbjct  317  EEAKAVLRLVPIWVACLAFAIVFSQSSTFFIKQGVTMDRSITFGFEVPSASLQSFISLSI  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDRIL+P+ R  TG   G+T+LQRIG GM+ S  +M +AALVE KRL   QE  
Sbjct  377  VISLLIYDRILIPIARNFTGKPSGITMLQRIGFGMLLSAISMVIAALVEIKRLKTAQEYG  436

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  437  LVDMPKATIPLSIWWLVPQYVLFGVADAFTMVGLQEFFYDQVPSGLRSIGLSLYLSIFGI  496

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+A+++ T+  G+ SWF  +LN + LDYFYWLL G++   L  +V  AR Y 
Sbjct  497  GNFLSSFLISAIEKLTSGDGKQSWFDNNLNKAHLDYFYWLLVGLSVIGLAAFVFCARTYI  556

Query  701  YKNVQSKTTMAVADCDDDGGR  763
            Y   +  TT  V    D  G 
Sbjct  557  YN--KGNTTXTVEGVVDYHGH  575


 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2     EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             E+ K V+ +VPIW+T L + +  +Q +TFFIKQG T+DR I  GF+IP A++ SL  +G+
Sbjct  874   EDAKAVLRLVPIWVTCLGYAIVFSQSSTFFIKQGVTMDRSIAGGFKIPAASLQSLIGLGI  933

Query  182   IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
             ++S+ IYD IL+P  RK TGN  G+T+LQRIG GM+ S+ +M VAALVE KRL   QE  
Sbjct  934   MISLLIYDCILIPTARKFTGNPSGITMLQRIGFGMLLSIISMVVAALVEGKRLKTAQEYG  993

Query  362   TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
               D       +S++WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  994   LVDMPKATIPLSIWWLVPQYILFGVADTFTMVGLQEFFYDQVPSGLRSIGLSLYLSIFGI  1053

Query  524   ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
               FLSS LI+A+++ T+  G+ SWF  +LN + L+YFYWLL  ++   L  ++  AR Y 
Sbjct  1054  GYFLSSFLISAIEKLTSGYGKQSWFDNNLNKAHLEYFYWLLVVLSVVGLAAFLFSARTYI  1113

Query  701   YKN  709
             Y  
Sbjct  1114  YNK  1116



>ref|XP_003542826.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Glycine max]
Length=579

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 169/247 (68%), Gaps = 8/247 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F +  +Q  TFFIKQGAT++R I   F++PPA++  L  + +
Sbjct  313  EEVKLVLRLIPIWLSCLMFTVVQSQVHTFFIKQGATMERSIGPHFQVPPASLQGLVGVTI  372

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + +V  YDR+ VP+ RK TG   G+T+LQRIG+G+  S+  M V+ALVE KR+   +E  
Sbjct  373  LFAVPFYDRVFVPLARKITGKPTGITVLQRIGVGLFLSILNMVVSALVEDKRVGVAKEFG  432

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ++I GI D FT+VGLQE FYDQ+P+S+RSLG A Y+S+ G 
Sbjct  433  LIDDPKAVLPISIWWLLPQYMITGISDAFTIVGLQELFYDQMPESLRSLGAAAYISIVGV  492

Query  524  ANFLSSLLITAVDRATARS--GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
             +F+ +++I  V+  T+R+  G  W G +LN + LDYFYW+L G++A NLCVYV +A  Y
Sbjct  493  GSFVGNIVIIVVEAVTSRAGDGEKWLGNNLNRAHLDYFYWVLAGLSAVNLCVYVWLAIAY  552

Query  698  TYKNVQS  718
             YK V  
Sbjct  553  VYKKVDE  559



>ref|XP_004499763.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X1 [Cicer arietinum]
 ref|XP_004499764.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X2 [Cicer arietinum]
Length=543

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 169/246 (69%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW T+L F +  +Q +TFFIKQG T+DRKI+  F +PPA++ S  ++ +
Sbjct  298  EEAKAVLRLVPIWATSLIFAIVFSQSSTFFIKQGVTMDRKILPTFNVPPASLQSFISLSI  357

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + +YDRI+VP+ R  TG   G+T+LQRIG+GM FSV +M VAA VE KRL   +++ 
Sbjct  358  VLFIPVYDRIIVPIARAFTGKPSGITMLQRIGVGMFFSVISMVVAAFVEMKRLKVARDHG  417

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ G+ D FT++GLQE+FYDQVPD +RS+G+A YLS+ G 
Sbjct  418  LLDMPNVTIPMSIWWLIPQYVLFGVSDVFTMIGLQEFFYDQVPDELRSIGLALYLSIFGV  477

Query  524  ANFLSSLLITAVDRATARSG-RSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A+ + T++ G   WF  +LN + LDYFY LL  ++A  L  +   +++Y 
Sbjct  478  GSFLSSFLISAIQKGTSKDGCDGWFASNLNRAHLDYFYALLAVLSAVELSAFWFFSKSYV  537

Query  701  YKNVQS  718
            YK   +
Sbjct  538  YKRTST  543



>ref|XP_008240575.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Prunus mume]
Length=572

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ + PIW+T L + +  AQ +TFF KQGAT+DR I  G +IP A++ +  +I +
Sbjct  326  EEAKSVLRLFPIWVTCLAYAVVFAQYSTFFTKQGATMDRTIAPGLDIPAASLQTFISITI  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ V IYDRI VP+ R  T    G+T+LQRIGIGM  S+ +MAVAALVE KRL   ++  
Sbjct  386  VIFVPIYDRIFVPIARVFTRKPSGITMLQRIGIGMFISIISMAVAALVEMKRLKTAKDYG  445

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+L+ G+ D FT+VGLQE+FYDQVP+ ++S+G+A YLS+ G 
Sbjct  446  LLDMPSATVPMSIWWLVPQYLLAGLADVFTMVGLQEFFYDQVPNELKSIGLALYLSIFGV  505

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A+D AT  +G  SWF  +LN + LDYFYWLLGGI+   L +Y+  A++Y 
Sbjct  506  GSFLSSFLISAIDDATTWAGETSWFSTNLNRAHLDYFYWLLGGISVVELAIYLYFAKSYI  565

Query  701  YKN  709
            Y  
Sbjct  566  YNR  568



>ref|XP_009362428.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 168/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ + PIW T L + +  AQ +TFF KQGAT+DR I+ GF++P A++ +L++I +
Sbjct  312  EEAKAVLRLFPIWATCLAYALVFAQCSTFFTKQGATMDRTIVPGFDVPAASLQTLSSIAI  371

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+ IYDRI VPV R  T    G+++LQRIG GM  S+ +M +AALVE KRL   ++  
Sbjct  372  IISLPIYDRIFVPVARSFTRIPSGISMLQRIGTGMFMSIISMVIAALVEMKRLKTAKDYG  431

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      M ++WL PQ+L+ GI D FT+VGLQE+FYDQVP+ +RS+G+A YLS+ G 
Sbjct  432  LLDTPSATVPMCIWWLVPQYLLTGISDIFTMVGLQEFFYDQVPNELRSVGLALYLSIFGV  491

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +F+SS LI+ +D  T+  G  SWF  +LN + LDYFYWLLGGI+   L +Y+   ++Y 
Sbjct  492  GSFISSCLISVIDDITSLPGESSWFSNNLNRAHLDYFYWLLGGISLVQLVIYLYFVKSYI  551

Query  701  YKN  709
            YK+
Sbjct  552  YKS  554



>emb|CDM85179.1| unnamed protein product [Triticum aestivum]
Length=549

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 172/258 (67%), Gaps = 11/258 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE++ ++ + PIW T + + +  +Q +TFF KQ ATLDR+I   F +PPA + +  ++ +
Sbjct  294  EEVRGLLRLFPIWATCIIYAVIFSQSSTFFTKQAATLDRRIGATFRVPPAALQTFISLTI  353

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I  + +YDR+ VP  R+ T    G+T+LQRIG G++ ++  M VAALVE +RL   ++  
Sbjct  354  ITFIPVYDRLFVPAARRFTRLSSGITMLQRIGTGLVLALVAMVVAALVEARRLGVARDAG  413

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G+ D F ++GLQE+FYDQVPD++RSLG+AF+LS+ G 
Sbjct  414  LVDDPKVALPMSLWWMVPQYVLFGLSDVFAMIGLQEFFYDQVPDALRSLGLAFFLSIFGV  473

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS LI+A+D AT +SG SWF  +LN + LDYFYWLL G+ AA L  +V+V+R Y Y
Sbjct  474  GHFLSSFLISAIDGATKKSGASWFSNNLNRAHLDYFYWLLAGLCAAELAAFVVVSRVYVY  533

Query  704  KNVQSKTTMAVADCDDDG  757
            K       +A  D DD G
Sbjct  534  KK-----RVAHHDHDDGG  546



>gb|ABK24896.1| unknown [Picea sitchensis]
Length=574

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 168/254 (66%), Gaps = 9/254 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E++K ++ + PIW++ L FG+  AQ +TFF KQGAT+DRKI   FEIP A++    ++ +
Sbjct  316  EDVKAILGLSPIWMSCLIFGVVFAQSSTFFTKQGATMDRKIGKHFEIPAASLQGFISLSI  375

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ + +YDRI VP  RK TGNERG+T LQRIG GM  S+ +M VAAL E +R+   ++N 
Sbjct  376  ILLLPVYDRIFVPNARKLTGNERGITFLQRIGTGMFISILSMIVAALAEIRRIKAAKDNG  435

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S+  L PQ+++ GI D FT+VGLQEYFYDQ+PD+M++LGIA YLSV G 
Sbjct  436  LIDMPEATIPLSISLLLPQYILFGIADVFTMVGLQEYFYDQMPDTMKTLGIAVYLSVFGV  495

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS++I   ++     G  WF  +LN + LDYFYWLL  ++A N  +Y+ +A  Y Y
Sbjct  496  GSFLSSIIILVTEKL---GGSRWFVNNLNKAHLDYFYWLLASLSAINFFIYMFLASRYKY  552

Query  704  KNVQSKTTMAVADC  745
            KN Q+  +     C
Sbjct  553  KNAQNNISYQEESC  566



>ref|XP_008437711.1| PREDICTED: uncharacterized protein LOC103483057 [Cucumis melo]
Length=1156

 Score =   254 bits (650),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L + +  +Q +TFFIKQG T+DR I+ GFE+P A++ S   +G+
Sbjct  317  EEAKAVLRLVPIWVTCLAYAIVFSQSSTFFIKQGVTMDRSIVVGFEVPAASLQSFIGLGI  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+S+ IYDRIL+P  RK TG   G+T+LQRIG GM+ S+ +M VAALVE KRL   QE+ 
Sbjct  377  IISLLIYDRILIPTARKFTGKPSGITMLQRIGFGMLLSIISMVVAALVEGKRLKTAQEHG  436

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  437  LVDLPKATIPLSIWWLVPQYILFGVADTFTMVGLQEFFYDQVPSGLRSIGLSLYLSIFGI  496

Query  524  ANFLSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI+A++  T+  G+  WF  +LN + LDYFYW L  ++A  L  ++  AR Y 
Sbjct  497  GNFLSSFLISAIENLTSGDGKQGWFDNNLNKAHLDYFYWFLVVLSAVGLAAFLFSARTYI  556

Query  701  YKN  709
            Y  
Sbjct  557  YNK  559


 Score =   243 bits (621),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 165/243 (68%), Gaps = 7/243 (3%)
 Frame = +2

Query  2     EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             EE K V+ ++PIW+T L + + ++Q +TFF KQG T+DR I+ GFE+P A++ S  ++ +
Sbjct  910   EEAKAVLRLIPIWVTCLAYAIVLSQISTFFTKQGVTMDRSIVVGFEVPAASLQSFISLTV  969

Query  182   IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
             ++S+ IYDRIL+P  RK TG   G+T+LQRIG GM+ S+  M VAALVE KRL   QE  
Sbjct  970   VISLVIYDRILIPTARKFTGKPSGITMLQRIGFGMLLSIICMVVAALVEVKRLKTAQEYG  1029

Query  362   TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
               D       +S++WL PQ+++ G+   FT VGLQE+FYDQVP  + S+G++ YLSV G 
Sbjct  1030  LVDLPKATIPLSIWWLVPQYVLFGVASTFTTVGLQEFFYDQVPSGLGSIGVSLYLSVFGV  1089

Query  524   ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
              +FLSS LI+A++  T+  G+ SWF  +LN + LDYFYWLL G++   L  ++ +AR Y 
Sbjct  1090  GSFLSSFLISAIENVTSGDGKQSWFDNNLNKAHLDYFYWLLVGLSVVGLAAFLCLARTYI  1149

Query  701   YKN  709
             Y  
Sbjct  1150  YNK  1152



>ref|XP_007204887.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
 gb|EMJ06086.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
Length=572

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 166/243 (68%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ + PIW+T L + +  AQ +TFF KQGAT+DR I  G +IP A++ +  +I +
Sbjct  326  EEAKSVLRLFPIWVTCLAYAVVFAQYSTFFTKQGATMDRTIAPGLDIPAASLQTFISITI  385

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ V IYDRI VP+ R  T    G+T+LQRIGIGM  S+ +M VAALVE KRL   ++  
Sbjct  386  VIFVPIYDRIFVPIARVFTRKPSGITMLQRIGIGMFISIISMVVAALVEMKRLKTAKDYG  445

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+L+ G+ D FT+VGLQE+FYDQVP+ ++S+G+A YLS+ G 
Sbjct  446  LLDMPSATVPMSIWWLVPQYLLAGLADVFTMVGLQEFFYDQVPNELKSIGLALYLSIFGV  505

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A+D AT  +G  SWF  +LN + LDYFYWLLGGI+   L +Y+  A++Y 
Sbjct  506  GSFLSSFLISAIDDATTWAGETSWFSTNLNRAHLDYFYWLLGGISVVELAIYLYFAKSYI  565

Query  701  YKN  709
            Y  
Sbjct  566  YNR  568



>ref|XP_008375318.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Malus domestica]
Length=466

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 172/262 (66%), Gaps = 8/262 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++P+WL+ L FG+  AQ  TFF KQ +T  R I   F++P A++  L  I +
Sbjct  204  EEVKLVLRLIPLWLSCLMFGVIEAQLHTFFTKQSSTTIRSISPHFQVPAASLQGLVGIAI  263

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR  VP+ RK TG+  G+T+LQRIGIG+  S+  M V+ALVE KRLN  ++  
Sbjct  264  LIAVPIYDRFFVPIARKYTGHPSGITVLQRIGIGLALSILVMVVSALVEAKRLNIAKDYN  323

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+LI+G+ + FT VGLQE FYDQ+P+ MRS+G A  +SV G 
Sbjct  324  LIDKXKAXVPMRVWWLLPQYLILGLANAFTTVGLQELFYDQMPEQMRSMGAAASMSVVGV  383

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+S+ +I+  +  T+R+G  W G ++N + LDYFYW+L  ++  NLCVYVL+A  + Y
Sbjct  384  GSFISNWIISVAELITSRNGDKWLGDNINRAHLDYFYWVLAVLSTLNLCVYVLIANAFVY  443

Query  704  KNV--QSKTTMAVADCDDDGGR  763
            K V  + K    ++  ++ GG 
Sbjct  444  KKVGREVKVKTDLSFANNHGGE  465



>gb|KDP27339.1| hypothetical protein JCGZ_20271 [Jatropha curcas]
Length=579

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 162/247 (66%), Gaps = 7/247 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW T+L + +  AQ  TFF KQG T+DR I  GF IPPA++ S + I  
Sbjct  330  EEAKAVLRLVPIWATSLLYAVVFAQSTTFFTKQGKTMDRSITKGFAIPPASLQSFSTIAS  389

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ V IYDR+ VPV R  T    G+T+LQRIGIGM  S  ++ + ALVE KRL   +E  
Sbjct  390  VLFVPIYDRVFVPVARALTRKTSGITMLQRIGIGMALSSLSLVICALVEMKRLEIAREYG  449

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  450  LVDMPNVTVPMSVWWLVPQYVLFGVSDVFTMVGLQEFFYDQVPSELRSVGLSLYLSIFGV  509

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +++SS L++A+++AT   GR SWF  ++N   LDYFYWLL G++   L  Y   A++Y 
Sbjct  510  GSYISSFLVSAIEKATGGEGRDSWFANNMNRGHLDYFYWLLAGMSTVQLLAYFYFAKSYV  569

Query  701  YKNVQSK  721
            YK+  S 
Sbjct  570  YKSTASS  576



>emb|CDP10687.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 162/242 (67%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ + PIW T L +G+  AQ +T F KQGAT+DR I   FE+P A++ S   + +
Sbjct  332  EEAKAVLRLFPIWTTCLVYGIVFAQSSTVFTKQGATMDRSISPSFELPAASLQSFITLSI  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDRILVPV R  T    G+T+LQRIGIG++ S  +M +AA VE KRL   QE  
Sbjct  392  VVFIPIYDRILVPVARAITSRPSGITMLQRIGIGILLSTVSMCIAAAVEMKRLETAQEYG  451

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV W+ PQ+LI+G+ +   +VGLQE+FYDQVP+ ++S G+A YLS+ G 
Sbjct  452  LVDKPEATIPMSVIWMIPQYLILGVSESLAMVGLQEFFYDQVPNQLKSTGLALYLSIFGI  511

Query  524  ANFLSSLLITAVDRATARSG-RSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ +D+AT+R G +SWF  +LN   LDYFYWLL G++A  L  Y+ VA++Y 
Sbjct  512  GSFLSSFLISVIDKATSRHGHQSWFSDNLNKGHLDYFYWLLAGLSAIALTAYLYVAKSYV  571

Query  701  YK  706
            Y 
Sbjct  572  YN  573



>ref|XP_003597990.1| Peptide transporter PTR3-A [Medicago truncatula]
 gb|AES68241.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=547

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 169/246 (69%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K ++ +VPIW T+L F +  +Q +TFF KQG TLDRKI+ GF +PPA++ S  ++ +
Sbjct  302  EEAKAILRLVPIWATSLIFAIVFSQSSTFFTKQGVTLDRKILPGFYVPPASLQSFISLSI  361

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + +YDRI+VP+ R  TG   G+T+LQRIG G++FSV +M +AA VE KRL   +++ 
Sbjct  362  VLFIPVYDRIIVPIARTFTGKPSGITMLQRIGAGILFSVISMVIAAFVEMKRLKVARDHG  421

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ G+ D FT+VGLQE+FYDQVPD +RS+G++ YLS+ G 
Sbjct  422  LIDMPDVTIPMSIWWLIPQYVLFGVSDVFTMVGLQEFFYDQVPDELRSVGLSLYLSIFGV  481

Query  524  ANFLSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A+ + T++ G   WF  +LN + LDYFY LL  ++A  L  +   +++Y 
Sbjct  482  GSFLSSFLISAIQKGTSKDGHDGWFASNLNRAHLDYFYALLAALSAVGLTAFWFFSKSYV  541

Query  701  YKNVQS  718
            YK   +
Sbjct  542  YKRTST  547



>ref|XP_008347002.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Malus domestica]
Length=467

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 165/246 (67%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L FG+  AQ  TFF KQ +T  R I   F++P A++  L  I +
Sbjct  205  EEVKLVLRLIPIWLSCLMFGVIQAQLHTFFTKQSSTTIRSIGPHFQVPAASLQGLVGIAI  264

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR+ VPV RK TG+  G+T+LQRIGIG++ S+  M V+ALVE KRLN  ++  
Sbjct  265  LIAVPIYDRVFVPVARKHTGHPSGITVLQRIGIGLVLSILLMVVSALVEAKRLNIAKDYN  324

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+LI+G+ D FT VGLQE FYDQ+P+ MRS+G A  +SV G 
Sbjct  325  LIDKPKAIIPMRVWWLLPQYLILGLADAFTTVGLQELFYDQMPEQMRSMGAAASMSVVGV  384

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F S+ +I+A +  T+R+G  W G ++N + LDYFYW+L  ++  N CVY + A  + Y
Sbjct  385  GSFTSNWIISAXELITSRNGNKWLGDNINXAHLDYFYWVLAVLSTLNFCVYGVXASAFVY  444

Query  704  KNVQSK  721
            K V+ +
Sbjct  445  KKVERE  450



>ref|XP_010272859.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=578

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 172/243 (71%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE ++V+N+VPIW T L F +   Q +TFF+KQG T+DR I++GFEIPPA++ S  ++ +
Sbjct  332  EEARVVLNLVPIWATCLMFAVVSVQCSTFFVKQGYTMDRSIMSGFEIPPASLISSISLSV  391

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDR++VP+ R  T    G+T+LQRIGIGM  SV +M VAA+VEKKRL   +++ 
Sbjct  392  VVFIPIYDRVIVPIARAYTKKPSGITMLQRIGIGMFLSVISMVVAAVVEKKRLKVARDSG  451

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+++ G+ D FTLVGLQE+FYDQVP+ +RS+G++ YLS+ G 
Sbjct  452  LVDIPQATLPMRVWWLVPQYVLFGLADVFTLVGLQEFFYDQVPNGLRSMGLSLYLSIFGM  511

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI  +++AT+R G+ SWF  +LN + LD+FY+LL G++A     Y+  A++Y 
Sbjct  512  GNFLSSFLIAVIEKATSRGGQVSWFANNLNQAHLDWFYFLLAGLSAVEFAFYLYFAKSYI  571

Query  701  YKN  709
            Y  
Sbjct  572  YNK  574



>ref|XP_002456711.1| hypothetical protein SORBIDRAFT_03g041200 [Sorghum bicolor]
 gb|EES01831.1| hypothetical protein SORBIDRAFT_03g041200 [Sorghum bicolor]
Length=534

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 169/242 (70%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ ++PIW + + + +  +Q +TFF KQ ATLDR+I   F++PPA + +  ++ +
Sbjct  281  EEVKSVLRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGARFKVPPAALQTFISVSI  340

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE--  355
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  +A++ALVE KRL    E  
Sbjct  341  VVFIPVYDRLFVPLARRYTGRPTGITMLQRVGAGLALSLVAVALSALVEMKRLRVATEAG  400

Query  356  --NTTSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              NT      M+++W+ PQ+++IG+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  401  LVNTPKAQLPMTLWWMVPQYILIGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  460

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             + LSSLLI+ +D+ TARSG SWF  +LN + LDYFYWLL G+ A  L  +VL +R Y Y
Sbjct  461  GHLLSSLLISVIDKTTARSGTSWFSNNLNRAHLDYFYWLLTGLCAVELVAFVLFSRVYAY  520

Query  704  KN  709
            K 
Sbjct  521  KR  522



>ref|XP_011031497.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=559

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 168/242 (69%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K ++ +VPIW+T+L + +  AQ +TFF KQGATLDRKI++GF++P A++ +     +
Sbjct  313  EDTKALLKLVPIWITSLAYAIAFAQTSTFFTKQGATLDRKIVSGFKVPAASLQTFIGFAI  372

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ +YDRI+VP+ R  T    G+T+LQRIG GM+FS  +M  AALVE KRL   +++ 
Sbjct  373  MISIPVYDRIVVPIARGLTRKPSGITMLQRIGTGMVFSAISMVTAALVEMKRLETAKDHG  432

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G+ D  T+VGLQE+ YDQVP  +RSLGIA YLS+ G 
Sbjct  433  LVDLPKVTVPMSIWWMVPQYILCGVADVLTIVGLQEFCYDQVPKELRSLGIALYLSIFGI  492

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLS+ LI+ +++AT+R G+ SWF  +LN + LDYFYWLL  ++A     Y+  AR+Y 
Sbjct  493  GSFLSTFLISTINKATSRDGQESWFANNLNRAHLDYFYWLLAVLSALGFSAYLYFARSYI  552

Query  701  YK  706
            Y 
Sbjct  553  YN  554



>ref|XP_010062425.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
 gb|KCW69565.1| hypothetical protein EUGRSUZ_F02994 [Eucalyptus grandis]
Length=579

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 166/246 (67%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ + PIW T+L + +  AQ +TFF KQG T+DR I  GF++PPA++ S  ++ +
Sbjct  333  EEAKSVLRLTPIWATSLIYAVVFAQSSTFFTKQGVTMDRSITPGFDVPPASLQSFISLSV  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR+ VP+ R  T    G+T+LQRIGIGM  S  +MAVA LVE KRL   +E+ 
Sbjct  393  VMFIPIYDRVFVPLARSFTQRPSGITMLQRIGIGMFLSAVSMAVATLVEIKRLETAREHG  452

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ GI D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  453  LVDMPNVTVPMSVWWLIPQYVLFGISDVFTMVGLQEFFYDQVPSELRSVGLSLYLSIFGV  512

Query  524  ANFLSSLLITAVDRAT-ARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS L++A+  AT    G SWF  +LN + LDYFYWLL G++A  L VY+  AR+Y 
Sbjct  513  GSFLSSFLVSAIATATGGDGGDSWFANNLNKAHLDYFYWLLAGLSAFELVVYLYFARSYI  572

Query  701  YKNVQS  718
            Y   ++
Sbjct  573  YNRSRT  578



>ref|XP_002325970.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF00352.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=596

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 163/242 (67%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K ++ +VPIW+T+L +    AQ  TFF KQGATLDR I++GF+IP A++       +
Sbjct  350  EDTKALLKLVPIWITSLAYATVFAQTTTFFTKQGATLDRTIVSGFKIPAASLQIFIGFAI  409

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I+ + +YDRI+VP+ R  T    G+T+LQRIG GM+FS  +M  AALVE+KRL   +E+ 
Sbjct  410  ILFIPVYDRIVVPISRGLTRKPSGITMLQRIGTGMVFSAISMVTAALVERKRLETAKEHG  469

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ GI D  T+VGLQE+ YDQVP  +RSLGI+ YLS+ G 
Sbjct  470  LVDLPNVTVPMSIWWLVPQYILCGIADVLTIVGLQEFCYDQVPKELRSLGISLYLSILGV  529

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS L++ +D AT+  G+ SWF  +LN + LDYFYWLL G++A     Y+  AR+Y 
Sbjct  530  GNFLSSFLVSVIDEATSGDGQESWFASNLNRAHLDYFYWLLAGLSAVGFIAYLYFARSYI  589

Query  701  YK  706
            Y 
Sbjct  590  YS  591



>ref|XP_002441154.1| hypothetical protein SORBIDRAFT_09g021330 [Sorghum bicolor]
 gb|EES19584.1| hypothetical protein SORBIDRAFT_09g021330 [Sorghum bicolor]
Length=571

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 165/246 (67%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKI-INGFEIPPATIYSLAAIG  178
            +E K +I + PIW T L + +  +Q +TFF KQ ATLDR+I  +G ++PPA + S  +I 
Sbjct  319  KEAKAIIRLFPIWATCLLYAVAFSQSSTFFTKQAATLDRRIGRHGLQVPPAALQSFISIT  378

Query  179  MIVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQEN  358
            ++V + IYDR+LVPV R+ +G   G+T+LQRIG GM+ S+ +M +AALVEK RL   ++ 
Sbjct  379  IVVFIPIYDRVLVPVSRRYSGKPSGITMLQRIGTGMLLSLLSMVIAALVEKHRLGVARDA  438

Query  359  TTSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSG  520
               D       MS++W+ PQ+++ G  D FT+VGLQE+FYDQVPD +RSLG+A YLS+ G
Sbjct  439  GLVDKPKVPLPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSLGLALYLSIFG  498

Query  521  AANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
              +F+SS L++ +DR T   G SWF  +LN   +DYFYWLL  ++A  L  YV  A  Y 
Sbjct  499  VGSFISSALVSVIDRVTTARGGSWFNNNLNRGHVDYFYWLLAALSAVELLAYVFFAVTYK  558

Query  701  YKNVQS  718
            YKN ++
Sbjct  559  YKNKRA  564



>gb|ACJ85853.1| unknown [Medicago truncatula]
Length=547

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 169/246 (69%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K ++ +VPIW T+L F +  +Q +TFF KQG TLDRKI+ GF +PPA++ S  ++ +
Sbjct  302  EEAKAILRLVPIWATSLIFAIVFSQSSTFFTKQGVTLDRKILPGFYVPPASLQSFISLSI  361

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + +YDRI+VP+ R  TG   G+T+LQRIG G++FSV +M +AA VE KRL   +++ 
Sbjct  362  VLFIPVYDRIIVPIARTFTGKPSGITMLQRIGAGILFSVISMVIAAFVEMKRLKVARDHG  421

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ G+ D FT+VGLQE+FYDQVPD +RS+G++ YLS+ G 
Sbjct  422  LIDMPDVTIPMSIWWLIPQYVLFGVSDVFTMVGLQEFFYDQVPDELRSVGLSLYLSIFGV  481

Query  524  ANFLSSLLITAVDRATARSGRS-WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A+ + T++ G   WF  +LN + LDYFY LL  ++A  L  +   +++Y 
Sbjct  482  GSFLSSFLISAIQKGTSKDGHDGWFASNLNRAHLDYFYALLAALSAVGLTPFWFFSKSYV  541

Query  701  YKNVQS  718
            YK   +
Sbjct  542  YKRTST  547



>ref|XP_007218954.1| hypothetical protein PRUPE_ppa003507mg [Prunus persica]
 gb|EMJ20153.1| hypothetical protein PRUPE_ppa003507mg [Prunus persica]
Length=569

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 172/260 (66%), Gaps = 6/260 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVI ++PIWL+ L F +  +Q  T++ KQG+ ++R +   F++PPA++     I +
Sbjct  309  EEVKLVIRLIPIWLSCLMFNVVQSQLHTYYTKQGSKMNRSMGPHFQLPPASLKVFVGITI  368

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDRI VP+ RK +G+  G+T+LQRIG+G+  S+  +  AALVE KR++  +++ 
Sbjct  369  LITVPIYDRIFVPMARKLSGHPAGITVLQRIGVGLFLSILNVVAAALVEAKRVSVAKQHD  428

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      + V+WL PQ+LI G+ D F +VGLQE FYDQ+P+ +RSLG A Y+S+ G 
Sbjct  429  LMDNPKAIIPIRVWWLLPQYLICGLSDTFAVVGLQELFYDQMPEGLRSLGAAAYISILGV  488

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS +I+ V   +++SG  W G +LN + LDYFYW+L G++A NLCVYV  A+ + Y
Sbjct  489  GSFLSSAIISLVQAISSKSGEEWLGDNLNRAHLDYFYWVLAGMSALNLCVYVWTAKGFVY  548

Query  704  KNVQSKTTMAVADCDDDGGR  763
            K V+++            G 
Sbjct  549  KKVEAQKPTGAKKAGTKAGE  568



>ref|XP_007011003.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY19813.1| Major facilitator superfamily protein [Theobroma cacao]
Length=581

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 172/258 (67%), Gaps = 6/258 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL  L F   +AQ  TFF KQG+T+ R I   F++PPA + SL    +
Sbjct  318  EEVKLVLRLIPIWLGCLMFCAVIAQLHTFFTKQGSTMMRSIGPNFQVPPAALQSLVGFTI  377

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V +YDR+ VP+ RK TG+  G+T+LQRIGIG+  S+  M VA L+E  R+N  +++ 
Sbjct  378  LIAVPVYDRVFVPMARKITGHPSGITMLQRIGIGLFVSMLNMVVAGLIETARVNTARKHG  437

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV+WL PQ+++  IGD FT+VGLQE FYDQ+P+ MRS+G A Y+S+ G 
Sbjct  438  LMDNPKAVVPMSVWWLLPQYVLTAIGDVFTIVGLQELFYDQMPEEMRSIGAAAYISIVGV  497

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+++ +I+ V   T+R G  W G +LN + L+YFYW+L G++  NLCVY+ +   + Y
Sbjct  498  GSFINTAIISVVQVITSRHGSVWLGDNLNRAHLNYFYWVLAGLSGINLCVYMWITSGFVY  557

Query  704  KNVQSKTTMAVADCDDDG  757
            K V++  T    + + +G
Sbjct  558  KKVENDETREGKELEMEG  575



>ref|XP_009363640.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=571

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 169/248 (68%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E++KLV+ ++P+W+  L F +  +   TFF KQG+T+ R I   F+IP A+++    + +
Sbjct  317  EQVKLVLRLIPVWMCCLMFAVVQSFSITFFTKQGSTMVRSIGPNFKIPQASLHVFNGLTI  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IV + IYDR+ VP  RK TG+  G+TILQRIGIG+  S+ TM V+ALVE KR+N  +++ 
Sbjct  377  IVVIPIYDRVFVPAARKVTGHSSGITILQRIGIGLFVSIFTMVVSALVEAKRVNIARDHN  436

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      M V+WL PQ++I G+ D FT VGLQE+FYDQ+P+ MRS+G A YLSV G 
Sbjct  437  LLDNPKTIVPMRVWWLIPQYMICGLSDVFTFVGLQEFFYDQMPEEMRSMGAAAYLSVVGV  496

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             NF+S+ +I+AV   +++ G  W G ++N + L+YFYW++  ++  N C+YVL+A+ + Y
Sbjct  497  GNFMSNAIISAVQEISSQHGEKWLGNNINRAHLNYFYWVIAALSTLNWCIYVLIAKLFVY  556

Query  704  KNVQSKTT  727
            K  +++ T
Sbjct  557  KKFEAQET  564



>ref|XP_009415773.1| PREDICTED: uncharacterized protein LOC103996574 [Musa acuminata 
subsp. malaccensis]
Length=1023

 Score =   251 bits (642),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 166/249 (67%), Gaps = 6/249 (2%)
 Frame = +2

Query  2     EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
             EE K ++ + PIW T L + +  AQ +T F KQG TLDR+I +  ++PPA + S  +  +
Sbjct  775   EETKGLVRLFPIWTTCLIYAVVFAQSSTLFTKQGGTLDRRISSKLQVPPAALQSFISTSI  834

Query  182   IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
             IVS+ IYDRILVPV RK +G   G+T+LQRIG GM  S+ +M +AALVE KRL   +E  
Sbjct  835   IVSIPIYDRILVPVARKFSGLPSGITMLQRIGTGMALSLISMVIAALVEMKRLKTAREFG  894

Query  362   TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
               D       MS++WL PQ+++ G+ D FT+VGLQE+FYDQVPD++RSLG+A Y+S+ G 
Sbjct  895   LVDLPNARIPMSLWWLVPQYVLFGVADVFTMVGLQEFFYDQVPDALRSLGLALYMSIFGI  954

Query  524   ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
              +F+S  LI+ +++ T+R G SWF  +LN + LDYFYWLL G++   L +YV   + Y Y
Sbjct  955   GSFISGFLISVINKTTSRGGESWFSNNLNRAHLDYFYWLLAGLSMIELVLYVYFTQAYVY  1014

Query  704   KNVQSKTTM  730
             K  Q    M
Sbjct  1015  KKKQDTAVM  1023


 Score =   246 bits (627),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 163/241 (68%), Gaps = 6/241 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K +  + PIW T L + +  AQ +T F KQG TLDR+I +  ++PPA + S  +  +
Sbjct  268  EETKGLFRLFPIWTTCLIYAVVFAQSSTLFTKQGGTLDRRISSKLQVPPAALQSFISASI  327

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            IVS+ IYDRILVPV RK +G   G+T+LQRIG GM  S+ +M +AALVE KRL   +E  
Sbjct  328  IVSIPIYDRILVPVARKFSGLPSGITMLQRIGTGMALSLISMVIAALVEMKRLKTAREFG  387

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+++ G+ D FT+VGLQE+FYDQVPD++R+LG+A Y+S+ G 
Sbjct  388  LVDQPNARIPMSLWWLVPQYVLFGVADVFTMVGLQEFFYDQVPDALRTLGLALYISIFGI  447

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+S  LI+ +++ T+R G SWF  +LN + LDYFYWLL G++   L +YV   + Y Y
Sbjct  448  GSFISGFLISVINKTTSRGGESWFSNNLNRAHLDYFYWLLAGLSMIELVLYVYFTQAYVY  507

Query  704  K  706
            K
Sbjct  508  K  508



>gb|AGT17393.1| hypothetical protein SHCRBa_189_K21_R_20 [Saccharum hybrid cultivar 
R570]
Length=541

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 168/242 (69%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ ++PIW + + + +  +Q +TFF KQ ATLDR+I   F++PPA + +  ++ +
Sbjct  288  EEVKSVLRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGARFKVPPAALQTFISVSI  347

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE--  355
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  +A++ALVE KRL    E  
Sbjct  348  VVFIPVYDRLFVPLARRHTGRPTGITMLQRVGAGLALSLVAVALSALVEMKRLRVATEAG  407

Query  356  --NTTSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              NT      M+++W+ PQ+++IG+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  408  LVNTPKAHLPMTLWWMVPQYVLIGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  467

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             + LSS LI+ +D+ TARSG SWF  +LN + LDYFYWLL G+ A  L  +VL +R Y Y
Sbjct  468  GHLLSSFLISVIDKTTARSGTSWFSNNLNRAHLDYFYWLLTGLCAVELVAFVLFSRVYAY  527

Query  704  KN  709
            K 
Sbjct  528  KR  529



>gb|AGT17133.1| peptide/nitrate transporter [Saccharum hybrid cultivar R570]
Length=534

 Score =   244 bits (622),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 168/242 (69%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ ++PIW + + + +  +Q +TFF KQ ATLDR+I   F++PPA + +  ++ +
Sbjct  281  EEVKSVLRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGARFKVPPAALQTFISVSI  340

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQE--  355
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  +A++ALVE KRL    E  
Sbjct  341  VVFIPVYDRLFVPLARRHTGRPTGITMLQRVGAGLALSLVAVALSALVEMKRLRVATEAG  400

Query  356  --NTTSDS--MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              NT      M+++W+ PQ+++IG+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  401  LVNTPKAHLPMTLWWMVPQYVLIGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  460

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             + LSS LI+ +D+ TARSG SWF  +LN + LDYFYWLL G+ A  L  +VL +R Y Y
Sbjct  461  GHLLSSFLISVIDKTTARSGTSWFSNNLNRAHLDYFYWLLTGLCAVELVAFVLFSRVYAY  520

Query  704  KN  709
            K 
Sbjct  521  KR  522



>gb|EMT32230.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=417

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 166/249 (67%), Gaps = 6/249 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ + PIW T L + +  +Q +TFF KQ ATLDR +    ++PPA + S  +I +
Sbjct  168  EEVKGVLRLFPIWATCLIYAVAFSQSSTFFTKQAATLDRHVGKRVQVPPAALQSFISITI  227

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR +VP+ R+ TG   G+T+LQRIG+GM+ S+ +M VAALVE +RL    +  
Sbjct  228  VLFMPIYDRAIVPLARRCTGVSSGITMLQRIGVGMVLSLVSMVVAALVETRRLRIAADAG  287

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
             +D       MS++W+ PQ+++ G  D FT+VGLQE+FYDQVPD +RS+G+A YLS+ G 
Sbjct  288  LADLPRVPVPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSIGLALYLSIFGI  347

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +D+ ++  G+SWF  +LN   LDYFYWL+  ++A  L VYV  A  + Y
Sbjct  348  GSFISSGLVSGIDKWSSERGQSWFSNNLNRGHLDYFYWLIAALSALELVVYVFFAVTFKY  407

Query  704  KNVQSKTTM  730
            K   +  T+
Sbjct  408  KKKAASATV  416



>ref|XP_004308589.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Fragaria vesca subsp. vesca]
Length=551

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 168/251 (67%), Gaps = 6/251 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F    +Q  T+FIKQG+T+ R I   F  PPA++ ++  I +
Sbjct  301  EEVKLVVRLIPIWLSCLMFHAVQSQLHTYFIKQGSTMIRSIGPKFRFPPASLQAVVGIMI  360

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + +V IYDRI+VP  RK TG+  G+T+LQRIG+G+  SV  M VAALVE KR+   ++N 
Sbjct  361  VTTVLIYDRIIVPTARKVTGHPAGITVLQRIGVGLFLSVINMVVAALVEAKRVGVARDNN  420

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      +SV+WL PQF++ G+ D FT+VGLQE FYDQ+PD+MRSLG A Y+S+ G 
Sbjct  421  LMDNPKAIVPISVWWLLPQFIVTGLSDAFTVVGLQELFYDQMPDAMRSLGAAAYISILGV  480

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +FLSS +I+ V+  +  SG  W G +LN + LD FYW+L G++A    VY+ VA  + Y
Sbjct  481  GSFLSSFIISLVETFSRNSGEPWLGNNLNRAHLDDFYWVLAGLSALFFGVYIWVANRFVY  540

Query  704  KNVQSKTTMAV  736
            K V  + +  V
Sbjct  541  KRVVGEASNEV  551



>ref|XP_009361962.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=564

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 167/246 (68%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L FG+  AQ  TFF KQ +T  R I   F++P A++  L  I +
Sbjct  302  EEVKLVLRLIPIWLSCLMFGVIQAQLHTFFTKQCSTTIRSIGPHFQVPAASLQGLVGIAI  361

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR+ VPV RK TG+  G+T+LQRIGIG++ S+  M V+ALVE KRLN  ++  
Sbjct  362  LIAVPIYDRVFVPVARKYTGHPSGITVLQRIGIGLVLSILLMVVSALVEAKRLNIAKDYN  421

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+LI+G+ D F  VGLQE FYDQ+P+ MRS+G A  +SV G 
Sbjct  422  LIDKPKAIIPMRVWWLLPQYLILGLADAFATVGLQELFYDQMPEQMRSMGAAASMSVVGV  481

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+S+ +I+AV+  T+R+G  W G ++N + LDYFYW+L  ++  N CVY ++A  + Y
Sbjct  482  GSFISNWIISAVELITSRNGNKWLGDNINRAHLDYFYWVLAVLSTLNFCVYGVIASAFVY  541

Query  704  KNVQSK  721
            K V+ +
Sbjct  542  KKVERE  547



>ref|XP_004172151.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like, 
partial [Cucumis sativus]
Length=458

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L + +  +Q +TFFIKQG T+DR I  GF+IP A++ SL  +G+
Sbjct  210  EEAKAVLRLVPIWVTCLGYAIVFSQSSTFFIKQGVTMDRSIAGGFKIPAASLQSLIGLGI  269

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYD IL+P  RK TGN  G+T+LQRIG GM+ S+ +M VAALVE KRL   QE  
Sbjct  270  MISLLIYDCILIPTARKFTGNPSGITMLQRIGFGMLLSIISMVVAALVEGKRLKTAQEYG  329

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       +S++WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  330  LVDMPKATIPLSIWWLVPQYILFGVADTFTMVGLQEFFYDQVPSGLRSIGLSLYLSIFGI  389

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
              FLSS LI+A+++ T+  G+ SWF  +LN + L+YFYWLL  ++   L  ++  AR Y 
Sbjct  390  GYFLSSFLISAIEKLTSGYGKQSWFDNNLNKAHLEYFYWLLVVLSVVGLAAFLFSARTYI  449

Query  701  YKN  709
            Y  
Sbjct  450  YNK  452



>ref|XP_010272857.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=579

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 167/246 (68%), Gaps = 7/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K+V+N+VP W T L +G+   Q +TFF KQG T+DR I +GFEIPPA++ S+  + +
Sbjct  333  EEAKVVLNLVPTWATCLMYGVVSVQSSTFFTKQGYTMDRSITSGFEIPPASLQSIIFLSI  392

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR++VP+ R  T    G+TILQRIG GM  S+ +M VAA+VEK RL   +E+ 
Sbjct  393  VIFIPIYDRVIVPIARAYTRKPSGITILQRIGTGMFLSIISMVVAAVVEKVRLRVARESG  452

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+ + G+ D F +VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  453  LIDMPQATLPMKVWWLIPQYFLFGVADAFAMVGLQEFFYDQVPKGLRSMGLSLYLSIFGM  512

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NFLSS LI  +++AT+R G+ +WF  +LN + LD++Y LL G++A  L +Y+  A++Y 
Sbjct  513  GNFLSSFLIFVIEKATSREGQENWFANNLNQAHLDWYYCLLTGLSAVELALYLYFAKSYI  572

Query  701  YKNVQS  718
            Y    S
Sbjct  573  YNRGSS  578



>ref|XP_004514886.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Cicer arietinum]
Length=562

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 170/255 (67%), Gaps = 8/255 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVI ++PIWL+ L F +  +Q  TFF KQ +TL+  I   F+IPPA++  L  I +
Sbjct  306  EEVKLVIRLIPIWLSCLMFIVVQSQLGTFFTKQSSTLNHSIGPHFKIPPASLQGLVGIVI  365

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + +V IYD++ VP  RK TG+  G+T+LQRIG G+  S+ TM V+ALVE KR+N  ++N 
Sbjct  366  LFAVPIYDKLFVPFARKITGHHSGITVLQRIGFGLFLSIFTMVVSALVEGKRVNIAKKNN  425

Query  362  TSD--------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVS  517
              D         MS++WL PQ+ I+GI D FT+VGLQE FYDQ+P+ MRSLG A Y+S+ 
Sbjct  426  LIDNNTNNAIIPMSIWWLLPQYTILGISDAFTIVGLQELFYDQMPNRMRSLGAAAYISIL  485

Query  518  GAANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
            G  +F+++ +I  V   T+RSGR W G +LN + LDYFYW+L  ++A NLCVY+ +A+ +
Sbjct  486  GVGSFVTNGVIIIVVEITSRSGRKWLGDNLNRAHLDYFYWMLALLSALNLCVYLFIAKCF  545

Query  698  TYKNVQSKTTMAVAD  742
             YK      T  V +
Sbjct  546  VYKKRDMDETTMVEN  560



>ref|XP_010095905.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62499.1| putative peptide/nitrate transporter [Morus notabilis]
Length=590

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 161/229 (70%), Gaps = 7/229 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L +G+  AQ  TFF KQGAT++R I+ GF+IPPA++ S  ++ +
Sbjct  350  EEAKAVLRLVPIWVTCLVYGIVGAQCPTFFTKQGATMERTIVPGFDIPPASLQSFESLAI  409

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +VS+ IYDR +VP+ R  TG   G+T+LQRIG GM  SV +M +AALVE KRL   QE  
Sbjct  410  LVSIPIYDRAIVPIARAFTGKPSGITMLQRIGTGMFLSVISMVIAALVEIKRLQTTQEYD  469

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV WL PQ+L+ GI + FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  470  LVDTPGVTVPMSVGWLVPQYLLFGISEAFTMVGLQEFFYDQVPTELRSVGLSLYLSIFGV  529

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANL  667
             +FLSS LI+ ++ AT   GR SWF  +LN + LDY+YWLL G+++  L
Sbjct  530  GSFLSSFLISIIEEATGGDGRDSWFSNNLNRAHLDYYYWLLTGLSSVAL  578



>gb|KHG09768.1| hypothetical protein F383_13158 [Gossypium arboreum]
Length=584

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 168/245 (69%), Gaps = 6/245 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL  L F   + Q  TFF KQG+T+ R I   F++PPA + SL  + +
Sbjct  319  EEVKLVLRLIPIWLGCLMFSAVITQLHTFFTKQGSTMLRSIGPNFQVPPAALQSLVGLTI  378

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR+ VP+ RK TG+  G+T+LQRIG G+  S+  M VA LVE  R+N   ++ 
Sbjct  379  LIAVPIYDRVFVPIARKITGHPSGITMLQRIGTGLFISILNMVVAGLVETARVNTAAKHG  438

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV+WL PQ+++ G+GD FT+VGLQE FYDQ+P+ MRS+G A Y+SV G 
Sbjct  439  LIDAPKAIVPMSVWWLLPQYVLTGLGDVFTIVGLQELFYDQMPEEMRSIGAAAYISVVGV  498

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+++ +I+ V   + R G  W G +LN ++L+YFYW+L G++A NLC Y+ +++ + Y
Sbjct  499  GSFINTAVISVVQVISLRHGNEWLGDNLNRAKLNYFYWVLAGLSAFNLCAYIWISKGFVY  558

Query  704  KNVQS  718
            K V++
Sbjct  559  KKVEN  563



>ref|XP_002297740.2| hypothetical protein POPTR_0001s06440g [Populus trichocarpa]
 gb|EEE82545.2| hypothetical protein POPTR_0001s06440g [Populus trichocarpa]
Length=586

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 168/246 (68%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F + + Q  T FIKQG+T+ R I   F++PPA+  SL  + +
Sbjct  323  EEVKLVLRLLPIWLSCLMFTVVIVQTHTLFIKQGSTMTRSIGPNFQVPPASFQSLVGLTI  382

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + ++ +Y+R+ +P  RK TG+  G+T+LQRIGIG+  S+  M VAALVE KR++  +E+ 
Sbjct  383  LFTIPLYERVFIPAARKITGHSSGITMLQRIGIGLFLSIVEMVVAALVEAKRVSIAREHG  442

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+W+ PQ++I GI D FT+VGLQE FYDQ+P+SMRS+G A Y+SV+G 
Sbjct  443  LMDIPKATIPMSVWWILPQYMISGISDVFTVVGLQELFYDQMPESMRSMGAAAYISVTGL  502

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F ++ +IT V   TARS     G +LN + +DYFYW+L  ++A N CVY+ VA  + Y
Sbjct  503  GSFFNTAIITVVQAITARSSGILLGNNLNRAHVDYFYWILAVLSALNFCVYLWVAHGFVY  562

Query  704  KNVQSK  721
            K V+ +
Sbjct  563  KKVEGE  568



>ref|XP_006376225.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
 gb|ERP54022.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
Length=567

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 163/242 (67%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K ++ +VPIW T L F +  AQ +TFF KQG T+DR I    ++P A++ S  ++ +
Sbjct  321  EEAKALLRLVPIWATCLVFAIVFAQTSTFFTKQGVTMDRSISPSLDLPAASLQSFISLSI  380

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR+LVP+ R  T    G+T+LQRIG GM  SV  M VAALVE KRL   QE+ 
Sbjct  381  VLFIPIYDRVLVPIARALTRKPSGITMLQRIGSGMFISVVAMIVAALVEMKRLKTAQEHG  440

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ + FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  441  LVDLPNVTIPMSVWWLIPQYVLFGVAEAFTMVGLQEFFYDQVPSDLRSVGLSLYLSIFGV  500

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ +++AT  +GR SWF  +LN + LDYFYWLL G++A  L  YV  A++Y 
Sbjct  501  GSFLSSFLISIIEKATGGNGRYSWFANNLNRAHLDYFYWLLAGLSAVQLVAYVCFAKSYI  560

Query  701  YK  706
            Y 
Sbjct  561  YN  562



>ref|XP_010418901.1| PREDICTED: protein NRT1/ PTR FAMILY 5.11-like [Camelina sativa]
Length=523

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW+T L + +  AQ  TFF KQGAT++R I+ G  +P AT+    ++ M
Sbjct  280  EEAKAVLKLVPIWMTCLVYAIICAQSHTFFTKQGATMNRSILPGLLVPAATLQCFISLTM  339

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + +YDR+LVPV R  T N  G+T+LQRIG G+  S+  + VAALVE +RL   +++ 
Sbjct  340  VIFIPLYDRLLVPVARSFTQNPSGITMLQRIGTGIFLSILAIVVAALVETQRLQTARDDV  399

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            T   MSV+WL PQ++I G+ D FT+VGLQE+FYDQVP  +RS+G+A  LS+ G  NFLSS
Sbjct  400  TI-LMSVWWLVPQYVIFGVADVFTMVGLQEFFYDQVPCELRSVGMALNLSIYGVGNFLSS  458

Query  542  LLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYK  706
             +I+ +D+ T++SG+ SWF  DLN + LDYFYWLL  +++  L  Y+  A++Y Y 
Sbjct  459  FMISIIDKVTSQSGQTSWFDNDLNQAHLDYFYWLLACLSSTGLASYLWFAKSYVYN  514



>ref|XP_011000563.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Populus euphratica]
Length=578

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 169/246 (69%), Gaps = 6/246 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F + + Q  T FIKQG+T+ R I   F++PPA+  SL  + +
Sbjct  315  EEVKLVLRLLPIWLSCLMFTVVIVQTHTLFIKQGSTMTRSIGPDFQVPPASFQSLVGLTI  374

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            + ++ +Y+R+ +P  RK TG+  G+T+LQRIGIG+  S+  M VAALVE KR++  +E+ 
Sbjct  375  LFTIPLYERVFIPAARKITGHSSGITMLQRIGIGLFLSIVEMVVAALVEGKRVSIAREHG  434

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+W+ PQ++I GI D FT+VGLQE FYDQ+P+SMRS+G A Y+SV+G 
Sbjct  435  LMDIPKATIPMSVWWILPQYMISGISDVFTVVGLQELFYDQMPESMRSMGAAAYISVTGL  494

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F ++ +IT V   TARS     G +LN + +DYFYW+L  ++A N CVY+ VA ++ Y
Sbjct  495  GSFFNTAIITVVQAITARSSGILLGNNLNRAHVDYFYWILAVLSALNFCVYLWVAHSFVY  554

Query  704  KNVQSK  721
            K V+ +
Sbjct  555  KKVEGE  560



>ref|XP_009361960.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=576

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 172/248 (69%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E++KLV+ ++PIWL+ L F    +Q  T++ KQG+T+ R I   F++PPA++ +L  + +
Sbjct  316  EDVKLVLRLIPIWLSCLMFNAVQSQLHTYYTKQGSTMIRSIGPHFQLPPASLGALVGLVI  375

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V +YDRI VP+ RK TG+  G+T+LQRIG G+  S+  M V+ALVE KR++  +++ 
Sbjct  376  LITVPMYDRIFVPIARKFTGHHSGITVLQRIGFGLFLSILNMVVSALVEAKRVSVAKQHG  435

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      M ++WL PQ+   G+ D FT+VGLQE FYDQ+P++MRS G A YLS+ G 
Sbjct  436  IIDNPKAVVPMRMWWLLPQYFFCGLSDTFTIVGLQELFYDQMPEAMRSFGAAAYLSIIGV  495

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS +I+ V   ++++G  W G +LN + LDYFYW+L G++A +LCVYVL A ++ Y
Sbjct  496  GSFISSAVISVVQAISSKAGEEWLGDNLNRAHLDYFYWVLAGLSALSLCVYVLFAMSFVY  555

Query  704  KNVQSKTT  727
            K VQ K +
Sbjct  556  KIVQGKDS  563



>ref|XP_008375319.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4 [Malus domestica]
Length=576

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 170/248 (69%), Gaps = 6/248 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F    +Q  T++ KQG+T+ R I   F +PPA++ SL  + +
Sbjct  316  EEVKLVLRLIPIWLSCLMFSAVQSQLHTYYTKQGSTMIRSIGPHFLLPPASLGSLVGVVI  375

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V +YDRI VP+ RK TG+  G+T+LQRIG G+  S+  M V+ALVE KR++  +++ 
Sbjct  376  LITVPMYDRIFVPMARKFTGHHSGITVLQRIGFGLFLSILNMVVSALVEAKRVSVAEQHG  435

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      M ++WL PQ+ I G+ D FT+VGLQE FYDQ+P++MRS G A YLS+ G 
Sbjct  436  IIDNPKAVVPMRMWWLLPQYFICGLSDTFTIVGLQELFYDQMPEAMRSFGAAAYLSIIGV  495

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS +I+ V   ++++G  W G +LN S LDYFYW+L G++A +LC YV  A ++ Y
Sbjct  496  GSFISSAVISVVQAISSKAGEEWLGDNLNRSHLDYFYWVLAGLSALSLCAYVWFAMSFVY  555

Query  704  KNVQSKTT  727
            K VQ K +
Sbjct  556  KIVQGKDS  563



>ref|XP_002887416.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63675.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=534

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 162/239 (68%), Gaps = 3/239 (1%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIWLT L + +  AQ  TFF KQGA +DR I  G  +P AT+    ++ M
Sbjct  298  EEAKAVLKLVPIWLTCLVYAIVCAQSHTFFTKQGAKMDRSISPGLLVPAATLQCFISLTM  357

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR+LVPV R  T N  G+T+LQRIG G+  S+  M VAALVE+KRL    +N 
Sbjct  358  VIFIPIYDRLLVPVARSFTHNPSGITMLQRIGTGIFLSILAMVVAALVERKRLQIAHDNV  417

Query  362  TSDSMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGAANFLSS  541
            T   MSV+WL PQ+++ G+ D F +VGLQE+FYDQVP  +RS+G+A  LS+ G  NFLSS
Sbjct  418  T-ILMSVWWLVPQYVLYGVSDVF-MVGLQEFFYDQVPSELRSVGMALNLSIYGVGNFLSS  475

Query  542  LLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTYKNVQ  715
             +I+ +D+ T++SG+ SWF  DLN + LDYFYWLL  +++  L  Y+  A++Y Y  + 
Sbjct  476  FMISVIDKVTSQSGQTSWFDNDLNHAHLDYFYWLLACLSSIGLVSYLWFAKSYLYNRLN  534



>ref|XP_004172150.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Cucumis sativus]
Length=565

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 165/243 (68%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW T L + +  +Q +TFFIKQG TLDR I++GFE+P A++ S  ++G+
Sbjct  317  EEAKAVLKLVPIWATCLTYAIVFSQSSTFFIKQGVTLDRSIVDGFEVPAASLQSFISLGV  376

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++S+ IYDR+L+P  RK T    G+T+LQRIG GM+ S+ +M VAALVE KRL   +E  
Sbjct  377  VISLVIYDRVLIPTARKFTRKPSGITMLQRIGFGMLLSIISMVVAALVEGKRLKTAKEYG  436

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       ++++WL PQ+++ G+   FT+VGLQE+FYDQVP  +RS+G++  LS+ G 
Sbjct  437  LVDLPKATIPLNIWWLVPQYVLFGVASTFTMVGLQEFFYDQVPSGLRSIGVSLNLSIFGT  496

Query  524  ANFLSSLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS L+ A+++ T+    +SWF  +LN + LDYFYWLL G++   L  ++  AR Y 
Sbjct  497  GSFLSSFLVFAIEKLTSGDEKQSWFDNNLNKAHLDYFYWLLVGLSVVGLAAFLCFARTYI  556

Query  701  YKN  709
            Y  
Sbjct  557  YNK  559



>ref|NP_001044939.2| Os01g0871600 [Oryza sativa Japonica Group]
 dbj|BAD81723.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD82710.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAF06853.2| Os01g0871600 [Oryza sativa Japonica Group]
Length=532

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 175/264 (66%), Gaps = 15/264 (6%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ ++PIW + + + +  +Q +TFF KQ ATLDR+I   F +PPA + +  ++ +
Sbjct  269  EEVKSVLRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGRSFNVPPAALQTFISVSI  328

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  + ++ALVE +RL       
Sbjct  329  VVFIPVYDRLFVPLARRYTGRPSGITMLQRVGAGLALSLVAVVLSALVETRRLRVAAGAG  388

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
             +D+      MS++W+ PQ++++G+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  389  MADAPKARLPMSLWWMVPQYVLVGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  448

Query  524  ANFLSSLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             + LSSLLI+ +D ATA R+G SWF  +LN + LDYFYWLL G+ A  L  + L +R YT
Sbjct  449  GHLLSSLLISVIDGATARRAGGSWFANNLNRAHLDYFYWLLAGLCAVELVAFFLFSRVYT  508

Query  701  YKNVQSKTTMAVADC-----DDDG  757
            YK    K   A  +C     DDDG
Sbjct  509  YKK---KGNDADGNCDYRGVDDDG  529



>ref|XP_011001076.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=567

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 163/242 (67%), Gaps = 7/242 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K ++ +VPIW T L F +  AQ +TFF KQG T+DR I    ++P A++ S  ++ +
Sbjct  321  EEAKALLRLVPIWATCLVFAIVFAQTSTFFTKQGVTMDRSISPSLDLPAASLQSFISLSI  380

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDR+LVP+ R  T    G+T+LQRIG GM  SV  M VAALVE KRL   QE+ 
Sbjct  381  VLFIPIYDRVLVPIARALTRKPSGITMLQRIGSGMFISVVAMIVAALVEMKRLKTAQEHG  440

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ + FT+VGLQE+FYDQVP  +RS+G++ YLS+ G 
Sbjct  441  LVDLPNVTIPMSVWWLIPQYVLFGVAEAFTMVGLQEFFYDQVPSDLRSVGLSLYLSIFGV  500

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ +++AT   G+ SWF  +LN + LDYFYWLL G++A  L VYV  A++Y 
Sbjct  501  GSFLSSFLISIIEKATGGDGQYSWFANNLNRAHLDYFYWLLAGLSAVQLVVYVCFAKSYI  560

Query  701  YK  706
            Y 
Sbjct  561  YN  562



>gb|KDP27340.1| hypothetical protein JCGZ_20272 [Jatropha curcas]
Length=569

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ +VPIW T L + +  AQ ATFF KQG T+DR I  GF++PPA++ S  ++ +
Sbjct  327  EEAKAVLRLVPIWFTCLIYAVVFAQSATFFTKQGVTMDRSISKGFDVPPASLQSFISLAI  386

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ V IYDR+ VP+ R  T    G+T+LQRIG GM  S  +MA+AALVE +RL   +E  
Sbjct  387  VLFVPIYDRVFVPIARTLTRKPSGITMLQRIGTGMFLSALSMAIAALVEMRRLEISREYG  446

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D FT+VGLQE+FYDQVP  +RS+G++ YL + G 
Sbjct  447  LVDMPNVTVPMSVWWLIPQYVLFGVADVFTMVGLQEFFYDQVPSELRSVGLSLYLGIFGV  506

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +F+SS L++A+++AT   G  SWF  +LN + LDYFYWLL G++   L  ++  A+ Y 
Sbjct  507  GSFISSFLVSAIEKATGGEGHDSWFSNNLNRAHLDYFYWLLAGLSIVQLIAFLYFAKRYV  566

Query  701  YKN  709
            Y  
Sbjct  567  YSR  569



>ref|XP_009361961.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=559

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 173/262 (66%), Gaps = 8/262 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++P+WL+ L FG+  AQ  TFF KQ +T  R I   F++P A++  L  I +
Sbjct  297  EEVKLVLRLIPLWLSCLMFGVIEAQLHTFFTKQSSTTIRSIGPHFQVPAASLQGLVGIAI  356

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +++V IYDR  VP+ RK TG+  G+T+LQRIGIG++ S+  M V+ALVE KRLN  ++  
Sbjct  357  LIAVPIYDRFFVPIARKYTGHPSGITVLQRIGIGLVLSILVMVVSALVEAKRLNIAKDYN  416

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M V+WL PQ+LI+G+ + F  VGLQE FYD++P+ MRS+G A  +SV G 
Sbjct  417  LIDKPKAIVPMRVWWLLPQYLILGLANAFATVGLQELFYDEMPEQMRSIGAATSMSVVGV  476

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+S+ +I+  +  T+R+G  W G+++N + LDYFYW+L  ++  NLCVYVL+A  + Y
Sbjct  477  GSFISNWIISVAELITSRNGDKWLGENINRAHLDYFYWVLAVLSTLNLCVYVLIANAFVY  536

Query  704  KNV--QSKTTMAVADCDDDGGR  763
            K V  + K    ++  ++ GG 
Sbjct  537  KKVGREVKVETDLSFANNHGGE  558



>dbj|BAB86542.1| OSJNBb0008G24.12 [Oryza sativa Japonica Group]
Length=548

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 175/264 (66%), Gaps = 15/264 (6%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V+ ++PIW + + + +  +Q +TFF KQ ATLDR+I   F +PPA + +  ++ +
Sbjct  285  EEVKSVLRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGRSFNVPPAALQTFISVSI  344

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  + ++ALVE +RL       
Sbjct  345  VVFIPVYDRLFVPLARRYTGRPSGITMLQRVGAGLALSLVAVVLSALVETRRLRVAAGAG  404

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
             +D+      MS++W+ PQ++++G+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  405  MADAPKARLPMSLWWMVPQYVLVGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  464

Query  524  ANFLSSLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             + LSSLLI+ +D ATA R+G SWF  +LN + LDYFYWLL G+ A  L  + L +R YT
Sbjct  465  GHLLSSLLISVIDGATARRAGGSWFANNLNRAHLDYFYWLLAGLCAVELVAFFLFSRVYT  524

Query  701  YKNVQSKTTMAVADC-----DDDG  757
            YK    K   A  +C     DDDG
Sbjct  525  YKK---KGNDADGNCDYRGVDDDG  545



>dbj|BAK03342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 164/242 (68%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE++ ++ + PIW T + + +  +Q +TFF KQ ATLDR+I   F +PPA + +  ++ +
Sbjct  294  EEVRGLLRLFPIWATCIIYAVIFSQSSTFFTKQAATLDRRIGATFRVPPAALQTFISLTI  353

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            I  + +YDR+ VP  R+ T    G+T+LQRIG G++ ++  M VAALVE +RL   +E  
Sbjct  354  ITFIPVYDRLFVPAARRFTRLSSGITMLQRIGTGLVLALVAMVVAALVEARRLGVAREAG  413

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G+ D F ++GLQE+FYDQVPD++RSLG+AF+LS+ G 
Sbjct  414  LVDDPKAALPMSLWWMVPQYVLFGLSDVFAMIGLQEFFYDQVPDALRSLGLAFFLSIFGV  473

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F SS LI+A+D  T +SG SWF  +LN + LDYFYWLL G+ AA L  +V+V+R Y Y
Sbjct  474  GHFFSSFLISAIDGYTKKSGASWFSNNLNRAHLDYFYWLLAGLCAAELAAFVVVSRVYVY  533

Query  704  KN  709
            K 
Sbjct  534  KK  535



>gb|EAY76648.1| hypothetical protein OsI_04604 [Oryza sativa Indica Group]
Length=532

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 174/264 (66%), Gaps = 15/264 (6%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+K V  ++PIW + + + +  +Q +TFF KQ ATLDR+I   F +PPA + +  ++ +
Sbjct  269  EEVKSVFRLLPIWASCIIYAIIFSQTSTFFTKQAATLDRRIGRSFNVPPAALQTFISVSI  328

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + +YDR+ VP+ R+ TG   G+T+LQR+G G+  S+  + ++ALVE +RL       
Sbjct  329  VVFIPVYDRLFVPLARRYTGRPSGITMLQRVGAGLALSLVAVVLSALVETRRLRVAAGAG  388

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
             +D+      MS++W+ PQ++++G+ D F ++GLQE+FYDQVPD++RSLG+A +LS+ G 
Sbjct  389  MADAPKARLPMSLWWMVPQYVLVGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGV  448

Query  524  ANFLSSLLITAVDRATA-RSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             + LSSLLI+ +D ATA R+G SWF  +LN + LDYFYWLL G+ A  L  + L +R YT
Sbjct  449  GHLLSSLLISVIDGATARRAGGSWFANNLNRAHLDYFYWLLAGLCAVELVAFFLFSRVYT  508

Query  701  YKNVQSKTTMAVADC-----DDDG  757
            YK    K   A  +C     DDDG
Sbjct  509  YKK---KGNDADGNCDYRGVDDDG  529



>gb|ACL52999.1| unknown [Zea mays]
 gb|AFW78189.1| peptide transporter PTR2-B [Zea mays]
Length=565

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 158/242 (65%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            +E K +I + PIW   L + +  +Q +TFF KQ ATLDR+I    ++PPA + S  ++ +
Sbjct  314  KEAKAIIRLFPIWAACLLYAVAYSQSSTFFTKQAATLDRRIGRHVQVPPAALQSFISVTI  373

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDR+LVPV R+ +G   G+T+LQRIG GM  S+ +M +AALVEK RL    +  
Sbjct  374  VVIIPIYDRVLVPVSRRYSGKPSGITMLQRIGTGMFLSLLSMVIAALVEKHRLRVAGDAG  433

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G  D FT+VGLQE+FYDQVPD +RSLG+A YLS+ G 
Sbjct  434  LVDKPKVPVPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSLGLALYLSIFGV  493

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +DR T   G SWF  +LN   +DYFYWLL  ++A  L  YV  A  Y Y
Sbjct  494  GSFISSALVSVIDRVTTDRGGSWFSNNLNRGHVDYFYWLLAALSAVELLAYVFFAVTYKY  553

Query  704  KN  709
            KN
Sbjct  554  KN  555



>gb|KEH29311.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=433

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K V+ ++PIW TTL +G+  AQ  TFF KQG++++R I  GF+IPPA++ ++  + +
Sbjct  184  EEAKAVLRLIPIWATTLVYGIVFAQVFTFFTKQGSSMERTIFPGFDIPPASLQTINGVAI  243

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V   IYDRI VP+ R  TG   G+T+LQRIG G+  S+ T+ +AA VE KRL   QE+ 
Sbjct  244  VVFSAIYDRIFVPLARAITGKTSGITMLQRIGTGIFLSIFTVVLAAFVENKRLKVAQEHG  303

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS+ WL PQ+++ G+ + FT+VGLQE+FYDQVP+ +RS+G+A YLS+ G 
Sbjct  304  LVDDPNATVPMSIGWLIPQYVLFGVSEVFTMVGLQEFFYDQVPNELRSMGLALYLSIIGV  363

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLS  LI+ ++  T + G  SWF  ++N + LDYFYWLL G++     ++V  A++Y 
Sbjct  364  GSFLSGFLISLIEHFTGKDGHESWFCDNINKAHLDYFYWLLAGLSVLGFTLFVYFAKSYI  423

Query  701  YKN  709
            Y +
Sbjct  424  YNH  426



>gb|EYU38280.1| hypothetical protein MIMGU_mgv1a021345mg [Erythranthe guttata]
Length=552

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 170/246 (69%), Gaps = 8/246 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE KLV+ +VPIWL+ L F + +AQ  T+F KQG+TL+R I   F+IPPA+   +  + +
Sbjct  298  EEAKLVLQLVPIWLSCLMFAVVIAQLGTYFTKQGSTLNRTITPKFQIPPASFQVITGLTI  357

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++SV +Y+R L+P+ R  TG + G+T+LQRIG G+ FS+ TMAVAALVE +R++   EN 
Sbjct  358  LISVLLYERALIPLSRALTGRQSGITVLQRIGTGLAFSILTMAVAALVESRRVSVAVENG  417

Query  362  TSD------SMSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       M+V+WL PQ+++ G+ D FT+VGLQE FY+Q+P  MRS+G A Y++V+G 
Sbjct  418  LLDRPRSIVPMAVWWLVPQYVLCGLSDVFTVVGLQELFYEQMPVGMRSVGAAAYITVTGV  477

Query  524  ANFLSSLLITAVDRATARS--GRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNY  697
             +FLSS LI+ V   +  S  G  W G ++N + L+YFYW+L G++  NLCVYV VA+ +
Sbjct  478  GSFLSSGLISVVQWISGVSGGGGEWLGDNINRAGLEYFYWVLAGMSVVNLCVYVCVAKRF  537

Query  698  TYKNVQ  715
             YK V+
Sbjct  538  VYKRVE  543



>gb|AFW78190.1| hypothetical protein ZEAMMB73_551902 [Zea mays]
Length=567

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 158/242 (65%), Gaps = 6/242 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            +E K +I + PIW   L + +  +Q +TFF KQ ATLDR+I    ++PPA + S  ++ +
Sbjct  316  KEAKAIIRLFPIWAACLLYAVAYSQSSTFFTKQAATLDRRIGRHVQVPPAALQSFISVTI  375

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V + IYDR+LVPV R+ +G   G+T+LQRIG GM  S+ +M +AALVEK RL    +  
Sbjct  376  VVIIPIYDRVLVPVSRRYSGKPSGITMLQRIGTGMFLSLLSMVIAALVEKHRLRVAGDAG  435

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G  D FT+VGLQE+FYDQVPD +RSLG+A YLS+ G 
Sbjct  436  LVDKPKVPVPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSLGLALYLSIFGV  495

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +DR T   G SWF  +LN   +DYFYWLL  ++A  L  YV  A  Y Y
Sbjct  496  GSFISSALVSVIDRVTTDRGGSWFSNNLNRGHVDYFYWLLAALSAVELLAYVFFAVTYKY  555

Query  704  KN  709
            KN
Sbjct  556  KN  557



>ref|NP_001055628.2| Os05g0431700 [Oryza sativa Japonica Group]
 dbj|BAF17542.2| Os05g0431700, partial [Oryza sativa Japonica Group]
Length=281

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 166/252 (66%), Gaps = 6/252 (2%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            E+ K ++ + PIW T L + + +AQ +TFF KQ  TLDR+I +  ++PPA + S  +I +
Sbjct  27   EQAKGIVRLFPIWATCLIYAVALAQSSTFFTKQAGTLDRRIGDHIQVPPAALQSFISITI  86

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +  + +YDR++VPV R+ TG   G+T+LQRIG GM+ S+ +M +AALVE +RL   ++  
Sbjct  87   VAIIPVYDRVIVPVARRYTGVPSGITMLQRIGAGMVLSLVSMVIAALVETRRLRAARDAG  146

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++W+ PQ+++ G  D FT+VGLQE+FYDQVPD +RSLG+A YLS+ G 
Sbjct  147  LVDKAGVPVPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSLGLALYLSIFGV  206

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+SS L++ +DRATA  G SWF  +LN + LDYFYWL+  ++A  L  Y   A  + Y
Sbjct  207  GSFISSALVSGIDRATAARGGSWFSNNLNRAHLDYFYWLIAALSALELLAYGYFAVTFKY  266

Query  704  KNVQSKTTMAVA  739
            KN      +A +
Sbjct  267  KNKNKGALLATS  278



>ref|XP_003579530.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Brachypodium distachyon]
Length=572

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 165/249 (66%), Gaps = 7/249 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE + V+ ++PIW T L +G+ +AQ +T FIKQG TLDR+I++G E+P A + +     +
Sbjct  306  EEARHVLRLLPIWATCLAYGVVLAQVSTIFIKQGRTLDRRILDGLELPSAALQTFGPAAI  365

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V V IYDR+LVP LR ATGN  GLT LQR+G G+  S+ T+++AALVE +RL   +E+ 
Sbjct  366  LVFVPIYDRLLVPALRYATGNPSGLTPLQRVGTGLALSLATVSMAALVEARRLGIAREHG  425

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS  WLAPQF++IG+ D F  VGLQE+FYDQ+P  +RSL +A Y SV G 
Sbjct  426  LMDDAGATVPMSWVWLAPQFVMIGVADSFVAVGLQEFFYDQMPCGLRSLALALYFSVIGI  485

Query  524  ANFLSSLLITAVDRATAR-SGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             NF+S  L+  +DR T    G SWF  +LN + +DYFY LL G++AA L +Y+  A +Y 
Sbjct  486  GNFISGALVCLIDRITGSGGGDSWFADNLNRAHVDYFYLLLAGLSAAGLALYLYFASSYV  545

Query  701  YKNVQSKTT  727
            YK   ++ +
Sbjct  546  YKCTATRAS  554



>gb|KHG04630.1| hypothetical protein F383_29596 [Gossypium arboreum]
Length=598

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 163/241 (68%), Gaps = 7/241 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K VI + PIW T+L + +  AQ +TFF KQGAT+DR    GFEIP A++ S  ++ +
Sbjct  351  EEAKAVIRLAPIWATSLTYAIVFAQSSTFFTKQGATMDRSTATGFEIPAASLQSFISLSI  410

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDRI VP+ R  TG   G+T+LQRIG GM+ S  ++ +AA+VE +RL   +E+ 
Sbjct  411  VLFIPIYDRIFVPLTRALTGEPAGITLLQRIGSGMVISTISLVIAAVVEMRRLKIAEEHG  470

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MS++WL PQ+ + G+ D FT+VGLQE+FYDQ+P+ +RS+G+A YLS+ G 
Sbjct  471  LIDKPIVVVPMSIWWLVPQYALYGLADVFTMVGLQEFFYDQMPNELRSVGLALYLSIFGV  530

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+A++  T+R GR SWF  +LN + LDYFY LL  ++A  L +YV   + Y 
Sbjct  531  GSFLSSFLISAIENLTSRDGRDSWFANNLNRAHLDYFYLLLAALSAVGLTLYVCCTKYYI  590

Query  701  Y  703
            Y
Sbjct  591  Y  591



>ref|XP_007020112.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY17337.1| Major facilitator superfamily protein [Theobroma cacao]
Length=571

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 161/241 (67%), Gaps = 7/241 (3%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE K +I + P+W T+L + +  AQ +TFF KQGAT+DR I  G EIP AT+ S  ++ +
Sbjct  325  EEAKALIRLAPVWATSLFYAVVFAQSSTFFTKQGATMDRSITAGLEIPAATLQSFISLSI  384

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            ++ + IYDRI VP+ R  TG   G+T+LQRIG+GM+ S T+M VAALVE +RL   Q+  
Sbjct  385  VLFIPIYDRIFVPLARAVTGKPAGITMLQRIGMGMLLSATSMVVAALVEIQRLKTAQDYG  444

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D       MSV+WL PQ+++ G+ D F +VGLQE+FYDQVP+ +RS+G+A YLS+ G 
Sbjct  445  LVDKPNVTVPMSVWWLIPQYVLYGLADVFAMVGLQEFFYDQVPNELRSVGLALYLSIFGV  504

Query  524  ANFLSSLLITAVDRATARSGR-SWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYT  700
             +FLSS LI+ ++  T   GR SWF  +LN + LDYFYWLL   +A  L +Y   A+ Y 
Sbjct  505  GSFLSSFLISVIENVTGGDGRDSWFANNLNRAHLDYFYWLLAAFSAVGLALYFYSAKFYI  564

Query  701  Y  703
            Y
Sbjct  565  Y  565



>ref|XP_006470865.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Citrus sinensis]
Length=572

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 172/243 (71%), Gaps = 9/243 (4%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLVI ++PIWL+ L F   + Q  TFF KQG+T+ R I + F++PPA++ SL  + +
Sbjct  323  EEVKLVIRLIPIWLSCLMFSCILVQLHTFFTKQGSTMRRSIGSNFQVPPASLQSLVGLSI  382

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V+V +Y+RI VP+ R+ TG+  G+T+LQRIGIG+  S+ TM VAALVE KR+   +EN 
Sbjct  383  LVAVPVYERIFVPLARRITGHRSGITMLQRIGIGLFTSILTMIVAALVEAKRVRTARENG  442

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              DS      +S++WL PQ+L++ I D F +VGLQE FYDQ+P++MRS+G A Y+S+ G 
Sbjct  443  LIDSPKAIVPISIWWLLPQYLLVSICDVFGIVGLQELFYDQMPEAMRSIGAAAYISIIGV  502

Query  524  ANFLSSLLITAVDRATARSGRSWFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARNYTY  703
             +F+++ +I  V+   A + RSW   +LN + LDYFYW+L G++A NLCV++ +A+ + Y
Sbjct  503  GSFINTGVIEVVE---AITHRSWLVDNLNRAHLDYFYWVLAGLSALNLCVFIWIAKRFVY  559

Query  704  KNV  712
            K V
Sbjct  560  KKV  562



>gb|KDP40528.1| hypothetical protein JCGZ_24527 [Jatropha curcas]
Length=590

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 176/264 (67%), Gaps = 13/264 (5%)
 Frame = +2

Query  2    EEMKLVINMVPIWLTTLPFGMCVAQGATFFIKQGATLDRKIINGFEIPPATIYSLAAIGM  181
            EE+KLV+ ++PIWL+ L F   + Q  TFF+KQG+T+ R I   F +PPA++  L  + +
Sbjct  331  EEVKLVLRLIPIWLSCLIFTSIIVQNHTFFVKQGSTMIRSIGPNFVLPPASLQCLIGLTI  390

Query  182  IVSVTIYDRILVPVLRKATGNERGLTILQRIGIGMIFSVTTMAVAALVEKKRLNFVQENT  361
            +V+V +YD++ VP+ RK TG+  G+T+LQRIGIG+  S+  MAVAALVE KR++  +E+ 
Sbjct  391  LVTVPVYDKLFVPLARKITGHPSGITMLQRIGIGLFLSILEMAVAALVEAKRISIAKEHG  450

Query  362  TSDS------MSVFWLAPQFLIIGIGDGFTLVGLQEYFYDQVPDSMRSLGIAFYLSVSGA  523
              D+      MSV+WL PQ++I G  D F +VGLQE FYDQ+P++MRS+G A Y+S+ G 
Sbjct  451  LLDTPKAIVPMSVWWLVPQYMISGFSDAFAVVGLQELFYDQMPEAMRSMGAAAYISIIGI  510

Query  524  ANFLSSLLITAVDRATARSGRS---WFGKDLNSSRLDYFYWLLGGITAANLCVYVLVARN  694
             +F+++ +I+ V   T+R G     W G +LN + LDYFYW+L  ++  NLC+YV +A  
Sbjct  511  GSFVNTAVISVVQAVTSRHGGGGGVWLGDNLNLAHLDYFYWVLAVLSGLNLCLYVWIASG  570

Query  695  YTYKNVQSKTTMAVADCDDDGGRD  766
            + YK V+ + T    + ++ GG  
Sbjct  571  FEYKKVEGEKT----EMEEKGGES  590



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426