BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21986_g1_i1 len=2560 path=[4718:0-871 5590:872-912 5631:913-1005
5724:1006-1035 5754:1036-1327 6046:1328-1358 1227:1359-2559]

Length=2560
                                                                      Score     E

ref|XP_009588696.1|  PREDICTED: outer envelope protein 64, chloro...    835   0.0      
ref|XP_006341523.1|  PREDICTED: outer envelope protein 64, chloro...    830   0.0      
ref|XP_004235757.1|  PREDICTED: outer envelope protein 64, chloro...    829   0.0      
emb|CDO98344.1|  unnamed protein product                                791   0.0      
ref|XP_010264573.1|  PREDICTED: outer envelope protein 64, chloro...    769   0.0      
ref|XP_009780770.1|  PREDICTED: outer envelope protein 64, chloro...    764   0.0      
ref|XP_002282402.1|  PREDICTED: translocon at the outer membrane ...    764   0.0      Vitis vinifera
ref|XP_004503273.1|  PREDICTED: translocon at the outer membrane ...    761   0.0      
ref|XP_011084180.1|  PREDICTED: outer envelope protein 64, chloro...    756   0.0      
ref|XP_006490775.1|  PREDICTED: outer envelope protein 64, chloro...    753   0.0      
ref|XP_011084169.1|  PREDICTED: outer envelope protein 64, chloro...    752   0.0      
ref|XP_006451616.1|  hypothetical protein CICLE_v10007714mg             754   0.0      
gb|EYU24147.1|  hypothetical protein MIMGU_mgv1a003366mg                751   0.0      
ref|XP_010036953.1|  PREDICTED: outer envelope protein 64, chloro...    751   0.0      
ref|XP_006580398.1|  PREDICTED: translocon at the outer membrane ...    746   0.0      
ref|XP_003631114.1|  Glutamyl-tRNA(Gln) amidotransferase subunit A      745   0.0      
ref|XP_008240148.1|  PREDICTED: outer envelope protein 64, chloro...    743   0.0      
ref|XP_009356037.1|  PREDICTED: translocon at the outer membrane ...    738   0.0      
ref|XP_007211280.1|  hypothetical protein PRUPE_ppa003231mg             737   0.0      
ref|XP_003530960.1|  PREDICTED: translocon at the outer membrane ...    734   0.0      
ref|XP_004299527.1|  PREDICTED: translocon at the outer membrane ...    734   0.0      
ref|XP_008374849.1|  PREDICTED: translocon at the outer membrane ...    733   0.0      
ref|XP_002322105.1|  Toc64 family protein                               731   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004160411.1|  PREDICTED: translocon at the outer membrane ...    731   0.0      
gb|KGN63878.1|  hypothetical protein Csa_1G025100                       729   0.0      
ref|XP_007036834.1|  Amidase family protein isoform 1                   727   0.0      
ref|XP_010549063.1|  PREDICTED: outer envelope protein 64, chloro...    726   0.0      
gb|KDP23937.1|  hypothetical protein JCGZ_27097                         723   0.0      
ref|XP_006406668.1|  hypothetical protein EUTSA_v10020361mg             723   0.0      
gb|KHN10539.1|  Translocon at the outer membrane of chloroplasts 64     721   0.0      
sp|Q9MUK5.1|TOC64_PEA  RecName: Full=Translocon at the outer memb...    721   0.0      Pisum sativum [garden pea]
ref|XP_010678253.1|  PREDICTED: translocon at the outer membrane ...    720   0.0      
ref|XP_008453484.1|  PREDICTED: outer envelope protein 64, chloro...    719   0.0      
ref|XP_009135562.1|  PREDICTED: outer envelope protein 64, chloro...    717   0.0      
ref|XP_011035613.1|  PREDICTED: outer envelope protein 64, chloro...    716   0.0      
ref|XP_004137345.1|  PREDICTED: LOW QUALITY PROTEIN: translocon a...    715   0.0      
ref|XP_002530483.1|  amidase, putative                                  713   0.0      Ricinus communis
gb|KDO63834.1|  hypothetical protein CISIN_1g008025mg                   711   0.0      
emb|CDX93679.1|  BnaA06g03690D                                          710   0.0      
ref|XP_009147958.1|  PREDICTED: outer envelope protein 64, chloro...    707   0.0      
ref|NP_188424.2|  translocon at the outer membrane of chloroplast...    703   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX95800.1|  BnaC05g35510D                                          709   0.0      
ref|XP_002317872.2|  Toc64 family protein                               702   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY51926.1|  BnaAnng11030D                                          700   0.0      
ref|XP_010487707.1|  PREDICTED: outer envelope protein 64, chloro...    699   0.0      
ref|XP_010465870.1|  PREDICTED: outer envelope protein 64, chloro...    698   0.0      
emb|CDX75952.1|  BnaC03g40350D                                          696   0.0      
emb|CDY40591.1|  BnaC06g02070D                                          696   0.0      
ref|XP_009145949.1|  PREDICTED: outer envelope protein 64, chloro...    693   0.0      
ref|XP_010506209.1|  PREDICTED: outer envelope protein 64, chloro...    693   0.0      
gb|KFK39126.1|  hypothetical protein AALP_AA3G204300                    691   0.0      
ref|XP_006297201.1|  hypothetical protein CARUB_v10013209mg             687   0.0      
emb|CDX92180.1|  BnaA05g22270D                                          688   0.0      
ref|XP_004503275.1|  PREDICTED: translocon at the outer membrane ...    669   0.0      
ref|XP_008809807.1|  PREDICTED: outer envelope protein 64, chloro...    668   0.0      
gb|KDO63833.1|  hypothetical protein CISIN_1g008025mg                   666   0.0      
ref|XP_010916516.1|  PREDICTED: outer envelope protein 64, chloro...    662   0.0      
ref|XP_009409633.1|  PREDICTED: translocon at the outer membrane ...    662   0.0      
ref|XP_006826894.1|  hypothetical protein AMTR_s00010p00149200          654   0.0      
ref|XP_007160538.1|  hypothetical protein PHAVU_002G330000g             623   0.0      
gb|KEH21426.1|  translocon at the outer membrane ofs-like protein       625   0.0      
gb|KDO63832.1|  hypothetical protein CISIN_1g008025mg                   619   0.0      
ref|XP_004982030.1|  PREDICTED: outer envelope protein 64, chloro...    601   0.0      
ref|NP_001051033.1|  Os03g0707900                                       596   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97726.1|  predicted protein                                      596   0.0      
gb|EEE59781.1|  hypothetical protein OsJ_12287                          594   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650474.1|  PREDICTED: outer envelope protein 64, chloro...    593   0.0      
ref|XP_002464019.1|  hypothetical protein SORBIDRAFT_01g010650          587   0.0      Sorghum bicolor [broomcorn]
ref|XP_007036835.1|  Amidase family protein isoform 2                   581   0.0      
ref|NP_001152345.1|  LOC100285985                                       585   0.0      Zea mays [maize]
ref|XP_003560735.1|  PREDICTED: outer envelope protein 64, chloro...    570   0.0      
ref|XP_007042951.1|  Translocon at the outer membrane of chloropl...    557   0.0      
gb|AAS47584.1|  chloroplast Toc64-1                                     550   0.0      Physcomitrella patens
ref|XP_010030038.1|  PREDICTED: outer envelope protein 64, mitoch...    542   3e-179   
gb|KHF99139.1|  Amidase 1 -like protein                                 541   1e-178   
ref|XP_010422985.1|  PREDICTED: outer envelope protein 64, mitoch...    540   2e-178   
ref|XP_010520942.1|  PREDICTED: outer envelope protein 64, mitoch...    539   4e-178   
ref|XP_007036836.1|  Amidase family protein isoform 3                   534   5e-178   
ref|XP_006341842.1|  PREDICTED: outer envelope protein 64, mitoch...    538   8e-178   
ref|XP_010491570.1|  PREDICTED: outer envelope protein 64, mitoch...    537   2e-177   
ref|XP_006399420.1|  hypothetical protein EUTSA_v10013019mg             536   7e-177   
ref|XP_010452933.1|  PREDICTED: outer envelope protein 64, mitoch...    535   2e-176   
ref|XP_007200962.1|  hypothetical protein PRUPE_ppa003071mg             534   4e-176   
gb|KDP40901.1|  hypothetical protein JCGZ_24900                         533   7e-176   
ref|XP_006286476.1|  hypothetical protein CARUB_v10000509mg             531   4e-175   
ref|XP_002298203.2|  chloroplast outer membrane translocon subuni...    531   6e-175   Populus trichocarpa [western balsam poplar]
ref|XP_002268888.1|  PREDICTED: outer envelope protein 64, mitoch...    530   1e-174   Vitis vinifera
ref|XP_002525865.1|  amidase, putative                                  530   2e-174   Ricinus communis
ref|XP_004248799.1|  PREDICTED: outer envelope protein 64, mitoch...    529   3e-174   
ref|XP_009624799.1|  PREDICTED: outer envelope protein 64, mitoch...    529   3e-174   
ref|XP_008237381.1|  PREDICTED: outer envelope protein 64, mitoch...    528   5e-174   
ref|XP_009337882.1|  PREDICTED: outer envelope protein 64, mitoch...    528   6e-174   
gb|EMT03933.1|  Glutamyl-tRNA(Gln) amidotransferase subunit A           536   3e-173   
gb|AAS47585.1|  chloroplast Toc64-2                                     525   5e-173   Physcomitrella patens
emb|CDY21581.1|  BnaC09g47110D                                          525   1e-172   
emb|CDX69906.1|  BnaA10g22550D                                          524   2e-172   
ref|XP_011002073.1|  PREDICTED: outer envelope protein 64, mitoch...    524   2e-172   
ref|NP_196504.2|  translocon at the outer membrane of chloroplast...    524   3e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493887.1|  PREDICTED: outer envelope protein 64, mitoch...    523   7e-172   
emb|CDO97443.1|  unnamed protein product                                523   8e-172   
ref|XP_009344574.1|  PREDICTED: outer envelope protein 64, mitoch...    523   9e-172   
ref|XP_009776046.1|  PREDICTED: outer envelope protein 64, mitoch...    523   1e-171   
ref|XP_009122515.1|  PREDICTED: outer envelope protein 64, mitoch...    521   2e-171   
ref|XP_011087889.1|  PREDICTED: outer envelope protein 64, mitoch...    521   5e-171   
ref|XP_010937490.1|  PREDICTED: outer envelope protein 64, mitoch...    519   6e-170   
gb|EYU18475.1|  hypothetical protein MIMGU_mgv1a020842mg                517   2e-169   
ref|XP_002871370.1|  hypothetical protein ARALYDRAFT_325494             516   6e-169   
emb|CAC05468.1|  putative subunit of TOC complex                        514   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348816.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    514   2e-168   
gb|EPS65438.1|  hypothetical protein M569_09339                         513   2e-168   
ref|XP_010267662.1|  PREDICTED: outer envelope protein 64, mitoch...    513   4e-168   
gb|KHN00149.1|  Translocon at the outer membrane of chloroplasts 64     503   7e-168   
ref|XP_003524732.1|  PREDICTED: outer envelope protein 64, mitoch...    510   7e-167   
gb|KFK25250.1|  hypothetical protein AALP_AA8G087600                    509   2e-166   
ref|XP_009417579.1|  PREDICTED: outer envelope protein 64, mitoch...    508   5e-166   
ref|XP_001781385.1|  predicted protein                                  505   5e-165   
ref|XP_003531546.1|  PREDICTED: outer envelope protein 64, mitoch...    503   2e-164   
ref|XP_008455198.1|  PREDICTED: outer envelope protein 64, mitoch...    504   2e-164   
ref|XP_007159113.1|  hypothetical protein PHAVU_002G209800g             504   2e-164   
ref|XP_004504805.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    503   4e-164   
gb|KEH31213.1|  translocon at the outer membrane ofs-like protein       501   2e-163   
ref|XP_004136877.1|  PREDICTED: outer envelope protein 64, mitoch...    499   9e-163   
gb|EMS53790.1|  RNA polymerase II-associated protein 3                  496   1e-162   
ref|XP_006597350.1|  PREDICTED: outer envelope protein 64, mitoch...    494   8e-161   
ref|XP_010690507.1|  PREDICTED: outer envelope protein 64, mitoch...    493   3e-160   
ref|XP_008802223.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    487   5e-157   
ref|XP_007148409.1|  hypothetical protein PHAVU_006G206200g             483   2e-156   
ref|XP_003570616.2|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    493   4e-155   
ref|XP_006647919.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    478   3e-154   
gb|EPS58820.1|  hypothetical protein M569_15994                         467   5e-153   
dbj|BAK05802.1|  predicted protein                                      469   6e-151   
ref|NP_001048155.1|  Os02g0754500                                       466   1e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002987441.1|  hypothetical protein SELMODRAFT_42040              465   1e-149   
gb|EEC74029.1|  hypothetical protein OsI_08982                          464   6e-149   Oryza sativa Indica Group [Indian rice]
gb|KHN33528.1|  Outer envelope protein 64, mitochondrial                463   2e-148   
ref|XP_008643639.1|  PREDICTED: LOC100281793 isoform X1                 462   2e-148   
ref|XP_007036837.1|  Translocon at the outer membrane of chloropl...    453   1e-147   
gb|KDO41288.1|  hypothetical protein CISIN_1g0074012mg                  459   1e-147   
gb|KDO41289.1|  hypothetical protein CISIN_1g0074012mg                  458   2e-147   
gb|KCW56987.1|  hypothetical protein EUGRSUZ_I02661                     457   5e-147   
ref|XP_004953960.1|  PREDICTED: outer envelope protein 64, mitoch...    456   9e-146   
gb|ACN40706.1|  unknown                                                 444   3e-143   Picea sitchensis
ref|XP_010678254.1|  PREDICTED: translocon at the outer membrane ...    437   6e-140   
ref|XP_006850734.1|  hypothetical protein AMTR_s00025p00053190          416   2e-132   
ref|XP_010099753.1|  Translocon at the outer membrane of chloropl...    410   3e-131   
ref|XP_006597351.1|  PREDICTED: outer envelope protein 64, mitoch...    413   1e-130   
ref|XP_007042952.1|  Translocon at the outer membrane of chloropl...    410   1e-129   
ref|NP_001148185.1|  LOC100281793                                       410   2e-128   Zea mays [maize]
ref|XP_008643640.1|  PREDICTED: LOC100281793 isoform X2                 407   3e-127   
gb|AFW73495.1|  amidase                                                 406   4e-127   
ref|XP_010278157.1|  PREDICTED: amidase 1 isoform X2                    399   2e-126   
ref|XP_010043096.1|  PREDICTED: amidase 1-like isoform X1               394   2e-124   
ref|XP_008813665.1|  PREDICTED: amidase 1-like                          394   3e-124   
emb|CAN77023.1|  hypothetical protein VITISV_015334                     393   3e-124   Vitis vinifera
ref|XP_002284823.2|  PREDICTED: amidase 1                               393   4e-124   Vitis vinifera
gb|KHG21461.1|  Amidase 1 -like protein                                 396   5e-124   
ref|XP_010278148.1|  PREDICTED: amidase 1 isoform X1                    393   5e-124   
gb|EMT16420.1|  Small glutamine-rich tetratricopeptide repeat-con...    400   7e-124   
ref|XP_002454250.1|  hypothetical protein SORBIDRAFT_04g027530          391   1e-121   Sorghum bicolor [broomcorn]
gb|KHN26750.1|  Outer envelope protein 64, mitochondrial                390   5e-121   
ref|XP_010938781.1|  PREDICTED: amidase 1-like isoform X1               383   3e-120   
ref|XP_010043094.1|  PREDICTED: amidase 1                               383   4e-120   
ref|XP_011023584.1|  PREDICTED: LOW QUALITY PROTEIN: amidase 1-like     381   1e-119   
gb|KCW85156.1|  hypothetical protein EUGRSUZ_B01996                     380   2e-119   
ref|XP_004302440.1|  PREDICTED: amidase 1-like                          380   4e-119   
ref|XP_011023586.1|  PREDICTED: amidase 1-like isoform X1               378   2e-118   
ref|XP_009391586.1|  PREDICTED: amidase 1                               377   5e-118   
ref|XP_010674770.1|  PREDICTED: amidase 1                               374   1e-116   
ref|XP_004135624.1|  PREDICTED: amidase 1-like                          373   1e-116   
ref|XP_007030866.1|  Amidase 1                                          373   1e-116   
ref|XP_004166037.1|  PREDICTED: amidase 1-like                          373   1e-116   
dbj|BAG84637.1|  indole-3-acetamide hydrolase                           372   3e-116   Nicotiana tabacum [American tobacco]
ref|XP_008450658.1|  PREDICTED: amidase 1-like                          371   7e-116   
ref|XP_008370498.1|  PREDICTED: amidase 1-like                          371   1e-115   
emb|CDP20120.1|  unnamed protein product                                370   2e-115   
ref|XP_009589965.1|  PREDICTED: amidase 1                               370   2e-115   
ref|XP_007030865.1|  Amidase 1                                          369   6e-115   
ref|XP_007205225.1|  hypothetical protein PRUPE_ppa005982mg             368   1e-114   
ref|XP_004495736.1|  PREDICTED: amidase 1-like                          367   2e-114   
gb|KDP23530.1|  hypothetical protein JCGZ_23363                         365   1e-113   
gb|EYU39138.1|  hypothetical protein MIMGU_mgv1a019997mg                369   1e-113   
ref|XP_002512364.1|  amidase, putative                                  367   2e-113   Ricinus communis
gb|KHG20058.1|  Amidase 1 -like protein                                 364   3e-113   
ref|XP_003591093.1|  Glutamyl-tRNA(Gln) amidotransferase subunit A      364   3e-113   
ref|XP_006585446.1|  PREDICTED: outer envelope protein 64, mitoch...    366   9e-113   
ref|XP_011084291.1|  PREDICTED: amidase 1 isoform X1                    363   1e-112   
ref|XP_008246489.1|  PREDICTED: amidase 1 isoform X1                    363   1e-112   
ref|XP_006433291.1|  hypothetical protein CICLE_v10001239mg             362   3e-112   
ref|XP_003556503.1|  PREDICTED: amidase 1-like isoform X1               362   4e-112   
ref|XP_006433295.1|  hypothetical protein CICLE_v10001213mg             362   4e-112   
ref|XP_007144743.1|  hypothetical protein PHAVU_007G180900g             361   4e-112   
ref|XP_003536085.1|  PREDICTED: amidase 1-like                          358   1e-110   
gb|EYU39870.1|  hypothetical protein MIMGU_mgv1a006860mg                357   1e-110   
ref|XP_009349393.1|  PREDICTED: amidase 1-like isoform X4               357   2e-110   
ref|XP_006433294.1|  hypothetical protein CICLE_v10001213mg             357   2e-110   
gb|KHN16134.1|  Amidase 1                                               357   3e-110   
ref|XP_010549880.1|  PREDICTED: amidase 1                               357   3e-110   
ref|XP_009349392.1|  PREDICTED: amidase 1-like isoform X3               355   1e-109   
ref|XP_009349391.1|  PREDICTED: amidase 1-like isoform X2               353   4e-109   
ref|XP_009349390.1|  PREDICTED: amidase 1-like isoform X1               353   8e-109   
ref|XP_009350393.1|  PREDICTED: amidase 1-like                          352   1e-108   
ref|XP_004135625.1|  PREDICTED: amidase 1-like                          352   2e-108   
ref|XP_006471975.1|  PREDICTED: amidase 1-like isoform X1               352   5e-108   
ref|XP_004166038.1|  PREDICTED: amidase 1-like                          350   8e-108   
ref|XP_009350390.1|  PREDICTED: amidase 1-like isoform X2               350   1e-107   
ref|XP_009349985.1|  PREDICTED: amidase 1-like isoform X1               349   2e-107   
ref|XP_009349986.1|  PREDICTED: amidase 1-like isoform X2               349   2e-107   
ref|XP_009350389.1|  PREDICTED: amidase 1-like isoform X1               348   3e-107   
ref|XP_010099754.1|  Outer envelope protein 64                          346   7e-107   
ref|XP_008450659.1|  PREDICTED: amidase 1-like                          347   1e-106   
ref|XP_002889727.1|  hypothetical protein ARALYDRAFT_888131             347   2e-106   
ref|XP_009350391.1|  PREDICTED: amidase 1-like isoform X3               346   2e-106   
ref|NP_563831.1|  amidase 1                                             345   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349388.1|  PREDICTED: amidase 1-like                          344   1e-105   
ref|XP_008348348.1|  PREDICTED: amidase 1-like isoform X1               344   2e-105   
ref|XP_009118331.1|  PREDICTED: amidase 1                               343   3e-105   
ref|XP_010458166.1|  PREDICTED: amidase 1-like                          343   4e-105   
ref|XP_010489566.1|  PREDICTED: amidase 1-like isoform X1               342   1e-104   
gb|KFK43202.1|  hypothetical protein AALP_AA1G093600                    341   2e-104   
ref|XP_004967877.1|  PREDICTED: amidase 1-like                          342   2e-104   
tpg|DAA50921.1|  TPA: toc64 isoform 1                                   335   4e-104   
ref|XP_006417625.1|  hypothetical protein EUTSA_v10007679mg             340   6e-104   
ref|XP_009350394.1|  PREDICTED: amidase 1-like                          340   9e-104   
emb|CDY06342.1|  BnaA09g48610D                                          338   1e-103   
ref|XP_010043097.1|  PREDICTED: amidase 1-like isoform X2               337   2e-103   
emb|CDY22653.1|  BnaC08g42870D                                          338   2e-103   
ref|XP_008388968.1|  PREDICTED: amidase 1-like                          338   3e-103   
ref|XP_010475716.1|  PREDICTED: amidase 1                               338   3e-103   
gb|EAY92845.1|  hypothetical protein OsI_14646                          337   1e-102   Oryza sativa Indica Group [Indian rice]
emb|CAH66005.1|  H0613H07.3                                             337   1e-102   Oryza sativa [red rice]
gb|EPS64745.1|  hypothetical protein M569_10030                         336   2e-102   
ref|XP_007042954.1|  Translocon at the outer membrane of chloropl...    335   3e-102   
ref|NP_001052056.1|  Os04g0118100                                       335   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010475719.1|  PREDICTED: amidase 1-like                          335   6e-102   
ref|XP_010489596.1|  PREDICTED: amidase 1-like                          333   2e-101   
gb|ABR18072.1|  unknown                                                 327   2e-101   Picea sitchensis
ref|XP_007042953.1|  Translocon at the outer membrane of chloropl...    334   6e-101   
ref|XP_010458167.1|  PREDICTED: amidase 1-like                          330   4e-100   
ref|XP_006307599.1|  hypothetical protein CARUB_v10009223mg             329   8e-100   
ref|XP_006433293.1|  hypothetical protein CICLE_v10001239mg             328   1e-99    
ref|XP_002461034.1|  hypothetical protein SORBIDRAFT_02g039510          327   9e-99    Sorghum bicolor [broomcorn]
gb|KDO59507.1|  hypothetical protein CISIN_1g0442941mg                  320   5e-97    
ref|XP_006606510.1|  PREDICTED: amidase 1-like isoform X2               319   2e-96    
ref|NP_001052054.2|  Os04g0117800                                       319   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008246490.1|  PREDICTED: amidase 1 isoform X2                    317   1e-95    
gb|EEE60408.1|  hypothetical protein OsJ_13590                          317   2e-95    Oryza sativa Japonica Group [Japonica rice]
gb|KCW85157.1|  hypothetical protein EUGRSUZ_B01996                     315   2e-95    
ref|XP_010312345.1|  PREDICTED: amidase 1                               317   3e-95    
ref|XP_006853167.1|  hypothetical protein AMTR_s00038p00191060          311   8e-95    
gb|EMS46388.1|  Glutamyl-tRNA(Gln) amidotransferase subunit A           318   1e-94    
ref|XP_007144741.1|  hypothetical protein PHAVU_007G180900g             312   1e-93    
ref|NP_001170670.1|  hypothetical protein                               313   2e-93    Zea mays [maize]
ref|XP_010042517.1|  PREDICTED: amidase 1-like                          309   3e-93    
ref|XP_006363664.1|  PREDICTED: amidase 1-like                          311   4e-93    
gb|KHN42749.1|  Outer envelope protein 64, mitochondrial                312   4e-92    
ref|XP_006387191.1|  hypothetical protein POPTR_1567s00200g             304   2e-91    
ref|XP_006653116.1|  PREDICTED: amidase 1-like                          306   4e-91    
ref|XP_002319550.2|  hypothetical protein POPTR_0013s02510g             300   6e-90    Populus trichocarpa [western balsam poplar]
ref|XP_011023587.1|  PREDICTED: amidase 1-like isoform X2               297   6e-89    
gb|KCW85159.1|  hypothetical protein EUGRSUZ_B01996                     296   3e-88    
ref|XP_006652078.1|  PREDICTED: amidase 1-like                          297   1e-87    
ref|XP_010489574.1|  PREDICTED: amidase 1-like isoform X2               293   8e-87    
ref|XP_003580892.1|  PREDICTED: amidase 1                               293   6e-86    
ref|XP_006606511.1|  PREDICTED: amidase 1-like isoform X3               287   5e-85    
ref|XP_008373244.1|  PREDICTED: outer envelope protein 64, mitoch...    288   9e-85    
ref|XP_010105841.1|  Amidase 1                                          287   5e-84    
ref|XP_006375768.1|  hypothetical protein POPTR_0013s025002g            280   3e-83    
ref|XP_009349988.1|  PREDICTED: amidase 1-like isoform X4               281   2e-82    
ref|XP_008345874.1|  PREDICTED: amidase 1-like                          279   3e-82    
ref|XP_007144742.1|  hypothetical protein PHAVU_007G180900g             278   2e-81    
ref|XP_010938782.1|  PREDICTED: amidase 1-like isoform X2               278   3e-81    
ref|XP_009349987.1|  PREDICTED: amidase 1-like isoform X3               275   2e-80    
ref|XP_010938810.1|  PREDICTED: amidase 1-like                          279   6e-80    
ref|XP_008348349.1|  PREDICTED: amidase 1-like isoform X2               274   7e-80    
ref|XP_006423854.1|  hypothetical protein CICLE_v10028606mg             274   1e-79    
ref|XP_009804827.1|  PREDICTED: uncharacterized protein LOC104249984    286   1e-78    
ref|XP_004967878.1|  PREDICTED: amidase 1-like                          267   3e-77    
ref|XP_003082054.1|  chloroplast Toc64-2 (ISS)                          264   1e-73    
ref|XP_001768126.1|  predicted protein                                  253   7e-72    
emb|CAE01726.2|  OSJNBb0050O03.16                                       248   6e-71    
emb|CDY03602.1|  BnaC03g68610D                                          245   3e-70    
ref|XP_001773759.1|  predicted protein                                  246   2e-69    
ref|XP_010094153.1|  Outer envelope protein 64                          246   3e-69    
ref|XP_008345958.1|  PREDICTED: amidase 1-like                          235   1e-66    
ref|XP_011084292.1|  PREDICTED: amidase 1 isoform X2                    234   1e-66    
ref|XP_009350388.1|  PREDICTED: amidase 1-like                          234   2e-66    
gb|ACN30694.1|  unknown                                                 233   8e-66    
ref|XP_008388583.1|  PREDICTED: amidase 1-like                          231   2e-65    
ref|XP_001420347.1|  predicted protein                                  238   7e-65    
ref|XP_009349984.1|  PREDICTED: amidase 1-like                          229   8e-65    
ref|XP_004173958.1|  PREDICTED: outer envelope protein 64, mitoch...    222   3e-62    
gb|KDO59508.1|  hypothetical protein CISIN_1g037166mg                   219   7e-62    
ref|XP_001775498.1|  predicted protein                                  214   4e-59    
ref|XP_009350386.1|  PREDICTED: amidase 1-like                          210   2e-58    
ref|XP_006423855.1|  hypothetical protein CICLE_v10028606mg             211   3e-58    
ref|XP_008350749.1|  PREDICTED: amidase 1-like                          207   1e-56    
ref|WP_035724953.1|  hypothetical protein                               209   2e-56    
ref|WP_019537430.1|  hypothetical protein                               207   1e-55    
ref|XP_007509379.1|  amidase                                            213   2e-55    
ref|XP_002508981.1|  chloroplast envelope protein translocase family    210   5e-55    
ref|WP_005587302.1|  Amidase 1                                          204   2e-54    
ref|WP_026849842.1|  amidase                                            203   4e-54    
ref|WP_026989504.1|  hypothetical protein                               202   1e-53    
ref|WP_020592848.1|  hypothetical protein                               202   2e-53    
ref|WP_027134422.1|  hypothetical protein                               201   2e-53    
ref|WP_028986539.1|  amidase                                            201   3e-53    
ref|WP_012682528.1|  amidase                                            200   5e-53    
ref|WP_026280970.1|  amidase                                            200   5e-53    
gb|KGA96674.1|  amidase                                                 199   7e-53    
ref|WP_018932139.1|  hypothetical protein                               199   9e-53    
gb|AAB70409.1|  Contains similarity to Rhodococcus amidase (gb|D1...    195   1e-52    
ref|WP_018698254.1|  hypothetical protein                               198   2e-52    
ref|WP_019155089.1|  hypothetical protein                               197   2e-52    
ref|WP_013487505.1|  amidase                                            196   6e-52    
ref|WP_025680606.1|  amidase                                            197   8e-52    
ref|WP_031540491.1|  amidase                                            196   1e-51    
ref|WP_036634162.1|  amidase                                            196   1e-51    
ref|WP_034750308.1|  amidase                                            196   1e-51    
ref|WP_034626277.1|  amidase                                            194   3e-51    
ref|WP_013171538.1|  amidase [                                          194   4e-51    
ref|WP_031337231.1|  hypothetical protein                               194   5e-51    
ref|WP_015847442.1|  amidase                                            194   5e-51    
ref|WP_026293744.1|  amidase                                            193   1e-50    
ref|WP_019005788.1|  hypothetical protein                               193   1e-50    
ref|WP_028412266.1|  amidase                                            192   2e-50    
ref|WP_034745331.1|  amidase                                            192   2e-50    
ref|WP_034653931.1|  amidase                                            192   4e-50    
ref|WP_034269875.1|  amidase                                            191   5e-50    
ref|XP_005647194.1|  amidase                                            191   7e-50    
ref|WP_029324943.1|  amidase                                            191   7e-50    
ref|WP_008635629.1|  peptidase M22, glycoprotease                       191   9e-50    
ref|WP_028407713.1|  amidase                                            190   1e-49    
ref|WP_033578222.1|  amidase                                            190   1e-49    
gb|AIQ34387.1|  amidase                                                 191   1e-49    
ref|WP_028608402.1|  amidase                                            189   2e-49    
ref|WP_026299266.1|  hypothetical protein                               189   2e-49    
ref|WP_016763300.1|  amidase                                            189   2e-49    
ref|WP_026588785.1|  amidase                                            189   2e-49    
ref|WP_013055744.1|  amidase                                            189   3e-49    
ref|WP_014461278.1|  amidase                                            189   3e-49    
ref|WP_026578215.1|  amidase                                            189   3e-49    
ref|WP_035691953.1|  hypothetical protein                               188   5e-49    
ref|WP_018922118.1|  hypothetical protein                               188   9e-49    
ref|WP_026702648.1|  amidase                                            187   1e-48    
ref|WP_026559532.1|  amidase                                            187   1e-48    
ref|WP_025678991.1|  amidase                                            187   1e-48    
ref|WP_037449942.1|  amidase                                            187   2e-48    
ref|WP_018887202.1|  hypothetical protein                               187   2e-48    
ref|WP_028590230.1|  amidase                                            187   2e-48    
ref|WP_025749632.1|  amidase                                            187   2e-48    
ref|WP_013082047.1|  amidase                                            187   2e-48    
gb|EZQ02699.1|  amidase                                                 186   3e-48    
ref|WP_013487846.1|  amidase                                            186   3e-48    
gb|AIQ22587.1|  amidase                                                 187   4e-48    
ref|WP_027415701.1|  amidase                                            185   5e-48    
ref|WP_020179138.1|  hypothetical protein                               185   5e-48    
ref|WP_034749967.1|  amidase                                            184   1e-47    
ref|WP_036653350.1|  amidase                                            184   1e-47    
ref|WP_037448685.1|  hypothetical protein                               184   2e-47    
ref|WP_027093747.1|  amidase                                            184   2e-47    
ref|WP_017812520.1|  hypothetical protein                               184   3e-47    
ref|WP_019912779.1|  hypothetical protein                               183   3e-47    
ref|WP_011440979.1|  amidase                                            183   4e-47    
ref|WP_038943780.1|  hypothetical protein                               183   4e-47    
ref|WP_008943947.1|  amidase                                            182   6e-47    
ref|WP_014281842.1|  amidase                                            182   8e-47    
ref|WP_010684493.1|  Hypothetical protein                               182   8e-47    
ref|WP_020618628.1|  hypothetical protein                               181   3e-46    
gb|KFE58204.1|  amidase                                                 180   4e-46    
ref|WP_016202856.1|  glutamyl-tRNA(Gln) amidotransferase subunit A      180   4e-46    
ref|WP_011927259.1|  amidase                                            180   4e-46    
ref|WP_035206196.1|  hypothetical protein                               180   4e-46    
ref|WP_035355385.1|  amidase                                            180   6e-46    
gb|AIC93289.1|  amidase                                                 179   7e-46    
gb|EMT10205.1|  hypothetical protein F775_07780                         176   7e-46    
ref|WP_028963102.1|  amidase                                            179   7e-46    
ref|WP_025729357.1|  amidase                                            179   7e-46    
ref|WP_029557024.1|  amidase                                            179   8e-46    
ref|WP_002727721.1|  amidase                                            180   8e-46    
gb|AIQ45655.1|  amidase                                                 180   9e-46    
ref|WP_038485226.1|  hypothetical protein                               179   9e-46    
ref|WP_011248567.1|  amidase                                            179   9e-46    
ref|WP_035667405.1|  amidase                                            179   1e-45    
dbj|GAF65466.1|  putaive amidase                                        178   2e-45    
gb|KGA95981.1|  amidase                                                 177   4e-45    
gb|AIQ67523.1|  amidase                                                 177   4e-45    
ref|WP_026695754.1|  amidase                                            177   4e-45    
gb|AHV96283.1|  amidase                                                 177   4e-45    
gb|ETT62881.1|  Amidase                                                 179   5e-45    
ref|WP_036246380.1|  amidase                                            177   5e-45    
ref|WP_018664963.1|  hypothetical protein                               177   5e-45    
ref|WP_026040479.1|  amidase                                            177   5e-45    
gb|AIQ56881.1|  amidase                                                 177   6e-45    
ref|XP_008367990.1|  PREDICTED: outer envelope protein 64, chloro...    170   1e-44    
ref|WP_035397129.1|  hypothetical protein                               176   1e-44    
ref|WP_021133514.1|  amidase                                            176   2e-44    
ref|WP_022792453.1|  amidase                                            175   3e-44    
ref|WP_018388857.1|  amidase                                            175   3e-44    
gb|AIQ28130.1|  hypothetical protein P40081_08000                       176   3e-44    
ref|WP_019536231.1|  hypothetical protein                               175   3e-44    
gb|AIQ39837.1|  amidase                                                 176   4e-44    
ref|WP_028194464.1|  amidase                                            174   5e-44    
ref|WP_038362873.1|  amidase                                            174   5e-44    
gb|EMS64174.1|  hypothetical protein TRIUR3_02000                       170   8e-44    
ref|WP_026948208.1|  hypothetical protein                               173   1e-43    
ref|WP_039301441.1|  amidase                                            174   1e-43    
ref|WP_030100577.1|  amidase                                            173   1e-43    
ref|WP_013986280.1|  amidase                                            173   2e-43    
ref|WP_038587319.1|  amidase                                            172   3e-43    
ref|WP_011903025.1|  amidase                                            172   3e-43    
ref|WP_038121684.1|  amidase                                            172   4e-43    
ref|WP_031228037.1|  hypothetical protein                               171   4e-43    
gb|ERS15510.1|  hypothetical protein Q668_00350                         171   5e-43    
ref|WP_036708594.1|  amidase                                            171   7e-43    
ref|WP_012116025.1|  amidase                                            171   7e-43    
ref|WP_014996206.1|  glutamyl-tRNA(Gln) amidotransferase subunit A      171   7e-43    
ref|WP_025810754.1|  amidase                                            171   7e-43    
gb|KFM83964.1|  amidase family protein                                  171   7e-43    
ref|WP_024925811.1|  MULTISPECIES: amidase                              171   8e-43    
ref|WP_020452968.1|  hypothetical protein                               171   9e-43    
ref|WP_026580116.1|  MULTISPECIES: amidase                              171   1e-42    
ref|WP_006913773.1|  amidase                                            171   1e-42    
ref|WP_008045742.1|  amidase                                            171   1e-42    
ref|WP_023856299.1|  amidase                                            170   1e-42    
ref|WP_029354555.1|  amidase                                            170   2e-42    
ref|WP_035605181.1|  amidase                                            170   2e-42    
ref|WP_010464770.1|  amidase                                            170   2e-42    
ref|WP_023432031.1|  Asp-tRNAAsn/Glu-tRNAGln amidotransferase           170   2e-42    
ref|WP_025909264.1|  amidase                                            169   3e-42    
ref|WP_010027513.1|  glutamyl-tRNA amidotransferase subunit A           169   3e-42    
ref|WP_028983620.1|  glutamyl-tRNA amidotransferase                     169   4e-42    
ref|WP_020068003.1|  amidase                                            168   5e-42    
ref|WP_029651783.1|  amidase                                            168   5e-42    
ref|WP_020053855.1|  hypothetical protein                               168   6e-42    
ref|WP_006462036.1|  glutamyl-tRNA(Gln) amidotransferase subunit A      169   6e-42    
ref|WP_027284389.1|  hypothetical protein                               168   6e-42    
gb|AIF98626.1|  amidase                                                 168   7e-42    
ref|WP_028977806.1|  glutamyl-tRNA amidotransferase                     168   9e-42    
ref|WP_036800852.1|  hypothetical protein                               168   9e-42    
gb|AIQ51212.1|  amidase                                                 168   1e-41    
ref|WP_024278202.1|  amidase                                            167   1e-41    
ref|WP_034351241.1|  amidase                                            167   1e-41    
ref|WP_028614952.1|  amidase                                            167   2e-41    
gb|EIJ46128.1|  hypothetical protein GWL_31560                          167   2e-41    
ref|WP_017474574.1|  amidase                                            167   2e-41    
ref|WP_027328297.1|  amidase                                            167   2e-41    
ref|WP_021837694.1|  amidase                                            167   2e-41    
ref|WP_034332432.1|  amidase                                            167   2e-41    
ref|XP_005846832.1|  hypothetical protein CHLNCDRAFT_35982              168   2e-41    
ref|WP_003611167.1|  amidase                                            167   2e-41    
ref|WP_003185277.1|  amidase                                            166   3e-41    
ref|WP_016885738.1|  amidase                                            166   3e-41    
ref|WP_019390795.1|  hypothetical protein                               167   3e-41    
ref|WP_008120006.1|  amidase                                            166   4e-41    
ref|WP_020201255.1|  amidase                                            166   5e-41    
ref|WP_007743538.1|  amidase                                            165   5e-41    
ref|WP_021026228.1|  amidase                                            166   6e-41    
ref|WP_028671441.1|  hypothetical protein                               166   6e-41    
ref|WP_038852263.1|  amidase                                            165   7e-41    
ref|WP_019425974.1|  hypothetical protein                               165   7e-41    
ref|WP_028161874.1|  hypothetical protein                               165   7e-41    
ref|WP_028368014.1|  amidase                                            165   8e-41    
ref|WP_029003433.1|  amidase                                            165   1e-40    
ref|WP_008333678.1|  amidase                                            165   1e-40    
ref|WP_029554882.1|  amidase                                            164   1e-40    
ref|WP_021005580.1|  amidase                                            164   1e-40    
ref|WP_006296592.1|  amidase                                            164   1e-40    
gb|KFC74131.1|  Amidase                                                 164   1e-40    
ref|WP_019657290.1|  amidase                                            164   2e-40    
ref|WP_013168386.1|  amidase                                            164   2e-40    
ref|WP_038694443.1|  amidase                                            165   2e-40    
ref|WP_011481356.1|  amidase                                            164   3e-40    
ref|WP_018408728.1|  amidase                                            164   3e-40    
ref|XP_008378208.1|  PREDICTED: outer envelope protein 64, mitoch...    157   4e-40    
ref|WP_029008802.1|  amidase                                            163   4e-40    
dbj|BAG84638.1|  indole-3-acetamide hydrolase                           156   5e-40    
ref|WP_011516667.1|  amidase                                            163   5e-40    
ref|WP_018181445.1|  hypothetical protein                               162   7e-40    
ref|WP_008944777.1|  glutamyl-tRNA amidotransferase subunit A           162   7e-40    
ref|WP_014892944.1|  amidase                                            162   7e-40    
ref|WP_013539352.1|  amidase                                            162   7e-40    
ref|WP_029076789.1|  amidase                                            162   1e-39    
ref|WP_036158366.1|  amidase                                            162   1e-39    
gb|EXU79793.1|  amidase                                                 162   1e-39    
ref|WP_035882591.1|  amidase                                            162   1e-39    
ref|WP_038278946.1|  hypothetical protein                               161   1e-39    
ref|WP_019950343.1|  hypothetical protein                               161   2e-39    
ref|WP_035607240.1|  amidase                                            161   2e-39    
ref|WP_035500539.1|  amidase                                            160   2e-39    
ref|XP_002500788.1|  predicted protein                                  160   3e-39    
ref|WP_007830989.1|  amidase                                            160   3e-39    
ref|WP_020333205.1|  amidase                                            160   3e-39    
dbj|GAK39839.1|  hypothetical protein TCA2_2328                         160   3e-39    
ref|WP_016918078.1|  amidase                                            160   4e-39    
ref|WP_006338872.1|  Glutamyl-tRNA(Gln) amidotransferase, subunit A     160   4e-39    
ref|WP_024591948.1|  MULTISPECIES: amidase                              160   4e-39    
ref|WP_036371022.1|  amidase                                            160   4e-39    
ref|WP_025694034.1|  amidase                                            160   4e-39    
ref|WP_025254854.1|  amidase                                            161   4e-39    
gb|EKE08899.1|  hypothetical protein ACD_16C00238G0004                  160   5e-39    



>ref|XP_009588696.1| PREDICTED: outer envelope protein 64, chloroplastic [Nicotiana 
tomentosiformis]
Length=589

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/589 (76%), Positives = 507/589 (86%), Gaps = 3/589 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGILIMTRK KKAVKAD GAFVERLQLLPPPQPPPPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILIMTRKFKKAVKADFGAFVERLQLLPPPQPPPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
              SFA+SDVF I GFVTGFGNPDW++THE A+QTS VV ALVE GATC  +TIVDDMAFGI
Sbjct  61    FSFAISDVFDINGFVTGFGNPDWSRTHELASQTSAVVCALVEGGATCTGRTIVDDMAFGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG + HYD PTNPA+ +R+PGG SSGA+VAVAA  VDFSLG D  GGVRVPA YCG+LGF
Sbjct  121   SGEHIHYDTPTNPAAPARIPGGSSSGASVAVAAKFVDFSLGTDAVGGVRVPAAYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G V+H G+IPVS SLD VGWF RDP +LRRVGHVLLQVPF +QRNPRN+VIA+D F
Sbjct  181   RPSHGTVAHTGVIPVSASLDTVGWFARDPSILRRVGHVLLQVPFASQRNPRNVVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             QS+N   DR SQ VIKA+EK FGRQ+IRHENL+AYL++KVPSLK F  KK NGE K S T
Sbjct  241   QSVN-SGDRVSQAVIKAVEKLFGRQIIRHENLEAYLNSKVPSLKQFASKKSNGERKSSAT  299

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
              LL  V+ TLKRHEFK+NH +WI+  KP LDP+I+AQ+  G E+ D+ I+ CHAVRNEMR
Sbjct  300   NLLAKVMHTLKRHEFKQNHLEWINAAKPNLDPVISAQMQGGPEITDSNIENCHAVRNEMR  359

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SAL+DLLKDDGILVIPTV +PPPK GAKE QS DY  R+C F+S+AS+SGGCQ  +P+GF
Sbjct  360   SALNDLLKDDGILVIPTVAEPPPKIGAKEIQSEDYQIRSCSFSSIASMSGGCQVCVPMGF  419

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDKCP SVSFVAR GGDRFLLD +Q+++A LQEQAE+A +S +S NAISKEASAE+AK K
Sbjct  420   HDKCPASVSFVARQGGDRFLLDTIQSMYASLQEQAEVATKSSTSGNAISKEASAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+KQWQ+AIGFYTEAIKL GNSATYFSNRAAAYL +G+F+QAEAD +KAI+LDKK
Sbjct  480   GNQAYKDKQWQKAIGFYTEAIKLNGNSATYFSNRAAAYLAMGNFLQAEADSSKAIDLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTAREMLGY+ +AIEDFRYALVLEPTNKRA+QSA+RL KLF
Sbjct  540   NVKAYLRRGTAREMLGYHKEAIEDFRYALVLEPTNKRASQSADRLKKLF  588



>ref|XP_006341523.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Solanum 
tuberosum]
Length=590

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/589 (75%), Positives = 503/589 (85%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGILIMTRKLKKAVKAD GAFVERL+LLPPPQPPPPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILIMTRKLKKAVKADFGAFVERLKLLPPPQPPPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SDVF + G VTGFGNPDW++THEPA+QTSTVVT LVE GATC  +T+VDDMAFGI
Sbjct  61    LSFAISDVFDVNGSVTGFGNPDWSRTHEPASQTSTVVTTLVEGGATCTGRTVVDDMAFGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG   H+D PTNPA+ +R+PGG SSGAAVAVAAN VDFSLG D  GGVRVPA YCG+LGF
Sbjct  121   SGEQIHFDTPTNPAAPARMPGGSSSGAAVAVAANFVDFSLGTDAVGGVRVPAAYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G VSH GIIPVS SLD VGWF RDP +LRRVGHVLLQVPF AQRNPRN+VIA+D F
Sbjct  181   RPSHGTVSHTGIIPVSASLDTVGWFARDPSILRRVGHVLLQVPFVAQRNPRNVVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L  P D  SQ V KA+EK FGRQ++RHENL+AYL++KVPSLK F  KK NGE K S+T
Sbjct  241   QLLKSPGDCVSQAVTKAVEKLFGRQILRHENLEAYLNSKVPSLKLFADKKFNGERKSSST  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
              LL + +  L+RHEFK+NH +WIDD KP LDP+I++Q+   LE+ DT ID CHA+RNEMR
Sbjct  301   NLLAYAMHMLRRHEFKQNHLEWIDDGKPNLDPVISSQMQCALEITDTIIDSCHAIRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SAL+DLLKDDGILVIPTV +PPPK GAKE QS DY  R+C F+S+AS+SGGCQ  +P+GF
Sbjct  361   SALNDLLKDDGILVIPTVAEPPPKTGAKEIQSEDYQIRSCSFSSIASMSGGCQVCVPVGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDKCPISVSFVAR GGDRFLLD +Q ++A LQEQAE+A +S +S NA+SKE SAE+AK K
Sbjct  421   HDKCPISVSFVARQGGDRFLLDTIQTMYADLQEQAELATKSSASGNALSKETSAEMAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQW +AIGFYTEAIKL GNSATYFSNRAAA+LE+ +F+QAEAD +KAI+LDKK
Sbjct  481   GNQAFKEKQWPKAIGFYTEAIKLNGNSATYFSNRAAAHLEMRNFLQAEADSSKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTAREMLGYY +AIEDFRYALVLEPTNKRA+ SA+RL   F
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRASLSADRLKTTF  589



>ref|XP_004235757.1| PREDICTED: outer envelope protein 64, chloroplastic [Solanum 
lycopersicum]
Length=590

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/589 (76%), Positives = 505/589 (86%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL+MTRKLKKAVKAD GAFVERL+LLPPPQPPPPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILLMTRKLKKAVKADFGAFVERLKLLPPPQPPPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FA+SDVF + GFVTGFGNPDW++THEPA+QTSTVVT LVE GATC  +T+VDDMAFGI
Sbjct  61    LTFAISDVFDVNGFVTGFGNPDWSRTHEPASQTSTVVTTLVEGGATCTGRTVVDDMAFGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG   H+D PTNPA+ +R+PGG SSGAAVAVAA  VDFSLG D  GGVRVPA YCG+LGF
Sbjct  121   SGEQMHFDTPTNPAAPARMPGGSSSGAAVAVAAKFVDFSLGTDAVGGVRVPAAYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G VSH GIIPVS SLD VGWF RDP +LRRVGHVLLQVPF AQRNPRN+VIA+D F
Sbjct  181   RPSHGTVSHTGIIPVSASLDTVGWFARDPSILRRVGHVLLQVPFAAQRNPRNVVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L  P DR SQ V KA+EK FGRQ++RHENL+AYL++KVPSLK F  +K NGE K S+T
Sbjct  241   QLLKSPGDRISQAVTKAVEKLFGRQILRHENLEAYLTSKVPSLKLFADRKSNGERKSSST  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
              LL + +  L+RHEFK+NH +WI+  KP LDP I++Q+   LE+ DT ID CHA+RNEMR
Sbjct  301   NLLAYAMHILRRHEFKQNHLEWINAEKPNLDPFISSQMQGALEITDTNIDSCHAIRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SAL+DLLKDDGILVIPTV +PPPK GAKE QS DY  RAC F+S+AS+SGGCQ S+P GF
Sbjct  361   SALNDLLKDDGILVIPTVAEPPPKTGAKEIQSEDYQIRACSFSSIASMSGGCQVSVPAGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDKCPISVSFVAR GGDRFLLD +Q ++A LQEQAE+A +S +S NA+SKE SAE+AK K
Sbjct  421   HDKCPISVSFVARQGGDRFLLDTIQTIYADLQEQAELATKSSASGNALSKETSAEMAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQRAIGFYTEAIKL GNSATYFSNRAAA+LE+ +F+QAEAD +KAI+LDKK
Sbjct  481   GNQAFKEKQWQRAIGFYTEAIKLNGNSATYFSNRAAAHLEMRNFLQAEADSSKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTAREMLGYY +AIEDFRYALVLEPTNKRA+ SA+RL KLF
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRASLSADRLKKLF  589



>emb|CDO98344.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/589 (71%), Positives = 495/589 (84%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             M S  ANLWVLLGLGLAGILIMTRKLKKAVKAD GAFVERLQLLPPP PPPPKAPHPLTG
Sbjct  1     MGSPQANLWVLLGLGLAGILIMTRKLKKAVKADFGAFVERLQLLPPPPPPPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF +EG +TGFGN DWAKTHE A+QTS VV+ALVE GA+C  KT+VDDMAFG+
Sbjct  61    LTFAVSDVFDVEGSITGFGNLDWAKTHEAASQTSPVVSALVEGGASCTGKTVVDDMAFGV  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD PTNPA+ +R PGG SSGAAVAVAANLVDFSLGIDT GGVRVPAGYCG+ GF
Sbjct  121   SGENKHYDTPTNPAAPARTPGGSSSGAAVAVAANLVDFSLGIDTVGGVRVPAGYCGVFGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G VS MG++PVS S D VGWF +DP +LRRVGHVLLQVP+T  ++PR+IV+A+D F
Sbjct  181   RPSHGTVSQMGVLPVSASFDTVGWFAKDPTILRRVGHVLLQVPYTVPQSPRSIVVADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTT  1135
               LN   DR SQ V+K++EK FGRQ++RHENL  YLS+KVPSLK+F+  K NGE K S  
Sbjct  241   NLLNSSADRVSQAVVKSVEKLFGRQVLRHENLGDYLSSKVPSLKAFQSEKSNGEVKSSVI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL ++++TLKR+EFK+ HD+WI  VKPTLDP+I+ QL + L++A+ EI+ CHAVR+EMR
Sbjct  301   RLLANIMRTLKRYEFKQYHDEWIKSVKPTLDPVISVQLQQDLDMAEAEIENCHAVRDEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SAL+ LLKDDGIL IPT  +PPPK G+KET S DY  RA +  SL S+SG CQ ++PLGF
Sbjct  361   SALNFLLKDDGILAIPTTSEPPPKLGSKETLSEDYQIRATMLTSLVSMSGCCQVAVPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+S+S +AR+GGDRFLLD VQ ++  LQEQA+I  ++KSS NA+S+E SAE+AK K
Sbjct  421   NEKCPVSISLIARHGGDRFLLDTVQTMYGVLQEQADIVTKTKSSKNAVSQETSAEMAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK++QWQRAI FYTEAIKL   +ATY+SNRAAAYLELGSF+QAEADCT AI+LDKK
Sbjct  481   GNQAFKDRQWQRAIVFYTEAIKLNAKNATYYSNRAAAYLELGSFIQAEADCTNAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTARE LGY+ +A EDFRYALVLEP NKRAAQSAERL +LF
Sbjct  541   NVKAYLRRGTARETLGYFKEATEDFRYALVLEPNNKRAAQSAERLRRLF  589



>ref|XP_010264573.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Nelumbo 
nucifera]
Length=589

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/590 (71%), Positives = 480/590 (81%), Gaps = 3/590 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS S NLWVLLGLGLAGI++MTRKLKK VK D GAFVERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASNSTNLWVLLGLGLAGIILMTRKLKKVVKEDFGAFVERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF I+G+VTGFGNPDWAKTHE AT+TS VV+ LVE GATCV K +VD+MA+ I
Sbjct  61    LSFAVSDVFDIDGYVTGFGNPDWAKTHEAATRTSPVVSLLVEGGATCVGKAVVDEMAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHYD PTNPA+ +R+PGG SSG+AVAVAA LVDFSLG DT GGVRVPA +CGI+GF
Sbjct  121   NGENKHYDTPTNPAAPARVPGGASSGSAVAVAAKLVDFSLGTDTAGGVRVPASFCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GA+SHMG+IPVS SLD VGWF +DP +LRRVGHVLLQ+PF  QR PR +++A+D F
Sbjct  181   RPSYGAISHMGVIPVSSSLDTVGWFAKDPSILRRVGHVLLQLPFADQRMPRQVLVADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLN--GEAKLSTT  1135
             Q L IP  R  +VVI + EK FGRQ+++H NL  YL +KVPSLK F  +N  GE K ST 
Sbjct  241   QQLKIPVSRILEVVITSTEKLFGRQVLKHINLGEYLDSKVPSLKKFHDMNRNGELKTSTL  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R L + +Q L+RHEFK NH  WID  KP LDP+I A++ + +E  DT+ D C  +RNE R
Sbjct  301   RSLANAMQFLQRHEFKTNHGQWIDSTKPVLDPVILAKVQQPMEFTDTKFDSCKLIRNETR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SALS LLKD+GILV+PTV DPPPK G KE  S +Y SR     S+AS+SG CQ S+PLGF
Sbjct  361   SALSSLLKDEGILVLPTVADPPPKLG-KELLSEEYQSRVFSLLSIASISGCCQVSLPLGF  419

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             +DKCP+SVSFVAR+GGDRFLLD VQ +FA LQEQ +IA  SK S N IS+E SAEIAK K
Sbjct  420   YDKCPVSVSFVARHGGDRFLLDIVQIMFACLQEQVDIAANSKVSANTISQEESAEIAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN AFK+KQWQ+AIGFYTEAIKL   +ATY+SNRAAAYLELGS+ QAEADC+KAI LDKK
Sbjct  480   GNAAFKDKQWQKAIGFYTEAIKLSSKNATYYSNRAAAYLELGSYHQAEADCSKAIILDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +AIEDF+YALVLEPTNKRAA SAERL KLF 
Sbjct  540   NVKAYLRRGTAREMLGYYKEAIEDFKYALVLEPTNKRAANSAERLRKLFQ  589



>ref|XP_009780770.1| PREDICTED: outer envelope protein 64, chloroplastic, partial 
[Nicotiana sylvestris]
Length=524

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/521 (72%), Positives = 441/521 (85%), Gaps = 3/521 (1%)
 Frame = +2

Query  446   FHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYD  625
             F I GFVTGFGNP+W++THEPA+QTS VV+ALVE GATC  +T+VDDMAFGISG + HYD
Sbjct  4     FDINGFVTGFGNPEWSRTHEPASQTSPVVSALVEGGATCTGRTVVDDMAFGISGEHIHYD  63

Query  626   APTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVS  805
              PTNPA+ +R+PGG SSGAAVAVAA  VDFSLG D  GGVRVPA YCG+LGF PS G V+
Sbjct  64    TPTNPAAPARIPGGSSSGAAVAVAAKFVDFSLGTDAVGGVRVPAAYCGVLGFRPSHGTVA  123

Query  806   HMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTD  985
             H GIIPVS SLD VGWF RDP +LRRVGHVLLQVPF +QRNPRN+VIA+D FQS+N    
Sbjct  124   HTGIIPVSASLDTVGWFARDPSILRRVGHVLLQVPFASQRNPRNVVIADDCFQSVN-SGG  182

Query  986   RTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQ  1159
             R SQ VIKA+EK FGRQ+IRHENL+AYL++K+PSLK F  KK N E K S+T LL + + 
Sbjct  183   RVSQAVIKAVEKLFGRQIIRHENLEAYLNSKIPSLKQFASKKSNTERKSSSTNLLAYFMH  242

Query  1160  TLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLK  1339
              LKRHEFK+NH +WI+  KP LDP+I+AQ+  G E+ DT I+ CHAVRNE+RSAL+DLLK
Sbjct  243   ILKRHEFKQNHLEWINAAKPNLDPVISAQIQGGPEITDTNIENCHAVRNELRSALNDLLK  302

Query  1340  DDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISV  1519
             DDGILVIPTV +PPPK GAKE QS DY  R+C F+S+AS+SGGCQ  +P+GFHDKCP SV
Sbjct  303   DDGILVIPTVSEPPPKIGAKEIQSEDYQIRSCSFSSIASMSGGCQVCVPMGFHDKCPTSV  362

Query  1520  SFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEK  1699
             SFVAR GGDRFLLD +Q+++APLQEQAE+A +S +S NAISKEASAE+AK KGNQA+K+K
Sbjct  363   SFVARQGGDRFLLDTIQSMYAPLQEQAEVATKSSTSGNAISKEASAEMAKEKGNQAYKDK  422

Query  1700  QWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRR  1879
             QWQ+AIGFYTEAIKL  N+ATYFSNRAAAYLE+ +F+QAEAD +KAI+LDKKNVKAY RR
Sbjct  423   QWQKAIGFYTEAIKLNDNTATYFSNRAAAYLEMRNFIQAEADSSKAIDLDKKNVKAYLRR  482

Query  1880  GTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             GTAREMLGY  +A+EDFRYALVLEPTNKRA+QSA+RL KLF
Sbjct  483   GTAREMLGYCKEALEDFRYALVLEPTNKRASQSADRLKKLF  523



>ref|XP_002282402.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
[Vitis vinifera]
 emb|CBI15572.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/590 (70%), Positives = 493/590 (84%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAG+L+MTRKLKK ++ D GAFV+RLQLLPPPQP PPKAPHPLT 
Sbjct  1     MASSSANLWVLLGLGLAGVLLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPHPLTN  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF IEG+VTGFGNPDWA+TH+ A++TS VV+ALVE GATC  KT+VD+MA+ I
Sbjct  61    LSFAVSDVFDIEGYVTGFGNPDWARTHDTASRTSPVVSALVEGGATCTGKTVVDEMAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNPA+ SR+PGG SSGAAVAVAAN VDFSLG+DT GGVRVPA +CG++GF
Sbjct  121   NGENKHYGTPTNPAAPSRIPGGSSSGAAVAVAANFVDFSLGLDTVGGVRVPAAFCGVIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVSHMGII VS SLD VGWF +DP +LRRVGHVLLQ+ +  QR+PR I+ A+D F
Sbjct  181   RPSHGAVSHMGIIHVSSSLDTVGWFAKDPSILRRVGHVLLQLTYAVQRSPRQIIFADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             QSL IP DR  QVV+K+ EK FGRQ+++ ENL+ YL +KVPSLK+F  +K NGE + S  
Sbjct  241   QSLRIPVDRVYQVVLKSTEKLFGRQVLKRENLENYLDSKVPSLKAFHSQKTNGETRNSLI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R L  ++  L+RHEFK NH++WI+ VKP LD  I++QLH+ LEVADTEI+ C + R E+R
Sbjct  301   RSLVKIMHCLQRHEFKHNHEEWINSVKPILDASISSQLHDVLEVADTEIENCQSSRMEIR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SAL+ LLKDDGILVIPTV DPPPK G KE+ S +Y +R     S+AS+SG CQ ++PLG 
Sbjct  361   SALNSLLKDDGILVIPTVADPPPKLGGKESLSEEYQNRTLGLLSIASMSGCCQVTVPLGL  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             +DK P+SVSF+AR+GGDRFLLD VQ ++A LQEQA+IA +SK S+NA+ +E SAEIAK K
Sbjct  421   YDKYPVSVSFMARHGGDRFLLDTVQTMYASLQEQADIAAKSKLSSNAVDRETSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK+KQWQ+A+GFYTEAIKL GN+ATY+SNRAAAYLE+GSF+QAEADCT+AI LDKK
Sbjct  481   GNQAFKDKQWQKAVGFYTEAIKLSGNNATYYSNRAAAYLEMGSFLQAEADCTEAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY  AIEDFRYALVLEPTNKRA+ SA+RL KLF 
Sbjct  541   NVKAYLRRGTAREMLGYYKDAIEDFRYALVLEPTNKRASLSADRLKKLFQ  590



>ref|XP_004503273.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X1 [Cicer arietinum]
 ref|XP_004503274.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X2 [Cicer arietinum]
Length=592

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/589 (69%), Positives = 493/589 (84%), Gaps = 1/589 (0%)
 Frame = +2

Query  239   SMASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplT  418
             SMASQS+N+WVLLGLGLAGI ++TRKLK+ VK D GAF+++LQLLPPP P PPKAPHPLT
Sbjct  3     SMASQSSNIWVLLGLGLAGIYVLTRKLKQTVKLDFGAFIQKLQLLPPPPPAPPKAPHPLT  62

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
              L+FA+SD+F IEG V+ FG+P+WA+THE A+ TS  V+ LVEAGATC+  T++D+ A+G
Sbjct  63    ALTFAISDLFDIEGHVSSFGHPEWARTHEAASSTSPSVSTLVEAGATCLGTTVLDEFAYG  122

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ISG NKH+ APTNPA  +R+PGG SSGAAV+VAAN VDFSLG+DT GGVRVPAG+CGILG
Sbjct  123   ISGENKHFGAPTNPAVPARVPGGSSSGAAVSVAANFVDFSLGVDTSGGVRVPAGFCGILG  182

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS GAVSH+GIIPVS SLD VGWF +DPDVLRRVG +LLQ PF  QR+PR I+IA+D 
Sbjct  183   FRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGLILLQAPFGMQRSPRQIIIADDC  242

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
             FQ LN+P DR+SQVVIKA EK FG+Q+++H NL+ Y+S+KVPSLK++ +K NG+ K S+ 
Sbjct  243   FQHLNVPLDRSSQVVIKATEKVFGKQVLKHINLEDYISSKVPSLKAYSQKSNGQLKSSSL  302

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL  ++Q L+RHEF + HD+W+  VKP L P ++AQLHE  EV+D EI+   +VR+E+R
Sbjct  303   KLLASIMQLLQRHEFGQIHDEWMSIVKPELHPAVSAQLHEKFEVSDVEIENSKSVRSELR  362

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ +IPLGF
Sbjct  363   VAVNSLLKDEGILVIPTVADPPPKLGGKEFLSQDYQSRALSLLSIASISGCCQVTIPLGF  422

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             +DK PISVS +AR+GGDRFLLD ++ ++  LQEQA+IA  SKSS N +SKE SAEIAK K
Sbjct  423   YDKYPISVSLIARHGGDRFLLDTLKTMYTILQEQADIAATSKSSKNVVSKEQSAEIAKEK  482

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+KQWQ+AIGFYTEAIKL G++ATY+SNRA AYLELGS++QAEADCTKAI LDKK
Sbjct  483   GNQAYKDKQWQKAIGFYTEAIKLCGDNATYYSNRAQAYLELGSYLQAEADCTKAISLDKK  542

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAYFRRGTAREMLGYY +AI+DF+YALVLEPTNKRAA +AERL KLF
Sbjct  543   NVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASAAERLRKLF  591



>ref|XP_011084180.1| PREDICTED: outer envelope protein 64, chloroplastic isoform X2 
[Sesamum indicum]
Length=589

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/590 (69%), Positives = 495/590 (84%), Gaps = 3/590 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLG+AGILIMT+KLK+ VKAD GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASSSANLWVLLGLGIAGILIMTKKLKRTVKADLGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF+I+GFVTGFGNPDW++THE A  T  VV ALV+ GATCV KT+VDDMA GI
Sbjct  61    LSFAVSDVFNIKGFVTGFGNPDWSRTHEAAPHTCPVVAALVDGGATCVGKTVVDDMALGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG +KHY +PTNPAS +R+PGG SSGAAVAVAA LVDFSLGIDTDGGVRVPAGYCGILGF
Sbjct  121   SGESKHYGSPTNPASPARVPGGASSGAAVAVAAKLVDFSLGIDTDGGVRVPAGYCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G VS  G+IPVS SLD VGWF +DP VLRRVGHVLLQVP+ AQRNPRNIVIA+D F
Sbjct  181   RPSHGTVSLSGVIPVSGSLDAVGWFAKDPSVLRRVGHVLLQVPYAAQRNPRNIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q   +P +  +Q+V+K++EK +GRQ++R ENL  Y++  VPSL +F  K+LNGE + S  
Sbjct  241   QLSKVPAEHITQMVVKSVEKLYGRQVLRRENLGDYINLNVPSLSAFNVKQLNGEGR-SPI  299

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q LKR+EFK+NHD+WI+ VKP+LDP+I AQ+ +   + D +I+KC+ +R+E+R
Sbjct  300   RLLANVMQILKRYEFKQNHDEWINSVKPSLDPVILAQIPDVSGLTDADIEKCNTIRSELR  359

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SA++ LLKDDGILVIPT  DPPPK GAK+  S +++ RA   +SL S+SG CQ ++PLG 
Sbjct  360   SAINMLLKDDGILVIPTSSDPPPKLGAKDVLSEEFLIRASTLSSLGSMSGCCQVAVPLGV  419

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+S+S +AR+GGDRFLLD +Q ++A LQEQ + A + KSS+ A+++E SAE+AK K
Sbjct  420   YEKCPVSLSLLARHGGDRFLLDTLQTVYASLQEQVDTAGKPKSSSKAVTQETSAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK+KQWQRAIGFYTEAIKL  ++ATY+SNRAAAYLE+ SF+QAEADCT+AI+LDKK
Sbjct  480   GNQAFKDKQWQRAIGFYTEAIKLNSSNATYYSNRAAAYLEMRSFIQAEADCTQAIDLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGY  +A+EDFRYALVLEP N+RAAQS +RL KLF 
Sbjct  540   NVKAYLRRGTAREMLGYCKEAMEDFRYALVLEPNNRRAAQSLDRLKKLFQ  589



>ref|XP_006490775.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Citrus 
sinensis]
 gb|KDO63831.1| hypothetical protein CISIN_1g008025mg [Citrus sinensis]
Length=580

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/587 (69%), Positives = 489/587 (83%), Gaps = 8/587 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL+MT+KLKK +K D GAF+E+LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F IEG+VTGFG+P+WA+TH  A++TSTVV+ LVE GATC+ KT+VD+ A+ I
Sbjct  61    LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHYD PTNPA+ S++PGG SSGAAVAVAA+LVDFSLGIDT GGVRVP+ +CGILGF
Sbjct  121   NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GAVSHMGIIP+S SLD VGWF RDP +LR VGHVLLQ+PF AQR+PR I+IA+D F
Sbjct  181   RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             + L IP DR  QVVIK+ EK FGRQ+++HENL  Y  +KVPSLK F K NGE K      
Sbjct  241   ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELK------  294

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
               +V++ ++R+EFK NH++WI+ VKP LDP I+A++ E LE+++T I+ C ++RNEMRSA
Sbjct  295   --NVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSA  352

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +S LLKDDGILV PT   PPPK G KE  S DY +RA    S+AS+SG CQ ++PLG++D
Sbjct  353   ISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYD  412

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP SVSF+AR+GGDRFLLD VQ ++A LQEQA+IA +SK S N  +++ SAEIAK KGN
Sbjct  413   KCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGN  472

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
             QA+K+KQW +AI FYTEAIKL GN+ATY+SNRAAAYLE GSF+QAEADCTKAI LDKKNV
Sbjct  473   QAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNV  532

Query  1862  KAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KAY RRGTAREMLGYY +AIEDF YALVLEPTNKRA+ SA+RL K+F
Sbjct  533   KAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVF  579



>ref|XP_011084169.1| PREDICTED: outer envelope protein 64, chloroplastic isoform X1 
[Sesamum indicum]
Length=590

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/591 (69%), Positives = 495/591 (84%), Gaps = 4/591 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLG+AGILIMT+KLK+ VKAD GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASSSANLWVLLGLGIAGILIMTKKLKRTVKADLGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF+I+GFVTGFGNPDW++THE A  T  VV ALV+ GATCV KT+VDDMA GI
Sbjct  61    LSFAVSDVFNIKGFVTGFGNPDWSRTHEAAPHTCPVVAALVDGGATCVGKTVVDDMALGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG +KHY +PTNPAS +R+PGG SSGAAVAVAA LVDFSLGIDTDGGVRVPAGYCGILGF
Sbjct  121   SGESKHYGSPTNPASPARVPGGASSGAAVAVAAKLVDFSLGIDTDGGVRVPAGYCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G VS  G+IPVS SLD VGWF +DP VLRRVGHVLLQVP+ AQRNPRNIVIA+D F
Sbjct  181   RPSHGTVSLSGVIPVSGSLDAVGWFAKDPSVLRRVGHVLLQVPYAAQRNPRNIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q   +P +  +Q+V+K++EK +GRQ++R ENL  Y++  VPSL +F  K+LNGE + S  
Sbjct  241   QLSKVPAEHITQMVVKSVEKLYGRQVLRRENLGDYINLNVPSLSAFNVKQLNGEGR-SPI  299

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q LKR+EFK+NHD+WI+ VKP+LDP+I AQ+ +   + D +I+KC+ +R+E+R
Sbjct  300   RLLANVMQILKRYEFKQNHDEWINSVKPSLDPVILAQIPDVSGLTDADIEKCNTIRSELR  359

Query  1316  SALSDLLK-DDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             SA++ LLK DDGILVIPT  DPPPK GAK+  S +++ RA   +SL S+SG CQ ++PLG
Sbjct  360   SAINMLLKQDDGILVIPTSSDPPPKLGAKDVLSEEFLIRASTLSSLGSMSGCCQVAVPLG  419

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
              ++KCP+S+S +AR+GGDRFLLD +Q ++A LQEQ + A + KSS+ A+++E SAE+AK 
Sbjct  420   VYEKCPVSLSLLARHGGDRFLLDTLQTVYASLQEQVDTAGKPKSSSKAVTQETSAEMAKE  479

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQAFK+KQWQRAIGFYTEAIKL  ++ATY+SNRAAAYLE+ SF+QAEADCT+AI+LDK
Sbjct  480   KGNQAFKDKQWQRAIGFYTEAIKLNSSNATYYSNRAAAYLEMRSFIQAEADCTQAIDLDK  539

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KNVKAY RRGTAREMLGY  +A+EDFRYALVLEP N+RAAQS +RL KLF 
Sbjct  540   KNVKAYLRRGTAREMLGYCKEAMEDFRYALVLEPNNRRAAQSLDRLKKLFQ  590



>ref|XP_006451616.1| hypothetical protein CICLE_v10007714mg [Citrus clementina]
 gb|ESR64856.1| hypothetical protein CICLE_v10007714mg [Citrus clementina]
Length=644

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/592 (69%), Positives = 492/592 (83%), Gaps = 8/592 (1%)
 Frame = +2

Query  227   VAGSSMASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkap  406
             ++ S MASQSANLWVLLGLGLAGIL+MT+KLKK +K D GAF+E+LQLLPPPQP PPKAP
Sbjct  60    ISSSYMASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAP  119

Query  407   hplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDD  586
             HPLTGLSFAVSD+F IEG+VTGFG+P+WA+TH  A++TSTVV+ LVE GATC+ KT+VD+
Sbjct  120   HPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDE  179

Query  587   MAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYC  766
              A+ I+G NKHYD PTNPA+ S++PGG SSGAAVAVAA+LVDFSLGIDT GGVRVP+ +C
Sbjct  180   FAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFC  239

Query  767   GILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVI  946
             GILGF PS+GAVSHMGIIP+S SLD VGWF RDP +LR VGHVLLQ+PF AQR+PR I+I
Sbjct  240   GILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIII  299

Query  947   ANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKL  1126
             A+D F+ L IP DR  QVVIK+ EK FGRQ+++HENL  Y  +KVPSLK F K NGE K 
Sbjct  300   ADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELK-  358

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
                    +V++ ++R+EFK NH++WI+ VKP LDP I+A++ E LE+++T I+ C ++RN
Sbjct  359   -------NVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRN  411

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             EMRSA+S LLKDDGILV PT   PPPK G KE  S DY +RA    S+AS+SG CQ ++P
Sbjct  412   EMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVP  471

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIA  1666
             LG++DKCP SVSF+AR+GGDRFLLD VQ ++A LQEQA+IA +SK S N  +++ SAEIA
Sbjct  472   LGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIA  531

Query  1667  KGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIEL  1846
             K KGNQA+K+KQW +AI FYTEAIKL GN+ATY+SNRAAAYLE GSF+QAEADCTKAI L
Sbjct  532   KEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINL  591

Query  1847  DKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             DKKNVKAY RRGTAREMLGYY +AIEDF YALVLEPTNKRA+ SA+RL K+F
Sbjct  592   DKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVF  643



>gb|EYU24147.1| hypothetical protein MIMGU_mgv1a003366mg [Erythranthe guttata]
Length=589

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/589 (68%), Positives = 487/589 (83%), Gaps = 3/589 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLG+AGIL MT+KLK+AVKAD GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASSSANLWVLLGLGIAGILFMTKKLKRAVKADFGAFMERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF+IEG VTGFGNPDW+ THE AT+T  VV  LV+ GATCV KT+VDDMA G+
Sbjct  61    LSFAVSDVFNIEGHVTGFGNPDWSMTHEAATRTCPVVALLVDGGATCVGKTVVDDMALGV  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG N HY+APTNPAS +R+PGG SSGAAVAVAA   DFSLGIDTDGGVRVPAGYCGILGF
Sbjct  121   SGENVHYEAPTNPASPARMPGGASSGAAVAVAAKFTDFSLGIDTDGGVRVPAGYCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+G VS  G++PVS SLD VGWF +DP VLRRVGHVLLQ+P+ A RNPRNIVIA+D F
Sbjct  181   RPSYGTVSLSGVVPVSGSLDTVGWFAKDPSVLRRVGHVLLQLPYAAPRNPRNIVIADDFF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q   +  +R +Q V K+IEK +GRQ +RHE L  Y+S KVPSL SF  K+LNGE + S  
Sbjct  241   QLSKVSAERITQAVTKSIEKLYGRQGLRHEKLSDYISLKVPSLNSFNVKQLNGEGRASPI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q LKRHEF++NH +WI+  KPTLDP+I+AQ+ E L++ D +I++C+A+R E+R
Sbjct  301   RLLANVMQMLKRHEFRQNHIEWINSAKPTLDPVISAQIPEVLDLTDADIEQCNAIRTELR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SA++ LLKDDG+LV+PT  D PPK GAKE  S ++V +   F SLAS+SG CQ ++PLG 
Sbjct  361   SAINALLKDDGVLVVPTC-DLPPKCGAKEIASEEFVIQTSCFTSLASMSGCCQVALPLGV  419

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCPIS+S +AR+GGDRFLLD +Q ++A LQEQ + A + K S+  ++ E SAE+AK K
Sbjct  420   HEKCPISLSLLARHGGDRFLLDTLQPIYASLQEQVDTAEKPKPSSKVVTPETSAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK+KQWQRA+GFYTEAIKL G++ATY+SNRAAAYLE+GSF+QAE DCT+AI+LDKK
Sbjct  480   GNQAFKDKQWQRAVGFYTEAIKLNGSNATYYSNRAAAYLEMGSFLQAETDCTQAIDLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +VKAY RRGT+REMLG+Y  A+EDFRYALVLEP NKRAAQ+ +RL K F
Sbjct  540   SVKAYLRRGTSREMLGFYKDAMEDFRYALVLEPNNKRAAQTLDRLKKYF  588



>ref|XP_010036953.1| PREDICTED: outer envelope protein 64, chloroplastic [Eucalyptus 
grandis]
 ref|XP_010036954.1| PREDICTED: outer envelope protein 64, chloroplastic [Eucalyptus 
grandis]
 gb|KCW48607.1| hypothetical protein EUGRSUZ_K02274 [Eucalyptus grandis]
Length=590

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/589 (69%), Positives = 484/589 (82%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLG+AGI++MTRKLK+AV+ D GAFV +LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGIAGIVLMTRKLKRAVREDLGAFVRKLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA SDVF IEG+VTGFG+PDW KTHE A +TSTVV+ LVE GATCV  T+VD++AF I
Sbjct  61    LSFAASDVFDIEGYVTGFGHPDWEKTHEAAARTSTVVSTLVEGGATCVGITVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNPA ++R+PGG  SGAAV+VAANLVDFSLGIDT GGVRVPA YC I+GF
Sbjct  121   NGQNKHYGTPTNPAVTARVPGGSCSGAAVSVAANLVDFSLGIDTIGGVRVPAAYCDIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G +S+MG++PVS SLD VGWF +DP +LRRVGHVLLQVPF  QRNPR ++IA+D F
Sbjct  181   RSSHGTISNMGVLPVSTSLDTVGWFAKDPSILRRVGHVLLQVPFAVQRNPRQMIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKS--FKKLNGEAKLSTT  1135
             Q L I  DR  QVV+KA EK +GRQ+++HENL++Y ++KVPSLK+   KK NG+ K S+ 
Sbjct  241   QLLKISVDRVVQVVVKATEKLYGRQILKHENLESYFNSKVPSLKASPAKKTNGDLKRSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R L  V   ++RHEF  NH++WI    P LD +I+ QLH   + A+ +I+ C  +RNEMR
Sbjct  301   RDLADVAMFVQRHEFITNHEEWIHSANPVLDAVISKQLHNMPQTAEVDIENCRLIRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SA++ LLKDDGILVIPTV DPPPK G KE QS DY SRA    S+AS+SG CQ S+P+GF
Sbjct  361   SAINSLLKDDGILVIPTVADPPPKLGGKELQSEDYQSRAFSLLSIASVSGCCQVSVPVGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDKCP+SVS +ARNGGDRFLLD V A++A LQEQA+IA +SK + NA+++E SAEIAK K
Sbjct  421   HDKCPVSVSLIARNGGDRFLLDTVNAMYATLQEQADIASKSKLTKNAVTREDSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AI FYTEAIKL GN+ATY+SNRAAAYLELGSF+QAEAD TKAI LDKK
Sbjct  481   GNQAFKEKQWQKAISFYTEAIKLSGNNATYYSNRAAAYLELGSFLQAEADSTKAISLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             N+KAY RRGTAREMLGYY +AIEDF +ALVLEPTNKRA+ SAERL KLF
Sbjct  541   NIKAYLRRGTAREMLGYYKEAIEDFDHALVLEPTNKRASLSAERLRKLF  589



>ref|XP_006580398.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X1 [Glycine max]
 ref|XP_006580399.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X2 [Glycine max]
Length=587

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/568 (68%), Positives = 471/568 (83%), Gaps = 2/568 (0%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             +TRKL K+V+ D GAF+ +LQLLPPPQP PPKAPHPLT L+FA+SD+FHI G V  FG+P
Sbjct  19    ITRKLNKSVREDFGAFIHKLQLLPPPQPSPPKAPHPLTSLTFALSDLFHIHGHVPSFGHP  78

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DWA+THEP++ T+  V+ALVE GATCVA T++DD+A GI G NKH+  PTNPA  +R+PG
Sbjct  79    DWARTHEPSSSTAPAVSALVEGGATCVATTVLDDLALGIGGENKHFGTPTNPAVPARVPG  138

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSGAAVAVAAN VDF+LGIDT GGVRVPAG+CGILGF PS GAVSHMGIIP+S SLD 
Sbjct  139   GSSSGAAVAVAANFVDFALGIDTTGGVRVPAGFCGILGFRPSHGAVSHMGIIPISTSLDT  198

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VGWF +DP++LRRVGH+LLQ PF  QR+PR IVIA+D FQ +N+P DR+SQVV+KA EK 
Sbjct  199   VGWFAKDPNILRRVGHILLQAPFVMQRSPRQIVIADDCFQHINVPLDRSSQVVVKATEKL  258

Query  1025  FGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
             FGRQ+++H NL  YLS++VPSLK  S +K NGE K S+ +LL H++Q L+RHEF+  HDD
Sbjct  259   FGRQVLKHINLGDYLSSRVPSLKGCSGQKPNGEVKASSLKLLAHIMQFLQRHEFRLKHDD  318

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             W++ VKP L P ++AQLHE  EV+D EI+   +VR+EMR+A++ LLKD+GILVIPTV DP
Sbjct  319   WMNTVKPDLHPGVSAQLHEKFEVSDAEIENSKSVRSEMRAAVNSLLKDEGILVIPTVADP  378

Query  1379  PPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLL  1558
             PPK G KE  S DY SRA    S+AS+SG CQ SIPLGF+DK P+SVS +AR+GGDRFLL
Sbjct  379   PPKLGGKEILSEDYQSRAFSLLSIASISGCCQVSIPLGFYDKYPVSVSLIARHGGDRFLL  438

Query  1559  DAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
             D +Q ++  LQEQA+IA +SKSS N +SKE SAEIAK KGNQA+K+KQWQ+AIGFYTEAI
Sbjct  439   DTLQTVYTTLQEQADIASKSKSSGNVVSKEQSAEIAKEKGNQAYKDKQWQKAIGFYTEAI  498

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             KL G++ATY+SNRA AYLEL S++QA  DCTKAI LDKKNVKAYFRRGTAR+MLGYY +A
Sbjct  499   KLCGDNATYYSNRAQAYLELESYLQAVEDCTKAISLDKKNVKAYFRRGTARQMLGYYKEA  558

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             I+DF++ALVLEPTNKRAA +AERL KLF
Sbjct  559   IDDFKHALVLEPTNKRAASAAERLRKLF  586



>ref|XP_003631114.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
 gb|AET05590.1| translocon at the outer membrane ofs-like protein [Medicago truncatula]
Length=594

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/592 (67%), Positives = 489/592 (83%), Gaps = 4/592 (1%)
 Frame = +2

Query  239   SMASQ--SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphp  412
             SMAS   S NLWVLLGLGLAGI ++TRKLK+ VK D GAF+++LQLLPPP P PPKAPHP
Sbjct  3     SMASSQSSNNLWVLLGLGLAGIYVLTRKLKQTVKEDLGAFIQKLQLLPPPPPAPPKAPHP  62

Query  413   lTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMA  592
             LT L+FA+SD+F IEG V+ FG+P+WA+THEPA+ TS  V+ LV++GATC+A T++D+++
Sbjct  63    LTSLTFAISDLFDIEGHVSTFGHPEWARTHEPASSTSPAVSTLVQSGATCIATTVLDNLS  122

Query  593   FGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGI  772
             +GISG NKH+  P+NPA  +R+PGG SSGAAVAVAAN VDFSLG+DT GGVRVPAG+CGI
Sbjct  123   YGISGENKHFGTPSNPAIPARVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGI  182

Query  773   LGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAN  952
             LGF PS GAVSH GIIPVS SLD VGWF +DPD+LRRVGH+LLQ PF  QR+PR I+IA+
Sbjct  183   LGFRPSHGAVSHGGIIPVSTSLDTVGWFAKDPDILRRVGHILLQAPFVMQRSPRQIIIAD  242

Query  953   DLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKL  1126
             D FQ LN+P DR+SQVVIKA EK FG+Q+++H NL+ Y+ +KVPSLK  S +K NGE K 
Sbjct  243   DCFQHLNVPLDRSSQVVIKATEKLFGKQVLKHINLEGYIRSKVPSLKACSGQKANGELKS  302

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
             S+  LL +++Q L+RHEF   HD+W+  VKP L P ++AQLHE  +V++ E++   +VR+
Sbjct  303   SSLILLANIMQFLQRHEFGHMHDEWMSIVKPDLHPAVSAQLHEKFDVSEVEMENSKSVRS  362

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             EMR A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ ++P
Sbjct  363   EMRVAVNSLLKDEGILVIPTVADPPPKLGGKEILSQDYQSRAFSLLSIASISGCCQVTVP  422

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIA  1666
             LGF+DK P+SVS +AR GGDRFLLD ++ ++  LQEQA+IA  SK+S N +SKE SAEIA
Sbjct  423   LGFYDKYPVSVSLIARYGGDRFLLDTLKTMYTSLQEQADIAATSKASRNVVSKEQSAEIA  482

Query  1667  KGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIEL  1846
             K KGNQA+K+KQWQ+AIGFYTEAIKL GN+ATY+SNRA AYLELGS++QAEADCTKAI L
Sbjct  483   KEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEADCTKAISL  542

Query  1847  DKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             DKK+VKAYFRRGTAREMLGYY +AI+DF+YALVLEPTNKRAA +AERL KLF
Sbjct  543   DKKSVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASAAERLRKLF  594



>ref|XP_008240148.1| PREDICTED: outer envelope protein 64, chloroplastic [Prunus mume]
Length=590

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/590 (69%), Positives = 486/590 (82%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL MTRKLKK ++ D GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILFMTRKLKKTIREDFGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW +TH+ A++TS VV+ LVE GATC+ KT+VD++A+ I
Sbjct  61    LTFAVSDVFDIEGHVTGFGHPDWERTHDAASRTSPVVSVLVEGGATCIGKTVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY  PTNPA+SSR PGG SSGAAVAVAANLVDFSLGIDT GGVRVPAG CG++GF
Sbjct  121   SGENKHYATPTNPAASSRTPGGSSSGAAVAVAANLVDFSLGIDTVGGVRVPAGSCGVIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVSH GIIPVS SLD VGWF +D  VLRRVGHVLLQ+P+   R+PR IVIA+D F
Sbjct  181   RPSHGAVSHNGIIPVSTSLDTVGWFAKDSSVLRRVGHVLLQLPYAVSRSPRQIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTT  1135
             Q + IP DR  QVV K+ EK FGRQ+ +HENL  Y ++KVPSLK F   K NGE K S+ 
Sbjct  241   QQVKIPVDRIVQVVTKSTEKLFGRQVFKHENLGDYFNSKVPSLKEFHGPKTNGEVKTSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL +VVQ L+RHEF+ NH++WI+ VKP LD   +AQ+   L+ +D EI+ C +++NE+ 
Sbjct  301   KLLANVVQLLQRHEFRHNHEEWINLVKPVLDSATSAQICGPLDASDEEIEICKSIKNELH  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A++ LLKDDGILVIPT+ DPP K G K+  S D+ SRA    S+ASLSG CQ ++PLG 
Sbjct  361   AAVNSLLKDDGILVIPTIADPPSKLGGKDILSEDFRSRAFGLLSIASLSGCCQVTVPLGS  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDK P+SVSF+AR+GGDRFLLDA+  ++A LQEQA+IA +SK S NA+++E SAEIAK K
Sbjct  421   HDKYPVSVSFIARHGGDRFLLDALHTMYASLQEQADIASKSKLSKNALTREQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+K+W +AI FY+EAIKL GN+ATY+SNRAAAYLE+GSF+QAEADCTKAI LDKK
Sbjct  481   GNQAYKDKEWHKAINFYSEAIKLSGNNATYYSNRAAAYLEVGSFLQAEADCTKAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +AIEDF+YALVLEPTNKRA+ SAERL KLF 
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIEDFKYALVLEPTNKRASLSAERLRKLFQ  590



>ref|XP_009356037.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
[Pyrus x bretschneideri]
Length=590

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/590 (68%), Positives = 484/590 (82%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++TRKL K ++ D GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILLVTRKLTKTIREDFGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW +TH+ A++TSTVV+ LVE GATC   T+VD++A+ I
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWGRTHDAASRTSTVVSTLVEGGATCTGITVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNPA+SSR PGG SSGAAVAVAA+LVDFSLG+DT GGVRVPAG CGI+GF
Sbjct  121   TGENKHYGTPTNPAASSRTPGGSSSGAAVAVAADLVDFSLGLDTVGGVRVPAGSCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G+VSH G IPVS  LD VGWF +DP VLRRVGHVLLQ+P+   R+PR IVIA+D F
Sbjct  181   RASHGSVSHAGFIPVSTILDAVGWFAKDPSVLRRVGHVLLQLPYAVSRSPRQIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q + IP DR  QVVIK+ EK FG+Q+++HENL  Y ++K+PSLK F  +K NGE K S+ 
Sbjct  241   QEVKIPVDRIVQVVIKSTEKLFGKQVLKHENLGNYFNSKIPSLKEFHGQKTNGEVKTSSL  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL +VVQ L+RHEF+ NH +WID VKP L+   + Q+   LE +D EI+ C ++RNE++
Sbjct  301   KLLANVVQFLQRHEFRHNHGEWIDSVKPVLESATSTQICGPLEASDEEIEICKSIRNELQ  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A+S LLKDDGILVIPT+ DPP K G KE  S D+ SRA    S+ASLSG CQ ++PLGF
Sbjct  361   AAVSSLLKDDGILVIPTIADPPSKLGGKEMLSEDFRSRAFGLLSIASLSGCCQVTVPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HD CP+SVSF+AR+GGDRFLLDA+  ++  LQEQA+IA +SKSS NA++KE  AEIAK K
Sbjct  421   HDNCPVSVSFIARHGGDRFLLDALHTMYTSLQEQADIASKSKSSKNALTKEQCAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+K WQ+AIGFY+EAIKL GN+ATY+SNRA AYLE+G F+QAEADCTKAI LDKK
Sbjct  481   GNQAYKDKDWQKAIGFYSEAIKLKGNNATYYSNRAQAYLEVGRFIQAEADCTKAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAYFRRGTARE LGYY +AIEDFR+ALVLEPTNKRAA +AE+L KLF 
Sbjct  541   NVKAYFRRGTAREKLGYYKEAIEDFRHALVLEPTNKRAAAAAEKLRKLFQ  590



>ref|XP_007211280.1| hypothetical protein PRUPE_ppa003231mg [Prunus persica]
 gb|EMJ12479.1| hypothetical protein PRUPE_ppa003231mg [Prunus persica]
Length=590

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/590 (69%), Positives = 485/590 (82%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL MTRKLKK ++ D GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILFMTRKLKKTIREDFGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW +TH+ A++T+ VV+ LVE GATCV KT+VD++A+ I
Sbjct  61    LTFAVSDVFDIEGHVTGFGHPDWERTHDAASRTAPVVSVLVEGGATCVGKTVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY  PTNPA+SSR PGG SSGAAVAVAANLVDFSLGIDT GGVRVPAG CG++GF
Sbjct  121   SGENKHYGTPTNPAASSRTPGGSSSGAAVAVAANLVDFSLGIDTVGGVRVPAGSCGVIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVSH GIIPVS SLD VGWF +D  VLRRVGHVLLQ+P+   R+PR IVIA+D F
Sbjct  181   RPSHGAVSHNGIIPVSTSLDTVGWFAKDSSVLRRVGHVLLQLPYAVSRSPRQIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q + IP DR  QVV K+  K FGRQ+ +HENL  Y ++KVPSLK F  +K NGE K S+ 
Sbjct  241   QQVKIPVDRIVQVVTKSTLKLFGRQVFKHENLGDYFNSKVPSLKEFHGQKTNGEVKTSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL +VVQ L+RHEF+ NH +WI+ VKP LD   +AQ+   L+ +D EI+ C +++NE+ 
Sbjct  301   KLLANVVQLLQRHEFRHNHGEWINLVKPVLDSATSAQICGPLDASDEEIEICKSIKNELH  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A++ LLKDDGILVIPT+ DPP K G K+  S D+ SRA    S+ASLSG CQ ++PLG 
Sbjct  361   AAVNSLLKDDGILVIPTLADPPSKLGGKDILSEDFRSRAFGLLSIASLSGCCQVTVPLGS  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDK P+SVSF+AR+GGDRFLLDA+  ++A LQEQA+IA +SK S NA+++E SAEIAK K
Sbjct  421   HDKYPVSVSFIARHGGDRFLLDALHTMYASLQEQADIASKSKLSKNALTREQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+K+W +AI FY+EAIKL GN+ATY+SNRAAAYLE+GSF+QAEADCTKAI LDKK
Sbjct  481   GNQAYKDKEWHKAINFYSEAIKLSGNNATYYSNRAAAYLEVGSFLQAEADCTKAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +AIEDF+YALVLEPTNKRA+ SAERL KLF 
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIEDFKYALVLEPTNKRASLSAERLRKLFQ  590



>ref|XP_003530960.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X1 [Glycine max]
Length=591

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/591 (68%), Positives = 492/591 (83%), Gaps = 3/591 (1%)
 Frame = +2

Query  242   MASQSA-NLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplT  418
             M SQSA NL VLLGLGLAGI+++TRKLKK+V+ D GAF+E+LQLLPPPQP PPKAPHPLT
Sbjct  1     MTSQSAKNLLVLLGLGLAGIVLITRKLKKSVRKDLGAFIEKLQLLPPPQPAPPKAPHPLT  60

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
              L+FA+SD+F IEG V+ FG+P+WA+THEPA+ T+  V+ALVE GATCVA T++DD+A G
Sbjct  61    ALTFALSDLFDIEGHVSTFGHPEWARTHEPASSTAPAVSALVEGGATCVATTVLDDLALG  120

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I G NKHY  PTNPA  +R+PGG SSGAAVAVAA+ VDF+LGIDT GGVRVPAG+CGILG
Sbjct  121   IGGENKHYGTPTNPAVPARVPGGSSSGAAVAVAADFVDFALGIDTVGGVRVPAGFCGILG  180

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS GAVSH+GIIP+S SLD VGWF +DP++LRRVGH+LLQ PF  QR+PR IVIA+D 
Sbjct  181   FRPSHGAVSHLGIIPISTSLDTVGWFAKDPNILRRVGHILLQAPFAMQRSPRQIVIADDC  240

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKLST  1132
             FQ +N+P DR+SQVV+K  EK FGRQ+++H NL  YLS++VPSLK  S +K NGE K S 
Sbjct  241   FQHINVPLDRSSQVVVKTTEKLFGRQVLKHINLGDYLSSRVPSLKGCSGQKTNGEVKASA  300

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
              +LL +++Q+L+RHEF+  HD+W++ VKP L P ++AQLHE  EV+D EI+   +VR+EM
Sbjct  301   LKLLANIMQSLQRHEFRLKHDEWMNTVKPELHPGVSAQLHEKFEVSDAEIENSKSVRSEM  360

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
              +A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ SIPLG
Sbjct  361   CAAVNSLLKDEGILVIPTVADPPPKLGGKEILSEDYQSRAFSLLSIASISGCCQVSIPLG  420

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
             F+DK P+SVS +AR+GGDRFLLD +Q ++  LQEQA+IA +SKSS NA+SKE SAEIAK 
Sbjct  421   FYDKYPVSVSLIARHGGDRFLLDTLQTVYTTLQEQADIASKSKSSGNAVSKEQSAEIAKE  480

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQA+K+KQWQ+AIGFYTEAIKL G++ATY+SNRA AYL LGS++QA  DCTKAI LDK
Sbjct  481   KGNQAYKDKQWQKAIGFYTEAIKLCGDNATYYSNRAQAYLGLGSYLQAVEDCTKAISLDK  540

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KNVKAYFRRGTAREMLGYY +AI+DF++ALVLEPTNKRAA +AERL KLF 
Sbjct  541   KNVKAYFRRGTAREMLGYYKEAIDDFKHALVLEPTNKRAASAAERLRKLFQ  591



>ref|XP_004299527.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
[Fragaria vesca subsp. vesca]
Length=592

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/588 (67%), Positives = 489/588 (83%), Gaps = 2/588 (0%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +SQ+A+LWVLLGLGLAGILIMTRKLK+ ++ D GAFVE+LQLLPPPQP PPKAPHPLTGL
Sbjct  3     SSQAASLWVLLGLGLAGILIMTRKLKQVIREDFGAFVEKLQLLPPPQPAPPKAPHPLTGL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
             +FAVSDVF IEG VTGFG+PDWAKTH+PA++T+ VV+ LV+ GATC+ KT+VD++A+ IS
Sbjct  63    TFAVSDVFDIEGHVTGFGHPDWAKTHDPASRTAPVVSTLVQGGATCIGKTVVDELAYSIS  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G N+HY  PTNP + S+ PGG SSGAAVAVAANL DFSLG+DT GGVRVPA +CGI+GF 
Sbjct  123   GENEHYFTPTNPTAPSKTPGGSSSGAAVAVAANLADFSLGLDTVGGVRVPAAFCGIMGFR  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
             PS GAVSH G++PVS SLD VGWF +DP VL RVGHVLLQ+PF + R+PR IVIA+D  Q
Sbjct  183   PSHGAVSHSGVLPVSTSLDTVGWFAKDPKVLGRVGHVLLQLPFASSRSPRQIVIADDCLQ  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTR  1138
              + +PTDR +QVV+K+ EK FGRQ+++HENLD Y + KVPSL+ F  +K NG  K+S+ +
Sbjct  243   QVKVPTDRIAQVVVKSTEKHFGRQVLKHENLDNYFNLKVPSLRKFHGEKTNGVVKVSSIK  302

Query  1139  LLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRS  1318
             LL HV Q+L+RHEFK+NHD+WI+ VKPTLDP  +AQL    E +D E++ C +++NE+ +
Sbjct  303   LLAHVAQSLQRHEFKQNHDEWINLVKPTLDPATSAQLCGPPESSDMEVEICKSIKNELHA  362

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             A++ LLKDDGILVIPTV DPP K G K   S D+ SRA    S+ASLSG CQ +IPLG H
Sbjct  363   AVNALLKDDGILVIPTVADPPSKLGGKPLLSEDFRSRAFGLLSIASLSGCCQVTIPLGLH  422

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             +K P+SVSF+AR+GGDRFLLD +Q ++  LQEQA++   +K S NA+++E SAE++K KG
Sbjct  423   NKNPVSVSFIARHGGDRFLLDTLQTMYTSLQEQADLVTNTKLSKNALTREQSAEVSKEKG  482

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             NQAFK K++Q+AIGFY+EAIKL GN+ATY+SNRAAAYLE+GSF+QAEADC++AI LDKKN
Sbjct  483   NQAFKAKEYQKAIGFYSEAIKLSGNNATYYSNRAAAYLEIGSFLQAEADCSQAINLDKKN  542

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             VKAYFRRGTARE+LGYY +AIEDF+YA VLEPTNKRAA +AERL KLF
Sbjct  543   VKAYFRRGTAREVLGYYKEAIEDFKYAHVLEPTNKRAAAAAERLRKLF  590



>ref|XP_008374849.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
[Malus domestica]
Length=590

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/590 (68%), Positives = 486/590 (82%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++TRKL K ++ D GAF+ERLQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILLVTRKLTKTIREDFGAFIERLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW +TH+ A++TS VV+ LVE GATC   T+VD++A+ I
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWGRTHDAASRTSPVVSTLVEGGATCTGITVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNPA+SSR PGG SSGAAVAVAA+LVDFSLG+DT GGVRVPAG CGI+GF
Sbjct  121   TGENKHYGTPTNPAASSRTPGGSSSGAAVAVAADLVDFSLGLDTVGGVRVPAGSCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G+VSH G IPVS SLD VGWF RDP VLRRVGHVLLQ+P+   R+PR IVIA+D F
Sbjct  181   RASHGSVSHAGFIPVSTSLDTVGWFARDPSVLRRVGHVLLQLPYAVSRSPRQIVIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q + IP DR  QVVIK+ EK FG+Q+++HENL  Y ++K+PSLK F  +K NGE K S+ 
Sbjct  241   QEVKIPIDRIVQVVIKSTEKLFGKQVLKHENLRDYFNSKIPSLKEFHGQKTNGEVKTSSL  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL +VVQ L+RHEF+ NH +WID VKP L+   + Q+   LE +D EI+ C ++RNE++
Sbjct  301   KLLANVVQFLQRHEFRHNHGEWIDSVKPVLESATSMQICGPLEASDEEIEICKSIRNELQ  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A+S LLKDDGILVIPT+ DPP K G KE  S D+ SRA    S+ASLSG CQ ++PLGF
Sbjct  361   AAVSSLLKDDGILVIPTIADPPSKLGGKEMLSEDFRSRAFGLLSIASLSGCCQVTVPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HDKCP+SVSF+A++GGDRFLLDA+  ++  LQEQA+IA +SKSS NA++KE SAEIAK K
Sbjct  421   HDKCPVSVSFIAKHGGDRFLLDALHTMYTSLQEQADIASKSKSSKNALTKEQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN+A+K+K WQ+AIGFY+EAIKL GN+ATY+SNRA AYLE+  F+QAEADCTKAI LDKK
Sbjct  481   GNRAYKDKDWQKAIGFYSEAIKLSGNNATYYSNRAQAYLEVERFIQAEADCTKAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAYFRRGTAREMLGYY +AIEDFR+ALVLEPTNKRAA +A+RL KLF 
Sbjct  541   NVKAYFRRGTAREMLGYYKEAIEDFRHALVLEPTNKRAAAAADRLRKLFQ  590



>ref|XP_002322105.1| Toc64 family protein [Populus trichocarpa]
 gb|EEF06232.1| Toc64 family protein [Populus trichocarpa]
Length=592

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/589 (66%), Positives = 480/589 (81%), Gaps = 3/589 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS  ANLWVLLGLGLAGI + T+K KK ++ D GAF+ +LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASNPANLWVLLGLGLAGIFLFTKKFKKVLREDFGAFIHKLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F IEG+VTGFG+PDWAKTHE A++TS VV+ LVE GATCV KT++D++A+ I
Sbjct  61    LTFAVSDLFDIEGYVTGFGHPDWAKTHEAASRTSVVVSTLVEGGATCVGKTVIDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNP   +R+PGG SSGAAVAVAANLVDFSLG+DT GGVRVPAG+CGI+GF
Sbjct  121   TGENKHYGTPTNPVEPARVPGGSSSGAAVAVAANLVDFSLGVDTVGGVRVPAGFCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GA+S +G++PVS SLD VGWF +DP++LRRVGHVLLQ  F  QR+PR I++A+D F
Sbjct  181   RPSYGAISKIGVLPVSVSLDTVGWFAKDPNILRRVGHVLLQSAFGGQRSPRQIIMADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +QVV+K+ EK FGRQ+++HE LD YL++KVPSLK F  KK NGE K S+ 
Sbjct  241   QLLKIPVDRIAQVVVKSTEKHFGRQLLKHEILDVYLNSKVPSLKEFHNKKTNGEVKTSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L R+EF+ NH++WI+ VKP L+P ++AQ++E +E++D EI+ C ++R EMR
Sbjct  301   RLLANVMQLLHRYEFRSNHEEWINTVKPILEPNLSAQMNEIMELSDAEIELCKSIREEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SA++ LLKDDGILV+PT    PPK G KE  S +Y S +    S+ASLSG CQ ++PLG+
Sbjct  361   SAINSLLKDDGILVVPTTAYLPPKLGGKEILSEEYQSSSFGLLSIASLSGCCQVTVPLGY  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+SVS +AR+G DRFLLD VQ ++  LQEQAE  V SKSSN   S+E SAE+AK K
Sbjct  421   YNKCPVSVSLIARHGSDRFLLDTVQTMYKTLQEQAETYVNSKSSNKD-SRENSAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKE+QWQ+AI +Y EAIKL   +ATY+SNRAAAYLELGSF  AEADC+ AI LDKK
Sbjct  480   GNQAFKEQQWQKAISYYNEAIKLNDKNATYYSNRAAAYLELGSFQHAEADCSNAINLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTAREMLGYY  AIEDF+YALVLEPTNKRA+ SAERL K+F
Sbjct  540   NVKAYLRRGTAREMLGYYKDAIEDFKYALVLEPTNKRASLSAERLQKVF  588



>ref|XP_004160411.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
[Cucumis sativus]
Length=591

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/589 (68%), Positives = 485/589 (82%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAGIL+MT+KLKKA++ D GAF+E+ QLLPPPQP PPKAPHPLTG
Sbjct  1     MASNSANLWVLLGLGLAGILLMTKKLKKAIREDFGAFIEKFQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDWAKTH+ A++TS VV+ALVE GATC+ KT+ ++++ GI
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWAKTHDAASRTSPVVSALVEGGATCIGKTVTNELSMGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NK+Y+ PTNPAS S++PGG SSGAAVAVAANLVDFSLGIDT G VR+PA +CGILGF
Sbjct  121   SGENKYYETPTNPASHSKVPGGSSSGAAVAVAANLVDFSLGIDTVGDVRIPASFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G+VS +GI+PVS SLD VG F +DP+VLRRVGHVLLQ+P+  QRNPR I+IA+D F
Sbjct  181   RPSHGSVSQVGIVPVSLSLDTVGMFAKDPNVLRRVGHVLLQLPYAVQRNPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +Q V K+ EK FGRQ ++HENL +YLS+KVP+LK    KK NG    ++ 
Sbjct  241   QLLKIPVDRITQAVTKSTEKLFGRQALKHENLGSYLSSKVPNLKELIGKKTNGNLNSASI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R+L +++QT++R EFK NH +WID VKP LD  +  QL+E LE++DT I+K  +VRNEMR
Sbjct  301   RVLANLMQTVERIEFKGNHGEWIDSVKPDLDSALMEQLNEKLEISDTMIEKFKSVRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT +DPPPK G KE  S +Y +R     S+AS+SG CQ ++PLGF
Sbjct  361   MAINSLLKDDGVLVIPTTVDPPPKLGGKEIFSEEYQTRVFSSLSIASISGCCQVTLPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HD CP+SVSF+AR+G DRFLLD VQ ++  LQE+AE A +SK S NA+S+E SAEIAK K
Sbjct  421   HDSCPVSVSFLARHGADRFLLDIVQTMYKSLQEEAEAASKSKFSKNAVSQEQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+KEKQW++AIG YTEAIKL   +ATY+SNRAAAYLELG F QAEADC+KAI+LDKK
Sbjct  481   GNQAYKEKQWEKAIGCYTEAIKLNSRNATYYSNRAAAYLELGRFHQAEADCSKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVK+Y RRGTAREMLG+Y +AIEDF +ALVLEPTNKRA+ SAERL KLF
Sbjct  541   NVKSYLRRGTAREMLGFYKEAIEDFSHALVLEPTNKRASISAERLRKLF  589



>gb|KGN63878.1| hypothetical protein Csa_1G025100 [Cucumis sativus]
Length=591

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/589 (68%), Positives = 484/589 (82%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAGIL+MT+KLKKA++ D GAF+E+ QLLPPPQP PPKAPHPLTG
Sbjct  1     MASNSANLWVLLGLGLAGILLMTKKLKKAIREDFGAFIEKFQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDWAKTH+ A++TS VV+ALVE GATC+ KT+ ++++ GI
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWAKTHDAASRTSPVVSALVEGGATCIGKTVTNELSMGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY+ PTNPAS S++PGG SSGAAVAVAANLVDFSLGIDT G VR+PA +CGILGF
Sbjct  121   SGENKHYETPTNPASHSKVPGGSSSGAAVAVAANLVDFSLGIDTVGDVRIPASFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G+VS +GI+PVS SLD VG F +DP+VLRRVGHVLLQ+P+  QRNPR I+IA+D F
Sbjct  181   RPSHGSVSQVGIVPVSLSLDTVGMFAKDPNVLRRVGHVLLQLPYAVQRNPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +Q V K+ EK FGRQ ++HENL +YLS+KVP+LK    KK NG    ++ 
Sbjct  241   QLLKIPVDRITQAVTKSTEKLFGRQALKHENLGSYLSSKVPNLKELIGKKTNGNLNSASI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R+L +++QT++R EFK NH +WID VKP LD  +  QL+E LE++DT I+K  +VRNEMR
Sbjct  301   RVLANLMQTVERIEFKGNHGEWIDSVKPDLDSALMEQLNEKLEISDTMIEKFKSVRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT +D PPK G KE  S +Y +R     S+AS+SG CQ ++PLGF
Sbjct  361   MAINSLLKDDGVLVIPTTVDSPPKLGGKEIFSEEYQTRVFSSLSIASISGCCQVTLPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HD CP+SVSF+AR+G DRFLLD VQ ++  LQE+AE A +SK S NA+S+E SAEIAK K
Sbjct  421   HDSCPVSVSFLARHGADRFLLDIVQTMYRSLQEEAEAASKSKFSKNAVSQEQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+KEKQW++AIG YTEAIKL   +ATY+SNRAAAYLELG F QAEADC+KAI+LDKK
Sbjct  481   GNQAYKEKQWEKAIGCYTEAIKLNSRNATYYSNRAAAYLELGRFHQAEADCSKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVK+Y RRGTAREMLG+Y +AIEDF +ALVLEPTNKRA+ SAERL KLF
Sbjct  541   NVKSYLRRGTAREMLGFYKEAIEDFSHALVLEPTNKRASISAERLRKLF  589



>ref|XP_007036834.1| Amidase family protein isoform 1 [Theobroma cacao]
 gb|EOY21335.1| Amidase family protein isoform 1 [Theobroma cacao]
Length=590

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/592 (66%), Positives = 488/592 (82%), Gaps = 6/592 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS +ANLWVLLGLGLAGIL+MT++LKK +KAD GAF+++L+LLPPPQP PPKAPHPLTG
Sbjct  1     MASHAANLWVLLGLGLAGILLMTKRLKKTIKADFGAFIQKLELLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F IEG+VTGFG+PDW +THE +++TS VV +LVE GATCV KT+VD++A+ I
Sbjct  61    LSFAVSDLFDIEGYVTGFGHPDWVRTHEASSRTSPVVLSLVEGGATCVGKTVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
              G NKHY  PTNPA+ +R+PGG SSGAAVAVAAN VDFSLGIDT GGVRVPA +CG++GF
Sbjct  121   HGENKHYSTPTNPAAPARIPGGSSSGAAVAVAANFVDFSLGIDTLGGVRVPAAFCGVIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+G VSH GIIPV+ SLD VG   +DP++L RVG VLLQ+PF+ QRNPR I++A+D F
Sbjct  181   RPSYGVVSHTGIIPVASSLDTVGLLAKDPNILHRVGLVLLQLPFSVQRNPRQILLADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP +R SQVVI + EK FGRQ+++HENL+ Y S+KVPSLK F  +K+N + K+S+ 
Sbjct  241   QLLKIPMERVSQVVINSTEKLFGRQVLKHENLEDYFSSKVPSLKEFYRQKINVDLKISSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V Q L+R+EFK  H++WI   KP LD  ++ Q++E L++ D EI+ C ++RNEMR
Sbjct  301   RLLANVAQFLQRYEFKCAHEEWISSEKPVLDSAVSTQINETLDLTDKEIEICKSIRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFA--SLASLSGGCQASIPL  1489
              A++ LLKDDGILVIPT   PPPK G+KE  S DY    C+F+  S+AS+SG CQ ++PL
Sbjct  361   LAVNSLLKDDGILVIPTTAHPPPKLGSKEIFSEDY--HNCMFSLLSIASISGCCQVTLPL  418

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAK  1669
             G+HD  P+SVSF+AR+GGDRFLLD VQ +++ LQE A+   +SK S NA+++E SAE+AK
Sbjct  419   GYHDNYPVSVSFIARHGGDRFLLDTVQTMYSSLQEHADTVAKSKLSRNAVNQEQSAEVAK  478

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGNQA+K+KQWQ+A+ FYTEAIKL GN+ATY+SNRAAAYLELGSF+QAE DCTKAI+LD
Sbjct  479   EKGNQAYKDKQWQKAVMFYTEAIKLNGNNATYYSNRAAAYLELGSFLQAETDCTKAIDLD  538

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KKNVKAY RRGTAREMLGYY +AIEDFRYALVLEPTNKRAA SAERL K+F 
Sbjct  539   KKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAALSAERLRKVFQ  590



>ref|XP_010549063.1| PREDICTED: outer envelope protein 64, chloroplastic [Tarenaya 
hassleriana]
Length=594

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/591 (67%), Positives = 481/591 (81%), Gaps = 3/591 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAGIL++T+KLKKAV+ D GAFVE+L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHSANLWVLLGLGLAGILLVTKKLKKAVREDLGAFVEKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF I+G+VTGFG+PDW +THE A+ TS VV+ LVE GATCV KT+VD++ + I
Sbjct  61    LSFAVSDVFDIKGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDELGYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG N+HYD PTNP+SS R+PGG SSGAAVAVAAN+VDF+LGIDT GGVRVPAGYCGILGF
Sbjct  121   SGENRHYDTPTNPSSSGRVPGGSSSGAAVAVAANIVDFALGIDTVGGVRVPAGYCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G VS+ GIIPV+ SLD VGWF RDP  LRRVGHVLLQ+PF AQRNPR I++ +D F
Sbjct  181   RSSHGVVSNAGIIPVASSLDAVGWFARDPSTLRRVGHVLLQLPFAAQRNPRQIILVDDFF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK---LNGEAKLST  1132
             Q + IP DR S+VVIK+ EK FGRQ+++HENL+ +  +KVPSLK F+K   +  +AK+ T
Sbjct  241   QLVKIPVDRISEVVIKSAEKLFGRQLLKHENLENFFESKVPSLKDFRKRKAIADDAKIPT  300

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
              +LLG+++  L+RHEF +NH DWI+ VKP  D +I ++  E  E+ D +I+   A+R++M
Sbjct  301   AKLLGNLMHLLQRHEFLQNHGDWINTVKPAADTVIPSRACENKELTDEDIETLKAIRSQM  360

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R A+  LLKDDG+LVIPT    PPK G+KE  S +Y +RA    S+AS+SG CQA++P+G
Sbjct  361   RVAIGSLLKDDGVLVIPTTPSIPPKLGSKEITSEEYQNRAASLLSIASISGCCQATVPVG  420

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
              H+KCP+SVSF+AR+GGDRFLLD V+ ++A +QEQA I   SKSS   +S+E SAEI+K 
Sbjct  421   HHEKCPVSVSFIARHGGDRFLLDTVETMYASMQEQASIVANSKSSRKTMSQEESAEISKE  480

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQAFKE+QW +AIG Y+EAIKL GN+ATY+SNRAAAYLELGSF+QAEADCTKAI +DK
Sbjct  481   KGNQAFKERQWPKAIGCYSEAIKLSGNNATYYSNRAAAYLELGSFIQAEADCTKAIAIDK  540

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KNVKAY RRGTAREMLGYY +AI+DF +ALVLEP NKRAAQSAERL K F 
Sbjct  541   KNVKAYLRRGTAREMLGYYKEAIDDFGHALVLEPNNKRAAQSAERLRKHFQ  591



>gb|KDP23937.1| hypothetical protein JCGZ_27097 [Jatropha curcas]
Length=590

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/590 (67%), Positives = 482/590 (82%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MA+  ANLWVLLGLG+AGIL+MTRKLKK ++ D GAFVE+LQLLPPPQP PPKAPHPLTG
Sbjct  1     MAANPANLWVLLGLGIAGILLMTRKLKKTIREDFGAFVEKLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG+VTGFG+PDWA+THE A++TS+VV+ LVE GATC+ KT+VD++A+ I
Sbjct  61    LTFAVSDVFDIEGYVTGFGHPDWARTHEVASRTSSVVSVLVEGGATCIGKTVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNPA+ +R+PGG SSGAAVAVAANLVDFSLG+DT GGVR+PAG+CGI+GF
Sbjct  121   NGENKHYGTPTNPAAPARVPGGSSSGAAVAVAANLVDFSLGVDTVGGVRIPAGFCGIMGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G + H GIIP S SLD VGWF +DP+VLRRVGH+LLQVPF  QRNPR I+IA+D F
Sbjct  181   RPSHGIIPHWGIIPASASLDTVGWFAKDPNVLRRVGHLLLQVPFGVQRNPRQIIIADDFF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +QVVI++ EK FGRQ++RHE L+  L +KVPSLK    KK NGE + S+ 
Sbjct  241   QLLKIPVDRVAQVVIRSTEKLFGRQVLRHEILEEILFSKVPSLKQLHDKKSNGEGRPSSV  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +++Q L+R+EF+ NH +WI   K  LD  I A ++E +E+ D E++   ++RNEMR
Sbjct  301   RLLANIMQLLQRYEFRYNHGEWISAEKLNLDHDICALVNEVMEIPDAEMEIYISIRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A++ LLKDDGILVIPT    PPK G KE  S DY  R+    S+ASLSG CQ +IPLG 
Sbjct  361   AAINSLLKDDGILVIPTTAYLPPKLGGKELLSEDYQIRSFSLLSIASLSGCCQVTIPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+SVSF+AR+GGDRFLLD VQ ++  LQEQA++ V SKS +   S+E SAE+AK K
Sbjct  421   YEKCPVSVSFIARHGGDRFLLDTVQNMYTSLQEQADLLVNSKSPHKTDSQERSAEMAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK+KQWQ+AI +YT+AIKL G +ATY+SNRAAA+LEL SF+QAEADCTKAI+LDKK
Sbjct  481   GNQAFKDKQWQKAISYYTDAIKLNGKNATYYSNRAAAHLELASFLQAEADCTKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +AIEDF++ALVLEPTNKRAA SAERL K+F 
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIEDFKHALVLEPTNKRAAISAERLRKMFQ  590



>ref|XP_006406668.1| hypothetical protein EUTSA_v10020361mg [Eutrema salsugineum]
 gb|ESQ48121.1| hypothetical protein EUTSA_v10020361mg [Eutrema salsugineum]
Length=590

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/590 (67%), Positives = 473/590 (80%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS ++NLWVLLGLG+AGIL+ T+KLKK  + D GAF+++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHASNLWVLLGLGIAGILLATKKLKKTTREDFGAFIDKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSDVF I G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LSFAVSDVFDITGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ +R+PGG  SGAA+AVA N VDF+LGIDT GGVRVPA YCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPARIPGGACSGAAIAVATNAVDFALGIDTVGGVRVPAVYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GAVS+ GIIPVS SLD VGWF RDP+ LRRVGHVLLQ+PF  QRNPR I+IA+D F
Sbjct  181   KFSHGAVSNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIIIADDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTT  1135
             Q L IP DR +QVVIK+ EK FGRQ+++H+NL+ Y   KVPSLK F +    A   +ST+
Sbjct  241   QLLKIPVDRITQVVIKSAEKLFGRQLLKHQNLENYFEAKVPSLKEFIRTRAIANTNVSTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L+RHEF +NH DWI+ VKP +DP+I++QL E  E+++ EI+  + +RN+MR
Sbjct  301   RLLANVMQLLQRHEFLKNHGDWINTVKPAIDPVISSQLRENPELSNDEIENLNTIRNQMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A+  LLKDDGILVIPT+   PPK G+KE  S DY SRA    S+AS+SG CQ ++PLG 
Sbjct  361   VAIGSLLKDDGILVIPTMPAVPPKLGSKEITSEDYQSRASSLLSIASISGCCQVTVPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+ R+GGDRFLLD VQ ++A LQE + I    KS    IS+E SAEIAK K
Sbjct  421   HEKCPVSVSFIGRHGGDRFLLDTVQTMYATLQENSSIIADPKSFKKTISQEESAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AIG Y+EAIKL  N+ATY+SNRAAAYLE+GSF+QAE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWQKAIGLYSEAIKLSENNATYYSNRAAAYLEIGSFLQAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREML YY +AI+DF+YALVLEP NKRAA SAERL KLF 
Sbjct  541   NVKAYLRRGTAREMLSYYKEAIDDFKYALVLEPNNKRAALSAERLRKLFQ  590



>gb|KHN10539.1| Translocon at the outer membrane of chloroplasts 64 [Glycine 
soja]
Length=569

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/566 (67%), Positives = 457/566 (81%), Gaps = 16/566 (3%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             +TRKL K+V+ D GAF+ +LQLLPPPQP PPKAPHPLT L+FA+SD+FHI G V  FG+P
Sbjct  19    ITRKLNKSVREDFGAFIHKLQLLPPPQPSPPKAPHPLTSLTFALSDLFHIHGHVPSFGHP  78

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DWA+THEP++ T+  V+ALVE GATCVA T++DD+A GI G NKH+  PTNPA  +R+PG
Sbjct  79    DWARTHEPSSSTAPAVSALVEGGATCVATTVLDDLALGIGGENKHFGTPTNPAVPARVPG  138

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSGAAVAVAAN VDF+LGIDT GGVRVPAG+CGILGF PS GAVSHMGIIP+S SLD 
Sbjct  139   GSSSGAAVAVAANFVDFALGIDTTGGVRVPAGFCGILGFRPSHGAVSHMGIIPISTSLDT  198

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VGWF +DP++LRRVGH+LLQ PF  QR+PR IVIA+D FQ +N+P DR+SQVV+KA EK 
Sbjct  199   VGWFAKDPNILRRVGHILLQAPFVMQRSPRQIVIADDCFQHINVPLDRSSQVVVKATEKL  258

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
             FGRQ+++H NL  YL                 K S+ +LL H++Q L+RHEF+  HDDW+
Sbjct  259   FGRQVLKHINLGDYL----------------MKASSLKLLAHIMQFLQRHEFRLKHDDWM  302

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
             + VKP L P ++AQLHE  EV+D EI+   +VR+EMR+A++ LLKD+GILVIPTV DPPP
Sbjct  303   NTVKPDLHPGVSAQLHEKFEVSDAEIENSKSVRSEMRAAVNSLLKDEGILVIPTVADPPP  362

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K G KE  S DY SRA    S+AS+SG CQ SIPLGF+DK P+SVS +AR+GGDRFLLD 
Sbjct  363   KLGGKEILSEDYQSRAFSLLSIASISGCCQVSIPLGFYDKYPVSVSLIARHGGDRFLLDT  422

Query  1565  VQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKL  1744
             +Q ++  LQEQA+IA +SKSS N +SKE SAEIAK KGNQA+K+KQWQ+AIGFYTEAIKL
Sbjct  423   LQTVYTTLQEQADIASKSKSSGNVVSKEQSAEIAKEKGNQAYKDKQWQKAIGFYTEAIKL  482

Query  1745  YGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
              G++ATY+SNRA AYLEL S++QA  DCTKAI LDKKNVKAYFRRGTAR+MLGYY +AI+
Sbjct  483   CGDNATYYSNRAQAYLELESYLQAVEDCTKAISLDKKNVKAYFRRGTARQMLGYYKEAID  542

Query  1925  DFRYALVLEPTNKRAAQSAERLAKLF  2002
             DF++ALVLEPTNKRAA +AERL KLF
Sbjct  543   DFKHALVLEPTNKRAASAAERLRKLF  568



>sp|Q9MUK5.1|TOC64_PEA RecName: Full=Translocon at the outer membrane of chloroplasts 
64 (chloroplast) [Pisum sativum]
 gb|AAF62870.1|AF179282_1 Toc64 [Pisum sativum]
Length=593

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/591 (67%), Positives = 487/591 (82%), Gaps = 2/591 (0%)
 Frame = +2

Query  239   SMASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplT  418
             SMAS S+ +WV+LGLGLAGI ++TRKL +AVK D GAF+ +L+LLPPP P PPKAPHPL+
Sbjct  3     SMASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHPLS  62

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
              L+FA+SD+F IEG V+ FG+P+WA+THEPA+ T++ V+ALVE+GATC+  T+VD++A+G
Sbjct  63    SLNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELAYG  122

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ISG NKH+  PTNPA  +R+PGG SSGAAVAVAAN VDFSLG+DT GGVRVPAG+CGILG
Sbjct  123   ISGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGILG  182

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS GAVSH+GIIPVS SLD VGWF +DPDVLRRVGH+LLQ PF  QRNPR I+IA+D 
Sbjct  183   FRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIADDC  242

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKLST  1132
             FQ LN+P DRTSQVVIKA EK FG+Q+++H N + Y+S+KV SLK  S +K NG  K S+
Sbjct  243   FQHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKSSS  302

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
              +LL +V+Q+L+RHEF+  H +W+  VKP L P ++AQLHE  EV++ EI+   +VR+E+
Sbjct  303   LKLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRSEL  362

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R A++ LLKD+G+LVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ ++PLG
Sbjct  363   RVAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVPLG  422

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
             F DK P+SVS +AR+GGDRFLLD ++ ++  LQEQA+IA  SKSS + +SKE SAEI+K 
Sbjct  423   FFDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEISKE  482

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQA+K+KQWQ+AIGFYTEAIKL GN+ATY+SNRA AYLELGS++QAE DCT AI  DK
Sbjct  483   KGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDK  542

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KNVKAYFRRGTAREMLGYY +AI+DF+YALVLEPTNKRAA SAERL KLF 
Sbjct  543   KNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLFQ  593



>ref|XP_010678253.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=590

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/590 (64%), Positives = 472/590 (80%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SAN+WV+LGLGLAGIL+MTRKLKK ++ D GAFV+RLQLLPPPQP PPKAP+PLT 
Sbjct  1     MASSSANIWVMLGLGLAGILLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPYPLTA  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F IEGFVTGFGNPDWA+THE A++T++VV+ LV+ GA+CV +T +D+MA+ +
Sbjct  61    LTFAVSDLFDIEGFVTGFGNPDWARTHEAASRTASVVSTLVDGGASCVGRTTIDEMAYSV  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD P+NP +  R+PGG  SGAAV VA+NLVDFS+G+D  GG+RVP+G+CG++GF
Sbjct  121   SGQNKHYDTPSNPGAPGRVPGGSCSGAAVCVASNLVDFSVGVDAVGGIRVPSGFCGVIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+SH GIIPVS SLD +G   +DP VLRRV HV++++ F   R+PR I+IA+D F
Sbjct  181   RASHGAISHSGIIPVSTSLDTIGCSAKDPSVLRRVVHVMMKLQFATPRSPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKL--NGEAKLSTT  1135
             + L +P DR  Q VIK+ EK FGRQ+++HENL  YLS+KV SL     L  N + K S  
Sbjct  241   ELLKVPADRLVQPVIKSTEKLFGRQVLKHENLGKYLSSKVSSLLELSALQNNDQVKTSMF  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
              LL HV+Q+L R+EFK NH +W++ VKP +D  I A  HE + + ++EI K   +RNEMR
Sbjct  301   SLLAHVMQSLYRYEFKGNHGEWMNLVKPDVDARIAALFHESVVIDESEIQKMSRMRNEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              AL+ LLKDDG+LVIPT  DPPPK GAKE  S  Y+SR     S+ASLSG C+ ++PLG+
Sbjct  361   LALNSLLKDDGVLVIPTFADPPPKVGAKELSSEIYLSRLYSLLSIASLSGCCEVTVPLGY  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
              +KCP+SVSF+AR+GGDRFLLD VQ +++ LQEQ ++  ++KS++N +S+E+SAEIAK K
Sbjct  421   FNKCPLSVSFIARHGGDRFLLDTVQTMYSSLQEQLDVLSKTKSTSNTLSRESSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFK+KQWQ+AI FYTEAIKLYG+S TY+SNRAAAYLELGSFVQAEADCTKAI LDKK
Sbjct  481   GNQAFKDKQWQKAINFYTEAIKLYGSSPTYYSNRAAAYLELGSFVQAEADCTKAINLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +A EDFRYALVLEPTNKRAA S ERL  LF 
Sbjct  541   NVKAYLRRGTAREMLGYYKEATEDFRYALVLEPTNKRAAVSVERLKNLFQ  590



>ref|XP_008453484.1| PREDICTED: outer envelope protein 64, chloroplastic [Cucumis 
melo]
Length=591

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/589 (67%), Positives = 478/589 (81%), Gaps = 2/589 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAGIL+MT+KLKKA++ D GAF+E+ QLLPPPQP PPKAPHPLTG
Sbjct  1     MASNSANLWVLLGLGLAGILLMTKKLKKAIREDFGAFIEKFQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW KTH+ A++TS +V+ALVE GATC+ KT++++++ GI
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWTKTHDAASRTSPIVSALVEGGATCIGKTVINELSMGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY  PTNPAS SR+PGG SSGAAVAVAANLVDFSLGIDT G VR+PA +CGILGF
Sbjct  121   SGENKHYGTPTNPASHSRVPGGSSSGAAVAVAANLVDFSLGIDTVGDVRIPASFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G+VS +GI+PVS SLD VG F +DP+VLRRVGHVLLQ+P+  QRNPR ++IA+D F
Sbjct  181   RPSHGSVSQVGIVPVSLSLDTVGMFAKDPNVLRRVGHVLLQLPYAVQRNPRQVIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +Q V K  EK FGRQ ++HENL +YLS+KVP LK    K+ NG    ++ 
Sbjct  241   QLLKIPVDRITQAVTKCTEKLFGRQALKHENLGSYLSSKVPKLKELVGKRTNGNLDSASI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R++ +++QT++R EFK NH +WID VKP LDP +T QL+E LE+ D  I+   +VRNE R
Sbjct  301   RVMANLIQTVERIEFKGNHGEWIDSVKPDLDPALTEQLNEKLEIPDAMIENFKSVRNETR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT +DPPPK G KE  S +Y +R     S+AS+SG CQ ++PLGF
Sbjct  361   MAINSLLKDDGVLVIPTTVDPPPKLGGKEIFSEEYQTRVFSSLSIASISGCCQVTLPLGF  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HD CP+SVS +AR+GGDRFLLD VQ ++  LQE+AE A +SK S NA+S+E SAEIAK K
Sbjct  421   HDSCPVSVSLLARHGGDRFLLDIVQTMYKSLQEEAEAASKSKFSKNAVSQEQSAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+KEKQW+RAI  YTEAIKL   +ATY+SNRAAAYLEL  F QAEADC+KAI+LDKK
Sbjct  481   GNQAYKEKQWERAIACYTEAIKLNSRNATYYSNRAAAYLELSRFHQAEADCSKAIDLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVK+Y RRGTAREMLG++ +AIEDF +ALVLEPTNKRA+ SAERL KLF
Sbjct  541   NVKSYLRRGTAREMLGFFKEAIEDFSHALVLEPTNKRASISAERLRKLF  589



>ref|XP_009135562.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Brassica 
rapa]
Length=591

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/589 (64%), Positives = 471/589 (80%), Gaps = 2/589 (0%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S ++NLWVLLGLG+AGIL+  +KLKK ++ D GAF+++L LLPPP PPPPKAPHPLT L
Sbjct  3     SSHASNLWVLLGLGIAGILLAAKKLKKTIRQDLGAFIDKLLLLPPPPPPPPKAPHPLTAL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
             SFA+SD+F + G+VTGFG+PDW +THEPA  T  VV+ LVE GATCV KT+VD++AF IS
Sbjct  63    SFAISDLFDVSGYVTGFGHPDWVRTHEPAASTCPVVSTLVEGGATCVGKTVVDELAFSIS  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G  KHY++PTNPA+  R+PGG  SGAA++VA + VDF+LGIDT GGVRVPAGYCG+LGF 
Sbjct  123   GETKHYESPTNPAAHDRIPGGACSGAAISVATSAVDFALGIDTVGGVRVPAGYCGVLGFK  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
              S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF   RNPR I++A+D FQ
Sbjct  183   SSHGAISNAGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATPRNPRQIILADDYFQ  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTTR  1138
              L IP DR +QVVIK+ EK FG+Q+++H NL+ Y  +KVPSLK F +       K+ T+R
Sbjct  243   LLKIPVDRITQVVIKSAEKLFGKQLLKHLNLENYFESKVPSLKEFARTKAITSTKVPTSR  302

Query  1139  LLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRS  1318
             LL +V+Q L+RHEF +NH DWI+ VKP +DP+I++QL E  E+ + EI+  +A+RN+ R+
Sbjct  303   LLANVMQLLQRHEFLQNHGDWINTVKPAIDPVISSQLSETPEITNEEIENLNAIRNQTRA  362

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             A++ LLKDDGILVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG+H
Sbjct  363   AINTLLKDDGILVIPTMPTLPPKLGSKEIISEDYQNRAYSLLSIASISGCCQVTVPLGYH  422

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             +KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + I    KSS   IS+E SAEIAK KG
Sbjct  423   EKCPVSVSFIARHGGDRFLLDTVQTMYASLQENSSIIADPKSSKKTISQEESAEIAKEKG  482

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             NQAFKEKQWQ+AIG Y+EAIKL  ++ TY++NRAAAYLE+GSF+QAE DCTKAI LDKKN
Sbjct  483   NQAFKEKQWQKAIGLYSEAIKLSDSNGTYYNNRAAAYLEIGSFLQAEEDCTKAITLDKKN  542

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             VKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+QSAERL KLF 
Sbjct  543   VKAYLRRGTAREMLGVYKEAMDDFRHALVLEPNNKRASQSAERLRKLFQ  591



>ref|XP_011035613.1| PREDICTED: outer envelope protein 64, chloroplastic [Populus 
euphratica]
Length=592

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/589 (65%), Positives = 474/589 (80%), Gaps = 3/589 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS  ANLWVLLGLGLAGI + T+K KK ++ D GAF+ +LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASNPANLWVLLGLGLAGIFLFTKKFKKVLREDFGAFIHKLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F IEG VTGFG+PDWAKTHE A++TS VV+ LVE GA CV KT++D++A+ I
Sbjct  61    LTFAVSDLFDIEGHVTGFGHPDWAKTHEAASRTSVVVSTLVEGGAACVGKTVIDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNP   +R+PGG SSGAAVAVAANLVDFSLG+DT GGVRVPAG+CGI+GF
Sbjct  121   TGENKHYGTPTNPVEPARVPGGCSSGAAVAVAANLVDFSLGVDTVGGVRVPAGFCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GA+S +G++PVS SLD VGWF +DP++L+RVGHVLLQ  F   R+PR I++A+D F
Sbjct  181   RPSYGAISKIGVLPVSPSLDTVGWFAKDPNILQRVGHVLLQSAFGGHRSPRQIIMADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             QSL IP DR +QVV+K+ EK FGRQ+++HE LD YL +KVPSLK F  KK NGE K S+ 
Sbjct  241   QSLKIPVDRIAQVVVKSTEKHFGRQLLKHEILDVYLKSKVPSLKEFHNKKTNGEVKTSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L R+EF+ NH++WI+ VKP L+P  +AQ++E +E++D EI+ C ++R EMR
Sbjct  301   RLLANVMQLLHRYEFRSNHEEWINTVKPILEPNFSAQMNEIMELSDAEIELCKSIREEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             SA++ LLKDDGILV+PT    PPK G KE  S +Y S +    S+ASLSG CQ ++PLG+
Sbjct  361   SAVNFLLKDDGILVVPTTAYLPPKLGGKEILSEEYQSSSFGLLSIASLSGCCQVTVPLGY  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+SVS +AR+G DRFLLD VQ ++   QEQAE  V SK SN   S+  SAE+AK K
Sbjct  421   YNKCPVSVSLIARHGSDRFLLDTVQTMYKTFQEQAETYVNSKLSNKD-SRANSAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKE+QWQ+A+ +YTEAIKL   +ATY+SNRAAAYLELGSF  AEADC+ AI LDKK
Sbjct  480   GNQAFKEQQWQKAVSYYTEAIKLNDKNATYYSNRAAAYLELGSFHHAEADCSNAINLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTAREMLGYY  AIEDF+YALVLEPTNKRA+ SAERL K+F
Sbjct  540   NVKAYLRRGTAREMLGYYKDAIEDFKYALVLEPTNKRASLSAERLQKVF  588



>ref|XP_004137345.1| PREDICTED: LOW QUALITY PROTEIN: translocon at the outer membrane 
of chloroplasts 64-like [Cucumis sativus]
Length=585

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/589 (67%), Positives = 478/589 (81%), Gaps = 8/589 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLGLAGIL+MT+KLKKA++ D GAF+E+ QLLPPPQP PPKAPHPLTG
Sbjct  1     MASNSANLWVLLGLGLAGILLMTKKLKKAIREDFGAFIEKFQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDWAKTH+ A       +ALVE GATC+ KT+ ++++ GI
Sbjct  61    LTFAVSDVFEIEGHVTGFGHPDWAKTHDAAX------SALVEGGATCIGKTVTNELSMGI  114

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY+ PTNPAS S++PGG SSGAAVAVAANLVDFSLGIDT G VR+PA +CGILGF
Sbjct  115   SGENKHYETPTNPASHSKVPGGSSSGAAVAVAANLVDFSLGIDTVGDVRIPASFCGILGF  174

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G+VS +GI+PVS SLD VG F +DP+VLRRVGHVLLQ+P+  QRNPR I+IA+D F
Sbjct  175   RPSHGSVSQVGIVPVSLSLDTVGMFAKDPNVLRRVGHVLLQLPYAVQRNPRQIIIADDCF  234

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +Q V K+ EK FGRQ ++HENL +YLS+KVP+LK    KK NG    ++ 
Sbjct  235   QLLKIPVDRITQAVTKSTEKLFGRQALKHENLGSYLSSKVPNLKELIGKKTNGNLNSASI  294

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             R+L +++QT++R EFK NH +WID VKP LD  +  QL+E LE++DT I+K  +VRNEMR
Sbjct  295   RVLANLMQTVERIEFKGNHGEWIDSVKPDLDSALMEQLNEKLEISDTMIEKFKSVRNEMR  354

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT +D PPK G KE  S +Y +R     S+AS+SG CQ ++PLGF
Sbjct  355   MAINSLLKDDGVLVIPTTVDSPPKLGGKEIFSEEYQTRVFSSLSIASISGCCQVTLPLGF  414

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             HD CP+SVSF+AR+G DRFLLD VQ ++  LQE+AE A +SK S NA+S+E SAEIAK K
Sbjct  415   HDSCPVSVSFLARHGADRFLLDIVQTMYRSLQEEAEAASKSKFSKNAVSQEQSAEIAKEK  474

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+KEKQW++AIG YTEAIKL   +ATY+SNRAAAYLELG F QAEADC+KAI+LDKK
Sbjct  475   GNQAYKEKQWEKAIGCYTEAIKLNSRNATYYSNRAAAYLELGRFHQAEADCSKAIDLDKK  534

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVK+Y RRGTAREMLG+Y +AIEDF +ALVLEPTNKRA+ SAERL KLF
Sbjct  535   NVKSYLRRGTAREMLGFYKEAIEDFSHALVLEPTNKRASISAERLRKLF  583



>ref|XP_002530483.1| amidase, putative [Ricinus communis]
 gb|EEF31906.1| amidase, putative [Ricinus communis]
Length=589

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/590 (65%), Positives = 483/590 (82%), Gaps = 3/590 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             M S  ANLWVLLGLG+AGIL++T+KLKK ++ D GAFV++LQLLPPP P PPKAPHPLTG
Sbjct  1     MGSNPANLWVLLGLGIAGILLVTKKLKKVIREDFGAFVQKLQLLPPPPPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG+VTGFG+PDWA+THE A+QTS VV+ALVE GATC+ KT+VD++A+ I
Sbjct  61    LTFAVSDVFDIEGYVTGFGHPDWARTHEAASQTSLVVSALVEGGATCIGKTVVDELAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N+HY  PTNPA  +R+PGG SSGAAVAVAANLVDFSLG+DT GGVRVPAG+CGI+GF
Sbjct  121   NGENEHYGTPTNPAVPARVPGGSSSGAAVAVAANLVDFSLGVDTVGGVRVPAGFCGIIGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GA+ + GI+P+S SLD VGWF RDP+V+RRVGH+LLQ+PF  QRNP+ I+IA+D F
Sbjct  181   RPSYGAIPNTGILPISASLDTVGWFARDPNVIRRVGHLLLQLPFGVQRNPKQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q L IP DR +QVVIK+ EK FGRQ++RHE L+  L ++V SLK    +K NGE + S+ 
Sbjct  241   QLLKIPVDRIAQVVIKSTEKIFGRQVLRHEILEDVLFSRVRSLKLLHDQKTNGELRTSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL ++++ L R+EF+ NH++WI+  KP +D  I+AQ+HE +++ DTEI+   ++R EMR
Sbjct  301   RLLANIMRLLHRYEFRHNHEEWINIEKPNVDHNISAQIHEIVDIPDTEIEIFKSIRQEMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A++ LLKDDGILVIPT    PPK G K+  S DY        S+ASLSG CQ +IPLG 
Sbjct  361   AAINSLLKDDGILVIPTTAHLPPKLGGKDMLSEDYQILLFSLLSIASLSGCCQVTIPLGL  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             ++KCP+SVSF+AR+GGDRFL+D VQ +++ LQEQ ++  + KS + + ++E SAE+AK K
Sbjct  421   YEKCPVSVSFIARHGGDRFLMDTVQNMYSSLQEQVDMLAKPKS-HTSDNQERSAEMAKEK  479

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+KEKQWQ+AI +YTEAIKL G +ATY+SNRAAAYLELGSF+QAEADCTKAI LDKK
Sbjct  480   GNQAYKEKQWQKAISYYTEAIKLNGKNATYYSNRAAAYLELGSFLQAEADCTKAINLDKK  539

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREM+GYY +AIEDF+YALVLEPTNKRAA SAERL K+F 
Sbjct  540   NVKAYLRRGTAREMIGYYKEAIEDFQYALVLEPTNKRAALSAERLRKMFQ  589



>gb|KDO63834.1| hypothetical protein CISIN_1g008025mg [Citrus sinensis]
Length=554

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/561 (69%), Positives = 466/561 (83%), Gaps = 8/561 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL+MT+KLKK +K D GAF+E+LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F IEG+VTGFG+P+WA+TH  A++TSTVV+ LVE GATC+ KT+VD+ A+ I
Sbjct  61    LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHYD PTNPA+ S++PGG SSGAAVAVAA+LVDFSLGIDT GGVRVP+ +CGILGF
Sbjct  121   NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GAVSHMGIIP+S SLD VGWF RDP +LR VGHVLLQ+PF AQR+PR I+IA+D F
Sbjct  181   RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             + L IP DR  QVVIK+ EK FGRQ+++HENL  Y  +KVPSLK F K NGE K      
Sbjct  241   ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELK------  294

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
               +V++ ++R+EFK NH++WI+ VKP LDP I+A++ E LE+++T I+ C ++RNEMRSA
Sbjct  295   --NVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSA  352

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +S LLKDDGILV PT   PPPK G KE  S DY +RA    S+AS+SG CQ ++PLG++D
Sbjct  353   ISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYD  412

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP SVSF+AR+GGDRFLLD VQ ++A LQEQA+IA +SK S N  +++ SAEIAK KGN
Sbjct  413   KCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGN  472

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
             QA+K+KQW +AI FYTEAIKL GN+ATY+SNRAAAYLE GSF+QAEADCTKAI LDKKNV
Sbjct  473   QAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNV  532

Query  1862  KAYFRRGTAREMLGYYNQAIE  1924
             KAY RRGTAREMLGYY +AIE
Sbjct  533   KAYLRRGTAREMLGYYKEAIE  553



>emb|CDX93679.1| BnaA06g03690D [Brassica napus]
Length=601

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/591 (65%), Positives = 474/591 (80%), Gaps = 4/591 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             +AS+++NLWVLLGLG+AG L++T+KLKK V+ D GAF+E+L LLPPPQP PPKAPHPLT 
Sbjct  9     LASRASNLWVLLGLGIAGALLITKKLKKRVREDFGAFIEKLLLLPPPQPSPPKAPHPLTA  68

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F ++G+V+GFG+P+W +THE A  TS VV+ LVE GATCV KT+V + AF I
Sbjct  69    LSFAVSDLFDVKGYVSGFGHPEWIRTHEAAASTSPVVSVLVEGGATCVGKTVVGEFAFSI  128

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG  KHYD PTNPA+ +R+PGG  SGAAVAVAANLVDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  129   SGETKHYDTPTNPAAPARIPGGSCSGAAVAVAANLVDFALGIDTVGGVRVPAGYCGVLGF  188

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G VS+ GIIPVS SLD VGWF RDP+ LRRVGHV+LQ+PF AQRNPR I++A+D  
Sbjct  189   RSSQGIVSNAGIIPVSSSLDAVGWFARDPNTLRRVGHVILQLPFAAQRNPRQIILADDYL  248

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGE-AKLST  1132
             Q   +P DR SQVVIK+ EK FGRQ ++HENL+ Y   KVPSLK F  +K+NG+ AKL+T
Sbjct  249   QFSKVPVDRISQVVIKSAEKLFGRQALKHENLEKYFEAKVPSLKEFCREKVNGDDAKLTT  308

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
             + LL +V+Q L+RHEF +NH DWI+ V P++DP + +QL +  E+ D EI+  +AVRN+M
Sbjct  309   SMLLANVMQLLQRHEFLQNHGDWINTVNPSIDPAVYSQLCKTPELTDEEIENLNAVRNQM  368

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R A+  LLKDDGILVIPT+   PPK G+KET S DY +R+     +AS+SG CQ ++PLG
Sbjct  369   RVAIGSLLKDDGILVIPTMPSVPPKLGSKETMSEDYKNRSSSLLCVASISGCCQVTVPLG  428

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSN-NAISKEASAEIAK  1669
              HDKCP+SVS +AR+GGDRFLLD VQ ++A LQE + + V  KSS+ N IS+E SAEIAK
Sbjct  429   KHDKCPVSVSLIARHGGDRFLLDTVQKMYASLQENSSLIVNPKSSSVNTISQEESAEIAK  488

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGNQAFKEKQWQ+AIG Y+EAIKL   + TY+SNRAAAYLELGS+ QAE DCTKA+ LD
Sbjct  489   VKGNQAFKEKQWQKAIGMYSEAIKLNDKNGTYYSNRAAAYLELGSYRQAEGDCTKALTLD  548

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KKN+KAY RRGTAREMLG + +AI+DF YALVLEP NKRAA SA+RL K+F
Sbjct  549   KKNIKAYLRRGTAREMLGNFKEAIDDFSYALVLEPNNKRAALSADRLRKVF  599



>ref|XP_009147958.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Brassica 
rapa]
Length=601

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/591 (65%), Positives = 472/591 (80%), Gaps = 4/591 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             +AS+++NLWVLLGLG+AG L++T+KLKK V+ D GAF+E+L LLPPPQP PPKAPHPLT 
Sbjct  9     LASRASNLWVLLGLGIAGALLITKKLKKRVREDFGAFIEKLLLLPPPQPSPPKAPHPLTA  68

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F ++G+V+GFG+P+W +THE A  TS VV+ LVE GATCV KT+V + AF I
Sbjct  69    LSFAVSDLFDVKGYVSGFGHPEWIRTHEAAASTSPVVSVLVEGGATCVGKTVVGEFAFSI  128

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG  KHYD PTNPA+ +R+PGG  SGAAVAVAANLVDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  129   SGETKHYDTPTNPAAPARIPGGSCSGAAVAVAANLVDFALGIDTVGGVRVPAGYCGVLGF  188

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G VS+ GIIPVS SLD VGWF RDP+ LRRVGHV+LQ+PF AQRNPR I++A+D  
Sbjct  189   RSSQGIVSNAGIIPVSSSLDAVGWFARDPNTLRRVGHVILQLPFAAQRNPRQIILADDYL  248

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGE-AKLST  1132
                 +P DR SQVVIK+ EK FGRQ ++HENL+ Y   KVPSLK F   K NG+ AKL+T
Sbjct  249   HLSKVPVDRISQVVIKSAEKLFGRQALKHENLEKYFEAKVPSLKEFCRGKANGDDAKLTT  308

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
             + LL +V+Q L+RHEF +NH DWI+ V P++DP + +QL +  E+ D EI+  +AVRN+M
Sbjct  309   SMLLANVMQLLQRHEFLQNHGDWINTVNPSIDPAVYSQLCKTPELTDEEIENLNAVRNQM  368

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R A+  LLKDDGILVIPT+   PPK G+KET S DY +R+     +AS+SG CQ ++PLG
Sbjct  369   RVAIGSLLKDDGILVIPTMPSVPPKLGSKETMSEDYKNRSSSLLCVASISGCCQVTVPLG  428

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSN-NAISKEASAEIAK  1669
              HDKCP+SVS +AR+GGDRFLLD VQ ++A LQE + + +  KSS+ N IS+E SAEIAK
Sbjct  429   KHDKCPVSVSLIARHGGDRFLLDTVQKMYASLQENSSLIINPKSSSINTISQEESAEIAK  488

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGNQAFKEKQWQ+AIG Y+EAIKL   + TY+SNRAAAYLELGS+ QAEADCTKA+ LD
Sbjct  489   EKGNQAFKEKQWQKAIGMYSEAIKLNDKNGTYYSNRAAAYLELGSYRQAEADCTKALTLD  548

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KKN+KAY RRGTAREMLG + +AI+DF Y+LVLEP NKRAA SA+RL K+F
Sbjct  549   KKNIKAYLRRGTAREMLGNFKEAIDDFSYSLVLEPNNKRAALSADRLRKVF  599



>ref|NP_188424.2| translocon at the outer membrane of chloroplasts 64-III [Arabidopsis 
thaliana]
 sp|Q9LVH5.1|OE64C_ARATH RecName: Full=Outer envelope protein 64, chloroplastic; AltName: 
Full=Translocon at the outer membrane of chloroplasts 64-III 
[Arabidopsis thaliana]
 dbj|BAB02718.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76030.1| translocon at the outer membrane of chloroplasts 64-III [Arabidopsis 
thaliana]
Length=589

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/588 (67%), Positives = 470/588 (80%), Gaps = 2/588 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++T+KLKK V+ D GAF+++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF I G+VTGFG+PDW +THE A+ TS VV+ LVE GATCV KT+VD+ AF I
Sbjct  61    LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ +R+PGG  SGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S+GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLLQ+PF  QRNPR I++A+D F
Sbjct  181   KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA--KLSTT  1135
             Q L IP DR +QVV K+ EK FGRQ+++H+NL+ Y   KVPSLK F +    A  K+ST+
Sbjct  241   QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L+RHEF +NH DWI+ VKP +DP+I +Q+ E  E+ + E +  +A+RNE R
Sbjct  301   RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A+  LLKDDGILVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG 
Sbjct  361   VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCPISVSF+ R+GGDRFLLD VQ ++  LQE + I    KSS  AI+KE SAEIAK K
Sbjct  421   HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEK WQ+AIG Y+EAIKL  N+ATY+SNRAAAYLELG F+QAE DCTKAI LDKK
Sbjct  481   GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKL  1999
             NVKAY RRGTAREMLG    AIEDFRYALVLEP NKRA+ SAERL K 
Sbjct  541   NVKAYLRRGTAREMLGDCKGAIEDFRYALVLEPNNKRASLSAERLRKF  588



>emb|CDX95800.1| BnaC05g35510D [Brassica napus]
Length=765

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/602 (64%), Positives = 476/602 (79%), Gaps = 2/602 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS ++NLWVLLGLG+AGIL+  +KLKK ++ D GAFV++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHASNLWVLLGLGIAGILLAAKKLKKTIREDFGAFVDKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SDVF + G+VTGFG+PDW KTHE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LSFAISDVFDVTGYVTGFGHPDWVKTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY++PTNPA+  R+PGG  SGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYESPTNPAAHDRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF  QRNPR I++A+D F
Sbjct  181   KSSHGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATQRNPRQIIVADDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA--KLSTT  1135
             Q L IP DR +QVV K+ EK FGRQ ++H+NL++Y  +KVPSLK F +    A  K  T+
Sbjct  241   QLLKIPVDRITQVVTKSAEKLFGRQSLKHQNLESYFESKVPSLKEFTRTKAIANTKAPTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L+RHEF ++H DWI+ VKP +DP+I++Q+ E  E+ + EI+  +A+RN+ R
Sbjct  301   RLLANVMQLLQRHEFLQDHGDWINTVKPAIDPVISSQVCENAELTNEEIENLNAIRNQTR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDGILVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG 
Sbjct  361   VAINSLLKDDGILVIPTMPTLPPKLGSKEIISEDYQNRASSLLSVASISGCCQVTVPLGR  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+ R+GGDRFLLD VQ ++A LQE + I    KSS   IS+E SAEIAK K
Sbjct  421   HEKCPVSVSFIGRHGGDRFLLDTVQTMYASLQENSSIVTDPKSSKKTISQEESAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AIG Y+EAIKL  N+ATY+SNRAAAYLE+GSF+ AE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWQKAIGLYSEAIKLNENNATYYSNRAAAYLEIGSFLLAEEDCTKAIALDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH*VIKT*LGSL  2035
             NVKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+ SAERL K  +    T  GSL
Sbjct  541   NVKAYLRRGTAREMLGEYREAMDDFRHALVLEPNNKRASLSAERLRKKINQREMTTAGSL  600

Query  2036  IH  2041
             ++
Sbjct  601   MN  602



>ref|XP_002317872.2| Toc64 family protein [Populus trichocarpa]
 gb|EEE96092.2| Toc64 family protein [Populus trichocarpa]
Length=593

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/590 (64%), Positives = 477/590 (81%), Gaps = 4/590 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAV-KADSGAFVERlqllpppqppppkaphplT  418
             MAS SANLWVLLGLGLAGIL+MT+K KK++ + D GAF+E+L L+PPPQPPPPKAPHPLT
Sbjct  1     MASNSANLWVLLGLGLAGILLMTKKFKKSIIRQDFGAFIEKLLLVPPPQPPPPKAPHPLT  60

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
              L+FAVSD+F IEG+V+GFG+P+WAKTH+ A++TS VV+ LV+ GATCV KT++D++A+ 
Sbjct  61    ALTFAVSDLFEIEGYVSGFGHPEWAKTHQAASRTSLVVSTLVDGGATCVGKTVIDELAYS  120

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I G NKHY  P NP   +R+PGG  SGAAVAVAANLVDFSLG+DT GGVRVPAG+CG++G
Sbjct  121   IHGENKHYGTPINPVVPARVPGGSCSGAAVAVAANLVDFSLGVDTVGGVRVPAGFCGVIG  180

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS+GA+S  G++PVS SLD VGWF +DP++LRRVGHVLLQ  F  QR+PR I++A D 
Sbjct  181   FRPSYGAISKTGVLPVSASLDTVGWFAKDPNILRRVGHVLLQPAFGGQRSPRQIIMAEDC  240

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLST  1132
             FQ L IP DR +QVV+ + EK FGRQ+++HE LD YL++KVPSLK F  KK NG+ K S+
Sbjct  241   FQLLKIPVDRVAQVVVNSTEKHFGRQVLKHEILDVYLNSKVPSLKEFHNKKKNGDVKTSS  300

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
              RLL +V+Q L R+EF+ NH++WI+  KP L+P  +AQ++E +++++ EI+ C ++R EM
Sbjct  301   IRLLAYVMQLLHRYEFRSNHEEWINTEKPILEPDFSAQMNEIMKISEAEIELCKSIREEM  360

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R A++ LLKDDGILV+PT+   PPK   KE  S +Y S +    S+ASLSG CQ ++PLG
Sbjct  361   RLAINSLLKDDGILVVPTMAYLPPKLDGKEILSEEYKSSSFSLLSIASLSGCCQVTVPLG  420

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
             ++DKCP+SVS +AR+G DRFLLD +Q ++A LQEQAE  V+SKS N   S E SAE+AK 
Sbjct  421   YYDKCPVSVSLIARHGNDRFLLDTLQTMYASLQEQAETHVKSKSRNTD-SGENSAEMAKE  479

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQAFKEKQW++AI +Y EAIKL   +ATY+SNRAAAYLELGSF QAEADC+KAI LDK
Sbjct  480   KGNQAFKEKQWKKAISYYNEAIKLNDKNATYYSNRAAAYLELGSFHQAEADCSKAINLDK  539

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KNVKAY RRGTAREMLGYY  AIEDF+YALVLEPTNKRA+ SAERL K+F
Sbjct  540   KNVKAYLRRGTAREMLGYYKDAIEDFKYALVLEPTNKRASLSAERLRKVF  589



>emb|CDY51926.1| BnaAnng11030D [Brassica napus]
Length=591

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/589 (64%), Positives = 473/589 (80%), Gaps = 2/589 (0%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S ++NLWVLLGLG+AGIL+  +KLKK ++ D GAF+++L LLPPP PPPPKAPHPLT L
Sbjct  3     SSHASNLWVLLGLGIAGILLAAKKLKKTIRQDLGAFIDKLLLLPPPPPPPPKAPHPLTAL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
             SFA+SD+F + G+VTGFG+PDW +THEPA+ T  VV+ LVE GATCV KT+VD++AF IS
Sbjct  63    SFAISDLFDVTGYVTGFGHPDWVRTHEPASSTCPVVSTLVEGGATCVGKTVVDELAFSIS  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G  KHY++PTNPA+  R+PGG SSGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF 
Sbjct  123   GETKHYESPTNPAAHDRIPGGASSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGFK  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
              S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF   RNPR I++A+D FQ
Sbjct  183   SSHGAISNAGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATPRNPRQIILADDYFQ  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTTR  1138
              L IP DR +QVVIK+ EK FG+Q+++H+NL+ Y  +KVPSLK + +       K+ T+R
Sbjct  243   LLKIPVDRITQVVIKSAEKLFGKQLLKHQNLENYFESKVPSLKEYARTKAISSTKVPTSR  302

Query  1139  LLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRS  1318
             LL +V+Q L+RHEF +NH DWI+ VKP +DP+I++QL E  ++ + EI+  + VRN+ R+
Sbjct  303   LLANVMQLLQRHEFLQNHGDWINTVKPAIDPVISSQLSENSKLTNEEIENLNTVRNQTRA  362

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             A++ LLKDDGILVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG+H
Sbjct  363   AINSLLKDDGILVIPTMPTIPPKLGSKEIISEDYQNRASSLLSIASISGCCQVTVPLGYH  422

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             +KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + +    KSS   IS+E SAE+AK KG
Sbjct  423   EKCPVSVSFIARHGGDRFLLDTVQTMYASLQENSSVIADPKSSKKTISQEESAEMAKEKG  482

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             NQAFKEKQWQ+AIG Y+EAIKL  ++ TY++NRAAAYLE+GSF+QAE DCTKAI LDKKN
Sbjct  483   NQAFKEKQWQKAIGLYSEAIKLNDSNGTYYNNRAAAYLEIGSFLQAEEDCTKAITLDKKN  542

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             VKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+QSAERL KLF 
Sbjct  543   VKAYLRRGTAREMLGVYKEAMDDFRHALVLEPNNKRASQSAERLRKLFQ  591



>ref|XP_010487707.1| PREDICTED: outer envelope protein 64, chloroplastic [Camelina 
sativa]
Length=588

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/587 (66%), Positives = 468/587 (80%), Gaps = 0/587 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++++KLKK V+ D GAF+++L LLPPP P PPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILMISKKLKKTVREDFGAFLDKLLLLPPPPPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F I G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LTFAVSDLFDITGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ SR+PGG  SGAAVAVA   VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPSRIPGGACSGAAVAVATKAVDFALGIDTAGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP  L RVGHVLLQ+PF  QRNPR I++A+D F
Sbjct  181   KSSHGAISNTGIIPVSSSLDSVGWFARDPITLHRVGHVLLQLPFATQRNPRQIILADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             Q L IP DR +QVVIK+ EK FGRQ+++H+N + Y+  KVPSLK F +    AK+ T+RL
Sbjct  241   QLLKIPVDRITQVVIKSAEKLFGRQLLKHQNFENYIETKVPSLKEFARTKAVAKVPTSRL  300

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
             L +V+Q L+RHEF +NH DWI+ VKP +DP+I++Q+ E  E+   EI+  +A+RNE+R A
Sbjct  301   LANVMQLLQRHEFLQNHGDWINTVKPAIDPVISSQICENPELTSEEIENFNAIRNEIRVA  360

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +  LLKDDGILV+PT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG H+
Sbjct  361   IGSLLKDDGILVVPTMPSVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGHHE  420

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP+SVSF+AR+GGDRFLLD V+ ++A LQE + I    KSS   I++E  AEIAK KGN
Sbjct  421   KCPVSVSFIARHGGDRFLLDTVRTMYASLQEYSSIVADPKSSKKTITQEELAEIAKEKGN  480

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
             QAFKEK WQ+AIG Y+EAIKL   +ATY+SNRAAAYLE+G F+QAE DCTKAI LDKKNV
Sbjct  481   QAFKEKHWQKAIGLYSEAIKLSDKTATYYSNRAAAYLEVGGFLQAEEDCTKAITLDKKNV  540

Query  1862  KAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KAY RRGTAREML  Y  AIEDFRYALVLEP NKRAA SAERL K+F
Sbjct  541   KAYLRRGTAREMLSDYKGAIEDFRYALVLEPNNKRAALSAERLRKVF  587



>ref|XP_010465870.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Camelina 
sativa]
Length=588

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/587 (66%), Positives = 467/587 (80%), Gaps = 0/587 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++++KLKK V+ D GAF+++L LLPPP PPPPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILMISKKLKKTVREDFGAFLDKLLLLPPPPPPPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F I G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LTFAVSDLFDISGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ SR+PGG  SGAAVAVA   VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPSRVPGGACSGAAVAVATKAVDFALGIDTAGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP  L RVGHVLLQ+PF  QRNPR I++A+D F
Sbjct  181   KSSHGAISNTGIIPVSSSLDSVGWFARDPITLHRVGHVLLQLPFATQRNPRQIILADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             Q L IP DR +QVVIK+ EK FGRQ+++H+N + Y+  KVPSLK F +     K+ T+RL
Sbjct  241   QLLKIPVDRITQVVIKSAEKLFGRQLLKHQNFENYIETKVPSLKEFARTKAVDKVPTSRL  300

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
             L +V+Q L+RHEF +NH DWI+ VKP +DP+I++Q+ E  E+   EI+  +A+RNE+R A
Sbjct  301   LANVMQLLQRHEFLQNHGDWINTVKPAIDPVISSQICENPELTSEEIENLNAIRNEIRVA  360

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +  LLKDDGILV+PT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG H+
Sbjct  361   IGSLLKDDGILVVPTMPSVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTLPLGHHE  420

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP+SVSF+AR+GGDRFLLD V+ ++A LQE + I    KSS   I +E  AEIAK KGN
Sbjct  421   KCPVSVSFIARHGGDRFLLDTVRTMYASLQEYSSIVADPKSSKKTIRQEELAEIAKEKGN  480

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
             QAFKEKQWQ+AIG Y+EAIKL   +ATY+ NRAAAYLE+G F+QAE DCTKAI LDKKNV
Sbjct  481   QAFKEKQWQKAIGLYSEAIKLSDKTATYYGNRAAAYLEVGGFLQAEEDCTKAITLDKKNV  540

Query  1862  KAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             KAY RRGTAREML  Y  AIEDFRYALVLEP NKRAA SAERL K+F
Sbjct  541   KAYLRRGTAREMLSDYKGAIEDFRYALVLEPNNKRAALSAERLRKVF  587



>emb|CDX75952.1| BnaC03g40350D [Brassica napus]
Length=590

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/590 (64%), Positives = 468/590 (79%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS ++NLWVLLGLG+AGIL+  +KLKK ++ D GAF+E+L LLPPP P PPKAPHPLTG
Sbjct  1     MASHASNLWVLLGLGIAGILLAAKKLKKTIREDFGAFIEKLLLLPPPPPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SD+F + G+VTGFG+PDW  THEPA+ TS VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LSFAISDLFDVTGYVTGFGHPDWVGTHEPASSTSPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG  KHY++PTNPA+  R+PGG SSGAAVAVA + VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGETKHYESPTNPAAHDRIPGGASSGAAVAVATSAVDFALGIDTVGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF   RNPR I++A+D F
Sbjct  181   KSSHGAISNAGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATPRNPRQIILADDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTT  1135
             Q   IP DR +QVVIK+ EK FGRQ+++H+NL+ Y  +KVPSLK F +       K+ T+
Sbjct  241   QLQKIPVDRITQVVIKSAEKLFGRQLLKHQNLENYFESKVPSLKEFARTKAITSTKVPTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q  +RHEF +NH DWI  VK  +DP+I++QL E  E+ + EI+  +A+RN+ R
Sbjct  301   RLLANVMQLFQRHEFLQNHGDWIKTVKQAIDPVISSQLSETPELTNEEIENLNAIRNQAR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +A++ LLKDDGILVIPTV   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG 
Sbjct  361   AAINSLLKDDGILVIPTVPTLPPKLGSKEILSEDYQNRASSLLSIASISGCCQVTVPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + +    KSS   IS   SAE+AK K
Sbjct  421   HEKCPVSVSFIARHGGDRFLLDTVQTMYASLQENSSVISDPKSSKKTISLGESAEMAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AIG Y+EAIKL  ++ TY++NRAAAYLE+GSF+QAE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWQKAIGLYSEAIKLSDSNGTYYNNRAAAYLEIGSFLQAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+QSAERL KLF 
Sbjct  541   NVKAYLRRGTAREMLGVYKEAMDDFRHALVLEPNNKRASQSAERLRKLFQ  590



>emb|CDY40591.1| BnaC06g02070D [Brassica napus]
Length=600

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/568 (65%), Positives = 447/568 (79%), Gaps = 3/568 (1%)
 Frame = +2

Query  308   TRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPD  487
             T+KLKK V+ D GAF+E+L LLPPPQP PPKAPHPLT LSFA+SD+F ++G+V+GFG+PD
Sbjct  31    TKKLKKRVREDFGAFIEKLLLLPPPQPAPPKAPHPLTALSFALSDLFDVKGYVSGFGHPD  90

Query  488   WAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpgg  667
             W +THE A  TS VV+ LVE GATCV KT+V + AF ISG  KHYD PTNPA+ + +PGG
Sbjct  91    WIRTHEAAASTSPVVSVLVEGGATCVGKTVVGEFAFSISGETKHYDTPTNPAAPAHIPGG  150

Query  668   pssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVV  847
               SGAAVAV+ANLVDFSLGIDT GGVR  AGYCG+LGF  S G VS+ GIIPVS SLD V
Sbjct  151   ACSGAAVAVSANLVDFSLGIDTVGGVRAAAGYCGVLGFRSSQGIVSNAGIIPVSSSLDAV  210

Query  848   GWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQF  1027
             GWF RDP+ LRRVGHV+LQ+PF AQRNPR I++A+D  Q   +P DR  QVVIK+ EK F
Sbjct  211   GWFARDPNTLRRVGHVILQLPFEAQRNPRQIILADDYLQFSKVPVDRIKQVVIKSAEKLF  270

Query  1028  GRQMIRHENLDAYLSNKVPSLKSF--KKLNGE-AKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
             GRQ ++HENL+ YL  KVPSLK F  +K NG+ AKL+T+ LL +V+Q L+RHEF +NH D
Sbjct  271   GRQALKHENLEKYLEAKVPSLKEFCREKANGDDAKLTTSMLLANVMQLLQRHEFLQNHGD  330

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             WI+ V P++DP + +QL +  E+ D  I+  +AVRN+MR A+  LLKDDGILVIPT+   
Sbjct  331   WINTVNPSIDPAVYSQLCKTPELTDEVIENLNAVRNQMRVAIGSLLKDDGILVIPTMPSV  390

Query  1379  PPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLL  1558
             PPK G+KE  S DY +RA     +AS+SG CQ ++PLG HDKCP+SVS +AR+GGDRFLL
Sbjct  391   PPKLGSKEIMSEDYQNRASSLLCVASISGCCQVTVPLGKHDKCPVSVSLIARHGGDRFLL  450

Query  1559  DAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
             D VQ ++A LQE + + V  KSS N IS+E SAEIAK KGNQAFKEKQWQ+AIG Y+EAI
Sbjct  451   DTVQKMYASLQENSTLMVNPKSSINTISQEESAEIAKEKGNQAFKEKQWQKAIGMYSEAI  510

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             KL   + TY+SNRAAAYLELGSF QAEADCTKA+ LDKKN+KAY RRGTAREMLG + +A
Sbjct  511   KLNDENGTYYSNRAAAYLELGSFRQAEADCTKALALDKKNIKAYLRRGTAREMLGNFKEA  570

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             I+DF YALVLEP NKRAA SA+RL K+F
Sbjct  571   IDDFSYALVLEPNNKRAALSADRLGKVF  598



>ref|XP_009145949.1| PREDICTED: outer envelope protein 64, chloroplastic [Brassica 
rapa]
Length=590

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/590 (64%), Positives = 470/590 (80%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS ++NLWVLLGLG+AGIL+  +KLKK ++ D GAF+++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHASNLWVLLGLGIAGILLAAKKLKKTIREDFGAFIDKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SDVF + G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD+++F I
Sbjct  61    LSFAISDVFDVTGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELSFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY++PTNPA+  R+PGG  SGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYESPTNPAAHDRIPGGACSGAAVAVATNAVDFALGIDTIGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF  QRNPR I++A+D F
Sbjct  181   KSSHGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATQRNPRQIIVADDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA--KLSTT  1135
             Q L IP DR +QVV K+ EK FG+Q ++H++L+ Y  +KVPSLK F +    A  K+ T+
Sbjct  241   QLLKIPVDRITQVVTKSAEKLFGKQSLKHQSLENYFESKVPSLKEFTRTKAIANTKVPTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L+RHEF +NH DWI+ VKP + P+I++Q+ +  E+ + EI+  + +RN+ R
Sbjct  301   RLLANVMQLLQRHEFLQNHGDWINTVKPAIGPVISSQVCDNAELTNEEIENLNTIRNQTR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG 
Sbjct  361   VAINSLLKDDGVLVIPTMPTLPPKLGSKEIISEDYQNRASSLLSIASISGCCQVTVPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + I    KSS   IS+E SAEIAK K
Sbjct  421   HEKCPVSVSFIARHGGDRFLLDTVQTMYASLQENSSIVADPKSSKKTISQEESAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AIG Y+EAIKL  N+ATY+SNRAAAYLE+GSF+ AE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWQKAIGLYSEAIKLSENNATYYSNRAAAYLEIGSFLLAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+ SAERL K+F 
Sbjct  541   NVKAYLRRGTAREMLGEYKEAMDDFRHALVLEPNNKRASLSAERLRKVFQ  590



>ref|XP_010506209.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Camelina 
sativa]
Length=588

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/588 (65%), Positives = 464/588 (79%), Gaps = 0/588 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQ+ANLWVLLGLGLAGIL++++KLKK V+ D GAF+++L LLPPP P PPKAPHPLTG
Sbjct  1     MASQAANLWVLLGLGLAGILMISKKLKKTVREDFGAFLDKLLLLPPPPPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSD+F I G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LTFAVSDLFDITGYVTGFGHPDWVRTHEAASSTCPVVSILVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ SR+PGG  SGAAVAVA   VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPSRIPGGACSGAAVAVATKAVDFALGIDTAGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S G +S+ GIIP S SLD VGWF RDP  L RVGHVLLQ+PF  QRNPR I++A+D F
Sbjct  181   KSSHGTISNTGIIPASSSLDSVGWFARDPITLHRVGHVLLQLPFATQRNPRQIILADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             Q L IP DR +QVVIK+ EK FGRQ+++H+N + Y+  KVPSLK F +    AK+ T+RL
Sbjct  241   QLLKIPVDRITQVVIKSAEKLFGRQLLKHQNFENYIETKVPSLKEFARTKAVAKVPTSRL  300

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
             L + +  L+RHEF +NH DWI+ VKP +DP+I++Q+ E  E+   +I+  +A+RNE+R A
Sbjct  301   LANAMLLLQRHEFLQNHGDWINTVKPAIDPVISSQMCENPELTSEDIENLNAIRNEIRVA  360

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +  LLKDDGILV+PT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG H+
Sbjct  361   IGSLLKDDGILVVPTMPSVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGHHE  420

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP+SVSF+AR+GGDRFLLD VQ ++  LQE + I    KSS   I++E  AEIAK KGN
Sbjct  421   KCPVSVSFIARHGGDRFLLDTVQTMYKSLQEYSGIVADPKSSKKTITQEELAEIAKEKGN  480

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
             QAFKEKQWQ+AIG Y+EAIKL   +ATY+SNRAAAYLE+G F+QAE DCTKAI LDKKNV
Sbjct  481   QAFKEKQWQKAIGLYSEAIKLSDKTATYYSNRAAAYLEVGGFLQAEEDCTKAITLDKKNV  540

Query  1862  KAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KAY RRGTAREMLG Y  AIEDFRYALVLEP NKRAA SAERL K F 
Sbjct  541   KAYLRRGTAREMLGDYKGAIEDFRYALVLEPNNKRAALSAERLRKAFQ  588



>gb|KFK39126.1| hypothetical protein AALP_AA3G204300 [Arabis alpina]
Length=590

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/590 (66%), Positives = 471/590 (80%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS +ANLWVLLGLG+AGIL+ T+KLKK ++ D GAF+++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHAANLWVLLGLGIAGILLATKKLKKTIREDFGAFIDKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F I+G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LSFAVSDLFDIQGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD+PTNPA+ SR+PGG  SGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYDSPTNPAAPSRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GAVS+ GIIPVS SLD VGWF RDP  LRRVGHVLLQ+PF  QRNPR I++A D F
Sbjct  181   KFSHGAVSNTGIIPVSSSLDSVGWFARDPTTLRRVGHVLLQLPFATQRNPRQIILAGDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTT  1135
             Q L IP DR +QVVIK+ EK FGRQ+++H+NL++Y   KVPSLK     K +    + T+
Sbjct  241   QLLKIPVDRITQVVIKSAEKLFGRQLLKHQNLESYFEAKVPSLKELTRAKASDNTNVPTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +VVQ L+RHEF +NH DWI+ VKP +DP+I++Q+ E  E+ + E++  +A+RN+MR
Sbjct  301   RLLANVVQLLQRHEFLKNHGDWINTVKPAIDPVISSQVCENPELTNEEVENLNAIRNQMR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A+  LLKDDGILV+PT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG+
Sbjct  361   VAIGSLLKDDGILVVPTMPVVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGY  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+AR+GGDRFLLD VQ ++A LQEQ+ I    KSS   IS+E  AEIAK K
Sbjct  421   HEKCPVSVSFIARHGGDRFLLDTVQTMYATLQEQSTIVADPKSSKKTISQEELAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQW +AI  Y++AIKL   +ATY+SNRAAAYL LGSFV AE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWPKAITLYSDAIKLSDKNATYYSNRAAAYLALGSFVLAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLGYY +AI+DF+YALVLEP NKRAA SA+RL K F 
Sbjct  541   NVKAYLRRGTAREMLGYYKEAIDDFKYALVLEPNNKRAALSAQRLQKDFQ  590



>ref|XP_006297201.1| hypothetical protein CARUB_v10013209mg [Capsella rubella]
 gb|EOA30099.1| hypothetical protein CARUB_v10013209mg [Capsella rubella]
Length=629

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/592 (65%), Positives = 469/592 (79%), Gaps = 5/592 (1%)
 Frame = +2

Query  236   SSMASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphpl  415
             SSMASQ+ANLWVLLGLGLAGIL++T+KL+K V+ D GAF+++L LLPPPQP PPKAPHPL
Sbjct  41    SSMASQAANLWVLLGLGLAGILMITKKLQKTVREDFGAFIDKLLLLPPPQPAPPKAPHPL  100

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL+FA+SD+F I G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF
Sbjct  101   TGLTFALSDLFDITGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAF  160

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              ISG NKHYD+PTNPA+ +R+PGG  SGAAVAVA   VDF+LGIDT GGVRVPAGYCG+L
Sbjct  161   SISGENKHYDSPTNPAAPARIPGGACSGAAVAVATKAVDFALGIDTVGGVRVPAGYCGVL  220

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF  S GA+S+ GIIPVS SLD VGWF  DP  LRRVGHVLLQ+PF  QRNPR I++A+D
Sbjct  221   GFKSSHGAISNTGIIPVSSSLDSVGWFAHDPSTLRRVGHVLLQLPFATQRNPRQIILADD  280

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA--KLS  1129
              FQ L IP DR +QVVIK+ EK FGRQ+++H+NL+ +   KVPSLK F +   +A  K+ 
Sbjct  281   CFQLLKIPVDRITQVVIKSAEKLFGRQLLKHQNLENHFETKVPSLKEFARTKADANTKVP  340

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             T RLL +V+Q L+RHEF  NH DWI+ V  T+DP+I++Q+ E  E+   EI+  + +RNE
Sbjct  341   TLRLLANVMQLLQRHEFLHNHGDWINTV--TIDPVISSQVRENPELTSEEIENLNLIRNE  398

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
              R A+  LLKDDGILV+PT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PL
Sbjct  399   TRVAIGLLLKDDGILVVPTMPSVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPL  458

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAK  1669
             G H+KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + I    KSS   I++E SAEIAK
Sbjct  459   GHHEKCPVSVSFIARHGGDRFLLDTVQTMYASLQENSSIVADPKSSKKTITQEESAEIAK  518

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGNQAFKEKQWQ+AIG Y+EAIKL   +ATY++NRAAAYLE+G F+QAE DCTKAI LD
Sbjct  519   EKGNQAFKEKQWQKAIGLYSEAIKLSDKNATYYNNRAAAYLEVGGFLQAEEDCTKAITLD  578

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KKNVKAY RRGTARE+ G Y  AIEDFRYALVLEP NKRAA SAERL KLF 
Sbjct  579   KKNVKAYLRRGTAREIKGDYKGAIEDFRYALVLEPNNKRAALSAERL-KLFQ  629



>emb|CDX92180.1| BnaA05g22270D [Brassica napus]
Length=798

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/590 (64%), Positives = 470/590 (80%), Gaps = 2/590 (0%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS ++NLWVLLGLG+AGIL+  +KLKK ++ D GAF+++L LLPPPQP PPKAPHPLTG
Sbjct  1     MASHASNLWVLLGLGIAGILLAAKKLKKTIREDFGAFIDKLLLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SDVF + G+VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++AF I
Sbjct  61    LSFAISDVFDVTGYVTGFGHPDWVRTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY++ TNPA+  R+PGG SSGAAVAVA N VDF+LGIDT GGVRVPAGYCG+LGF
Sbjct  121   SGENKHYESSTNPAAHDRIPGGASSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
               S GA+S+ GIIPVS SLD VGWF RDP+ LRRVGHVLL +PF  QRNPR I++A+D F
Sbjct  181   KSSQGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATQRNPRQIIVADDYF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA--KLSTT  1135
             Q L IP DR +QVV K+ EK FG+Q ++H++L+ Y+ +KVPSLK F +    A  K+ T+
Sbjct  241   QLLKIPVDRITQVVTKSAEKLFGKQSLKHQSLENYIESKVPSLKEFTRTKAIANTKVPTS  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             RLL +V+Q L+RHEF +NH DWI+ VKP + P+I++Q+ +  E+ + EI+  + +RN+ R
Sbjct  301   RLLANVMQLLQRHEFLQNHGDWINTVKPAIGPVISSQVCDNAELTNEEIENLNTIRNQTR  360

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKDDG+LVIPT+   PPK G+KE  S DY +RA    S+AS+SG CQ ++PLG 
Sbjct  361   VAINSLLKDDGVLVIPTMPTLPPKLGSKEIISEDYQNRASSLLSIASISGCCQVTVPLGH  420

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+KCP+SVSF+AR+GGDRFLLD VQ ++A LQE + I    KSS   IS E SAEIAK K
Sbjct  421   HEKCPVSVSFLARHGGDRFLLDTVQTMYASLQENSSIIADPKSSKKTISLEESAEIAKEK  480

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQAFKEKQWQ+AIG Y+EAIKL  N+ATY+SNRAAAYLE+GSF+ AE DCTKAI LDKK
Sbjct  481   GNQAFKEKQWQKAIGLYSEAIKLSENNATYYSNRAAAYLEIGSFLLAEEDCTKAITLDKK  540

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             NVKAY RRGTAREMLG Y +A++DFR+ALVLEP NKRA+ SAERL K+F 
Sbjct  541   NVKAYLRRGTAREMLGEYKEAMDDFRHALVLEPNNKRASLSAERLRKVFQ  590



>ref|XP_004503275.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like 
isoform X3 [Cicer arietinum]
Length=560

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/540 (67%), Positives = 447/540 (83%), Gaps = 1/540 (0%)
 Frame = +2

Query  239   SMASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplT  418
             SMASQS+N+WVLLGLGLAGI ++TRKLK+ VK D GAF+++LQLLPPP P PPKAPHPLT
Sbjct  3     SMASQSSNIWVLLGLGLAGIYVLTRKLKQTVKLDFGAFIQKLQLLPPPPPAPPKAPHPLT  62

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
              L+FA+SD+F IEG V+ FG+P+WA+THE A+ TS  V+ LVEAGATC+  T++D+ A+G
Sbjct  63    ALTFAISDLFDIEGHVSSFGHPEWARTHEAASSTSPSVSTLVEAGATCLGTTVLDEFAYG  122

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ISG NKH+ APTNPA  +R+PGG SSGAAV+VAAN VDFSLG+DT GGVRVPAG+CGILG
Sbjct  123   ISGENKHFGAPTNPAVPARVPGGSSSGAAVSVAANFVDFSLGVDTSGGVRVPAGFCGILG  182

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS GAVSH+GIIPVS SLD VGWF +DPDVLRRVG +LLQ PF  QR+PR I+IA+D 
Sbjct  183   FRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGLILLQAPFGMQRSPRQIIIADDC  242

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
             FQ LN+P DR+SQVVIKA EK FG+Q+++H NL+ Y+S+KVPSLK++ +K NG+ K S+ 
Sbjct  243   FQHLNVPLDRSSQVVIKATEKVFGKQVLKHINLEDYISSKVPSLKAYSQKSNGQLKSSSL  302

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             +LL  ++Q L+RHEF + HD+W+  VKP L P ++AQLHE  EV+D EI+   +VR+E+R
Sbjct  303   KLLASIMQLLQRHEFGQIHDEWMSIVKPELHPAVSAQLHEKFEVSDVEIENSKSVRSELR  362

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
              A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ +IPLGF
Sbjct  363   VAVNSLLKDEGILVIPTVADPPPKLGGKEFLSQDYQSRALSLLSIASISGCCQVTIPLGF  422

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             +DK PISVS +AR+GGDRFLLD ++ ++  LQEQA+IA  SKSS N +SKE SAEIAK K
Sbjct  423   YDKYPISVSLIARHGGDRFLLDTLKTMYTILQEQADIAATSKSSKNVVSKEQSAEIAKEK  482

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GNQA+K+KQWQ+AIGFYTEAIKL G++ATY+SNRA AYLELGS++QAEADCTKAI LDKK
Sbjct  483   GNQAYKDKQWQKAIGFYTEAIKLCGDNATYYSNRAQAYLELGSYLQAEADCTKAISLDKK  542



>ref|XP_008809807.1| PREDICTED: outer envelope protein 64, chloroplastic [Phoenix 
dactylifera]
Length=588

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/569 (64%), Positives = 455/569 (80%), Gaps = 3/569 (1%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             MTR+LK+A+K D GAFVERL+LLPPPQP PPKAPHPLTGLSFAV+D+F I G+VTGFGNP
Sbjct  21    MTRRLKRAIKQDFGAFVERLELLPPPQPAPPKAPHPLTGLSFAVADIFDINGYVTGFGNP  80

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DWAKTH+PA +TS+VV+ALV+ GATCV KT++D+MA+ I+G NKH+  PTNPA+  R+PG
Sbjct  81    DWAKTHDPAARTSSVVSALVDGGATCVGKTVIDEMAYSINGENKHFGTPTNPAAVERIPG  140

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVA+ LVDFSLG+DT GGVR+P G+CGIL F PS  AVS++G+IPVS SLD 
Sbjct  141   GCSSGSAVAVASGLVDFSLGVDTIGGVRIPGGFCGILAFRPSHAAVSNIGVIPVSPSLDT  200

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VG F +DP +LRRV H+LLQ+P+   R PR+++IA+D F+ L IP  R +QVVIK+ EK 
Sbjct  201   VGLFAKDPSILRRVSHILLQLPYADHRQPRHMIIADDCFELLKIPNSRATQVVIKSTEKL  260

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
             FGRQ++ H NL  YL++K+ SLK  +  K +G++K +   L  + ++ L +HEFK NH+ 
Sbjct  261   FGRQLLNHVNLGEYLASKISSLKQLQNGKKSGDSKTALLSL-ANAMRLLYKHEFKNNHER  319

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             WI+ VKP LDP I A +   L+ +D  I+ CH  RNE R AL+ LLKDDGILV+PTV+  
Sbjct  320   WINSVKPVLDPSILADMSSSLDDSDAHIEYCHYARNETRLALNALLKDDGILVLPTVLGA  379

Query  1379  PPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLL  1558
             PPK  AKE  S +Y SRA   +++AS+SG CQA+IP+GFH+KCP+SVSF+AR+GGDRFLL
Sbjct  380   PPKLNAKEISSSNYQSRALCLSAIASMSGCCQATIPIGFHEKCPVSVSFIARHGGDRFLL  439

Query  1559  DAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
             D VQ +FA LQEQ +  ++SKSS+++ISKE SAEIAK KGN A+KEKQWQ+A+  YTEAI
Sbjct  440   DTVQTMFASLQEQVDEVMKSKSSSSSISKEESAEIAKEKGNIAYKEKQWQKAVNLYTEAI  499

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             KL   +ATY+SNRAAAYLELGS++QAEADC+ AI LDKKNVKAY RRGTAREMLGYY +A
Sbjct  500   KLSEKNATYYSNRAAAYLELGSYLQAEADCSAAISLDKKNVKAYLRRGTAREMLGYYKEA  559

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             IEDF+YALVLEPTNK A  +A RL KLF 
Sbjct  560   IEDFKYALVLEPTNKTAILAASRLKKLFQ  588



>gb|KDO63833.1| hypothetical protein CISIN_1g008025mg [Citrus sinensis]
Length=573

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/538 (68%), Positives = 445/538 (83%), Gaps = 8/538 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL+MT+KLKK +K D GAF+E+LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+F IEG+VTGFG+P+WA+TH  A++TSTVV+ LVE GATC+ KT+VD+ A+ I
Sbjct  61    LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHYD PTNPA+ S++PGG SSGAAVAVAA+LVDFSLGIDT GGVRVP+ +CGILGF
Sbjct  121   NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS+GAVSHMGIIP+S SLD VGWF RDP +LR VGHVLLQ+PF AQR+PR I+IA+D F
Sbjct  181   RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL  1141
             + L IP DR  QVVIK+ EK FGRQ+++HENL  Y  +KVPSLK F K NGE K      
Sbjct  241   ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELK------  294

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
               +V++ ++R+EFK NH++WI+ VKP LDP I+A++ E LE+++T I+ C ++RNEMRSA
Sbjct  295   --NVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSA  352

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             +S LLKDDGILV PT   PPPK G KE  S DY +RA    S+AS+SG CQ ++PLG++D
Sbjct  353   ISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYD  412

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP SVSF+AR+GGDRFLLD VQ ++A LQEQA+IA +SK S N  +++ SAEIAK KGN
Sbjct  413   KCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGN  472

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             QA+K+KQW +AI FYTEAIKL GN+ATY+SNRAAAYLE GSF+QAEADCTKAI LDKK
Sbjct  473   QAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK  530



>ref|XP_010916516.1| PREDICTED: outer envelope protein 64, chloroplastic [Elaeis guineensis]
Length=588

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/588 (63%), Positives = 467/588 (79%), Gaps = 3/588 (1%)
 Frame = +2

Query  248   SQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLS  427
             S S N+WVLLGLGLAG+L+MTR+LK+A+K D GAFVERL+LLPPPQP PPKAPHPLTGLS
Sbjct  2     SSSTNIWVLLGLGLAGVLLMTRRLKRAIKQDFGAFVERLELLPPPQPAPPKAPHPLTGLS  61

Query  428   FAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISG  607
             FAV+D+F I G VTGFGNPDWAKTH+PA +TS+VV+ALV+ GATCV KT++D+MA+ I+G
Sbjct  62    FAVADIFDINGCVTGFGNPDWAKTHDPAARTSSVVSALVDGGATCVGKTVIDEMAYSING  121

Query  608   ANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHP  787
              NKH+  PTNPA+  R+PGG SSG+AVAVA+ LVDFSLG+DT GGVR+P G+CGIL F P
Sbjct  122   ENKHFGTPTNPAALERIPGGCSSGSAVAVASGLVDFSLGVDTIGGVRIPGGFCGILAFRP  181

Query  788   SFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQS  967
             S  AVS++G+IPVS SLD VG F +DP +LRRV H+LLQ+P+   R PR+++IA+D F+ 
Sbjct  182   SHAAVSNIGVIPVSPSLDTVGLFAKDPSILRRVSHILLQLPYADHRQPRHMIIADDCFEL  241

Query  968   LNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRL  1141
             L IP  R +QVVIK+ EK FGRQ++ H NL  YL++K+ SLK  +  K +G++K +   L
Sbjct  242   LKIPKSRVTQVVIKSTEKLFGRQLLNHVNLGEYLASKISSLKQLQNGKKSGDSKAALLSL  301

Query  1142  LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSA  1321
               + ++ L + EFK NH+ WI+ VKP LDP I A +   L+ +D  I+ CH  RNE R A
Sbjct  302   -ANAMRLLYKREFKNNHERWINSVKPVLDPSILADISSSLDDSDAHIEYCHYARNETRLA  360

Query  1322  LSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHD  1501
             L+ LLKDDGI+V+PTV+  PPK  AKE  S DY S     +++AS+SG CQ +IP+G+H+
Sbjct  361   LNALLKDDGIIVLPTVLGAPPKLNAKEISSEDYQSHTLCLSAIASMSGCCQVTIPIGYHE  420

Query  1502  KCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGN  1681
             KCP+SVSF+AR+GGDRFLLD VQ +FA LQEQ +  ++SKSS+++ISKE SAEIAK KGN
Sbjct  421   KCPVSVSFIARHGGDRFLLDTVQTMFASLQEQVDEVMKSKSSSSSISKEESAEIAKEKGN  480

Query  1682  QAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNV  1861
              A+KEKQWQ+A+  YTEAIKL   +ATY+SNRAAAYLELGS++QAEADC+ AI LDKKNV
Sbjct  481   IAYKEKQWQKAVNLYTEAIKLSEKNATYYSNRAAAYLELGSYLQAEADCSAAISLDKKNV  540

Query  1862  KAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KAY RRGTAREMLGYY +AIEDF+YALVLEPTNK A  +A RL KLF 
Sbjct  541   KAYLRRGTAREMLGYYKEAIEDFKYALVLEPTNKTALLAASRLKKLFQ  588



>ref|XP_009409633.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
[Musa acuminata subsp. malaccensis]
Length=592

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/587 (60%), Positives = 458/587 (78%), Gaps = 5/587 (1%)
 Frame = +2

Query  254   SANLWVllglglagiliMTRKLKK-AVKADSGAFVERlqllpppqppppkaphplTGLSF  430
             S+NLWVLLGLG+A I IMTR++++ A+K D GAFVERLQLLPPP P PPKAPHPL+GL+F
Sbjct  8     SSNLWVLLGLGVASIFIMTRRMRRRALKEDFGAFVERLQLLPPPPPAPPKAPHPLSGLTF  67

Query  431   AVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGA  610
             AV+D+F IEG+VTGFGN DWA+THE A +T+ ++ ALV+ GATC+ KTI+D++A+G+SG 
Sbjct  68    AVADIFDIEGYVTGFGNLDWARTHESAARTAPIILALVDGGATCIGKTIIDELAYGMSGE  127

Query  611   NKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPS  790
             NKHYD PTNP    R+PGG SSG+AVAVA+ L +FSLG+DT GGVR+P  YCGIL F PS
Sbjct  128   NKHYDTPTNPTVPERVPGGCSSGSAVAVASGLAEFSLGVDTIGGVRIPGAYCGILAFRPS  187

Query  791   FGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSL  970
             + AVS +G +PVS SLD +G+F++DP+VLRRV ++L+Q P++  R PRNI IA+D F+ L
Sbjct  188   YAAVSTLGFVPVSPSLDTIGFFSKDPNVLRRVAYLLIQAPYSGLRQPRNIFIADDCFELL  247

Query  971   NIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLL  1144
              IPT R ++V+I ++EK FG+++++H NL  YLS K+PSLK  +  K NG++K ST   L
Sbjct  248   KIPTSRVTRVLINSVEKLFGKKLLKHLNLGDYLSTKLPSLKQLQNGKKNGDSK-STLLSL  306

Query  1145  GHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSAL  1324
                +Q+L  HEF+ NH++WI   KP LDP I+AQ++  L      +D C + R E R AL
Sbjct  307   AKAMQSLFNHEFRNNHEEWISSTKPALDPFISAQINR-LADDSLALDCCQSAREESRLAL  365

Query  1325  SDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDK  1504
             + LLKD+GILV+PTV+  PPK  AKE  S DY++     +++AS+SG CQ +IPLG  +K
Sbjct  366   NALLKDEGILVLPTVLGLPPKLNAKELSSEDYLNHTFCLSAIASMSGCCQVTIPLGLFEK  425

Query  1505  CPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQ  1684
             CP+SVSF+AR+GGD  LLD +Q ++A LQEQA+IA +S  S ++I+ E SAEIAK KGN 
Sbjct  426   CPVSVSFIARHGGDHLLLDTIQTMYAILQEQADIASKSNFSKSSITNEESAEIAKEKGNV  485

Query  1685  AFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVK  1864
             A+K+KQWQ+AI  YTEAIKL G +ATY+SNRAAAYLELGS++QAEADC+ AI LDKKNVK
Sbjct  486   AYKDKQWQKAISLYTEAIKLNGKNATYYSNRAAAYLELGSYLQAEADCSSAINLDKKNVK  545

Query  1865  AYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             AY RRGTAREMLGYY +AIEDF+YALVLEPTNK A  ++ RL +LF 
Sbjct  546   AYLRRGTAREMLGYYKEAIEDFKYALVLEPTNKTANLASNRLKQLFQ  592



>ref|XP_006826894.1| hypothetical protein AMTR_s00010p00149200 [Amborella trichopoda]
 gb|ERM94131.1| hypothetical protein AMTR_s00010p00149200 [Amborella trichopoda]
Length=591

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/589 (62%), Positives = 452/589 (77%), Gaps = 5/589 (1%)
 Frame = +2

Query  254   SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFA  433
             S N+WVL+GLGLAGIL+MTR+ KKA+K D GAFV RL+LLPPPQP PPKAPHPL+ LSFA
Sbjct  3     SPNVWVLIGLGLAGILLMTRRFKKAIKEDFGAFVMRLRLLPPPQPAPPKAPHPLSALSFA  62

Query  434   VSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGAN  613
             V D+F++ G+VTGFG+PDW KTHEPA+ T+  V+A+VE GATCV KT++D++   I+G N
Sbjct  63    VKDIFNVNGYVTGFGSPDWEKTHEPASWTAQAVSAVVEGGATCVGKTVMDELGLSINGDN  122

Query  614   KHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSF  793
              HY  P N A+ SR+PGG SSG+AVAVAA LVDFSLG DT G VR+PA +C ILGF PS 
Sbjct  123   AHYGTPINAAAPSRIPGGSSSGSAVAVAAELVDFSLGTDTVGDVRIPAAFCSILGFRPSH  182

Query  794   GAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLN  973
             G +S +G+IP++QSLD VG F RDP +LRRVGHVLLQ+ +T  RNPRNIVIA+D FQ + 
Sbjct  183   GTISMVGVIPLAQSLDTVGLFARDPAILRRVGHVLLQLSYTDSRNPRNIVIADDCFQLIK  242

Query  974   IPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLL  1144
             IP ++ +QVV K+ EK FGRQ++ H NL  Y+++KVPSL+     ++ NGE K  + ++L
Sbjct  243   IPANQITQVVTKSAEKLFGRQVLNHVNLGNYMASKVPSLRKLPNKEQRNGEEKSVSLKVL  302

Query  1145  GHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEV-ADTEI-DKCHAVRNEMRS  1318
              + +Q L+R+EFK+NH +W    KP L   I+  +   LE+  +TEI   C   RNE RS
Sbjct  303   SNAMQFLQRYEFKKNHVEWNKSTKPDLGSGISNHVQAALEMETETEIIGHCQTARNEARS  362

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             AL+ LLKDDGILVIPTV  PPPK  +K T   DY S+A    ++AS+SG CQ +IPLG H
Sbjct  363   ALNALLKDDGILVIPTVPGPPPKLRSKTTLLEDYQSQAFTLLAIASMSGCCQVTIPLGSH  422

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             D CP+SVSF+AR+GGDRFLLD VQA++  LQEQA+IA +S  S   ISKE SAEIAK KG
Sbjct  423   DNCPVSVSFIARHGGDRFLLDTVQAMYVTLQEQADIAAKSSLSRVPISKEESAEIAKEKG  482

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             N A+KEKQWQ+AI  Y+EAIKL G +ATY+SNRAAAYLEL +FV AEADCT AI LDK+N
Sbjct  483   NIAYKEKQWQKAINLYSEAIKLNGRNATYYSNRAAAYLELTNFVLAEADCTTAIALDKRN  542

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             VKAY RRGTAR+MLGYY  A+EDFR+ALVLEPTNK A Q++ RL KLF 
Sbjct  543   VKAYLRRGTARDMLGYYKDALEDFRHALVLEPTNKMATQASNRLKKLFE  591



>ref|XP_007160538.1| hypothetical protein PHAVU_002G330000g, partial [Phaseolus vulgaris]
 gb|ESW32532.1| hypothetical protein PHAVU_002G330000g, partial [Phaseolus vulgaris]
Length=471

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/471 (67%), Positives = 381/471 (81%), Gaps = 2/471 (0%)
 Frame = +2

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I G NKHY  PTNPA  +R+PGG SSGAAVAVAAN VDF+LGIDT GGVRVPAG+CGILG
Sbjct  1     IGGENKHYGTPTNPAVPARVPGGSSSGAAVAVAANFVDFALGIDTTGGVRVPAGFCGILG  60

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS GAVSH+GIIP+S SLD VGWF RDP +LRRVGH+LLQ PF  QR PR I+IA+D 
Sbjct  61    FRPSHGAVSHLGIIPISTSLDTVGWFARDPSILRRVGHILLQAPFVVQRPPRQIIIADDC  120

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKLST  1132
             FQ +N+P DR+SQVV+K  EK FGRQ+++H NL  Y+S+++PSLK  S  K NGE K S+
Sbjct  121   FQHINVPLDRSSQVVVKTTEKLFGRQVLKHINLGDYISSRIPSLKGCSAHKTNGEVKASS  180

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
               LL +++Q L+RHEFK  HD+W++ VKP L P ++ QLH+  EV+D EI+   +VR+EM
Sbjct  181   LGLLANIMQFLQRHEFKHTHDEWMNTVKPDLSPSVSTQLHDKFEVSDVEIENSKSVRSEM  240

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             RSA++ LLKD+GILVIPTV DPPPK G KE  S +Y +RA    S+AS+SG CQ SIPLG
Sbjct  241   RSAMNLLLKDEGILVIPTVADPPPKLGGKEILSEEYQNRAFSLLSIASISGCCQVSIPLG  300

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
             F+DK PISVS +AR+GGDRFLLD +Q ++  LQE A+IA +SK S N ISKE SAE AK 
Sbjct  301   FYDKYPISVSLIARHGGDRFLLDTLQTVYTTLQELADIASKSKPSENVISKEQSAEFAKE  360

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGNQA+K+KQWQ+AIGFYTEAIKL  ++ATY+SNRA AYLEL S++QAEADCTKAI LDK
Sbjct  361   KGNQAYKDKQWQKAIGFYTEAIKLCSDNATYYSNRAQAYLELASYLQAEADCTKAISLDK  420

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             KNVKAYFRRGT+REMLGYY +AI+DF++ALVLEPTNKRAA +AERL K+F 
Sbjct  421   KNVKAYFRRGTSREMLGYYKEAIDDFKHALVLEPTNKRAAAAAERLRKVFQ  471



>gb|KEH21426.1| translocon at the outer membrane ofs-like protein [Medicago truncatula]
Length=528

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/525 (65%), Positives = 426/525 (81%), Gaps = 4/525 (1%)
 Frame = +2

Query  239   SMASQ--SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphp  412
             SMAS   S NLWVLLGLGLAGI ++TRKLK+ VK D GAF+++LQLLPPP P PPKAPHP
Sbjct  3     SMASSQSSNNLWVLLGLGLAGIYVLTRKLKQTVKEDLGAFIQKLQLLPPPPPAPPKAPHP  62

Query  413   lTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMA  592
             LT L+FA+SD+F IEG V+ FG+P+WA+THEPA+ TS  V+ LV++GATC+A T++D+++
Sbjct  63    LTSLTFAISDLFDIEGHVSTFGHPEWARTHEPASSTSPAVSTLVQSGATCIATTVLDNLS  122

Query  593   FGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGI  772
             +GISG NKH+  P+NPA  +R+PGG SSGAAVAVAAN VDFSLG+DT GGVRVPAG+CGI
Sbjct  123   YGISGENKHFGTPSNPAIPARVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGI  182

Query  773   LGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAN  952
             LGF PS GAVSH GIIPVS SLD VGWF +DPD+LRRVGH+LLQ PF  QR+PR I+IA+
Sbjct  183   LGFRPSHGAVSHGGIIPVSTSLDTVGWFAKDPDILRRVGHILLQAPFVMQRSPRQIIIAD  242

Query  953   DLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--SFKKLNGEAKL  1126
             D FQ LN+P DR+SQVVIKA EK FG+Q+++H NL+ Y+ +KVPSLK  S +K NGE K 
Sbjct  243   DCFQHLNVPLDRSSQVVIKATEKLFGKQVLKHINLEGYIRSKVPSLKACSGQKANGELKS  302

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
             S+  LL +++Q L+RHEF   HD+W+  VKP L P ++AQLHE  +V++ E++   +VR+
Sbjct  303   SSLILLANIMQFLQRHEFGHMHDEWMSIVKPDLHPAVSAQLHEKFDVSEVEMENSKSVRS  362

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             EMR A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+AS+SG CQ ++P
Sbjct  363   EMRVAVNSLLKDEGILVIPTVADPPPKLGGKEILSQDYQSRAFSLLSIASISGCCQVTVP  422

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIA  1666
             LGF+DK P+SVS +AR GGDRFLLD ++ ++  LQEQA+IA  SK+S N +SKE SAEIA
Sbjct  423   LGFYDKYPVSVSLIARYGGDRFLLDTLKTMYTSLQEQADIAATSKASRNVVSKEQSAEIA  482

Query  1667  KGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELG  1801
             K KGNQA+K+KQWQ+AIGFYTEAIKL GN+ATY+SNRA AYLELG
Sbjct  483   KEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELG  527



>gb|KDO63832.1| hypothetical protein CISIN_1g008025mg [Citrus sinensis]
Length=442

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/434 (67%), Positives = 352/434 (81%), Gaps = 8/434 (2%)
 Frame = +2

Query  701   NLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLR  880
             +LVDFSLGIDT GGVRVP+ +CGILGF PS+GAVSHMGIIP+S SLD VGWF RDP +LR
Sbjct  16    DLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILR  75

Query  881   RVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLD  1060
              VGHVLLQ+PF AQR+PR I+IA+D F+ L IP DR  QVVIK+ EK FGRQ+++HENL 
Sbjct  76    HVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLG  135

Query  1061  AYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIIT  1240
              Y  +KVPSLK F K NGE K        +V++ ++R+EFK NH++WI+ VKP LDP I+
Sbjct  136   EYFDSKVPSLKGFHKTNGELK--------NVMRLIQRYEFKNNHNEWIESVKPALDPDIS  187

Query  1241  AQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY  1420
             A++ E LE+++T I+ C ++RNEMRSA+S LLKDDGILV PT   PPPK G KE  S DY
Sbjct  188   AEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDY  247

Query  1421  VSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQA  1600
              +RA    S+AS+SG CQ ++PLG++DKCP SVSF+AR+GGDRFLLD VQ ++A LQEQA
Sbjct  248   QNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQA  307

Query  1601  EIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRA  1780
             +IA +SK S N  +++ SAEIAK KGNQA+K+KQW +AI FYTEAIKL GN+ATY+SNRA
Sbjct  308   DIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRA  367

Query  1781  AAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTN  1960
             AAYLE GSF+QAEADCTKAI LDKKNVKAY RRGTAREMLGYY +AIEDF YALVLEPTN
Sbjct  368   AAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTN  427

Query  1961  KRAAQSAERLAKLF  2002
             KRA+ SA+RL K+F
Sbjct  428   KRASLSADRLRKVF  441



>ref|XP_004982030.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Setaria 
italica]
Length=587

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/591 (58%), Positives = 439/591 (74%), Gaps = 9/591 (2%)
 Frame = +2

Query  242   MASQ--SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphpl  415
             MAS   +ANLWVLLGLG+AG+L+  R+L+++ + D GAF+ RL+LLPPPQPPPP+APHPL
Sbjct  1     MASSGAAANLWVLLGLGIAGVLLAARRLRRSARPDHGAFIARLELLPPPQPPPPQAPHPL  60

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL FA++D  H+ G+VT FG+ +WAKTH+  TQTS VV+ALV+ GA CV KT++D+MA+
Sbjct  61    TGLCFAIADALHVSGYVTSFGSLEWAKTHDAETQTSPVVSALVDGGAICVGKTVIDEMAY  120

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I G NKH+D PTNPA+  R+PGG SSG+AVAVA  +VDF+LGID+ GGVR+P  YCG+L
Sbjct  121   SIHGENKHFDTPTNPAAPERVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRIPGAYCGVL  180

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
              F PS  AVS  G+IPV+ SLD +GWF RDP+VLRRVGH+LL++P+   R PR+  IA+D
Sbjct  181   AFRPSH-AVSSGGVIPVAPSLDTIGWFARDPNVLRRVGHLLLRLPYADIRPPRHFYIADD  239

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLS  1129
              F+   IP  R +QVV K++EK FGRQ+ R  NL+ YL++K+ SL+++     NG++K  
Sbjct  240   CFELSKIPARRLTQVVTKSVEKLFGRQVTR-VNLENYLASKISSLRNYSNGHKNGDSKFP  298

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L + +++L + EFK  H +WI+ VKP +D  I + L E     D++ID C   RN+
Sbjct  299   SLLALCNAMRSLHKREFKDQHMEWINSVKPAVDARIVSNLSED---GDSDIDACQDARNK  355

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
              R AL  LLKDDGILVIPT +  PPK  AKE  S  Y S+    +SLAS+SG CQ SIPL
Sbjct  356   ARLALGALLKDDGILVIPTALGCPPKLNAKELSSESYNSQTLCLSSLASMSGCCQVSIPL  415

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAK  1669
             G HDKCPISVSF+AR+GGDRFLLD VQ ++A +QEQ EI  +S  S+     E +AE AK
Sbjct  416   GTHDKCPISVSFIARHGGDRFLLDTVQTMYATIQEQVEILAKSNVSSKQAMNEEAAETAK  475

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGN AFKEKQWQ+A+  YTEAIKL G  ATY+SNRAAA+LEL ++ QAEADCT AI+L+
Sbjct  476   EKGNAAFKEKQWQKAVNLYTEAIKLNGKVATYYSNRAAAFLELTNYRQAEADCTNAIDLE  535

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
              K+VKAY RRGTAREM+GYY +A+EDF +ALVLEP NK A  +  RL KLF
Sbjct  536   PKSVKAYLRRGTAREMMGYYKEAVEDFNHALVLEPMNKTAGVAVNRLKKLF  586



>ref|NP_001051033.1| Os03g0707900 [Oryza sativa Japonica Group]
 gb|AAK50116.1|AC087797_1 chloroplast protein-translocon-like protein [Oryza sativa Japonica 
Group]
 gb|ABF98476.1| chloroplast outer membrane translocon subunit, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF98477.1| chloroplast outer membrane translocon subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12947.1| Os03g0707900 [Oryza sativa Japonica Group]
 gb|EEC76040.1| hypothetical protein OsI_13214 [Oryza sativa Indica Group]
Length=586

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/586 (57%), Positives = 432/586 (74%), Gaps = 3/586 (1%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S +ANLWVLLGLG+AG+L+  ++L++  + D+GAF+ RL+LLPPPQPPPP+A HPLTGL
Sbjct  3     SSTAANLWVLLGLGIAGVLLAAKRLRRPARPDNGAFIARLELLPPPQPPPPQARHPLTGL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
              FA++D FH+ G++T FG+ +WAKTH+ ATQTS VV++LV+ GA CV KT++D+MAF I 
Sbjct  63    CFAIADAFHVTGYITSFGSLEWAKTHDAATQTSLVVSSLVDGGAMCVGKTVIDEMAFSIH  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G NKH+  PTNPA+  R+PGG SSG+AVAVAA +VDFSLGIDT GGVRVP  YCG+L F 
Sbjct  123   GENKHFGTPTNPAAPDRVPGGCSSGSAVAVAAGIVDFSLGIDTIGGVRVPGSYCGVLAFR  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
             PS   V + G+IPV+ SLD +GWF RDP VLRRVGH+LL++P+   R PR+  IA+D F+
Sbjct  183   PSHAVVPNNGVIPVAPSLDAIGWFARDPSVLRRVGHLLLRLPYADIRQPRHFYIADDCFE  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLL  1144
                +   R +QVV K++EK FGRQ++ H NL+ YL++++PSL++    +G++K S+   L
Sbjct  243   MSKVHARRLTQVVTKSVEKLFGRQVLGHVNLENYLASRIPSLRNNSNGHGDSKFSSLLAL  302

Query  1145  GHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSAL  1324
                +Q L +HEFK  H +WI+ VKP +D  I   L +  E   + I+     R E+R+AL
Sbjct  303   SRAMQFLHKHEFKDQHMEWINSVKPAVDACIVGNLSDDGE---STINNSQDARKEVRAAL  359

Query  1325  SDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDK  1504
               LLKDDGILVIPTV+  PPK  A+E  S DY  +     SLAS+SG CQ ++PLG HDK
Sbjct  360   GALLKDDGILVIPTVLGCPPKLNARELSSQDYNVQTSCLTSLASMSGCCQVTVPLGTHDK  419

Query  1505  CPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQ  1684
             CP+SVS +AR+GGDRFLLD +Q ++A +QEQ +   +S  S+     E +AE AK KGN 
Sbjct  420   CPVSVSLIARHGGDRFLLDTIQTIYATIQEQVDALAKSNVSSKQAMSEEAAEAAKEKGNI  479

Query  1685  AFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVK  1864
             AFKEKQWQ+AI FYTEAIKL    ATY+SNRAAA+LEL S+ QAEADCT AI++D K VK
Sbjct  480   AFKEKQWQKAINFYTEAIKLNNKVATYYSNRAAAFLELASYRQAEADCTSAIDIDPKIVK  539

Query  1865  AYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             AY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  540   AYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGVAINRLKKLF  585



>dbj|BAJ97726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/588 (56%), Positives = 435/588 (74%), Gaps = 5/588 (1%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S +ANLWVLLGLG+AG+L+  ++LK+  + D GAFV RL+LLPPPQPPPP+A HPLT L
Sbjct  3     SSTAANLWVLLGLGIAGVLLAAKRLKRPARPDHGAFVSRLELLPPPQPPPPQARHPLTDL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
              FA++D FH+ G++T FG+ +WAKTH+ ATQTS VV+ LV+ GA CV KT++D+MA+ I 
Sbjct  63    CFAIADAFHVSGYITSFGSLEWAKTHDEATQTSLVVSTLVDGGAICVGKTVIDEMAYSIH  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G NKH+  PTNPA+S R+PGG SSG+AVAVA  +VDF+LGID+ GGVRVP GYCG+L F 
Sbjct  123   GENKHFGTPTNPAASDRVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRVPGGYCGVLAFR  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
             PS   +S+ G+IPV+ SLD +GWF RDP VLRRVGH+LL++ +T  R PR+  IA+D F+
Sbjct  183   PSHAVISNSGVIPVAPSLDTIGWFARDPIVLRRVGHLLLKLSYTDIRLPRHFYIADDCFE  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTR  1138
                IP  R +QVV K++EK +GRQ++ H NL  YL++K+PSL+++   + NG++K S+ +
Sbjct  243   ISKIPARRLTQVVTKSVEKLYGRQVLSHVNLGNYLASKIPSLRNYSNGQKNGDSKFSSLQ  302

Query  1139  LLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRS  1318
              L   +Q L +HEF+  H++WI+  K ++D  I   L +     D+ I+    VR E+R 
Sbjct  303   ALSSAMQLLHKHEFRDQHNEWINSAKSSVDASIVGNLSDD---GDSTINIIQDVRKEVRL  359

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             AL+ LLKDDGILVIPT +  PPK  A+E  S  Y +      SL+S+SG CQ ++P+G H
Sbjct  360   ALNTLLKDDGILVIPTALGCPPKINARELSSTSYNAETLYLQSLSSMSGCCQVTVPIGTH  419

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             DKCPISVSF+AR+GGDRFLLD  QA++A +QEQ EI  +S +S+     E +AE AK KG
Sbjct  420   DKCPISVSFIARHGGDRFLLDTTQAIYATIQEQVEILAKSNASSKEAMNEEAAEAAKEKG  479

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             N AFKEKQWQ+AI  YTEAIKL G  ATY+SNRAAA+LEL ++ QAE DCT AI++D K 
Sbjct  480   NSAFKEKQWQKAINLYTEAIKLNGKVATYYSNRAAAFLELANYRQAETDCTSAIDIDPKI  539

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             VKAY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  540   VKAYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGVAINRLKKLF  587



>gb|EEE59781.1| hypothetical protein OsJ_12287 [Oryza sativa Japonica Group]
Length=586

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/586 (56%), Positives = 432/586 (74%), Gaps = 3/586 (1%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S +ANLWVLLGLG+AG+L+  ++L++  + ++GAF+ RL+LLPPPQPPPP+A +PLTGL
Sbjct  3     SSTAANLWVLLGLGIAGVLLAAKRLRRPARPENGAFIARLELLPPPQPPPPQARNPLTGL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
              FA++D FH+ G++T FG+ +WAKTH+ ATQTS VV++LV+ GA CV KT++D+MAF I 
Sbjct  63    CFAIADAFHVTGYITSFGSLEWAKTHDAATQTSLVVSSLVDGGAMCVGKTVIDEMAFSIH  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G NKH+  PTNPA+  R+PGG SSG+AVAVAA +VDFSLGIDT GGVRVP  YCG+L F 
Sbjct  123   GENKHFGTPTNPAAPDRVPGGCSSGSAVAVAAGIVDFSLGIDTIGGVRVPGSYCGVLAFR  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
             PS   V + G+IPV+ SLD +GWF RDP VLRRVGH+LL++P+   R PR+  IA+D F+
Sbjct  183   PSHAVVPNNGVIPVAPSLDAIGWFARDPSVLRRVGHLLLRLPYADIRQPRHFYIADDCFE  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLL  1144
                +   R +QVV K++EK FGRQ++ H NL+ YL++++PSL++    +G++K S+   L
Sbjct  243   MSKVHARRLTQVVTKSVEKLFGRQVLGHVNLENYLASRIPSLRNNSNGHGDSKFSSLLAL  302

Query  1145  GHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSAL  1324
                +Q L +HEFK  H +WI+ VKP +D  I   L +  E   + I+     R E+R+AL
Sbjct  303   SRAMQFLHKHEFKDQHMEWINSVKPAVDACIVGNLSDDGE---STINNSQDARKEVRAAL  359

Query  1325  SDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDK  1504
               LLKDDGILVIPTV+  PPK  A+E  S DY  +     SLAS+SG CQ ++PLG HDK
Sbjct  360   GALLKDDGILVIPTVLGCPPKLNARELSSQDYNVQTSCLTSLASMSGCCQVTVPLGTHDK  419

Query  1505  CPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQ  1684
             CP+SVS +AR+GGDRFLLD +Q ++A +QEQ +   +S  S+     E +AE AK KGN 
Sbjct  420   CPVSVSLIARHGGDRFLLDTIQTIYATIQEQVDALAKSNVSSKQAMSEEAAEAAKEKGNI  479

Query  1685  AFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVK  1864
             AFKEKQWQ+AI FYTEAIKL    ATY+SNRAAA+LEL S+ QAEADCT AI++D K VK
Sbjct  480   AFKEKQWQKAINFYTEAIKLNNKVATYYSNRAAAFLELASYRQAEADCTSAIDIDPKIVK  539

Query  1865  AYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             AY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  540   AYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGVAINRLKKLF  585



>ref|XP_006650474.1| PREDICTED: outer envelope protein 64, chloroplastic-like [Oryza 
brachyantha]
Length=588

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/590 (56%), Positives = 435/590 (74%), Gaps = 6/590 (1%)
 Frame = +2

Query  242   MASQSA-NLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplT  418
             MAS +A NLWVLLGLG+AG+L+  ++L++  + DSGAF+ RL+LLPPPQPPPP+A HPLT
Sbjct  1     MASSTATNLWVLLGLGIAGVLLAAKRLRRPARPDSGAFITRLELLPPPQPPPPQARHPLT  60

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL FA++D FH+ G++T FG+ +WAKTH+  TQTS VV++LV+ GA CV KT++D+MAF 
Sbjct  61    GLCFAIADAFHVSGYITSFGSLEWAKTHDAETQTSLVVSSLVDGGAMCVGKTVIDEMAFS  120

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I G NKH+  PTNPA+  R+PGG SSG+AVAVAA +VDF+LG+D  GGVR+P  YCG+L 
Sbjct  121   IHGENKHFGIPTNPAAPDRVPGGCSSGSAVAVAAGMVDFALGVDAIGGVRIPGSYCGVLA  180

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS   V + G+IPV+ SLD +GWF RDP VLRRVGH+LL++P+   R PR   IA+D 
Sbjct  181   FRPSHAVVPNSGVIPVAPSLDAIGWFARDPSVLRRVGHLLLRLPYADIRQPRLFYIADDC  240

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLST  1132
             F+   +P  R +QV+ K++EK FGRQ++ H NL+ +L++++P L+++   + +G++K S+
Sbjct  241   FEMSKVPARRLTQVITKSVEKVFGRQVLGHVNLENHLASRIPCLRNYSNGQKHGDSKFSS  300

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
                L   +Q L +HEFK  H +WI+ VKP +D  I   L + LE   + I+     R E+
Sbjct  301   LLALSRAMQFLHKHEFKDQHMEWINSVKPAVDASIVGNLSDDLE---STINSSQDARKEV  357

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R+ALS LLKDDGILVIPTV+  PPK  A+E  S+DY  +     SLAS+SG CQ ++PLG
Sbjct  358   RAALSALLKDDGILVIPTVLGCPPKLHARELSSLDYNVQTSCLTSLASMSGCCQVTVPLG  417

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKG  1672
              HDKCP+SVS +AR+GGDRFLLD +Q ++A +QEQ ++  +S  S+     E +AE AK 
Sbjct  418   THDKCPVSVSLIARHGGDRFLLDTIQTIYATIQEQVDVLAKSNVSSKQAMSEEAAEAAKE  477

Query  1673  KGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDK  1852
             KGN AFKEKQWQ+AI  YTEAIKL    ATY+SNRAAA+LEL SF QAEADCT AI++D 
Sbjct  478   KGNIAFKEKQWQKAINCYTEAIKLNNKVATYYSNRAAAFLELASFRQAEADCTSAIDIDP  537

Query  1853  KNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             K VKAY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  538   KIVKAYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGVAINRLKKLF  587



>ref|XP_002464019.1| hypothetical protein SORBIDRAFT_01g010650 [Sorghum bicolor]
 gb|EER91017.1| hypothetical protein SORBIDRAFT_01g010650 [Sorghum bicolor]
Length=588

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/591 (58%), Positives = 429/591 (73%), Gaps = 8/591 (1%)
 Frame = +2

Query  242   MASQ--SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphpl  415
             MAS   +ANLWVLLGLG+AG+ +  R+L++  + D GAF+ RL+LLPPPQPPPP+APHPL
Sbjct  1     MASSGAAANLWVLLGLGIAGVFLAARRLRRPARPDHGAFIARLELLPPPQPPPPQAPHPL  60

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL FA++D  H+ G++T FG+ +WAKTH+   QTS VV+ALV++GA CV KT++D+MA+
Sbjct  61    TGLCFAIADALHVSGYITSFGSLEWAKTHDAEVQTSPVVSALVDSGAICVGKTVIDEMAY  120

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I G NK++D PTNPA+  R+PGG SSG+AVAVA  +VDF+LGID+ GGVRVP  YCG+L
Sbjct  121   SIHGENKYFDTPTNPATPDRVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRVPGAYCGVL  180

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
              F PS   VS  G+IPV+ SLD +GWF RDP VL RVGH+LL++P+   R PRN  IA+D
Sbjct  181   AFRPSHAVVSSSGVIPVAPSLDTIGWFARDPSVLHRVGHLLLRLPYAGIRQPRNFYIADD  240

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLS  1129
              F    IP  R +QVV K++EK FGRQ +RH NL+ YLS+++  L ++     NG++K  
Sbjct  241   CFGLSKIPVRRLTQVVTKSVEKLFGRQ-VRHVNLENYLSSRISGLSNYSNGHKNGDSKFP  299

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
                 L + +++L + EFK  H +WI+ VKP +D  I + L E     D++ID C   R E
Sbjct  300   LLLALCNAMRSLHKREFKDQHMEWINSVKPAVDARIVSDLSED---GDSDIDGCQDARKE  356

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
              RSALS+LLKDDGILVIPT +  PPK  AKE  S  Y S+     SLAS+SG CQ SIPL
Sbjct  357   ARSALSELLKDDGILVIPTALGCPPKLNAKELSSESYNSQTLGLLSLASMSGCCQVSIPL  416

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAK  1669
             G HDKCPISVS +AR+GGDRFLLD  Q ++  +QEQ EI  +S  S+     E +AE AK
Sbjct  417   GTHDKCPISVSLIARHGGDRFLLDTTQTMYTTIQEQVEILAKSSVSSKQAMNEEAAEAAK  476

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGN AFKEKQWQ+A+ FYTEAIKL G  ATY+SNRAAA+LEL S+ QAEADCT AI+LD
Sbjct  477   EKGNAAFKEKQWQKAVNFYTEAIKLNGKVATYYSNRAAAFLELTSYRQAEADCTSAIDLD  536

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
              K+VKAY RRGTAREMLGYY  A++DF +ALVLEP NK A  +  RL KLF
Sbjct  537   PKSVKAYLRRGTAREMLGYYKDAVDDFNHALVLEPMNKTAGVAINRLKKLF  587



>ref|XP_007036835.1| Amidase family protein isoform 2, partial [Theobroma cacao]
 gb|EOY21336.1| Amidase family protein isoform 2, partial [Theobroma cacao]
Length=466

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/497 (61%), Positives = 376/497 (76%), Gaps = 36/497 (7%)
 Frame = +2

Query  527   VVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNL  706
             VV +LVE GATCV KT+VD++A+ I G NKHY  PTNPA+ +R+PGG SSGAAVAVAAN 
Sbjct  2     VVLSLVEGGATCVGKTVVDELAYSIHGENKHYSTPTNPAAPARIPGGSSSGAAVAVAANF  61

Query  707   VDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRV  886
             VDFSLGI                              IPV+ SLD VG   +DP++L RV
Sbjct  62    VDFSLGI------------------------------IPVASSLDTVGLLAKDPNILHRV  91

Query  887   GHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAY  1066
             G VLLQ+PF+ QRNPR I++A+D FQ L IP +R SQVVI + EK FGRQ+++HENL+ Y
Sbjct  92    GLVLLQLPFSVQRNPRQILLADDCFQLLKIPMERVSQVVINSTEKLFGRQVLKHENLEDY  151

Query  1067  LSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIIT  1240
              S+KVPSLK F  +K+N + K+S+ RLL +V Q L+R+EFK  H++WI   KP LD  ++
Sbjct  152   FSSKVPSLKEFYRQKINVDLKISSIRLLANVAQFLQRYEFKCAHEEWISSEKPVLDSAVS  211

Query  1241  AQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY  1420
              Q++E L++ D EI+ C ++RNEMR A++ LLKDDGILVIPT   PPPK G+KE  S DY
Sbjct  212   TQINETLDLTDKEIEICKSIRNEMRLAVNSLLKDDGILVIPTTAHPPPKLGSKEIFSEDY  271

Query  1421  VSRACLFA--SLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQE  1594
                 C+F+  S+AS+SG CQ ++PLG+HD  P+SVSF+AR+GGDRFLLD VQ +++ LQE
Sbjct  272   --HNCMFSLLSIASISGCCQVTLPLGYHDNYPVSVSFIARHGGDRFLLDTVQTMYSSLQE  329

Query  1595  QAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSN  1774
              A+   +SK S NA+++E SAE+AK KGNQA+K+KQWQ+A+ FYTEAIKL GN+ATY+SN
Sbjct  330   HADTVAKSKLSRNAVNQEQSAEVAKEKGNQAYKDKQWQKAVMFYTEAIKLNGNNATYYSN  389

Query  1775  RAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEP  1954
             RAAAYLELGSF+QAE DCTKAI+LDKKNVKAY RRGTAREMLGYY +AIEDFRYALVLEP
Sbjct  390   RAAAYLELGSFLQAETDCTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEP  449

Query  1955  TNKRAAQSAERLAKLFH  2005
             TNKRAA SAERL K+F 
Sbjct  450   TNKRAALSAERLRKVFQ  466



>ref|NP_001152345.1| LOC100285985 [Zea mays]
 gb|ACG47149.1| toc64 [Zea mays]
Length=588

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/591 (58%), Positives = 430/591 (73%), Gaps = 8/591 (1%)
 Frame = +2

Query  242   MASQ--SANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphpl  415
             MAS   +ANLWVLLGLG+AG+L+  R+L++  + D GAFV RL+LLPPPQPPPP+APHPL
Sbjct  1     MASSGAAANLWVLLGLGIAGVLLAARRLRRPARPDHGAFVARLELLPPPQPPPPQAPHPL  60

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL FA++D  H+ G++T FG+ +WAKTH     TS+VV+ALV+ GA CV KT++D+MA+
Sbjct  61    TGLCFAIADALHVSGYITSFGSLEWAKTHNAEVLTSSVVSALVDGGAICVGKTVIDEMAY  120

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I G N+++D PTNPA+  R+PGG SSG+AVAVA  +VDF+LGID+ GGVR+P  YCG+L
Sbjct  121   SIHGENRYFDTPTNPAAPDRVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRIPGAYCGVL  180

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
              F PS   VS+ G+IPV+ SLD +GWF +DP VL RVGH+LL++P+   R PR   IA+D
Sbjct  181   AFRPSHAVVSNSGVIPVAPSLDTIGWFAKDPSVLHRVGHLLLRLPYAGIRQPRIFYIADD  240

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLS  1129
              F+   IP  R +QVV K++EK FGRQ +RH NL+ YLS+++ SL ++     NG++K  
Sbjct  241   CFELSKIPARRLTQVVTKSVEKLFGRQ-VRHVNLENYLSSRISSLGNYSNGHKNGDSKFP  299

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
                 L + + +L + EFK  H +WI+ VKP +D  I + L E     D++ID C  VR E
Sbjct  300   LLLALCNSMISLHKQEFKDKHMEWINSVKPAVDARIVSDLSED---GDSDIDGCQNVRKE  356

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
              RSALS LLKDDGILVIPT +  PPK  AKE  S  Y S+     SLAS+SG CQ SIPL
Sbjct  357   ARSALSGLLKDDGILVIPTALGCPPKLNAKELSSESYNSQTLRLLSLASMSGCCQVSIPL  416

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAK  1669
             G HDKCPISVS +AR+GGDRFLLD  Q ++  +QEQ EI  +S  S+     E +AE AK
Sbjct  417   GTHDKCPISVSLIARHGGDRFLLDTTQTMYTTIQEQVEILAKSSVSSKQAMNEEAAEAAK  476

Query  1670  GKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELD  1849
              KGN AFKEKQWQ+A+ FYTEAIKL G  ATY+SNRAAA+LEL S+ QAEADCT AIELD
Sbjct  477   EKGNAAFKEKQWQKAVNFYTEAIKLNGKVATYYSNRAAAFLELTSYRQAEADCTSAIELD  536

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
              K+VKAY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  537   SKSVKAYLRRGTAREMLGYYKEAVDDFNHALVLEPMNKTAGVAINRLKKLF  587



>ref|XP_003560735.1| PREDICTED: outer envelope protein 64, chloroplastic [Brachypodium 
distachyon]
Length=588

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/588 (56%), Positives = 430/588 (73%), Gaps = 5/588 (1%)
 Frame = +2

Query  245   ASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGL  424
             +S +ANLWVLLGLG+AG+L+  ++L++  + DSGAF+ RL+LLPPPQPPPP+A HPLT L
Sbjct  3     SSTAANLWVLLGLGIAGVLLAAKRLRRPARPDSGAFISRLELLPPPQPPPPQARHPLTDL  62

Query  425   SFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGIS  604
              FAV+D FHI  ++T FG+ +WAKTH+ ATQTS VV++LV+ GA CV KT++D+MA+ I 
Sbjct  63    CFAVADAFHISSYITSFGSLEWAKTHDAATQTSLVVSSLVDGGAICVGKTVIDEMAYSIH  122

Query  605   GANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFH  784
             G NKH+  P NPA+S R+PGG SSG+AVAVAA +VDF+LGID+ GGVRVP GYCG+L F 
Sbjct  123   GENKHFGTPRNPAASDRVPGGCSSGSAVAVAAGMVDFALGIDSVGGVRVPGGYCGVLAFR  182

Query  785   PSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQ  964
             PS   + + G+IPV+ SLD +GWF RDP VLRRVGH+LL++ +T  R PRN  IA+D F+
Sbjct  183   PSHAVIPNSGVIPVAPSLDTIGWFARDPIVLRRVGHLLLRLSYTEIRLPRNFYIADDCFE  242

Query  965   SLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTR  1138
                IP  R +QVV K+ EK +GRQ++ H NL  YL++++PSL+++   + NG++K  +  
Sbjct  243   LSKIPARRLTQVVTKSAEKLYGRQVLSHVNLGNYLASRMPSLRNYSNGQKNGDSKSCSLL  302

Query  1139  LLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRS  1318
              L   +Q L +HEF+  H++WI+ VK  +D  I   L +      + ID C  VR E RS
Sbjct  303   ALSSAMQLLHKHEFRDQHNEWINSVKSAVDACIVGNLSDN---GASTIDLCQDVRKEARS  359

Query  1319  ALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFH  1498
             AL+ LLKDDGILVIPT +  PPK  ++E  S  Y +     +SL+S+SG CQ +IP+G H
Sbjct  360   ALNALLKDDGILVIPTALGCPPKVNSRELSSASYNAETLCLSSLSSMSGCCQVTIPVGTH  419

Query  1499  DKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
             DKCPISVSF+AR+GGDRFLLD  QA++  +QEQ EI   S +S+     E +AE AK KG
Sbjct  420   DKCPISVSFIARHGGDRFLLDTTQAMYGTIQEQVEILATSNASSKQAMIEEAAEAAKEKG  479

Query  1679  NQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKN  1858
             N AFKEKQWQ+AI  YTEAIKL    ATY+SNRAAA+LEL S+ QAE DCT AI++D K 
Sbjct  480   NIAFKEKQWQKAINLYTEAIKLNDKVATYYSNRAAAFLELASYRQAETDCTSAIDIDPKI  539

Query  1859  VKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             VKAY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  540   VKAYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGIAINRLKKLF  587



>ref|XP_007042951.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
1 [Theobroma cacao]
 gb|EOX98782.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
1 [Theobroma cacao]
Length=606

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/568 (53%), Positives = 396/568 (70%), Gaps = 2/568 (0%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             M RK     + D GAF+ER +L+P PQPPPP A  PL+GL+FA+ D+F ++G+VTGFGNP
Sbjct  38    MRRKAIIIKREDFGAFLERFELIPFPQPPPPAAKLPLSGLTFAIKDIFDVKGYVTGFGNP  97

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW +THEPA +T+ VVTAL++ GA CV KT++D++AFG++G NKHY  PTNP   S +PG
Sbjct  98    DWRRTHEPADKTAVVVTALLKNGAKCVGKTVMDELAFGVTGENKHYGTPTNPNMESNVPG  157

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF+LG DT G VR+PA +CGILGF PS GAVS +G++P SQSLD 
Sbjct  158   GSSSGSAVAVAAELVDFALGTDTIGCVRIPASFCGILGFRPSHGAVSTIGLLPNSQSLDA  217

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             +GWF RDP +L  VGHVLLQ+     R  R +V A+DLFQ   +P  +T  VV KAIEK 
Sbjct  218   IGWFARDPSILHCVGHVLLQLKAVEPRRARRLVFADDLFQLSKVPKQKTVYVVSKAIEKL  277

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
              G Q  +H N   Y+++ VPSLK F  +  + +  +S  + L  V+ +L+R+EFK NH++
Sbjct  278   SGYQPPKHINFAQYVASNVPSLKGFCQQSTHLQNGISILKALSSVMVSLQRYEFKTNHEE  337

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             W+ DVKP L   I+  +   +      +   + VR EMR+A+  LLKDDGILVIPT+ D 
Sbjct  338   WVKDVKPRLGAEISNHVLASINTTYGNVKNLYKVRTEMRAAVQSLLKDDGILVIPTIADA  397

Query  1379  PPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLL  1558
             P K  +K+  S ++  +A    S+AS+SGGCQ S+PLG HD CP+SVSFV  +G D+FLL
Sbjct  398   PLKLNSKKGYSTEFHDKAYALLSIASMSGGCQVSVPLGKHDDCPVSVSFVTYHGADKFLL  457

Query  1559  DAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
             D V  ++A LQ+Q  IA       +      ++E+ K KGN AFK  QW +A+ +Y++AI
Sbjct  458   DTVLDMYASLQDQVSIASNLAPLPDVNGNMDASELLKEKGNAAFKGMQWNKAVSYYSKAI  517

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             KL G +ATY++NRAAAYLELG F QAE DC+KAI LDKKNVKAY RRGTARE L  Y +A
Sbjct  518   KLNGTTATYYNNRAAAYLELGCFQQAEEDCSKAISLDKKNVKAYLRRGTARESLLCYKEA  577

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +EDF++ALVLEP NK A  + +RL KL 
Sbjct  578   LEDFKHALVLEPQNKVANLAEKRLRKLI  605



>gb|AAS47584.1| chloroplast Toc64-1 [Physcomitrella patens]
Length=592

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/556 (53%), Positives = 400/556 (72%), Gaps = 1/556 (0%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D+GAF+E  +LLPPP PPPP APHPL+GL+FA+ D+F IEGFVTGFGNPDWA THEPAT+
Sbjct  37    DNGAFIEYFELLPPPPPPPPSAPHPLSGLTFAIKDIFDIEGFVTGFGNPDWASTHEPATR  96

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  V  LVEAGATC+ K I+D++A+ I G NKHY  P NPA+ +R+PGG SSG+ VAVA
Sbjct  97    TAAAVKVLVEAGATCIGKLIMDELAYSIIGDNKHYGTPVNPAAPNRIPGGSSSGSGVAVA  156

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A+LVDFSLG DT G VRVPA +CGILGF PS GAVS +G+ P++QSLD VG F RDP +L
Sbjct  157   ADLVDFSLGTDTAGSVRVPAAFCGILGFRPSHGAVSTVGVTPMAQSLDTVGCFARDPAIL  216

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
             R+VGH+LLQ+P+   R PR   IA+D F+   IPT+ +   V+K+I+K  GRQ+++H NL
Sbjct  217   RQVGHILLQLPYMDVRQPRRFFIADDCFKISLIPTELSLGTVVKSIQKLLGRQVLQHINL  276

Query  1058  DAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPII  1237
               Y++  VPSLK  +K   ++ L +  LL   +Q L+R EFK NH++W+  VKP L P +
Sbjct  277   GDYVARTVPSLKELQKEISDSNLGSLALLRTAMQILQRWEFKLNHEEWLTTVKPDLAPAL  336

Query  1238  TAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSID  1417
              A+    LE +   +     +++E R A+S+LLK+D +LV+PTV D PPK   K      
Sbjct  337   AARTKLALETSSNLVPLLQKIKDETRYAISELLKNDSLLVMPTVPDIPPKLNTKAEALEV  396

Query  1418  YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             + ++      +A +S  CQ ++P G HD  P++VS +A+ G DRFLLD V A+++ +QE+
Sbjct  397   FRNKTLDLICVAGMSSCCQVTMPAGNHDGVPMAVSLLAKQGSDRFLLDTVLAIYSTVQEE  456

Query  1598  AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNR  1777
              ++A    S  +     A+AE+AK KGN AFKEK +++A+GFYT+AI+L GN+ATY++NR
Sbjct  457   DKVAADQPSIVSD-GNSAAAELAKEKGNAAFKEKDYKKAVGFYTDAIRLNGNNATYYNNR  515

Query  1778  AAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPT  1957
             A AYL+L SF +AE+DCTKA+ LDK++VKAY RRGTARE LGYY +A EDFR AL+ EPT
Sbjct  516   AMAYLQLCSFSEAESDCTKALNLDKRSVKAYLRRGTAREFLGYYKEADEDFRQALIFEPT  575

Query  1958  NKRAAQSAERLAKLFH  2005
             NK A+++  RL KL +
Sbjct  576   NKTASEALSRLKKLLY  591



>ref|XP_010030038.1| PREDICTED: outer envelope protein 64, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56986.1| hypothetical protein EUGRSUZ_I02661 [Eucalyptus grandis]
Length=608

 Score =   542 bits (1396),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 290/563 (52%), Positives = 392/563 (70%), Gaps = 2/563 (0%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             +A K D GAF+ER +LLP PQPPPP    PL GL+FA+ D+F ++G+VTGFGNPDW +TH
Sbjct  46    EAAKEDFGAFLERFELLPFPQPPPPALKQPLAGLTFAIKDIFEVKGYVTGFGNPDWERTH  105

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
             E A +T+ V+ AL++ GA CV KT++D++AFG++G N H+  P NP   S +PGG SSG+
Sbjct  106   EAAEKTAVVINALLKNGAKCVGKTVLDELAFGMTGENIHHGTPVNPQMPSHIPGGSSSGS  165

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF+LG DT G VR+PA +CGI+G+ PS G VS +G++P SQSLD VGWF R
Sbjct  166   AVAVAAELVDFALGTDTVGCVRIPASFCGIIGYRPSHGVVSTIGVLPNSQSLDTVGWFAR  225

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP +L RVGH+LLQ+     R PR +V A+DLF+   +P  ++  VV KA EK  G Q  
Sbjct  226   DPSILHRVGHILLQLNTVEPRRPRRLVFADDLFELSKVPKHKSLYVVSKAAEKLSGYQPP  285

Query  1043  RHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             +H N   ++++ VPSLK F  +  N +  +ST + L   + +L+R EFK NH++W+  VK
Sbjct  286   KHINFGQHIASNVPSLKIFCEQSTNLQNGISTLKALSSAMLSLQRCEFKTNHEEWVTSVK  345

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P     +   +  +   I   + VR+EMR+AL  LLKDDGIL+IPTV DPP     
Sbjct  346   PRLGPRTANCVLTAVNTSLENIKTLYKVRSEMRAALQSLLKDDGILIIPTVADPPLPTNL  405

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             K+  S ++  RA    S++S+SG CQ SIPLG H+ CPISVSF++ +GGD+FLLD+V  +
Sbjct  406   KKHSSAEFFDRALALISISSMSGCCQVSIPLGKHEGCPISVSFISYHGGDKFLLDSVLDM  465

Query  1577  FAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNS  1756
             ++ LQEQA +A  S    +      ++E+ K KGN A+K +QW +A+ +Y+EAIKL G +
Sbjct  466   YSSLQEQATVASSSLPFADTNGNLDTSELLKEKGNAAYKGRQWNKAVTYYSEAIKLNGAN  525

Query  1757  ATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRY  1936
             ATY+ NRAAAYL+LG F QAE DCT AI LDKKNVKAY RRGTARE L  Y ++++DF++
Sbjct  526   ATYYCNRAAAYLQLGCFQQAEEDCTMAISLDKKNVKAYLRRGTARESLIRYKESLQDFKH  585

Query  1937  ALVLEPTNKRAAQSAERLAKLFH  2005
             ALVLEP NK A+ + +RL KL +
Sbjct  586   ALVLEPQNKDASLAEKRLRKLLN  608



>gb|KHF99139.1| Amidase 1 -like protein [Gossypium arboreum]
Length=635

 Score =   541 bits (1395),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 305/600 (51%), Positives = 398/600 (66%), Gaps = 39/600 (7%)
 Frame = +2

Query  311   RKLKKAV---KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGN  481
             R+ KKA+   + D GAF+ER +L+P PQPPPP A  PL+GL+FA+ D+F ++G  TGFGN
Sbjct  36    RRRKKAMIIKREDFGAFMERFELIPFPQPPPPAAKLPLSGLTFAIKDIFDVKGHATGFGN  95

Query  482   PDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlp  661
             PDW +THE A +T+ VVTAL++ GA CV KT++D++AFGI+G NKHY  PTNP   S +P
Sbjct  96    PDWQRTHEVADKTAVVVTALLKNGAKCVGKTVMDELAFGITGENKHYGTPTNPNMPSNVP  155

Query  662   ggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLD  841
             GG SSG+AVAVAA LVDF+LG DT G VRVPA +CG+LGF PS GAVS +G++P SQSLD
Sbjct  156   GGSSSGSAVAVAAELVDFALGTDTIGCVRVPASFCGVLGFRPSHGAVSTIGVLPNSQSLD  215

Query  842   VVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEK  1021
              +GWF RDP +L RVG+VLLQ+     R  R++V A+DLFQ   +P  +T  V+ KA+EK
Sbjct  216   AIGWFARDPSILHRVGNVLLQLKAVEPRRGRHLVFADDLFQLSKVPKQKTVHVISKAVEK  275

Query  1022  QFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHD  1195
               G Q+ +H N   ++++ VPSLK F     N +  +S  + L   + +L+R+EFK NH+
Sbjct  276   LSGYQLPKHVNFCLFIASNVPSLKGFCQHSTNLQNGISALQALSSAMVSLQRYEFKTNHE  335

Query  1196  DWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVID  1375
             +W+ DVKP L P ++  +   +      +   + VR EMR+A+  LLKDDGILVIPT+ D
Sbjct  336   EWLKDVKPRLGPEVSRCVLAAINNTYENVKSLYKVRTEMRAAMQSLLKDDGILVIPTIAD  395

Query  1376  PPPKAGAKETQSIDYVSRACLFASLASLSGGC----------------------------  1471
             PP K   K+  S ++  RAC   S+AS+SG C                            
Sbjct  396   PPLK--LKKGSSTEFHDRACALLSVASMSGCCQVAFAGTRLKFSILYVVCNLDIRNLFNL  453

Query  1472  ----QASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAI  1639
                 Q S+PLG HD CPISVSFV  +G D+FLLD V  ++A LQEQ  IA  S    +  
Sbjct  454   TISSQVSVPLGEHDGCPISVSFVTYHGADKFLLDTVLDMYASLQEQVSIASNSAPLPDLN  513

Query  1640  SKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAE  1819
                 ++E+ K KGN AFK KQW +A+ +YTEAIKL G +ATY++NRAAAYLELG F QAE
Sbjct  514   GNMDASELLKEKGNAAFKGKQWNKAVNYYTEAIKLNGTNATYYNNRAAAYLELGCFQQAE  573

Query  1820  ADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKL  1999
              DC KAI  DKKNVKAY RRGTAR+ L  Y +A+EDF++ALVLEP NK A  + +RL KL
Sbjct  574   EDCNKAISFDKKNVKAYLRRGTARDSLLCYKEALEDFKHALVLEPQNKVANLAEKRLRKL  633



>ref|XP_010422985.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Camelina 
sativa]
Length=604

 Score =   540 bits (1390),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 289/567 (51%), Positives = 388/567 (68%), Gaps = 3/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D GAF++R +LLP P PPPP A   L+ L+F++SD FH++ ++TGFG+P W
Sbjct  37    RRIKALREEDFGAFLDRFELLPFPPPPPPAAKQSLSDLTFSISDAFHVKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ V+T L++ GATCV KTI+D++ FG+ G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVITTLLKNGATCVGKTIMDELGFGVIGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRIPASFCGILGFRPSQGTVSSVGVLPTSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+++ A+DLF+  +IP  +   VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAIPHKRQRSLIFADDLFELSDIPKQKYVHVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  ++++ VPSL  F + +G+++   ST + L  V+  ++RHEFK NH++W 
Sbjct  277   YQTPKHVNVGQHVASNVPSLAEFCEESGKSQNSASTLKALSSVMLAIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L   +  I   + V+ EMR A+  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALNSRNESIKSLYKVKTEMRGAIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   S+ +++ R    +S+AS+SG CQ +IPLG H +CPISVSF+   GGD+FLLD
Sbjct  397   KLNTKNKNSLKEFLDRNYALSSIASMSGCCQVTIPLGEHGECPISVSFLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+Q+EIA      +N      ++E+ K KGN A+K +QW +A+ FYTEAIK
Sbjct  457   TILDVYASLQDQSEIASSLDPVSNTNGSIEASELMKEKGNAAYKGRQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATY+ NRAAAYLELG F QAE DCT+AI +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYYCNRAAAYLELGCFQQAEEDCTEAISIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DFR+ALVLEP NK A  + +RL KL 
Sbjct  577   ADFRHALVLEPQNKTAKIAEKRLRKLM  603



>ref|XP_010520942.1| PREDICTED: outer envelope protein 64, mitochondrial [Tarenaya 
hassleriana]
Length=604

 Score =   539 bits (1388),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 299/568 (53%), Positives = 395/568 (70%), Gaps = 5/568 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K     D GAF++R +LLP P PPPP A  PL+GL+F+V+D F ++ ++TGFGNP W
Sbjct  37    RRIKTLRLDDFGAFLDRFELLPFPPPPPPAAKQPLSGLTFSVADAFDVKDYITGFGNPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTH PA +T+ VVTAL++ GATCV KTI+D+M FGI+G NKHY  P NP   S +PGG 
Sbjct  97    KKTHGPAEKTAVVVTALLKTGATCVGKTIMDEMGFGITGENKHYGTPVNPKMPSHVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSGAAV+VAA LVDF+LGIDT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGAAVSVAAELVDFALGIDTTGGVRIPASFCGILGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     R  R  + A+DLF+   IP  +T  V+ K IE   G
Sbjct  217   WFARDPSVLCQVGHALLSLNAVPNRRQRCFIFADDLFELSYIPKQKTVHVIRKGIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H NL  ++++ +PSLK F  + +N +   ST ++L  V+ +++RHEF+ NH++W 
Sbjct  277   YQSPKHMNLGQHVASNIPSLKGFCEQSVNLQNSASTLKVLSSVMLSIQRHEFRTNHEEWF  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P +++Q+ E L+  +  I   + V+ EMR+A+ +LLKDDG+LVIPTV D  P
Sbjct  337   QSCKSYLGPKVSSQVLEALKSRNENIKSLYKVKTEMRAAIQNLLKDDGVLVIPTVADASP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K    +  S+ +++ R    +S+AS+SG CQ +IPLG H   PISVSF+  +GGD+FLLD
Sbjct  397   KLKTNKKNSLNEFLDRTYALSSIASMSGCCQVTIPLGNHGDHPISVSFLTYHGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEI-AVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
              V  ++A LQ+QA I +  +  S++  S EAS E+ K KGN AFK +QW +A+ FYTEAI
Sbjct  457   TVLDVYASLQDQARIMSTLAPISDSNGSLEAS-ELLKEKGNAAFKMRQWNKAVKFYTEAI  515

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             KL G +ATYF NRAAAYLELG F QAE DCT AI LDKKNVKAY RRGTARE L  Y +A
Sbjct  516   KLNGANATYFCNRAAAYLELGCFQQAEEDCTNAILLDKKNVKAYLRRGTARESLIRYKEA  575

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLF  2002
               DF++ALVLEP NK A  + +RL +L 
Sbjct  576   AADFKHALVLEPQNKTAKDAEKRLRRLL  603



>ref|XP_007036836.1| Amidase family protein isoform 3, partial [Theobroma cacao]
 gb|EOY21337.1| Amidase family protein isoform 3, partial [Theobroma cacao]
Length=466

 Score =   534 bits (1375),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 352/470 (75%), Gaps = 36/470 (8%)
 Frame = +2

Query  527   VVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNL  706
             VV +LVE GATCV KT+VD++A+ I G NKHY  PTNPA+ +R+PGG SSGAAVAVAAN 
Sbjct  2     VVLSLVEGGATCVGKTVVDELAYSIHGENKHYSTPTNPAAPARIPGGSSSGAAVAVAANF  61

Query  707   VDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRV  886
             VDFSLGI                              IPV+ SLD VG   +DP++L RV
Sbjct  62    VDFSLGI------------------------------IPVASSLDTVGLLAKDPNILHRV  91

Query  887   GHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAY  1066
             G VLLQ+PF+ QRNPR I++A+D FQ L IP +R SQVVI + EK FGRQ+++HENL+ Y
Sbjct  92    GLVLLQLPFSVQRNPRQILLADDCFQLLKIPMERVSQVVINSTEKLFGRQVLKHENLEDY  151

Query  1067  LSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIIT  1240
              S+KVPSLK F  +K+N + K+S+ RLL +V Q L+R+EFK  H++WI   KP LD  ++
Sbjct  152   FSSKVPSLKEFYRQKINVDLKISSIRLLANVAQFLQRYEFKCAHEEWISSEKPVLDSAVS  211

Query  1241  AQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY  1420
              Q++E L++ D EI+ C ++RNEMR A++ LLKDDGILVIPT   PPPK G+KE  S DY
Sbjct  212   TQINETLDLTDKEIEICKSIRNEMRLAVNSLLKDDGILVIPTTAHPPPKLGSKEIFSEDY  271

Query  1421  VSRACLFA--SLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQE  1594
                 C+F+  S+AS+SG CQ ++PLG+HD  P+SVSF+AR+GGDRFLLD VQ +++ LQE
Sbjct  272   --HNCMFSLLSIASISGCCQVTLPLGYHDNYPVSVSFIARHGGDRFLLDTVQTMYSSLQE  329

Query  1595  QAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSN  1774
              A+   +SK S NA+++E SAE+AK KGNQA+K+KQWQ+A+ FYTEAIKL GN+ATY+SN
Sbjct  330   HADTVAKSKLSRNAVNQEQSAEVAKEKGNQAYKDKQWQKAVMFYTEAIKLNGNNATYYSN  389

Query  1775  RAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
             RAAAYLELGSF+QAE DCTKAI+LDKKNVKAY RRGTAREMLGYY +AIE
Sbjct  390   RAAAYLELGSFLQAETDCTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIE  439



>ref|XP_006341842.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Solanum 
tuberosum]
Length=598

 Score =   538 bits (1386),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 300/570 (53%), Positives = 395/570 (69%), Gaps = 13/570 (2%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K + ++K D GAF+ER++LLP PQPPPP A   L+GLSFA+ D   ++ +VTGFG+P W 
Sbjct  34    KARNSIKQDFGAFIERIELLPFPQPPPPAARLSLSGLSFAIKDNIDVKEYVTGFGSPAWK  93

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             + HE AT+T+ VVTAL++ G+TCV KTI+D+   GI+G N HY  PTNP   S +PGG S
Sbjct  94    RMHEAATKTAMVVTALLKNGSTCVGKTIMDEFGLGITGENVHYGTPTNPKLPSHIPGGSS  153

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDF+LG DT G +RVP  +CG+ GF PS GAVS +G++PVSQSLD +GW
Sbjct  154   SGSAVAVAAELVDFALGTDTTGCIRVPVAFCGVFGFRPSHGAVSTIGVLPVSQSLDSIGW  213

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
               RDP VL RVGHVLLQ+P    +  R  VIA+DLFQ  N+P  +T  VV K IEK  G 
Sbjct  214   LARDPSVLHRVGHVLLQIPSIEPKRTRCFVIADDLFQLCNVPKQKTVYVVTKVIEKLSGY  273

Query  1034  QMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q  +H NL  Y+++ VPSLK F + +   +  +ST R L  V+  L+R+EF  N+++W+ 
Sbjct  274   QTPKHLNLGQYIASNVPSLKGFIEQSTIQQNGMSTLRALSSVMFLLQRYEFNTNYEEWMK  333

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   +T  +   + +A   I   + VR EMR A+ +LLK+DGILV+PT+ DPP K
Sbjct  334   SVKPRLGSQVTNHIAAAVTLAPENIKVLYKVRTEMRVAMQNLLKNDGILVLPTIADPPLK  393

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +++  S +   RA     +AS+SG CQA+IP G HD  PIS+SF+A +G D+FLLD V
Sbjct  394   LKSRKGLSAEVHDRAFALLGIASMSGCCQAAIPFGEHDNYPISLSFIASHGTDKFLLDTV  453

Query  1568  QALFAPLQEQAEIAVQSKSS-----NNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTE  1732
               +++ +Q+  E+ +QS +S     N +I    ++E+ K KGN AFK KQW +A+ +YTE
Sbjct  454   LDMYSSIQD--EVIIQSSASPLPDTNGSID---ASELLKEKGNAAFKGKQWNKAVSYYTE  508

Query  1733  AIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYN  1912
             AIKL  N ATY+SNRAAAYLELG F QAE DCTKAI LDKKNVKAY RRGTARE L +Y 
Sbjct  509   AIKLNDN-ATYYSNRAAAYLELGCFQQAEEDCTKAISLDKKNVKAYMRRGTARESLLFYK  567

Query  1913  QAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +A++D R+ALVLEP NK A+ S +RL KL 
Sbjct  568   EALQDIRHALVLEPQNKFASVSEKRLRKLI  597



>ref|XP_010491570.1| PREDICTED: outer envelope protein 64, mitochondrial [Camelina 
sativa]
Length=603

 Score =   537 bits (1384),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 287/566 (51%), Positives = 384/566 (68%), Gaps = 2/566 (0%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D GAF++R +LLP P PPPP A   L+ L+F++SD F ++ ++TGFG+P W
Sbjct  37    RRIKALREEDFGAFLDRFELLPFPPPPPPAAKQSLSDLTFSISDAFDVKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ V+T L++ GATCV KTI+D++ FG+ G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVITTLLKHGATCVGKTIMDELGFGVIGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRIPASFCGILGFRPSQGTVSSVGVLPTSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+++ A+DLF+  +IP  ++  VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAVPHKRQRSLIFADDLFELSDIPKQKSVHVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++ VPSL  F + +G+++   ST + L  V+  ++RHEFK NH++W 
Sbjct  277   YQTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLKALSSVMLAIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L   +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALNSRNESIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   K     +++ R    +S+AS+SG CQ +IPLG H  CPISVSF+   GGD+FLLD 
Sbjct  397   KLNTKNKSLKEFLDRTYALSSIASMSGCCQVTIPLGEHGDCPISVSFLTYYGGDKFLLDT  456

Query  1565  VQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKL  1744
             +  ++A LQ+QAEIA      +N      ++E+ K KGN A+K +QW +A+ FYTEAIKL
Sbjct  457   ILDVYASLQDQAEIASSLDPVSNTNGSIEASELMKEKGNAAYKGRQWNKAVNFYTEAIKL  516

Query  1745  YGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
              G +ATY+ NRAAAYLEL  F QAE DCT+AI +DKKNVKAY RRGTARE L  Y +A  
Sbjct  517   NGANATYYCNRAAAYLELACFQQAEEDCTEAISIDKKNVKAYLRRGTARESLVRYKEAAA  576

Query  1925  DFRYALVLEPTNKRAAQSAERLAKLF  2002
             DFR+ALVLEP NK A  + +RL KL 
Sbjct  577   DFRHALVLEPQNKTAKIAEKRLRKLM  602



>ref|XP_006399420.1| hypothetical protein EUTSA_v10013019mg [Eutrema salsugineum]
 gb|ESQ40873.1| hypothetical protein EUTSA_v10013019mg [Eutrema salsugineum]
Length=602

 Score =   536 bits (1380),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 290/566 (51%), Positives = 385/566 (68%), Gaps = 3/566 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D GAF++R +LLP P PPPP A   L+GL+F++SD F ++ ++TGFG+P W
Sbjct  37    RRIKALRQEDFGAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKNYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L++ GATCVAKTI+D++ FGI+G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLKNGATCVAKTIMDELGFGITGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVR+PA +CG+LGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRIPASFCGVLGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+ + A+DLF+  +IP  ++  VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAVTHKRQRSFIFADDLFELSDIPKQKSVHVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  ++++ VPSL  F  +    +   ST R L  V+ +++RHEFK NH++W 
Sbjct  277   YQTPKHINVSQHVASNVPSLAEFCEQSGKSKKSSSTLRALSSVMLSIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVAALKSRNDSIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   K+    +++ R    +S+AS+SG CQ +IPLG H  CPISVSF+   GGD+FLLD 
Sbjct  397   KLNTKKNFLNEFLDRNYALSSIASMSGCCQVTIPLGMHGDCPISVSFLTCYGGDKFLLDT  456

Query  1565  VQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKL  1744
             +  ++A LQ+QA+IA        +   E S E+ K KGN A+K +QW +A+ FYTEAIKL
Sbjct  457   IIDVYASLQDQADIASSLAPVTESDGMEVS-EVMKEKGNAAYKGRQWNKAVSFYTEAIKL  515

Query  1745  YGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
              G +ATYF NRAAAYLELG F QAE DCT+A+ +DKKNVKAY RRGTARE L  Y +A  
Sbjct  516   NGANATYFCNRAAAYLELGRFQQAEEDCTEAVSIDKKNVKAYLRRGTARESLIRYKEAAA  575

Query  1925  DFRYALVLEPTNKRAAQSAERLAKLF  2002
             DFR+ALVLEP NK A  + +RL KL 
Sbjct  576   DFRHALVLEPQNKTAKNAEKRLRKLM  601



>ref|XP_010452933.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Camelina 
sativa]
Length=604

 Score =   535 bits (1378),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 386/567 (68%), Gaps = 3/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D GAF++R +LLP P PPPP A   L+ L+F++SD F ++ ++TGFG+P W
Sbjct  37    RRIKALREEDFGAFLDRFELLPFPPPPPPAAKQSLSHLTFSISDAFDVKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ V+T L++ GATCV KTI+D++ FG+ G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVITTLLKHGATCVGKTIMDELGFGVIGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRIPASFCGILGFRPSQGTVSSVGVLPTSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+++ A+DLF+  +IP  +   VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAVPHKRQRSLIFADDLFELSDIPKQKYVHVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H ++  Y+++ VPSL  F + +G+++   ST + L  V+  ++RHE K NH++W 
Sbjct  277   YQTPKHVSVGQYVASNVPSLVEFCEESGKSQNSASTLKALSSVMLAIQRHELKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L   +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALNSRNESIKSLYKVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   S+ +++ R    +S+AS+SG CQ +IPLG H  CPISVSF+   GGD+FLLD
Sbjct  397   KLNTKNKNSMKEFLDRTYALSSIASMSGCCQVTIPLGEHGDCPISVSFLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+QAEIA      +NA     ++E+ K KGN A+K +QW +A+ FYTEAIK
Sbjct  457   TILDVYASLQDQAEIASSLDPVSNANGSVEASELMKEKGNAAYKGRQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATY+ NRAAAYLELG F QAE DCT+AI +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYYCNRAAAYLELGCFQQAEEDCTEAISIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DFR+ALVLEP NK A  + +RL KL 
Sbjct  577   ADFRHALVLEPQNKTAKIAEKRLRKLM  603



>ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica]
 gb|EMJ02161.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica]
Length=607

 Score =   534 bits (1375),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 277/529 (52%), Positives = 366/529 (69%), Gaps = 2/529 (0%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FA+SD+F ++G+VTGFG+PDWA THE AT+T+ VVTAL++ GATCV KT++D++ FGI
Sbjct  78    LTFAISDIFDVKGYVTGFGSPDWAGTHEAATKTALVVTALLKNGATCVGKTVMDELNFGI  137

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP   S +PGG SSG+AVAVAA LVDF+LGIDT G VR+PA +CG++GF
Sbjct  138   TGENVHYGTPVNPQLQSHIPGGSSSGSAVAVAAGLVDFALGIDTTGCVRIPASFCGVIGF  197

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVS +G+ P SQSLD VG FTRDP +L  VGHVLLQ+     + PR ++ A+DLF
Sbjct  198   RPSHGAVSMIGVSPNSQSLDTVGIFTRDPSILHHVGHVLLQLKSVETKRPRRLIFADDLF  257

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLSTT  1135
             Q   +PT++T QVV KAIE   G Q  +H N   Y+++ VP LK F++  +  + ++ T 
Sbjct  258   QLSKVPTEKTVQVVTKAIEHLSGYQPPKHMNFSQYVASNVPGLKGFREESVKHQNEIFTL  317

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             + L  V+  L+R EFK NH++W+   KP L P  +  +   ++     +   + VR EMR
Sbjct  318   KALSSVMLLLQRCEFKTNHEEWVKSAKPRLGPDASDHVRAAIDSTHENMKTLYKVRTEMR  377

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +AL  LLKDDGILVIPTV DPP K   K+ QS ++  R    +S+AS+SG CQ +IP+G 
Sbjct  378   AALQSLLKDDGILVIPTVADPPLKLNTKKRQSSEFNDRTLALSSIASMSGCCQVTIPVGK  437

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H + PIS+SF+A +  D+FLLD V  +++ +QE+  IA  S    +       +E+ K K
Sbjct  438   HKESPISISFIAFHSVDKFLLDTVLDMYSSIQEKVSIASHSSPLPDTNDNLDVSELLKEK  497

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN AFK KQW +A+ +YTEAIKL   SATY+ NRAAAYLELG F QAE DC+KAI LDKK
Sbjct  498   GNAAFKGKQWNKAVKYYTEAIKLNMTSATYYCNRAAAYLELGCFQQAEEDCSKAISLDKK  557

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTARE L  Y  A +DF++ALVLEP NK A  + +RL +L 
Sbjct  558   NVKAYMRRGTARESLLCYKDAAQDFKHALVLEPQNKVANLAEKRLRELM  606



>gb|KDP40901.1| hypothetical protein JCGZ_24900 [Jatropha curcas]
Length=605

 Score =   533 bits (1373),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 290/569 (51%), Positives = 390/569 (69%), Gaps = 5/569 (1%)
 Frame = +2

Query  311   RKLKKAV---KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGN  481
             R+ +KA    + D GAFVER ++LP PQPPPP A   L+GL+F++ D+F ++ +VTGFGN
Sbjct  36    RRRRKATLMNREDFGAFVERFEILPFPQPPPPAAKQSLSGLTFSIKDIFDVKDYVTGFGN  95

Query  482   PDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlp  661
             PDW +TH  A + + V+TAL++ GATCV KT++D++A GI+G N HY  P NP   S +P
Sbjct  96    PDWGRTHGVAEKMAVVMTALLKNGATCVGKTVMDELAMGITGENMHYGTPINPQMPSFVP  155

Query  662   ggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLD  841
             GG SSG+AVAVAA LVDF+LG DT G +R+PA +CGI G+ PS G++S +G IP SQSLD
Sbjct  156   GGSSSGSAVAVAAELVDFALGSDTIGCIRIPAAFCGIFGYRPSHGSISMIGAIPNSQSLD  215

Query  842   VVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEK  1021
              VGW  RDP VL RVGH LLQ+     R  R ++ A+DLFQ   +P  +T  V+ KAIEK
Sbjct  216   TVGWLARDPSVLHRVGHALLQLNAVEPRRARRLIFADDLFQLSKVPKQKTEYVISKAIEK  275

Query  1022  QFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHD  1195
               G Q ++H NL  Y+++ V SLK F  +  + +   ST + L  V+ +L+R+EFK NH+
Sbjct  276   LSGYQPLKHMNLGQYIASNVQSLKGFCEESTHLQNGTSTLKALSSVMVSLQRYEFKTNHE  335

Query  1196  DWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVID  1375
             +W+  VKP L P ++  +   +      I   + +R+EMR+AL  LLKDDG+LVIPTV D
Sbjct  336   EWVKSVKPKLAPDVSNHVLAAINTTYENIKMLYKIRSEMRTALHSLLKDDGLLVIPTVAD  395

Query  1376  PPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFL  1555
             PP K   K+  S     RA + +S+AS+SG CQ +IPLG HD  P+SVSF++ +G D+F+
Sbjct  396   PPFKLNTKKVYSTASYDRALILSSIASMSGCCQVTIPLGKHDGFPVSVSFISFHGADKFV  455

Query  1556  LDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEA  1735
             LD V  +++ LQEQ  I   S    +      ++E+ K KGN AFK KQW +A+ +YTEA
Sbjct  456   LDTVLDMYSALQEQVGIVSNSAPIPDINGNIDASELLKEKGNAAFKGKQWNKAVNYYTEA  515

Query  1736  IKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQ  1915
             IKL   +ATY+SNRAAA+LELG F QAE DC+KAI LDKKNVKAY RRGTARE L +Y +
Sbjct  516   IKLNELNATYYSNRAAAFLELGCFQQAEEDCSKAISLDKKNVKAYLRRGTARESLLFYKE  575

Query  1916  AIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             A +DF++ALVLEP NK A+ + +RL KL 
Sbjct  576   AAQDFKHALVLEPQNKVASLAEKRLRKLM  604



>ref|XP_006286476.1| hypothetical protein CARUB_v10000509mg [Capsella rubella]
 gb|EOA19374.1| hypothetical protein CARUB_v10000509mg [Capsella rubella]
Length=604

 Score =   531 bits (1368),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 384/567 (68%), Gaps = 3/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D  AF++R +LLP P PPPP A   L+GL+F++SD F ++ ++TGFG+P W
Sbjct  37    RRIKALREEDFAAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L++ GATCV KTI+D++ FGI G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLQNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLG+DT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGVDTTGGVRIPASFCGILGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +   A R  R+ + A+DLF+  +IP  R+  VV KAIE    
Sbjct  217   WFARDPSVLCQVGHALLTLSAVAHRRQRSFIFADDLFELSDIPKQRSVHVVRKAIENLSD  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++  PSL +F +  G+++   ST R L +V+  ++RHEFK NH++W 
Sbjct  277   YQTPKHVNIGQYITSNAPSLAAFCEQFGKSQNSASTLRALSYVMLAIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+     I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALKSKTDSIKSLYRVKTEMRACIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K    + +++ R    +S+AS+SG CQ +IPLG H   PISVSF+   GGD+FLLD
Sbjct  397   KLNTKNKNFLKEFLERTYALSSIASMSGCCQVTIPLGNHGDRPISVSFLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+ AEIA      ++      ++E+ K KGN A+K +QW +A+ FYTEAIK
Sbjct  457   TILDVYASLQDHAEIASHLAPVSDTNGNMEASELMKEKGNAAYKGRQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATYF NRAAA+LELGSF QAE DCT+A+ +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYFCNRAAAFLELGSFQQAEEDCTEAVSIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DFR+ALVLEP NK A  + +RL KL 
Sbjct  577   ADFRHALVLEPQNKTAKLAEKRLRKLM  603



>ref|XP_002298203.2| chloroplast outer membrane translocon subunit family protein 
[Populus trichocarpa]
 gb|EEE83008.2| chloroplast outer membrane translocon subunit family protein 
[Populus trichocarpa]
Length=599

 Score =   531 bits (1367),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 285/567 (50%), Positives = 383/567 (68%), Gaps = 2/567 (0%)
 Frame = +2

Query  308   TRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPD  487
             TR+ K   K D GAFV+R Q+LP PQPPPP A   L GL+FA++D+F +E +VTGFGNPD
Sbjct  32    TRRRKAKFKEDFGAFVQRFQILPFPQPPPPAAKQTLAGLTFAINDIFELEDYVTGFGNPD  91

Query  488   WAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpgg  667
             WA+THE A +T+  VTAL++ GA CV KT++ ++ FG+SG N HY  P NP   + +PGG
Sbjct  92    WARTHEAAEKTAVTVTALLKNGAVCVGKTVMGELGFGVSGENIHYGTPINPEMPAHVPGG  151

Query  668   pssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVV  847
              SSG+AVAVAA LVDF+LG DT G +R+PA +CG+L + PS GAVS +GI+P SQSLD V
Sbjct  152   SSSGSAVAVAAGLVDFALGTDTIGCIRIPAAFCGLLSYRPSHGAVSTIGILPNSQSLDTV  211

Query  848   GWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQF  1027
             GW  RDP +L RVGH LL++     R  R ++ A+DLFQ   +P  +   V+ KAIE   
Sbjct  212   GWLARDPSILLRVGHTLLKLNTVEPRRARRLIFADDLFQLSKVPKQKAEVVINKAIENLS  271

Query  1028  GRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDW  1201
             G Q  +H N   ++S  VPSLK F  +  N +  +S  + L   + +L+RHEFK NH+DW
Sbjct  272   GYQPQQHINFGQHISLNVPSLKGFLDQSTNMQNGISNLKALSSAMVSLQRHEFKTNHEDW  331

Query  1202  IDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPP  1381
             +  V+P L   ++  L   +      I   + +R E+R+ +  LLKDDGILVIPTV DPP
Sbjct  332   VKSVEPKLALDVSDNLLTAINTTHENIKALYDIRKELRACMQILLKDDGILVIPTVADPP  391

Query  1382  PKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
              K  +K+  +++  +RA + +S+AS+SG CQ +IPLG +D CPISVSF+  +GGD+FLLD
Sbjct  392   SKLNSKKRDTVESHNRALILSSIASMSGCCQVTIPLGKNDGCPISVSFITFHGGDKFLLD  451

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              V  +++ L+EQ           +A     ++E+ K KGN A+K KQW +A+ +Y+EAIK
Sbjct  452   TVLDMYSSLKEQINFLSNPAPLKDANENFDASELLKEKGNAAYKGKQWNKAVNYYSEAIK  511

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATY+SNRAAAYL+LG F +AE DC  AI LDKKNVKAY RRGTARE L +Y  A 
Sbjct  512   LNGKNATYYSNRAAAYLQLGCFQKAEEDCNMAISLDKKNVKAYLRRGTARESLLFYKDAA  571

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +DF++ALVLEP NK A  + +RL KL 
Sbjct  572   QDFKHALVLEPQNKVARHAEKRLRKLM  598



>ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera]
 emb|CBI32979.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   530 bits (1366),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 290/555 (52%), Positives = 383/555 (69%), Gaps = 2/555 (0%)
 Frame = +2

Query  344   GAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTS  523
             GAFVER +LLP PQPPPP +   L+G  FAV+D+F ++G+VTGFG+  W +THE AT+T+
Sbjct  52    GAFVERFELLPFPQPPPPASRLLLSGFKFAVTDIFDVKGYVTGFGSTSWKRTHEEATKTA  111

Query  524   TVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaN  703
               VTAL++ GATCV KT++D+++FGI+G N  + +P NP   S +PGG SSG+AVAVA+ 
Sbjct  112   VAVTALLKNGATCVGKTVLDELSFGITGENMDFGSPANPVLPSHIPGGSSSGSAVAVASQ  171

Query  704   LVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRR  883
             LVDF++G DT GGVRVPA +CGILG+ PS GAVS +G++P SQSLD VGWF RDP +L R
Sbjct  172   LVDFAIGTDTIGGVRVPASFCGILGYRPSHGAVSTIGVLPSSQSLDTVGWFARDPSILHR  231

Query  884   VGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDA  1063
             VGH+LLQ+     R  RN++IA+DLFQ   +P  +T  VV K  E   G Q  +H N   
Sbjct  232   VGHILLQINPVEPRRVRNLMIADDLFQLSKVPKQKTVHVVNKVAENLSGYQPPKHVNFGQ  291

Query  1064  YLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPII  1237
             Y+++ VPSLK F  + +N +  +S  + L  V+ +L+R EFK NH++W+  VKP L P +
Sbjct  292   YIASNVPSLKGFHEQSINVKNGISALKALSSVMISLQRCEFKTNHEEWVKSVKPRLGPEV  351

Query  1238  TAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSID  1417
             + ++   +      I   + VR EMR+AL  LLKDDGILVIPTV DPP K  +K+    +
Sbjct  352   SDRVLAAINTTHENIKIFYKVRTEMRAALHSLLKDDGILVIPTVADPPLKLNSKKAVFSE  411

Query  1418  YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             +  RA    S+AS+SG CQ ++PLG H+  PISVSF+A +G D+FLLD V  ++  LQEQ
Sbjct  412   FHDRAFTLLSIASMSGCCQVTVPLGKHEDFPISVSFIAFHGADKFLLDTVLDMYPSLQEQ  471

Query  1598  AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNR  1777
             A I   S    +      ++E+ K KGN AFK +QW +A+ +YTEAIKL   +ATY+ NR
Sbjct  472   ASITSNSLPLPDTNGDMDASELLKEKGNAAFKGRQWNKAVNYYTEAIKLNETNATYYCNR  531

Query  1778  AAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPT  1957
             AAAYLELG F QA  DC+KAI LDKKNVKAY RRGTARE L  Y +A +DF++ALVLEP 
Sbjct  532   AAAYLELGCFQQAVEDCSKAILLDKKNVKAYLRRGTARESLLCYKEAAQDFKHALVLEPQ  591

Query  1958  NKRAAQSAERLAKLF  2002
             NK A  + +RL KL 
Sbjct  592   NKVANLAEKRLRKLM  606



>ref|XP_002525865.1| amidase, putative [Ricinus communis]
 gb|EEF36559.1| amidase, putative [Ricinus communis]
Length=607

 Score =   530 bits (1364),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 283/559 (51%), Positives = 379/559 (68%), Gaps = 2/559 (0%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+E+ ++LP PQ PPP A  PL+GLSFA+ D+F ++ +VTGFGNPDW +THE A
Sbjct  48    REDFGAFIEKFEILPFPQAPPPAAKQPLSGLSFAIKDIFDVKDYVTGFGNPDWRRTHEVA  107

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
              + +  VTAL++ GATCV KTI+D++  GISG N HY  P NP   S +PGG SSG+AV 
Sbjct  108   EKMAVAVTALLKNGATCVGKTIMDELGLGISGENLHYGTPMNPIMPSFVPGGSSSGSAVT  167

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAA LVDF+LG DT G +R+PA +CGI G+ PS G VS +G IP +QSLD VGW  RDP 
Sbjct  168   VAAELVDFALGTDTIGCIRIPAAFCGIFGYRPSHGTVSMIGAIPNAQSLDTVGWLARDPS  227

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             +LR VGH LL++     R  R I+ A+DLFQ   +P  +T  V+ KAIE   G Q  +H 
Sbjct  228   ILRCVGHALLKLNAVEARKARRIIFADDLFQLCKVPKQKTEYVISKAIENLSGYQSPKHL  287

Query  1052  NLDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             N   Y+++ VPSLK F + +G  +  T+ L  L  V+ +L+R+EFK NH++W+  VKP L
Sbjct  288   NFGQYIASNVPSLKGFLEQSGNLQSGTSALKALSSVMVSLQRYEFKTNHEEWVKSVKPKL  347

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
              P ++ ++   +      +   + +R+EMR+A   LLKDDGILVIPTV DPP K   K+ 
Sbjct  348   APDVSNRVLAAINATYENVKVLYKIRSEMRAATQSLLKDDGILVIPTVADPPLKLNTKKG  407

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S +   R  + +S+AS+SG CQ ++PLG HD CPISVSF++ +G D+FLLD +  ++  
Sbjct  408   YSPESHDRVIILSSIASMSGCCQVAVPLGKHDDCPISVSFISFHGADKFLLDTIVDMYLS  467

Query  1586  LQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATY  1765
             LQ Q  I   S    +      ++E+ K KGN AFK  +W +A+ +YTEAIKL G++AT+
Sbjct  468   LQAQISIVSNSPLLPDTNGNMDASELLKEKGNAAFKGGKWNKAVDYYTEAIKLNGSNATF  527

Query  1766  FSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALV  1945
             + NRAAAYLELG F QAE DC+ AI LDKKNVKAY RRGTA+E L YY +A +DF++ALV
Sbjct  528   YCNRAAAYLELGCFQQAEEDCSMAISLDKKNVKAYLRRGTAKESLLYYKEAAQDFKHALV  587

Query  1946  LEPTNKRAAQSAERLAKLF  2002
             LEP NK A ++ ERL KL 
Sbjct  588   LEPHNKAAREAEERLRKLM  606



>ref|XP_004248799.1| PREDICTED: outer envelope protein 64, mitochondrial [Solanum 
lycopersicum]
Length=598

 Score =   529 bits (1362),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 297/570 (52%), Positives = 393/570 (69%), Gaps = 13/570 (2%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K + ++K D GAF+ER++LLP PQPPPP A   L+GLSFA+ D   ++ +VTGFG+P W 
Sbjct  34    KARNSIKQDFGAFIERIELLPFPQPPPPAARLSLSGLSFAIKDNIDVKEYVTGFGSPAWK  93

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             +THE AT+T+ VVTAL++ G+TCV KTI+D+   GI+G N HY  PTNP   S +PGG S
Sbjct  94    QTHEAATKTAIVVTALLKNGSTCVGKTIMDEFGLGITGENVHYGTPTNPKLPSHIPGGSS  153

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDF+LG D  G +RVPA +CG+ GF PS  A+S +G++PVSQSLD +GW
Sbjct  154   SGSAVAVAAELVDFALGTDMTGCIRVPAAFCGVFGFRPSHRAISTVGVLPVSQSLDSIGW  213

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
               RDP VL RVGHVLLQ+P    +  R  VIA+DLFQ  N+P  +T  VV K IEK  G 
Sbjct  214   LARDPSVLHRVGHVLLQIPSIEPKRTRCFVIADDLFQLCNVPKQKTVYVVTKVIEKLSGY  273

Query  1034  QMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q  +H NL  Y+++ VPSLK F + +   +  +ST R L  V+  L+R+EF  N+++W+ 
Sbjct  274   QAPKHLNLGQYIASNVPSLKGFIEQSTIQQNGMSTLRALSSVMFLLQRYEFNTNYEEWMK  333

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   +T  +     +A   I   + VR EMR A+ +LLK+DGILV+PTV DPP K
Sbjct  334   AVKPRLGSQVTNHIAAADTLAPENIKVLYKVRTEMRVAMQNLLKNDGILVLPTVADPPLK  393

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +++    +   RA     +AS+SG CQA+IP G H+  PIS+SF+A +G D+FLLD V
Sbjct  394   LKSRKGLYAEVHDRAFALLGIASMSGCCQAAIPFGEHENYPISLSFIASHGTDKFLLDTV  453

Query  1568  QALFAPLQEQAEIAVQSKSS-----NNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTE  1732
               +++ +Q   E+++QS +S     N +I    ++E+ K KGN A+K KQW +A+ +YTE
Sbjct  454   LDMYSSIQN--EVSIQSSASPLPDTNGSID---ASELLKEKGNAAYKGKQWNKAVSYYTE  508

Query  1733  AIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYN  1912
             AIKL  N ATY+SNRAAAYLELG F QAE DCTKAI LDKKNVKAY RRGTARE L +Y 
Sbjct  509   AIKLNDN-ATYYSNRAAAYLELGCFHQAEEDCTKAISLDKKNVKAYMRRGTARESLLFYK  567

Query  1913  QAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +A++D R+ALVLEP NK A+ S +RL KL 
Sbjct  568   EALQDIRHALVLEPQNKYASVSEKRLRKLI  597



>ref|XP_009624799.1| PREDICTED: outer envelope protein 64, mitochondrial [Nicotiana 
tomentosiformis]
Length=601

 Score =   529 bits (1362),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 297/570 (52%), Positives = 394/570 (69%), Gaps = 13/570 (2%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K + ++K D GAF+ER++LLP PQPPPP AP  L+ L+FA+ D   ++ +VTGFG+P+W 
Sbjct  37    KARNSIKEDFGAFIERVELLPFPQPPPPAAPLSLSALTFAIKDNIDVKEYVTGFGSPEWK  96

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             +THE AT+T+ VVTAL++ GATCV KTI+D+   G++G N HY  PTNP   S  PGG S
Sbjct  97    RTHEVATKTAMVVTALLKNGATCVGKTIMDEFGLGVTGENLHYGTPTNPKVRSHSPGGSS  156

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDF+LG DT G +RVPA +CG+LGF PS GA+S +G++PVSQSLD +GW
Sbjct  157   SGSAVAVAAELVDFALGTDTTGCIRVPAAFCGVLGFRPSHGAISTIGVLPVSQSLDSIGW  216

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
               RDP VL RVGHVLLQ+     +  R  VIA+DLFQ   +P  +T  VV K IEK  G 
Sbjct  217   LARDPSVLHRVGHVLLQLASVEPKRTRYFVIADDLFQLCKVPKQKTMYVVSKVIEKLSGY  276

Query  1034  QMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q  +H NL  Y+++ VPSLK F++   N +  +ST   L  V+  L+R+EFK N+++W+ 
Sbjct  277   QTPKHLNLGQYIASNVPSLKGFREDSANQQNGMSTLTALSSVMFLLQRYEFKTNYEEWMK  336

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   ++A +   +      I   + VR EMR A+ +LLK + ILV+PT  DPP K
Sbjct  337   AVKPRLGSKVSAHVAAAMTSTPENIKILYKVRTEMRVAMQNLLKSNSILVLPTTTDPPSK  396

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +++  S +   R     S+AS+SG CQA+IP G HD  PIS+SF+A +G D+FLLD V
Sbjct  397   LKSRKGLSAEVHDRLFALLSIASMSGCCQAAIPFGEHDNYPISLSFIASHGTDKFLLDTV  456

Query  1568  QALFAPLQEQAEIAVQSKSS-----NNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTE  1732
               +++ LQE  E+++QS +S     N +I    ++E+ K KGN A+K KQW +A+ +YTE
Sbjct  457   LDMYSSLQE--EVSIQSSASPLPDANGSID---ASELLKEKGNAAYKGKQWNKAVSYYTE  511

Query  1733  AIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYN  1912
             AIKL  N ATY+ NRAAAYLELG F QAE DCTKAI LDKKNVKAY RRGTARE L +Y 
Sbjct  512   AIKLNDN-ATYYCNRAAAYLELGCFQQAEEDCTKAISLDKKNVKAYLRRGTARESLLFYK  570

Query  1913  QAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +A++DFR+ALVLEP NK A+ + +RL KL 
Sbjct  571   EALQDFRHALVLEPQNKVASLAEKRLRKLI  600



>ref|XP_008237381.1| PREDICTED: outer envelope protein 64, mitochondrial [Prunus mume]
Length=607

 Score =   528 bits (1361),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 274/529 (52%), Positives = 365/529 (69%), Gaps = 2/529 (0%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FA+SD+F ++G+VTGFG+PDWA THE AT+T+ VVT L++ GATCV KT++D++ FGI
Sbjct  78    LTFAISDIFDVKGYVTGFGSPDWAGTHEAATKTALVVTVLLKNGATCVGKTVMDELNFGI  137

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP   S +PGG SSG+AVAVAA LVDF+LGIDT G VR+PA +CG++GF
Sbjct  138   TGENVHYGTPVNPQLQSHIPGGSSSGSAVAVAAGLVDFALGIDTTGCVRIPASFCGVIGF  197

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVS +G+ P SQSLD VG FTRDP +L  VGHVLLQ+     +  R ++ A+DLF
Sbjct  198   RPSHGAVSMIGVSPNSQSLDTVGIFTRDPSILHHVGHVLLQLKSVETKRARRLIFADDLF  257

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLSTT  1135
             Q   +PT++T QVV KAIE   G Q  +H N   Y+++ VP LK F++  +  + ++ T 
Sbjct  258   QLSKVPTEKTVQVVTKAIEHLSGYQPPKHMNFSQYIASNVPGLKGFREESVKHQNEIFTL  317

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             + L  V+  L+R EFK NH++W+   KP L P  + ++   ++     +   + VR EMR
Sbjct  318   KALSSVMLLLQRCEFKTNHEEWVKSAKPRLGPDASDRVRAAIDSTHENMKTLYKVRTEMR  377

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +AL  LLKDDGILVIPTV DPP K   K+ QS ++  R    +S+AS+SG CQ +IP+G 
Sbjct  378   AALQSLLKDDGILVIPTVADPPLKLNTKKRQSSEFNDRTLALSSIASMSGCCQVTIPVGK  437

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H + PIS+SF+A +  D+FLLD V  +++ +QE+  IA  S    +       +E+ K K
Sbjct  438   HKESPISISFIAFHSVDKFLLDTVLDMYSSIQEKVSIASHSSPLPDTNDNLDVSELLKEK  497

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN AFK +QW +A+ +YTEAIKL   SATY+ NRAAAYLELG F QAE DC+KAI LDKK
Sbjct  498   GNAAFKGRQWNKAVKYYTEAIKLNTMSATYYCNRAAAYLELGCFQQAEEDCSKAISLDKK  557

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTARE L  Y  A +DF++ALVLEP NK A  + +RL +L 
Sbjct  558   NVKAYMRRGTARESLLCYKDAAQDFKHALVLEPQNKVANLAEKRLRELM  606



>ref|XP_009337882.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Pyrus 
x bretschneideri]
Length=611

 Score =   528 bits (1361),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 270/529 (51%), Positives = 369/529 (70%), Gaps = 2/529 (0%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SD+F ++G VTGFG+PDWA+THE AT+T+ VVT L++ GATC   T++D+++FGI
Sbjct  82    LSFAISDIFDVKGNVTGFGSPDWARTHEAATKTAFVVTTLLKNGATCYGHTVMDELSFGI  141

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP   S +PGG SSG+AVAVAA LVDF+LG DT G VR+PA +CG++G+
Sbjct  142   TGENVHYGTPVNPQLQSHIPGGSSSGSAVAVAAGLVDFALGTDTTGCVRIPASFCGVIGY  201

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVS +G++P SQSLD VG F  DP +LRRVGHVLLQ+     +  R+++ A+DLF
Sbjct  202   RPSHGAVSMLGVLPNSQSLDAVGIFAHDPSILRRVGHVLLQLNSVEPKRARHLIFADDLF  261

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTT  1135
             Q   +PT++T  VV KAIE   G Q  +H N   Y+++ VPSLK F++ + + +  + T 
Sbjct  262   QLSKVPTEKTVHVVSKAIEHLSGYQPPKHMNFSQYIASSVPSLKGFREESTKHQNGVFTL  321

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             + L  V+  ++  EFK NH++W+   KP L P ++ ++   +   +  +   + VR EMR
Sbjct  322   KTLSSVMLLIQSCEFKTNHEEWVKSAKPKLGPDVSDRVRAAINFTNENLKTLYKVRTEMR  381

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +AL  LLKDDGILVIPT+ DPP K   K+ +S ++  R     S+AS+SG CQ ++P+G 
Sbjct  382   AALQSLLKDDGILVIPTIADPPLKLNTKKGRSSEFNDRTLALTSIASMSGCCQVTVPVGK  441

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H+ CPISVSF+A +G D+FLLD V  +++ +QE+  IA  S    +      ++E+ K K
Sbjct  442   HNDCPISVSFIAFHGADKFLLDIVLDMYSSVQEKVSIASHSSPLPDTNGNMDASELLKEK  501

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN AFK +QW +A+ +Y+EAIKL   SATY+SNRAAAYLELG F QAE DC+KAI LDKK
Sbjct  502   GNVAFKGRQWNKAVNYYSEAIKLNMMSATYYSNRAAAYLELGCFQQAEEDCSKAISLDKK  561

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTARE L  Y +A +DF++ALVLEP NK A  + +RL KL 
Sbjct  562   NVKAYLRRGTARESLLCYKEAAQDFKHALVLEPQNKVANLAEKRLRKLM  610



>gb|EMT03933.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Aegilops tauschii]
Length=874

 Score =   536 bits (1380),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 288/572 (50%), Positives = 376/572 (66%), Gaps = 56/572 (10%)
 Frame = +2

Query  446   FHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYD  625
             FH+ G++T FG+ +WAKTH+ ATQTS VV+ LV+ GA CV KT++D+MA+ I G NKH+ 
Sbjct  134   FHVSGYITSFGSLEWAKTHDAATQTSLVVSTLVDGGAICVGKTVIDEMAYSIHGENKHFG  193

Query  626   APTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVS  805
              PTNPA+S R+PGG SSG+AVAVA  +VDF+LGID+ GGVRVP GYCG+L F PS   +S
Sbjct  194   TPTNPAASDRVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRVPGGYCGVLAFRPSHAVIS  253

Query  806   HMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTD  985
             + G+IPV+ SLD +GWF +DP VLRRVGH+LL++ +T  R PR+  IA+D F+   IP  
Sbjct  254   NSGVIPVAPSLDTIGWFAKDPIVLRRVGHLLLKLSYTDIRLPRHFYIADDCFEISKIPAR  313

Query  986   RTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQ  1159
             R +QVV K++EK +GRQ++ H NL  YL++K+PSL+++   + NG++K S+ + L   +Q
Sbjct  314   RLTQVVTKSVEKLYGRQVLSHVNLGNYLASKIPSLRNYSNGQKNGDSKFSSLQALSSAMQ  373

Query  1160  TLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLK  1339
              L +HEF+  H++WI+  K  +D  I   L +     D+ I+     R E+R AL+ LLK
Sbjct  374   LLHKHEFRDQHNEWINSAKSAVDASIVGNLSDD---GDSTINIVQDARKEVRLALNTLLK  430

Query  1340  DDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISV  1519
             DDGILVIPT +  PPK  A+E  S  Y +      SL+S+SG CQ ++P+G HDKCPISV
Sbjct  431   DDGILVIPTALGCPPKLNARELSSTSYNAETLCLQSLSSMSGCCQVTVPIGTHDKCPISV  490

Query  1520  SFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEK  1699
             SF+AR+GGDRFLLD  QA++A +QEQ EI  +S  S+     E +AE AK KGN AFKEK
Sbjct  491   SFIARHGGDRFLLDTTQAIYATIQEQVEILAKSNPSSKEAMNEEAAEAAKEKGNSAFKEK  550

Query  1700  QWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELG--------------------------  1801
             QWQ+AI  YTEAIKL G  ATY+SNRAAA+LEL                           
Sbjct  551   QWQKAINLYTEAIKLNGKVATYYSNRAAAFLELAKYDLFSLCNFVSNLSLRAGMYECLPF  610

Query  1802  -------------------------SFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGY  1906
                                      S+ QAE DCT AI++D K VKAY RRGTAREMLGY
Sbjct  611   IFEELGCMSVYLALRLLMIIRFGPFSYRQAETDCTSAIDIDPKIVKAYLRRGTAREMLGY  670

Query  1907  YNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             Y  A++DF +ALVLEP NK A  +  RL KLF
Sbjct  671   YKDAVDDFSHALVLEPMNKTAGVAINRLKKLF  702



>gb|AAS47585.1| chloroplast Toc64-2 [Physcomitrella patens]
Length=585

 Score =   525 bits (1353),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 289/567 (51%), Positives = 400/567 (71%), Gaps = 8/567 (1%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             + R LK + K D+GAF+   +LLPPP PPPP AP PL+GL+FAV D+F +EGF+TGFGNP
Sbjct  25    LRRTLKSSSKKDNGAFIYYFELLPPPPPPPPSAPLPLSGLTFAVKDIFDVEGFITGFGNP  84

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
              WA+THEPAT T+  V  LVEAGA CV K  +D++A+ I+G NKHY  P NPA+ +R+PG
Sbjct  85    VWAETHEPATVTAPAVKVLVEAGAKCVGKLHMDELAYSINGENKHYGTPVNPAAPNRIPG  144

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAAN VDFSLG DT G VRVPA +CGILGF PS GA+S  G++P++QS D 
Sbjct  145   GSSSGSAVAVAANCVDFSLGTDTGGSVRVPAAFCGILGFRPSHGAISVSGVLPMAQSFDT  204

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VGWF +DP  LR+VGH LLQ+P++  + PR ++IA+D F+   IP +     VI++++K 
Sbjct  205   VGWFAKDPKTLRQVGHALLQLPYSDSKQPRRVLIADDCFKLSLIPNEDVVGAVIRSVQKL  264

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDW  1201
              GRQ++++ NL  ++   VPSLK   K+++  + +    LL   +Q L+R EFK NH +W
Sbjct  265   LGRQVLQYINLGDFIRRNVPSLKELEKEISNGSPIGALTLLRTAMQLLQRWEFKENHQEW  324

Query  1202  IDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPP  1381
             +++ KP L   I A++   L++   ++     +RNE R A++DLLK+D ILV+PTV D P
Sbjct  325   LENAKPDLSSDIAARVQAALDMKGDQVSLVQQIRNEARFAINDLLKNDTILVMPTVPDIP  384

Query  1382  PKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             PK G K     ++ +RA    S++ +SG CQ S+P+G ++  P +VS +A+ G DRFLLD
Sbjct  385   PKLGIKADFPDEFRARAFDLLSVSGMSGCCQVSVPVGEYNNVPTAVSLLAKRGSDRFLLD  444

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              V   +  +QE+A      K +++  S EA AE+AK KGN +FKEK +++AI  YT+AI+
Sbjct  445   TVLTAYPTIQEEA------KGASDRFSAEA-AEMAKEKGNASFKEKDYKKAISHYTDAIR  497

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             +  N+AT+++NRA AYL+L SF +AEADCTKA+ LDKK+VKAY RRGTARE LGYY +A 
Sbjct  498   MDENNATFYNNRAMAYLQLCSFQEAEADCTKALGLDKKSVKAYLRRGTAREFLGYYKEAN  557

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +DFR A +LEPTNK A+++  RL KL 
Sbjct  558   DDFRQAQILEPTNKTASEALARLKKLL  584



>emb|CDY21581.1| BnaC09g47110D [Brassica napus]
Length=603

 Score =   525 bits (1351),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 286/567 (50%), Positives = 387/567 (68%), Gaps = 4/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   +   GAF++R +LLP P P PP A   L+GL+F++SD F I+ ++TGFG+P W
Sbjct  37    RRIKALREEHFGAFLDRFELLPFPPPSPPAAKQTLSGLTFSISDAFDIKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L+  GATCVAKT++D+M FGI+G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLINGATCVAKTVMDEMGFGITGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+VAA LVDF+LGIDT GGVR+PA +CG+LGF PS G VS +G++P SQSL+  G
Sbjct  157   SSGSAVSVAAELVDFALGIDTTGGVRIPASFCGVLGFRPSQGTVSSVGVLPNSQSLETAG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL  VGH LL +     +  R+++ A+DLF+  ++P  ++  VV KAIE   G
Sbjct  217   WFARDPSVLCHVGHALLNLSAVTHKRQRSLIFADDLFELSDVPKQKSVHVVRKAIENLPG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++ VPSL  F + +G ++ S + L  L  V+ +++RHEFK NH++W 
Sbjct  277   YQPPKHMNVGQYVASNVPSLAEFCEKSGTSQDSASSLKALASVMLSIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  ++ +   L+  +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSSDVVTALKSRNENIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   ++ +++ R    +  AS+SG CQ +IPLG H + PISVSF+A  GGD+FLLD
Sbjct  397   KLNTKNKDAVNEFLERNYALSCTASMSGCCQVTIPLGKHGESPISVSFLAYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+QA+IA      N++   E S E+ K KGN A+K +QW +A+  YTEAIK
Sbjct  457   TILEVYASLQDQADIAASLAPVNDSNGIEPS-EVMKEKGNAAYKGRQWNKAVSCYTEAIK  515

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATYF NRAAAYLELG F QAE DCT+AI +DKKNVKAY RRGTARE L  Y ++ 
Sbjct  516   LNGANATYFCNRAAAYLELGRFQQAEEDCTEAILIDKKNVKAYLRRGTARESLIRYKESA  575

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DF++ALVLEP NK A  + +RL KL 
Sbjct  576   ADFKHALVLEPQNKTAKIAEKRLRKLM  602



>emb|CDX69906.1| BnaA10g22550D [Brassica napus]
Length=603

 Score =   524 bits (1350),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 286/567 (50%), Positives = 388/567 (68%), Gaps = 4/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   +   GAF++R +LLP P PPPP A   L+GL+F++SD F I+ ++TGFG+P W
Sbjct  37    RRIKALREEHFGAFLDRFELLPFPPPPPPAAKQTLSGLTFSISDAFDIKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L+  GATCVAKT++D+M FGI+G NKHY  P NP     +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLRNGATCVAKTVMDEMGFGITGENKHYGTPINPLMPCNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+VAA LVDF+LGIDT GGVR+PA +CGI  F PS G VS +G++P SQSL+  G
Sbjct  157   SSGSAVSVAAELVDFALGIDTTGGVRIPASFCGIPAFRPSQGTVSSVGVLPNSQSLETAG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+++ A+DLF+  ++P  ++  VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAVTHKRQRSLIFADDLFELSDVPKQKSVHVVRKAIENLPG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++ VPSL  F + +G+++   ST + L  V+ +++RHEFK NH++W 
Sbjct  277   YQAPKHMNVGQYVASNVPSLAEFCEKSGKSQDSASTLKALASVMLSIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALKSRNENIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   ++ +++ R    AS+AS+SG CQ +IPLG H + PISVSF+A  GGD+FLLD
Sbjct  397   KLNTKNKNAMNEFLDRNYALASIASMSGCCQVTIPLGKHGESPISVSFLAYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+QA+IA       ++   E S E+ K KGN A+K +QW +A+  YTEAIK
Sbjct  457   TILDVYASLQDQADIAASLAPMTDSNGIEPS-EVMKEKGNAAYKGRQWNKAVSCYTEAIK  515

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G++ATYF NRAAAYLELG F QAE DCT+AI +DKKNVKAY RRGTARE L  Y ++ 
Sbjct  516   LNGSNATYFCNRAAAYLELGRFQQAEEDCTEAILIDKKNVKAYLRRGTARESLIRYKESA  575

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DF++ALVLEP NK A  + +RL KL 
Sbjct  576   ADFKHALVLEPQNKTAKIAEKRLRKLM  602



>ref|XP_011002073.1| PREDICTED: outer envelope protein 64, mitochondrial [Populus 
euphratica]
Length=600

 Score =   524 bits (1350),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 277/567 (49%), Positives = 383/567 (68%), Gaps = 2/567 (0%)
 Frame = +2

Query  308   TRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPD  487
             TR+ K   K D GAFV+R  +LP PQPPPP A   L GL+FA++D+F +E +VTGFGNPD
Sbjct  33    TRRRKAKFKEDFGAFVQRFLILPSPQPPPPAAKQTLAGLTFAINDIFELEDYVTGFGNPD  92

Query  488   WAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpgg  667
             WA+THE + +T+  VTAL++ GA CV KTI+ ++ FG+SG N HY  P NP   + +PGG
Sbjct  93    WARTHEASEKTAVTVTALLKNGAVCVGKTIMGELGFGVSGENMHYGTPINPEMPTHVPGG  152

Query  668   pssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVV  847
              SSG+AVAVAA LVDF+LG DT G +R+PA +CG+L + PS GAVS +G++P SQSLD V
Sbjct  153   SSSGSAVAVAAGLVDFALGTDTIGCIRIPAAFCGLLSYRPSHGAVSTIGVLPNSQSLDTV  212

Query  848   GWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQF  1027
             GW  RDP +L RVGH +L++     R  R ++ A+DLFQ   +P  +   V+ KAIE   
Sbjct  213   GWLARDPSILLRVGHAVLKLNTVEPRRARRLIFADDLFQLSKVPKQKAEGVISKAIENLS  272

Query  1028  GRQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDW  1201
             G Q  +H N D ++S  VPSLK F+  + + +  +S  + L   + +L+RHEFK NH+DW
Sbjct  273   GYQPEQHINFDQHISLNVPSLKGFRDQSTKLQNGISNLKALSSAMVSLQRHEFKTNHEDW  332

Query  1202  IDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPP  1381
             +  V+P L   ++  +   +      I   + +R E+R+ +  LLKD+GILVIPTV DPP
Sbjct  333   VKSVEPKLASDVSDNVLTAINTTHENIKALYDIRKELRACMQILLKDNGILVIPTVADPP  392

Query  1382  PKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
              K  +K+  +++  +RA + +S+AS+SG CQ +IPLG +D CPISVSF+  +GGD+FLLD
Sbjct  393   SKLNSKKQDTVESHNRALILSSIASMSGCCQVTIPLGKNDGCPISVSFITFHGGDKFLLD  452

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              V  +++ L+EQ           +      ++E+ K KGN A+K KQW +A+ +Y+EAIK
Sbjct  453   TVLDMYSSLKEQINFVSNPVPLQDTNENFDASELLKEKGNAAYKGKQWNKAVNYYSEAIK  512

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G  ATY+SNRAAAYL++G F +AE DC +AI LD+KNVKAY RRGTARE L +Y  A 
Sbjct  513   LNGKKATYYSNRAAAYLQVGCFQKAEEDCNRAISLDEKNVKAYLRRGTARESLLFYKDAA  572

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +DF++ALVLEP NK A  + +RL KL 
Sbjct  573   QDFKHALVLEPQNKVARHAEKRLRKLM  599



>ref|NP_196504.2| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis 
thaliana]
 sp|F4KCL7.1|OE64M_ARATH RecName: Full=Outer envelope protein 64, mitochondrial; AltName: 
Full=Mitochondrial outer membrane protein 64; Short=mtOM64; 
AltName: Full=Translocon at the outer membrane of chloroplasts 
64-V; Short=AtTOC64-V [Arabidopsis thaliana]
 gb|AED91391.1| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis 
thaliana]
Length=603

 Score =   524 bits (1349),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 284/565 (50%), Positives = 383/565 (68%), Gaps = 3/565 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R+++   + D GAF++R +LLP P PPPP A   L+GL+F++SD F ++ ++TGFG P W
Sbjct  37    RRIRALREEDFGAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L++ GATCV KTI+D++ FGI G NKHY  P NP     +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLKNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVRVPA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF  DP VL +VGH LL +     R  R+++ A+DLF+  +IP  ++ QVV KAIE   G
Sbjct  217   WFASDPSVLCQVGHALLNLSAVTHRRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              +  +H N+  Y+++ VPSL  F + +G+++   ST R L  V+  ++RHEFK NH++W 
Sbjct  277   YKTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWW  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+NEMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALKSKNESIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             +   K  +S+ +++ R    + +AS+SG CQ +IPLG H   PISVS +   GGD+FLLD
Sbjct  397   RLNTKRNKSLNEFLDRTYALSCIASMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
                 ++A LQ+QA++A      ++      ++E+ K KGN A+K KQW +A+ FYTEAIK
Sbjct  457   TTLDVYASLQDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATY+ NRAAA+LEL  F QAE DCTKA+ +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYYCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  EDFRYALVLEPTNKRAAQSAERLAK  1996
              DFR+ALVLEP NK A  + +RL K
Sbjct  577   ADFRHALVLEPQNKTAKVAEKRLRK  601



>ref|XP_006493887.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Citrus 
sinensis]
Length=605

 Score =   523 bits (1347),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 292/569 (51%), Positives = 387/569 (68%), Gaps = 8/569 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R LK   + D GAF+ER +L+P PQPPPP A  PL GL FA+ DVF ++G+VTGFG+PDW
Sbjct  39    RNLKLNGRVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDW  98

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              + H  A +T+ VVT L++ GATC+ KT++D+ AFGI+G NKHY  P NP   S +PGG 
Sbjct  99    KRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGS  158

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AVAVAA LVDF+LG DT G VRVPA +CGILG+ PS G VS +G++P SQSLD VG
Sbjct  159   SSGSAVAVAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVG  218

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
                R+  +L RVGHVLLQ+     R  R ++ A+D+FQ   +P  +T  V+ KAIE   G
Sbjct  219   LLARNASILHRVGHVLLQLNTVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSG  278

Query  1031  RQMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q   H N+  Y+++ VPSLK  +    + E   +T + L  V+ +L+R+EFK  +++W+
Sbjct  279   YQNPEHMNVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWV  338

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                KP L   +  ++ E +      I   + VRNEMR+AL  LLKDD ILVIPTV DPP 
Sbjct  339   KSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPL  398

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   K+T S ++  R  + +S+ S+SG CQ +IP+G +++ PIS+SF+  +GGD+FLLD 
Sbjct  399   KLNTKKTYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDT  458

Query  1565  VQALFAPLQEQAEIA---VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEA  1735
             V  L+  LQEQ  IA   V    +N +I    ++E+ K KGN AFK KQW +A+ +Y+EA
Sbjct  459   VLDLYDSLQEQVNIASNLVPLPDTNGSID---ASELLKEKGNAAFKGKQWNKAVNYYSEA  515

Query  1736  IKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQ  1915
             IKL G SATY+SNRAAAYLELG F QAE DC+K I LDKKNVKAY RRGTARE L  YN+
Sbjct  516   IKLNGTSATYYSNRAAAYLELGCFQQAEEDCSKTISLDKKNVKAYLRRGTAREALFCYNE  575

Query  1916  AIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             A++DF++A+VLEP NK A  + +RL KL 
Sbjct  576   ALQDFKHAMVLEPQNKAANLAEKRLRKLI  604



>emb|CDO97443.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   523 bits (1346),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 289/567 (51%), Positives = 380/567 (67%), Gaps = 3/567 (1%)
 Frame = +2

Query  311   RKLK--KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             R+LK   A+K D G+FVER +L P PQPPPP A  PL+GL+FA+ D+  ++GFVTGFG+ 
Sbjct  34    RRLKSRNAIKEDFGSFVERFELSPFPQPPPPAARLPLSGLTFAIKDIIDVKGFVTGFGSV  93

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW KTHE A +T+ VVTAL+++GATCV KTI+D+  FGI+G N HY  PTNP   S +PG
Sbjct  94    DWKKTHEVAAKTAVVVTALLQSGATCVGKTIMDEFGFGITGENSHYGTPTNPNLPSHIPG  153

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF++G DT G +R+PA +CGILGF PS G VS +G++P SQSLD 
Sbjct  154   GSSSGSAVAVAAKLVDFAIGTDTIGCIRIPASFCGILGFRPSHGIVSLVGVLPNSQSLDT  213

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VGWF RDP  LR VGHVLLQ+     R  R ++IA+DLFQ   +P  +T  V  +   K 
Sbjct  214   VGWFARDPSTLRHVGHVLLQLNPLETRKTRRLLIADDLFQLSKVPKWKTIDVFKRVTGKL  273

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDW  1201
              G Q   H     Y+S+ VPSLK F ++L  +  +S  + L  V+  L+R+EF+ NH++W
Sbjct  274   SGYQTANHIKFGQYISSNVPSLKGFHEELKNQTLISNVKALASVMSILQRYEFRTNHEEW  333

Query  1202  IDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPP  1381
                VKP L P ++  +   +      I   + +R+EMR+AL  LLKDDGILVIPTV DPP
Sbjct  334   FVSVKPRLGPRVSDGVLAAINTTPENIKILYKIRSEMRTALQALLKDDGILVIPTVADPP  393

Query  1382  PKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
              K   K+    +++ R    +S+AS+SG CQ S+P G HD  P+SVSF+A +G D+FLLD
Sbjct  394   LKLNIKKGAFSEFLDRTFALSSIASMSGCCQVSVPFGEHDDYPVSVSFIASHGADKFLLD  453

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  +++ LQ++      S    +      ++E+ K KGN A+K KQW +A+ +YTEAI 
Sbjct  454   TIVDMYSSLQDEVSTVSNSPPLPDINGNMETSELLKEKGNAAYKGKQWNKAVSYYTEAIG  513

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L    ATY+ NRAAA+LELG F QAE DCT AI LDKKNVKAY RRGTARE L  Y +A+
Sbjct  514   LNDKIATYYCNRAAAFLELGCFQQAEEDCTSAISLDKKNVKAYLRRGTARESLLCYKEAL  573

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DF++ALVLEP NK A  + +RL KL 
Sbjct  574   LDFKHALVLEPQNKAANLAEKRLRKLI  600



>ref|XP_009344574.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Pyrus 
x bretschneideri]
Length=604

 Score =   523 bits (1346),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 270/529 (51%), Positives = 366/529 (69%), Gaps = 2/529 (0%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SD+F ++G+VTGFG+PDWA+THE A +T+ VVTAL++ GATCV  T++D++ FGI
Sbjct  75    LSFAISDIFDVKGYVTGFGSPDWARTHEAAAKTAFVVTALLKNGATCVGHTVMDELNFGI  134

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP   S +PGG SSG+AVAVAA LVDF+LG DT G VR+PA +CG++G+
Sbjct  135   TGENVHYGTPVNPELQSHIPGGSSSGSAVAVAAGLVDFALGTDTTGCVRIPASFCGVIGY  194

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVS +G++P SQSLD VG F  DP +L  VGHVLLQ+     +  R ++ A+DLF
Sbjct  195   RPSHGAVSMLGVLPNSQSLDAVGIFACDPSILHHVGHVLLQLNSVEPKRARRLIFADDLF  254

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTT  1135
             Q   IPT++T  VV KAIE   G Q  +H N   Y+++ VPSLK+F++ + + +  + T 
Sbjct  255   QLPKIPTEKTVHVVSKAIEHLSGYQPPKHMNFSQYIASNVPSLKAFREESTKHQNGVFTL  314

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
             + L  V+  ++  EFK NH++W+   KP L P ++ ++   +   +  +   + VR EMR
Sbjct  315   KALSSVMLLIQSCEFKTNHEEWVKSAKPKLGPDVSDRVRAAINSTNENMKTLYKVRAEMR  374

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGF  1495
             +AL  LLKDDGILVIPT+ DPP K   K+  S ++  R     S+AS+SG CQ ++P+G 
Sbjct  375   AALQSLLKDDGILVIPTIADPPLKLNTKKGGSSEFNDRTLALTSIASMSGCCQVTVPVGK  434

Query  1496  HDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK  1675
             H  CPISVSF+A +G D+FLLD V  +++ +QE+  IA  S    +      ++E+ K K
Sbjct  435   HKDCPISVSFIAFHGVDKFLLDTVLDMYSSVQEKVSIASHSLPLPDTNGNMDASELLKEK  494

Query  1676  GNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             GN AFK +QW +A+ +YTEAIKL   S TY+SNRAAAYLELG F QAE DC+KAI LDKK
Sbjct  495   GNAAFKGRQWNKAVNYYTEAIKLNMMSTTYYSNRAAAYLELGCFQQAEEDCSKAISLDKK  554

Query  1856  NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             NVKAY RRGTARE L  Y +A +DF++ALVLEP NK A+ + +RL KL 
Sbjct  555   NVKAYLRRGTARESLLCYKEAAQDFKHALVLEPQNKVASLAEKRLRKLL  603



>ref|XP_009776046.1| PREDICTED: outer envelope protein 64, mitochondrial [Nicotiana 
sylvestris]
Length=601

 Score =   523 bits (1346),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 296/570 (52%), Positives = 393/570 (69%), Gaps = 13/570 (2%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K + ++K D GAF+ER++LLP PQPPPP AP  L+ L+FA+ D   ++  VTGFG+P+W 
Sbjct  37    KARNSIKEDFGAFIERIELLPFPQPPPPAAPLSLSALTFAIKDNIDVKESVTGFGSPEWK  96

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             +THE AT+T+ VVTAL++ GATCV KTI+D+   G++G N H   PTNP   S +PGG S
Sbjct  97    RTHEVATKTAMVVTALLKNGATCVGKTIMDEFGLGVTGENLHCGTPTNPKVPSHIPGGSS  156

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDF+LG DT G +RVPA +CG+ GF PS GA+S +GI+PVSQSLD +GW
Sbjct  157   SGSAVAVAAELVDFALGTDTTGCIRVPAAFCGVFGFRPSHGAISTIGILPVSQSLDSIGW  216

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
               RDP VL RVGHVLLQ+     +  R  VIA+DLFQ   +P  +T  VV K IEK  G 
Sbjct  217   LARDPSVLHRVGHVLLQLASVEPKRTRCFVIADDLFQLCKVPKQKTMYVVSKVIEKLSGY  276

Query  1034  QMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q  +H NL  Y+++ VPSLK F++  +N +  +ST   L  V+  L+R+EFK N+++W+ 
Sbjct  277   QTPKHLNLGQYIASNVPSLKGFREESINQQNGMSTLTALSSVMFLLQRYEFKTNYEEWMK  336

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   ++  +   +      I   + VR EMR A+ +LLK++ ILV+PT  DPP K
Sbjct  337   AVKPRLGSKVSTHVAAAMTSTPENIKILYKVRTEMRVAMQNLLKNNSILVLPTTADPPSK  396

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +++  S +   R     S+AS+SG CQASIP G HD  PIS+SF+A +G D+FLLD V
Sbjct  397   LKSRKGLSAEVHDRLFALLSIASMSGCCQASIPFGEHDNYPISLSFIASHGTDKFLLDTV  456

Query  1568  QALFAPLQEQAEIAVQSKSS-----NNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTE  1732
               +++ LQE  E+++QS +S     N +I    ++E+ K KGN A+K KQW +A+ +YTE
Sbjct  457   LDMYSSLQE--EVSIQSSASPLSDTNGSID---ASELLKEKGNAAYKGKQWNKAVSYYTE  511

Query  1733  AIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYN  1912
             AIKL  N ATY+ NRAAAYLELG F QAE DCTKAI LDKKNVKAY RRGTARE L +Y 
Sbjct  512   AIKLNDN-ATYYCNRAAAYLELGCFRQAEEDCTKAILLDKKNVKAYLRRGTARESLLFYK  570

Query  1913  QAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             +A++DFR+ALVLEP NK A+ + +RL KL 
Sbjct  571   EALQDFRHALVLEPQNKVASLAEKRLRKLI  600



>ref|XP_009122515.1| PREDICTED: outer envelope protein 64, mitochondrial [Brassica 
rapa]
Length=603

 Score =   521 bits (1343),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 287/567 (51%), Positives = 384/567 (68%), Gaps = 4/567 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   +   GAF++R +LLP P PPPP A   L+GL+F++SD F I+ ++TGFG+P W
Sbjct  37    RRIKALREEHFGAFLDRFELLPFPPPPPPAAKQTLSGLTFSISDAFDIKDYITGFGSPHW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L+  GATCVAKT++D+M FGI+G N HY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLRNGATCVAKTVMDEMGFGITGENMHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+VAA LVDF+LGIDT GGVR+PA +CGIL F PS G VS +G++P SQSL+  G
Sbjct  157   SSGSAVSVAAELVDFALGIDTTGGVRIPASFCGILAFRPSQGTVSSVGVLPNSQSLETAG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL +VGH LL +     +  R+++ A+DLF+  ++P  ++  VV KAIE   G
Sbjct  217   WFARDPSVLCQVGHALLNLSAVTHKRQRSLIFADDLFELTDVPKQKSVHVVRKAIENLPG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++ VPSL  F +  G  E   ST + L  V+ +++RHEFK NH++W 
Sbjct  277   YQAPKHMNVGQYVASNVPSLAEFCEKPGKSEDSASTLKALASVMLSIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVAALKSRNENIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   ++ +++ R    AS+AS+SG CQ ++PLG H   PISVSF+A  GGD+FLLD
Sbjct  397   KLNTKNKNAMNEFLDRNYALASIASMSGCCQVTVPLGKHGDSPISVSFLAYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+QA+IA       ++   E S E+ K KGN A+K +QW +A+  YTEAIK
Sbjct  457   TILDVYASLQDQADIAASLAPVTDSNGIEPS-EVMKEKGNAAYKGRQWNKAVSCYTEAIK  515

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATYF NRAAAYLELG F QAE DCT+AI +DKKNVKAY RRGTARE L  Y ++ 
Sbjct  516   LNGANATYFCNRAAAYLELGRFQQAEEDCTEAILIDKKNVKAYLRRGTARESLIRYKESA  575

Query  1922  EDFRYALVLEPTNKRAAQSAERLAKLF  2002
              DF++ALVLEP NK A  + +RL KL 
Sbjct  576   ADFKHALVLEPQNKTAKIAEKRLRKLM  602



>ref|XP_011087889.1| PREDICTED: outer envelope protein 64, mitochondrial [Sesamum 
indicum]
Length=602

 Score =   521 bits (1341),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 284/563 (50%), Positives = 385/563 (68%), Gaps = 2/563 (0%)
 Frame = +2

Query  320   KKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKT  499
             K  +K D GAF+ER +LLP PQPPPP A  PL+GL+FAV+D F I+G++TG+G+ DW +T
Sbjct  39    KNNLKEDFGAFIERFELLPSPQPPPPAARLPLSGLNFAVNDNFDIKGYITGYGSADWKRT  98

Query  500   HEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssg  679
             H  A +T+ VVT L+ +GA C+ KT++D++ FGI G NK+Y  P NPA  S +PGG SSG
Sbjct  99    HVAAGKTAVVVTTLLRSGAACLGKTVMDELGFGILGENKNYGTPINPAKPSHVPGGSSSG  158

Query  680   aavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFT  859
             +AVAVAA +VDF+LG DT G +RVPA +CGILGF PS G VS +G++P SQSLD VGW  
Sbjct  159   SAVAVAAQIVDFALGTDTIGCIRVPASFCGILGFRPSHGIVSTVGVLPNSQSLDTVGWLA  218

Query  860   RDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQM  1039
              DP VL RVGH +L++     +  R I+IA+DLFQ   +P  +T  VV KA E+  G Q 
Sbjct  219   SDPSVLHRVGHAILKLNLLEPKRTRRIIIADDLFQLSKVPLQKTVYVVSKATERLSGYQT  278

Query  1040  IRHENLDAYLSNKVPSLKSFKKLNGEAKL--STTRLLGHVVQTLKRHEFKRNHDDWIDDV  1213
              +H N   Y+++ VPSLKSF + + + ++  ST R L   + +L+R+EF+ N+++WI   
Sbjct  279   PKHMNFGQYIASNVPSLKSFHEESEKLQIGTSTLRALSSAMLSLQRYEFRTNNEEWIKSA  338

Query  1214  KPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG  1393
             KP L P ++  +   +     ++   + VR EMR+ +  LLKDDGILVIPTV DPPPK  
Sbjct  339   KPKLGPDVSNCVRAAINATQEDVKSLYKVRMEMRATVQSLLKDDGILVIPTVADPPPKRN  398

Query  1394  AKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQA  1573
             +K+    +Y+ R     S+A++SGGCQ +IP G HD+ PISVSF+A +G D+FLLD V  
Sbjct  399   SKKGLPAEYLDRMSALLSVATMSGGCQVAIPFGKHDESPISVSFIASHGMDKFLLDTVLD  458

Query  1574  LFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
             + + LQE+  +               +AE+ K KGN A+K KQW +A+ +Y+EAIKL   
Sbjct  459   MHSSLQEEVSVVSSFSPLPYTNGNMDAAELLKEKGNAAYKGKQWNKAVSYYSEAIKLNDA  518

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+SNRAAAYLELG F QAE DC++AI LDKK VKAY RRGTARE L  Y +A++DF+
Sbjct  519   NATYYSNRAAAYLELGCFQQAEEDCSRAISLDKKYVKAYLRRGTARESLLLYREALQDFK  578

Query  1934  YALVLEPTNKRAAQSAERLAKLF  2002
             +ALVLEP NK A+ + +RL KL 
Sbjct  579   HALVLEPQNKVASLAEKRLRKLI  601



>ref|XP_010937490.1| PREDICTED: outer envelope protein 64, mitochondrial, partial 
[Elaeis guineensis]
Length=628

 Score =   519 bits (1336),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 282/554 (51%), Positives = 378/554 (68%), Gaps = 2/554 (0%)
 Frame = +2

Query  344   GAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTS  523
             GAFVER +L P PQPPPP A HPL GL+FAVSD F I+G+V GFGNPDW KTHEPA +T+
Sbjct  73    GAFVERFELAPSPQPPPPAARHPLAGLNFAVSDNFEIKGYVAGFGNPDWKKTHEPANRTA  132

Query  524   TVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaN  703
               V+ L++ GA+CV KT++D++A+GI+G N HY  P NP   S +PGG SSG+AVAVAA 
Sbjct  133   VAVSMLLKNGASCVGKTVMDELAYGITGENLHYGTPVNPELPSLVPGGSSSGSAVAVAAE  192

Query  704   LVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRR  883
             LVDF+LG DT GGVR+PA +C +LGF PS G +S +G++  SQ LD +GW  RDP VL R
Sbjct  193   LVDFALGTDTIGGVRIPASFCDVLGFRPSHGIISSIGVLTNSQCLDTIGWLARDPSVLHR  252

Query  884   VGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDA  1063
             VGH+LLQ      +  R  + A+D FQ L +P  +T  V+ KA E   G Q  +H N+  
Sbjct  253   VGHILLQASPVGLKRMRRFIFADDCFQFLKVPKHKTMHVISKATETLSGYQTPKHMNISQ  312

Query  1064  YLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPII  1237
             Y+++ VPSLK F + + + +  ++T + L  V+  L+R+EFK NH++WI+ VKP +   I
Sbjct  313   YIASNVPSLKEFHEPSTKLQQGMTTLKALSTVMILLQRYEFKTNHEEWINTVKPRIGLDI  372

Query  1238  TAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSID  1417
             + ++   +      +   +  R E+R+AL+ LLKDDGILVIPT  D P    +K+   ++
Sbjct  373   STRVLAAVGSTHENVKSLYKFRMELRAALNSLLKDDGILVIPTTTDFPFNRNSKKKMPLE  432

Query  1418  YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
                R     S+A +SG CQ ++PLG HD  PISVSF++ +G D+FLLD V  +++ LQEQ
Sbjct  433   LEDRLYALLSIAGMSGCCQVTVPLGKHDGLPISVSFISSHGADKFLLDTVLDIYSSLQEQ  492

Query  1598  AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNR  1777
               IA  S  + +       +E+ K KGN AFK +QW +A+ FY+EAIK+ G +ATY+ NR
Sbjct  493   ISIASNSVPTPDTNGDMELSELLKEKGNAAFKGRQWNKAVNFYSEAIKINGTNATYYCNR  552

Query  1778  AAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPT  1957
             AAAYLELG F QAEADC++AI LDKKNVKAY RRGTAREML  Y +A +DF++ALVLEP 
Sbjct  553   AAAYLELGCFQQAEADCSQAILLDKKNVKAYLRRGTAREMLLCYKEAAQDFKHALVLEPQ  612

Query  1958  NKRAAQSAERLAKL  1999
             NK A  + +RL KL
Sbjct  613   NKAALAAEKRLRKL  626



>gb|EYU18475.1| hypothetical protein MIMGU_mgv1a020842mg [Erythranthe guttata]
Length=602

 Score =   517 bits (1331),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 284/557 (51%), Positives = 380/557 (68%), Gaps = 2/557 (0%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+ER +LLP PQPPPP A  PL+GL+FA+SD F I+G++TG+G+ +W +THE A +
Sbjct  45    DFGAFIERFELLPFPQPPPPAARLPLSGLTFAISDNFDIKGYITGYGSAEWKRTHEAAVK  104

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+ VVT ++ +GATCV KTI+D++ FGI G NK+Y  PTNP   S +PGG SSG+AVA A
Sbjct  105   TAIVVTTMLRSGATCVGKTIMDELGFGILGENKNYGTPTNPQKPSHVPGGSSSGSAVAAA  164

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A +VDF+LG D  G +RVPA +CG+LGF PS G VS +G++P SQSLD VG    DP VL
Sbjct  165   AKIVDFALGTDIVGCIRVPASFCGVLGFRPSHGIVSTIGVLPNSQSLDTVGLLASDPSVL  224

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
               VGH LLQ+   A +  R IVIA+D+FQ   +P  +T  V+ K  +K  G Q  +H N 
Sbjct  225   HLVGHALLQLNTLAPKKTRRIVIADDIFQLSKVPLQKTVYVISKVADKLSGYQTSKHMNF  284

Query  1058  DAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDP  1231
               Y++  VPSL+ F++ + + +  +ST R L   +  L+RHEFK NH++WI  VKP L  
Sbjct  285   GQYIAANVPSLQIFREESKDQQTGMSTLRALSSAMLFLQRHEFKTNHEEWIKSVKPKLSS  344

Query  1232  IITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQS  1411
              ++ ++   +      +   + VR EMR+AL +LLKDDGILVIPTV DPP K  +++   
Sbjct  345   DVSNRVLAAINTTQENVKTLYKVRIEMRAALKNLLKDDGILVIPTVADPPLKRSSRKGLP  404

Query  1412  IDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQ  1591
              ++  R     S+A++SGGCQ +IPLG HD  PISVSF+A +G D+FLLD V  +++ LQ
Sbjct  405   TEFHDRMNALLSIANMSGGCQVAIPLGKHDDSPISVSFIASHGNDKFLLDTVLDMYSSLQ  464

Query  1592  EQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFS  1771
             EQ  I   S           +AE+ K KGN A+K KQW +A+ FY+EA+KL   +ATY S
Sbjct  465   EQVSIISSSSLLPGMNGSMDAAELLKEKGNAAYKGKQWNKAVSFYSEALKLEDTNATYHS  524

Query  1772  NRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLE  1951
             NRAAAYLELG F QAE DC+KAI LDKKNVKAY RRGTARE + +Y +A++DF++ALVLE
Sbjct  525   NRAAAYLELGCFQQAEDDCSKAISLDKKNVKAYLRRGTARESMLFYKEALQDFKHALVLE  584

Query  1952  PTNKRAAQSAERLAKLF  2002
             P N+ A  + +RL KL 
Sbjct  585   PQNRVAGLAEKRLRKLI  601



>ref|XP_002871370.1| hypothetical protein ARALYDRAFT_325494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47629.1| hypothetical protein ARALYDRAFT_325494 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   516 bits (1329),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 285/582 (49%), Positives = 385/582 (66%), Gaps = 22/582 (4%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R++K   + D GAF++R +LLP P PPPP A   L+ L+F++SD F ++ ++TGFG+P W
Sbjct  37    RRIKALREEDFGAFLDRFELLPFPPPPPPAAKQSLSALTFSISDAFDVKDYITGFGSPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L++ GATCV KTI+D++ FGI G NKHY  P NP   S +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLKNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPSNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVR+PA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRIPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF  DP VL +VGH LL +   A R  R+++ A+DLF+  +IP  ++  VV KAIE   G
Sbjct  217   WFASDPSVLCQVGHALLNLSAVAHRRQRSLIFADDLFELSDIPKQKSVHVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q  +H N+  Y+++ VPSL  F + +G+++   ST + L  V+  ++RHEFK NH++W 
Sbjct  277   YQTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLKALSSVMLAIQRHEFKTNHEEWS  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+ EMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALKSRNESIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             K   K   S+ +++ R    +S+AS+SG CQ +IPLG H   PISVSF+   GGD+FLLD
Sbjct  397   KLNTKNKNSLNEFLDRTYALSSIASMSGCCQVTIPLGQHGDRPISVSFLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
              +  ++A LQ+QA++A      ++      ++E+ K KGN A+K +QW +A+ FYTEAIK
Sbjct  457   TILDVYASLQDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGRQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATYF NRAAA+LELG F QAE DCT+A+ +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYFCNRAAAFLELGCFQQAEQDCTEAMLIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  -------------------EDFRYALVLEPTNKRAAQSAERL  1990
                                 DFR+ALVLEP NK A  + +RL
Sbjct  577   AESTLSGTVLERNIWFIISADFRHALVLEPQNKTAKAAEKRL  618



>emb|CAC05468.1| putative subunit of TOC complex [Arabidopsis thaliana]
Length=616

 Score =   514 bits (1325),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 284/578 (49%), Positives = 383/578 (66%), Gaps = 16/578 (3%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R+++   + D GAF++R +LLP P PPPP A   L+GL+F++SD F ++ ++TGFG P W
Sbjct  37    RRIRALREEDFGAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQW  96

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTHE A +T+ VVT L++ GATCV KTI+D++ FGI G NKHY  P NP     +PGG 
Sbjct  97    KKTHEAAEKTAVVVTTLLKNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGC  156

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AV+V A LVDFSLGIDT GGVRVPA +CGILGF PS G VS +G++P SQSL+ VG
Sbjct  157   SSGSAVSVGAELVDFSLGIDTTGGVRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVG  216

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF  DP VL +VGH LL +     R  R+++ A+DLF+  +IP  ++ QVV KAIE   G
Sbjct  217   WFASDPSVLCQVGHALLNLSAVTHRRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSG  276

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              +  +H N+  Y+++ VPSL  F + +G+++   ST R L  V+  ++RHEFK NH++W 
Sbjct  277   YKTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWW  336

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                K  L P  +  +   L+  +  I   + V+NEMR+ +  LLK+DGILVIPTV DPPP
Sbjct  337   QTCKSFLGPRFSNDVVTALKSKNESIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPP  396

Query  1385  KAGAKETQSI-DYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLD  1561
             +   K  +S+ +++ R    + +AS+SG CQ +IPLG H   PISVS +   GGD+FLLD
Sbjct  397   RLNTKRNKSLNEFLDRTYALSCIASMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLD  456

Query  1562  AVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
                 ++A LQ+QA++A      ++      ++E+ K KGN A+K KQW +A+ FYTEAIK
Sbjct  457   TTLDVYASLQDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIK  516

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATY+ NRAAA+LEL  F QAE DCTKA+ +DKKNVKAY RRGTARE L  Y +A 
Sbjct  517   LNGANATYYCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAA  576

Query  1922  -------------EDFRYALVLEPTNKRAAQSAERLAK  1996
                           DFR+ALVLEP NK A  + +RL K
Sbjct  577   AGYWSVTLWLIISADFRHALVLEPQNKTAKVAEKRLRK  614



>ref|XP_008348816.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Malus domestica]
Length=610

 Score =   514 bits (1324),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 271/532 (51%), Positives = 361/532 (68%), Gaps = 9/532 (2%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFA+SD+F ++G VTGFG+PDWA+THE AT+T+ VVT L++ GATC   T++D+++FGI
Sbjct  82    LSFAISDIFDVKGNVTGFGSPDWARTHEAATKTAFVVTTLLKNGATCHGHTVMDELSFGI  141

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P      S +PGG SSG+AVAVAA LVDF+LG DT G VR+PA +CG++G+
Sbjct  142   TGENVHYGTPV-XXLQSHIPGGSSSGSAVAVAAGLVDFALGTDTTGCVRIPASFCGVIGY  200

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVS +G++P SQSLD VG F RDP +L RVGHVLLQ+     +  R+++ A+DLF
Sbjct  201   RPSHGAVSMLGVLPNSQSLDAVGIFARDPSILHRVGHVLLQLNSVEPKRARHLIFADDLF  260

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-----KKLNGEAKL  1126
             Q   +PT++T  VV KAIE     Q  RH N   Y+++ VPSLK F     K  NG   +
Sbjct  261   QLSKVPTEKTVXVVSKAIEHLSRYQPPRHMNFSQYIASNVPSLKGFCEESTKHQNG---V  317

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
              T + L  V+  ++  EFK NH++W+   KP L P ++ ++   +   +  +   + VR 
Sbjct  318   FTLKALSSVMLLIQSCEFKTNHEEWVKSAKPKLGPDVSDRVRAAINFTNENMKTLYKVRT  377

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             EMR+AL  LLKDDGILVIPT+ DPP K   K+  S ++  R     S+AS+SG CQ ++P
Sbjct  378   EMRAALQSLLKDDGILVIPTIADPPLKLNTKKGWSSEFNDRTLALTSIASMSGCCQVTVP  437

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIA  1666
             +G H+ CPISVSF+A +G D+FLLD V  +++ +Q +  IA  S    +      ++E+ 
Sbjct  438   VGKHNDCPISVSFIAFHGADKFLLDIVLDMYSSVQLKVSIASHSSPLPDTNGNMDASELL  497

Query  1667  KGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIEL  1846
             K KGN AFK +QW +A+ +YTEAIKL   SATY+SNRAAAYLELG F QAE DC+KAI L
Sbjct  498   KEKGNAAFKGRQWNKAVNYYTEAIKLNMMSATYYSNRAAAYLELGCFQQAEEDCSKAISL  557

Query  1847  DKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             DKKNVKAY RRGTARE L  Y  A +DF++ALVLEP NK A  + +RL KL 
Sbjct  558   DKKNVKAYLRRGTARESLLCYKDAAQDFKHALVLEPQNKVANLAEKRLRKLM  609



>gb|EPS65438.1| hypothetical protein M569_09339, partial [Genlisea aurea]
Length=592

 Score =   513 bits (1322),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 387/567 (68%), Gaps = 5/567 (1%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K K  VK   GAFVER +LLP  QPPPP A  PL GL+FAV+D F ++G+VTG G+ DW 
Sbjct  28    KSKNRVKLQFGAFVERFELLPFAQPPPPAARFPLAGLTFAVNDNFDVKGYVTGNGSTDWR  87

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             KTHE A +T+ VVTA++  GATCV KT++D++ FGI G N+ +  PTNP + S +PGG S
Sbjct  88    KTHEEAGKTAIVVTAMLRNGATCVGKTVMDELGFGILGENRSHGTPTNPQNPSHVPGGSS  147

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDFSLG DT G +RVPA +CGI GF PS G  S +G+ P SQSLD VG 
Sbjct  148   SGSAVAVAAQLVDFSLGTDTIGCIRVPASFCGIFGFKPSHGTASAIGVSPNSQSLDTVGC  207

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
             F  DP +L RVGHVLLQ+     +  R I++A+DLFQ   +P  + + VV K  E   G 
Sbjct  208   FASDPSILHRVGHVLLQLNLVEPKRTRRIIVADDLFQLSKLPAQKIANVVAKVTENLSGY  267

Query  1034  QMIRHENLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +     NL  Y+++ VPSLKSF     N +  ++  + L  V+  L+R+EFK NH++WI 
Sbjct  268   KSPTSMNLGQYIASNVPSLKSFNDDSTNQQKGIAALKALSSVMLLLQRYEFKTNHEEWIK  327

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L P +++Q+HE + V    +   + VR EMR+AL  LL+DDGILV+PTV D PPK
Sbjct  328   SVKPKLGPEVSSQVHEAMNVKLENVKNLYRVRVEMRAALQSLLQDDGILVLPTVADFPPK  387

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               ++++    +  R     S+A++SG CQA++PLG +D  PISVSF+A +G D+FLLD V
Sbjct  388   LNSRKSLPSGFYDRMYALLSIATISGCCQAAVPLGKYDSFPISVSFMASHGFDKFLLDTV  447

Query  1568  QALFAPLQEQAEIAVQSKSSNNAISKEA-SAEIAKGKGNQAFKEKQWQRAIGFYTEAIKL  1744
               + + LQ+  E+   + S+   ++     AE+ K KGN AFK KQW +A+ +YTEA+KL
Sbjct  448   LDMNSSLQQ--EVLNSTSSALPYVNGNMDEAELLKEKGNAAFKGKQWNKAVSYYTEALKL  505

Query  1745  YGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
                +ATY+ NRAAAYLELG F QAE DC+KA+ LDKKNVKAY RRGTA+E L +Y +A++
Sbjct  506   NDTNATYYCNRAAAYLELGCFQQAEEDCSKAVSLDKKNVKAYLRRGTAKESLLFYKEALQ  565

Query  1925  DFRYALVLEPTNKRAAQSAERLAKLFH  2005
             DF++ALVLEP NK AA++ +RL +L +
Sbjct  566   DFKHALVLEPHNKAAAEAEKRLRRLLN  592



>ref|XP_010267662.1| PREDICTED: outer envelope protein 64, mitochondrial [Nelumbo 
nucifera]
Length=600

 Score =   513 bits (1321),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 280/556 (50%), Positives = 381/556 (69%), Gaps = 2/556 (0%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+ER +LLP PQPPPP A   L+GL+FA+SD+F ++ +VTGFGNPDW +THEPA +
Sbjct  43    DFGAFIERFELLPAPQPPPPAARQLLSGLNFAISDIFDVKEYVTGFGNPDWKRTHEPAGR  102

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  V++L++ GATC+ KT++D++AFGI+G N H+  P NP   S +PGG SSG+AVAVA
Sbjct  103   TAVAVSSLLKNGATCIGKTVMDELAFGITGENLHHGTPNNPEMPSHVPGGSSSGSAVAVA  162

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDF+LG DT G VR+P   CGI+GF PS G VS +G++  SQSLD VGWF RDP +L
Sbjct  163   AGLVDFALGTDTTGCVRIPGSCCGIIGFRPSHGVVSTVGVLSNSQSLDTVGWFARDPSIL  222

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
               VG +LLQV     R  R  + A+D FQ   +P  ++  VV ++ E   G Q  +H N+
Sbjct  223   HHVGRILLQVSPVELRRTRRFIFADDCFQLSKVPKQKSVYVVNRSTENLSGYQPPKHMNI  282

Query  1058  DAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDP  1231
               Y+++ VPSLK F +   N     ST + L  V+  L+R+EFK NH++WI  VKP L P
Sbjct  283   GQYIASNVPSLKGFHEPSSNLHHGTSTLKALSTVMLLLQRYEFKTNHEEWIKTVKPKLGP  342

Query  1232  IITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQS  1411
              I+ ++   +  ++  I   + VR E+R+AL +LLKDDGILV+PT+ D   K  + +   
Sbjct  343   DISGRVLAAINTSNENIKTFYKVRIELRAALHNLLKDDGILVLPTIPDSMLKLNSSKNLF  402

Query  1412  IDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQ  1591
              ++ ++A    S+AS+SG CQ ++PLG HD  PIS+SF+A +G D+FLLD +  +++ LQ
Sbjct  403   TEFHNQAFALLSIASMSGCCQVTVPLGKHDGSPISISFIASHGADKFLLDTILDIYSSLQ  462

Query  1592  EQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFS  1771
             EQA I   S    +      ++E+ K KGN AFK +QW +A+ +Y+EAIKL G +AT++ 
Sbjct  463   EQANITSNSLPMQDIDGNIDTSELLKEKGNAAFKGRQWNKAVSYYSEAIKLNGTNATFYC  522

Query  1772  NRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLE  1951
             NRAAAYLELG F QAEADC++AI LDKKNVKAY RRGTARE L  Y +A EDF++ALVLE
Sbjct  523   NRAAAYLELGCFQQAEADCSQAILLDKKNVKAYLRRGTARESLFRYKEAAEDFKHALVLE  582

Query  1952  PTNKRAAQSAERLAKL  1999
             P NK A  + +RL KL
Sbjct  583   PHNKVANLAEKRLRKL  598



>gb|KHN00149.1| Translocon at the outer membrane of chloroplasts 64 [Glycine 
soja]
Length=365

 Score =   503 bits (1296),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 241/364 (66%), Positives = 298/364 (82%), Gaps = 2/364 (1%)
 Frame = +2

Query  920   QRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLK--  1093
             QR+PR IVIA+D FQ +N+P DR+SQVV+K  EK FGRQ+++H NL  YLS++VPSLK  
Sbjct  2     QRSPRQIVIADDCFQHINVPLDRSSQVVVKTTEKLFGRQVLKHINLGDYLSSRVPSLKGC  61

Query  1094  SFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVAD  1273
             S +K NGE K S  +LL +++Q+L+RHEF+  HD+W++ VKP L P ++AQLHE  EV+D
Sbjct  62    SGQKTNGEVKASALKLLANIMQSLQRHEFRLKHDEWMNTVKPELHPGVSAQLHEKFEVSD  121

Query  1274  TEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLA  1453
              EI+   +VR+EM +A++ LLKD+GILVIPTV DPPPK G KE  S DY SRA    S+A
Sbjct  122   AEIENSKSVRSEMCAAVNSLLKDEGILVIPTVADPPPKLGGKEILSEDYQSRAFSLLSIA  181

Query  1454  SLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNN  1633
             S+SG CQ SIPLGF+DK P+SVS +AR+GGDRFLLD +Q ++  LQEQA+IA +SKSS N
Sbjct  182   SISGCCQVSIPLGFYDKYPVSVSLIARHGGDRFLLDTLQTVYTTLQEQADIASKSKSSGN  241

Query  1634  AISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQ  1813
             A+SKE SAEIAK KGNQA+K+KQWQ+AIGFYTEAIKL G++ATY+SNRA AYL LGS++Q
Sbjct  242   AVSKEQSAEIAKEKGNQAYKDKQWQKAIGFYTEAIKLCGDNATYYSNRAQAYLGLGSYLQ  301

Query  1814  AEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLA  1993
             A  DCTKAI LDKKNVKAYFRRGTAREMLGYY +AI+DF++ALVLEPTNKRAA +AERL 
Sbjct  302   AVEDCTKAISLDKKNVKAYFRRGTAREMLGYYKEAIDDFKHALVLEPTNKRAASAAERLR  361

Query  1994  KLFH  2005
             KLF 
Sbjct  362   KLFQ  365



>ref|XP_003524732.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Glycine 
max]
Length=603

 Score =   510 bits (1313),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 279/561 (50%), Positives = 375/561 (67%), Gaps = 1/561 (0%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             K  K D GAFVER +LLP PQPPPP A   L+ L+FA++D F ++ +VTGFGN  W  TH
Sbjct  42    KTHKQDFGAFVERFELLPFPQPPPPAAKQSLSALTFAINDTFDVKDYVTGFGNSTWKSTH  101

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
             + A +T+ VVTAL+ +GATCV KT+VD+ +FGISG NK+Y  PT+P   S   GG S G+
Sbjct  102   KAAEKTAVVVTALLMSGATCVGKTVVDEFSFGISGENKYYGTPTHPQMPSCKLGGSSCGS  161

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF++G DT G VR+PA +CGI GF PS GAVS +G++P +QSLD +GWF R
Sbjct  162   AVAVAAGLVDFAVGTDTTGCVRIPASFCGIFGFRPSHGAVSTIGVLPNAQSLDTIGWFAR  221

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP +L RVGHVLLQ+     +  R+ + A+DLFQ   IPT  T  V+ KAIE   G Q  
Sbjct  222   DPSILHRVGHVLLQLNSVETKRSRHFIFADDLFQLSKIPTQNTIYVIGKAIENMSGYQAP  281

Query  1043  RHENLDAYLSNKVPSLKSFKK-LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKP  1219
             +H NL  Y+ ++VPSL+  ++  + + + S  + L  V+ +L+ +EFK NH++W+  +K 
Sbjct  282   KHLNLCQYIDSRVPSLRLHQQSTHQQNETSILKTLSSVMLSLQGYEFKTNHEEWVKSLKY  341

Query  1220  TLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
              L   ++  +   +      I   + VR EMR A   LLKDDGILVIPTV     K   K
Sbjct  342   KLGCGVSDHVIAAINTTYDNIKALYKVRTEMRGAFQSLLKDDGILVIPTVAGSQLKLNTK  401

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
             +  S ++  R    +S+AS+SG CQ +IPLG+HD C +SVSF++ +G D+FLLD +  ++
Sbjct  402   KGFSSEFHDRTFALSSIASVSGCCQVTIPLGYHDDCSLSVSFISFHGADKFLLDTILDIY  461

Query  1580  APLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             + LQEQ  +   S    N      ++E+ K KGN AFKE+QW +A+ +Y+EAIKL G + 
Sbjct  462   STLQEQVSVGSYSLPLPNINGNRETSELLKEKGNAAFKERQWSKALSYYSEAIKLNGTNT  521

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYA  1939
             TY+ NRAAA+L+LG F QA  DC KAI LDKKNVKAY RRGTARE L  Y +A+EDF++A
Sbjct  522   TYYCNRAAAHLKLGCFQQAAEDCGKAILLDKKNVKAYLRRGTARESLLCYEEALEDFKHA  581

Query  1940  LVLEPTNKRAAQSAERLAKLF  2002
             LVLEP NK A+ + +RL KL 
Sbjct  582   LVLEPQNKDASLAEKRLRKLM  602



>gb|KFK25250.1| hypothetical protein AALP_AA8G087600 [Arabis alpina]
Length=603

 Score =   509 bits (1310),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 402/596 (67%), Gaps = 9/596 (2%)
 Frame = +2

Query  236   SSMASQSAN--LWVllglglagiliMTRKLKKAVKA----DSGAFVERlqllpppqpppp  397
             +S+ S ++N  +WV++G+ +AGI+I+    K+ +KA    D GAF++R +LLP P PPPP
Sbjct  6     TSIQSNASNPKVWVVIGVTIAGIVILAETRKRRIKALREEDFGAFLDRFELLPFPPPPPP  65

Query  398   kaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTI  577
              A   L+GL+F++SD F ++ ++TGFG+  W KTHE A +T+ VVT L++ GATCV KTI
Sbjct  66    AAKQSLSGLTFSISDSFDVKDYITGFGSSQWKKTHEVAEKTAVVVTTLLKNGATCVGKTI  125

Query  578   VDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPA  757
             +++M FGI G NK Y  P NP   S +PGG SSG+AV+V A LVDF+LGIDT GGVR+PA
Sbjct  126   MEEMGFGILGENKQYGTPINPLMPSNVPGGCSSGSAVSVGAKLVDFALGIDTTGGVRIPA  185

Query  758   GYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRN  937
              +CGILGF  S G VS +G++P SQS+  VGWF RDP VL +VGH LL +     +  R+
Sbjct  186   SFCGILGFRSSQGTVSSVGVLPNSQSIGTVGWFARDPSVLCQVGHALLNLSAVTHKRQRS  245

Query  938   IVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGE  1117
              + A+DLF+  +IP  ++  VV KAIE   G Q  +H N+  ++++ VPSL  F   +G+
Sbjct  246   FIFADDLFELSDIPKQKSVHVVRKAIENLSGYQTPKHINVGQHIASNVPSLAEFCDQSGK  305

Query  1118  AK--LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKC  1291
             ++   ST + L  V+ +++RHEFK NH++W    K    P  ++ +   L+  +  I   
Sbjct  306   SQKSASTLKALSSVMLSIQRHEFKTNHEEWSKTCKSFFGPSFSSDVVAALKSRNESIKSL  365

Query  1292  HAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSI-DYVSRACLFASLASLSGG  1468
             + V+ EMR+ +  LLK+DGILVIPTV DPPPK   K    + +++ R    +S+AS+SG 
Sbjct  366   YRVKTEMRATIQSLLKEDGILVIPTVADPPPKLNTKNKSVLNEFLDRNYALSSIASMSGC  425

Query  1469  CQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKE  1648
             CQ +IPLG H   P+SVSF+A  GGD+FLLD +  ++A LQ+QA+IA     + ++    
Sbjct  426   CQVTIPLGTHGDRPVSVSFLAYYGGDKFLLDTILDVYASLQDQADIASSLAPATDSNGSM  485

Query  1649  ASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADC  1828
              ++E+ K KGN A+K +QW  A+ FYTEAIKL G +ATYF NRAAAYLEL  F +AE DC
Sbjct  486   EASEVMKEKGNVAYKGRQWNVAVRFYTEAIKLNGANATYFCNRAAAYLELSRFQEAEEDC  545

Query  1829  TKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAK  1996
             T+A+ +DKKNVKAY RRGTARE L  Y +A  DFR+ALVLEP NK A  + +RL K
Sbjct  546   TEAVLIDKKNVKAYLRRGTARESLLRYKEAAADFRHALVLEPHNKTAKAAEKRLRK  601



>ref|XP_009417579.1| PREDICTED: outer envelope protein 64, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=611

 Score =   508 bits (1308),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 279/555 (50%), Positives = 377/555 (68%), Gaps = 2/555 (0%)
 Frame = +2

Query  344   GAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTS  523
             GAFVER +L P PQPPPP A HPL  L FAVSD F I+G+V G+GNPDW +THEPA+QT 
Sbjct  56    GAFVERFELAPSPQPPPPAARHPLADLKFAVSDNFEIKGYVAGYGNPDWKRTHEPASQTV  115

Query  524   TVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaN  703
              VV+AL+E GATCV +T++D+ AFG++G N HY  P NP   S +PGG SSG+AVAVAA 
Sbjct  116   VVVSALLERGATCVGRTVMDEFAFGVTGDNLHYGTPINPELPSLVPGGSSSGSAVAVAAE  175

Query  704   LVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRR  883
             LVDF+LG DT GG+R+PA +CGI GF PS G +S++G++  SQSLD +GWF RDP +L  
Sbjct  176   LVDFALGTDTIGGMRIPASFCGIFGFKPSHGTISNIGVLTNSQSLDTIGWFARDPSILHC  235

Query  884   VGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDA  1063
             VGH+LLQ      +  R  ++A+D FQ L +P  +T QV+ KA+E   G Q ++H N+  
Sbjct  236   VGHILLQASAMGPKRTRRFILADDCFQILRVPKHKTVQVLGKAVENLSGYQPLKHMNISQ  295

Query  1064  YLSNKVPSLKSFKKLNGEAKL--STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPII  1237
             Y++  V SLK F K + + +   ST R +   +  L+R+EFK NH+DW +  KP +   I
Sbjct  296   YIATNVLSLKEFVKPSTKMQHGNSTLRAISSAMVLLQRYEFKTNHEDWFNTTKPRIGIDI  355

Query  1238  TAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSID  1417
             ++Q+   +      I   + +R E+RSAL+ LLKDDGILVIPTV + P K  +++  + D
Sbjct  356   SSQVLAAVNSTQDNIKSLYKMRLELRSALNKLLKDDGILVIPTVTEFPFKRDSRKKMTPD  415

Query  1418  YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
                      S+A +SG CQ ++PLG H+  PIS+S++A +G D+FLLD V  +++ LQEQ
Sbjct  416   IEDHLHALLSIAGMSGCCQITVPLGKHESYPISISYIAAHGADKFLLDTVLDMYSSLQEQ  475

Query  1598  AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNR  1777
               IA     + +      ++E+ K KGN A+K  QW +A+ FY+EAIKL   +A Y+ NR
Sbjct  476   ITIASNLVPTPDTNGDMDASELWKEKGNAAYKGTQWNKAVSFYSEAIKLNNANAIYYCNR  535

Query  1778  AAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPT  1957
             AAAYL+L  F QAEADC++A+ LDKKNVKAY RRGTAREML  Y +A+EDF++ALVLEP 
Sbjct  536   AAAYLKLACFQQAEADCSQALLLDKKNVKAYLRRGTAREMLLCYKEALEDFKHALVLEPQ  595

Query  1958  NKRAAQSAERLAKLF  2002
             NK A  + +RL KL 
Sbjct  596   NKDAVDAEKRLRKLM  610



>ref|XP_001781385.1| predicted protein [Physcomitrella patens]
 gb|EDQ53832.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   505 bits (1301),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 284/583 (49%), Positives = 388/583 (67%), Gaps = 22/583 (4%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             + R L+ AVK D+GAF+E      PP   P  AP PL+GL+FAV D+F +EGFVTGFGNP
Sbjct  26    LRRALRLAVKRDNGAFIE--YFELPPATSPSSAPQPLSGLTFAVKDIFDVEGFVTGFGNP  83

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DWA THEPAT+T+  V  LV++GATCV K  +D++A+ I G NKHY  P NPA+ +R+PG
Sbjct  84    DWAATHEPATRTALAVKYLVDSGATCVGKLHMDELAYSIIGDNKHYGTPVNPAAPTRVPG  143

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+ VAVAA+LVDFSLG DT G VRVPA +CGILGF PS GAV  +G+IP++QS D 
Sbjct  144   GSSSGSGVAVAADLVDFSLGTDTAGSVRVPAAFCGILGFRPSHGAVPVIGVIPMAQSFDT  203

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VG F +DP +LR+VGH+LLQ+ +T  R P+  +IA+D F+   IP + +   VI++I+K 
Sbjct  204   VGCFAKDPTILRQVGHILLQLSYTDVRKPQRFLIADDCFELSLIPNEASVGAVIRSIQKL  263

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
             FGR+ ++H NL  Y+++ VPSLK  +K  G + +    LL   +Q ++R EFK NH+ W+
Sbjct  264   FGRKALQHINLGDYVASAVPSLKVLQKEIG-SDMGAISLLRTAMQMIQRWEFKVNHEGWL  322

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
                 P L P   A+    LE     +     +++E R A++DLLKDD +LV+PTV D PP
Sbjct  323   TTANPNLGPATAARTKAALETTSHLLPLLQRIKDEARYAINDLLKDDMLLVLPTVPDIPP  382

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   K     ++ +RA     +A +SG CQ ++P G HD  P++VS +AR G DRFLLD 
Sbjct  383   KLNTKPESLEEFRNRAMDLICIAGMSGCCQVTMPAGEHDDVPMAVSLLARQGSDRFLLDT  442

Query  1565  VQALFAPLQ--EQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
             + AL+A +Q  ++A+   ++  SN       +AE+AK KGN AFK   ++ AI  YT+AI
Sbjct  443   LLALYATVQVEDKADANQRASLSNGHFD---AAELAKEKGNAAFKRNDFKNAISHYTDAI  499

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
             ++ GN+ TY++NRA AYL+L S+ +AEADCTKA+ LDK +VKAY RRGTARE +GYYN+A
Sbjct  500   RIRGNNPTYYNNRAMAYLQLRSYSEAEADCTKALILDKNSVKAYLRRGTARESMGYYNEA  559

Query  1919  IED--------------FRYALVLEPTNKRAAQSAERLAKLFH  2005
              E               FR ALV EP+NK A+++  RL KL +
Sbjct  560   DEGHKRLPPATALPCAYFRQALVYEPSNKTASEALSRLKKLLY  602



>ref|XP_003531546.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform 
X1 [Glycine max]
Length=598

 Score =   503 bits (1296),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 281/564 (50%), Positives = 380/564 (67%), Gaps = 6/564 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R+ +   K D GAFVER++LLP PQP   +     + L+FA+ D+F ++G+VTGFGNP W
Sbjct  36    RRHRNLPKEDFGAFVERIELLPIPQPNQTQTL---SALTFAIKDIFDVKGYVTGFGNPQW  92

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTH  A +T+ V+TAL+  GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG 
Sbjct  93    KKTHGEAGKTAIVITALLSDGATCVGKTVMDEFSFGISGENKFYGTPTNPQMPSSIPGGS  152

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AVAVAA LVDF++G DT G VR+PA +CGILGF PS G +S +G++P +QSLD VG
Sbjct  153   SSGSAVAVAARLVDFAIGTDTTGCVRIPAAFCGILGFRPSHGVISTIGVLPNAQSLDTVG  212

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL RVG VLL +     +  R I+ A+DLFQ    P+ +T+ ++ KAIE   G
Sbjct  213   WFARDPSVLHRVGLVLLPLTSVELKRTRRIIFADDLFQLSKAPSQKTAYIIGKAIENLSG  272

Query  1031  RQMIRHENLDAYLSNKVPSLKSF-KKLNGEAK-LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q ++H NL  Y+++ VPSLK F +KL  +   LS  + L  V+ +L+ +EFK NH++W+
Sbjct  273   YQSLQHMNLCQYIASNVPSLKGFHEKLTQQQNGLSILKALTSVMFSLQGYEFKTNHEEWV  332

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
               VKP L   ++ +++  +      I   + VR EMR A   LLKDDGILVIPTV D P 
Sbjct  333   KSVKPRLGRGVSERVNAAMNATHDNIKTLYKVRTEMRGAFQHLLKDDGILVIPTVADYPL  392

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   ++  S ++  RA   +S+AS+SG CQ +IPLG H+ C  S+S ++ +G D+FLL+ 
Sbjct  393   KLNTEKGFSSEFHDRAFALSSIASISGCCQVAIPLGCHNDCCASISLISAHGVDKFLLNT  452

Query  1565  VQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKL  1744
             V  +++ LQEQ  +A      +   S E S E+ K KGN AFK + W +A+ +YTEAI L
Sbjct  453   VLDMYSTLQEQVSVAYALPLLDTNGSMETS-ELLKEKGNTAFKGRLWNKAVDYYTEAINL  511

Query  1745  YGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIE  1924
              G +ATY+SNRAAAYLELG F +AE DC  AI  DKKNVKAY RRGTARE+L  Y +A++
Sbjct  512   NGTNATYYSNRAAAYLELGCFQEAEEDCNMAILHDKKNVKAYLRRGTAREVLLCYKEALK  571

Query  1925  DFRYALVLEPTNKRAAQSAERLAK  1996
             DF++ALVLEP NK A+ + +RL K
Sbjct  572   DFQHALVLEPQNKTASLAEKRLRK  595



>ref|XP_008455198.1| PREDICTED: outer envelope protein 64, mitochondrial [Cucumis 
melo]
Length=606

 Score =   504 bits (1297),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 291/565 (52%), Positives = 372/565 (66%), Gaps = 17/565 (3%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF++R +L P PQPPPP A  PL GL+FAV DVF ++ +VTGFGNPDW +TH+ A +
Sbjct  48    DFGAFIQRFELRPFPQPPPPAARQPLAGLTFAVKDVFDVKDYVTGFGNPDWKRTHDVAEK  107

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T  VVT L++ GA CV KT++D++ FGI+G NK Y  PTNP  SS +PGG SSG+AVAVA
Sbjct  108   TDEVVTLLLKNGAACVGKTVMDELGFGITGENKQYGTPTNPKLSSFVPGGSSSGSAVAVA  167

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
               LVDF+LG DT G +R+PA +CGIL F PS G V    ++  S SLD VGWF RDP  L
Sbjct  168   GELVDFALGTDTVGCIRIPASFCGILAFRPSHGVVPMNRVLSNSPSLDTVGWFARDPSTL  227

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVGHVLL++     R  R  V A+DLFQ   +P  +T  VV KAIE   G Q  +H N 
Sbjct  228   HRVGHVLLKLNSVEPRRMRRFVFADDLFQLSKVPLQKTVHVVEKAIENLSGYQSPKHMNF  287

Query  1058  DAYLSNKVPSLKSFKKLNGEAKL----STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               YL++ VPSLK F  L+   KL    +  + L  V+  L+R EFK NH++WI  VKP L
Sbjct  288   GQYLASNVPSLKGF--LDQSPKLQKGITILKALSSVMILLQRCEFKINHEEWIKSVKPKL  345

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                 +  +   ++ +  +I   + VR E R AL  LLKDDGILVIPTV DPPPK   K+ 
Sbjct  346   GSNASEDVLAAIKTSYDDIKTLYKVRMETRIALKSLLKDDGILVIPTVADPPPKFSTKKG  405

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              + ++  R    +S++S+SG C+ ++PLG  D CPISVS +  +G D+FLLD V  +F+ 
Sbjct  406   IASEFRDRTFALSSISSMSGCCEVAVPLGKQDDCPISVSLITFHGADKFLLDTVLDIFSA  465

Query  1586  LQEQAEIAVQSKSSNNAI------SKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLY  1747
             LQEQ  IA     SNN +          ++E+ K KGN AFK +QW +A+ +Y +AIKL 
Sbjct  466   LQEQVGIA-----SNNLLPFADTNGDMDASELLKEKGNAAFKGRQWNKAVSYYADAIKLN  520

Query  1748  GNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIED  1927
             G +ATY+ NRAAAYLELG F QAE DC+KAI LDKKNVKAY RRGTARE L  Y +AI+D
Sbjct  521   GTNATYYCNRAAAYLELGCFQQAEDDCSKAILLDKKNVKAYLRRGTARESLLLYKEAIKD  580

Query  1928  FRYALVLEPTNKRAAQSAERLAKLF  2002
             F++ALVLEP NK A  + +RL KL 
Sbjct  581   FKHALVLEPQNKVANLAEKRLQKLI  605



>ref|XP_007159113.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris]
 gb|ESW31107.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris]
Length=602

 Score =   504 bits (1297),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 281/565 (50%), Positives = 377/565 (67%), Gaps = 10/565 (2%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             K  K D GAFVER ++LP PQ PP  A   L+ L+FA+++ F ++ +VTGFGNP W  TH
Sbjct  42    KTHKQDFGAFVERFEILPFPQLPPSAAKQSLSALTFAINETFDVKDYVTGFGNPTWKSTH  101

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
             + A +T+ VVTAL+++GATCV KT+VD+ +FGISG NK+Y  PTNP   S  PGG S G+
Sbjct  102   KKAEKTALVVTALLKSGATCVGKTVVDEFSFGISGENKYYGTPTNPRMPSCAPGGSSCGS  161

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF++G DT G VR+PA +CGI GF PS GAVS +G++P +QSLD +GWF  
Sbjct  162   AVAVAAGLVDFAVGTDTIGCVRIPAAFCGIFGFRPSHGAVSTIGVLPNAQSLDTIGWFAC  221

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP +L RVGHVLLQ+     +  R I+ A+DLFQ   IPT RT  V+ KAIE   G Q  
Sbjct  222   DPSILHRVGHVLLQLSSVETKRSRRIIFADDLFQLSTIPTQRTIHVIGKAIENMSGYQDP  281

Query  1043  RHENLDAYLSNKVPSLKSFKK-LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKP  1219
             +H NL  Y+ +KVPSL+  ++  + + + S  + L  V+ +L+ +EFK N+++W+  +K 
Sbjct  282   KHLNLCQYIDSKVPSLRLHEQSTHRQNETSILKTLSSVMLSLQGYEFKTNYEEWVKSLKF  341

Query  1220  TL----DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              L    D +I A     +      I   + VR EMR A   LLKDDGILVIPTV D   K
Sbjct  342   KLGRVSDHVIAA-----ISTVYDNIKALYKVRTEMRGAFQSLLKDDGILVIPTVADSQLK  396

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
                 +  S ++  R    +S+AS+SG CQ +IPLG+HD C +SVSF++ +G D+FLLDAV
Sbjct  397   LNTTKGFSSEFHDRTFALSSIASVSGCCQVTIPLGYHDGCCVSVSFISFHGADKFLLDAV  456

Query  1568  QALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLY  1747
               +++ L+EQ  +     S  +      ++E+ K KGN AFKE+QW +A+ +YTEAIKL 
Sbjct  457   LDIYSTLREQVSVGFDLVSLPDISGNMETSELLKEKGNAAFKERQWSKALSYYTEAIKLN  516

Query  1748  GNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIED  1927
             G + TY+ NRAAA+L+LG F  A  DC+KAI LDKKNVKAY RRG ARE L  Y +A+ED
Sbjct  517   GTNTTYYCNRAAAHLKLGCFQHAAEDCSKAILLDKKNVKAYLRRGAARESLLCYEEALED  576

Query  1928  FRYALVLEPTNKRAAQSAERLAKLF  2002
             F++ALVLEP NK A+ + +RL KL 
Sbjct  577   FKHALVLEPQNKDASLAEKRLRKLM  601



>ref|XP_004504805.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Cicer arietinum]
Length=606

 Score =   503 bits (1295),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 279/560 (50%), Positives = 365/560 (65%), Gaps = 3/560 (1%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             K D GAF++R ++LP PQPPPP A H L  L+FA+SD+F ++G+VTGFGNP+W +TH  A
Sbjct  46    KQDFGAFIDRFEILPFPQPPPPAAKHTLASLTFAISDIFDVKGYVTGFGNPEWKRTHGEA  105

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssr--lpggpssgaa  685
              +T+ VVTAL+  GATCV KT++D+ +FGISG NK+Y  PTNP   S         S   
Sbjct  106   EKTALVVTALLWNGATCVGKTVMDEFSFGISGENKYYGTPTNPQMPSCIPGGSSSGSXXX  165

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
              AVAA LVDF++G DT G VR+PA  CGI  F PS GAVS +G++P +QSLD VGWF RD
Sbjct  166   XAVAAGLVDFAIGTDTTGSVRIPASLCGIFSFRPSHGAVSTIGVLPNAQSLDTVGWFARD  225

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P VL RVGHVLLQ+     R  R I  A+DLFQ     T +T  V+ K IE   G Q  +
Sbjct  226   PSVLHRVGHVLLQLNSVDTRRSRCITFADDLFQLSKDATQKTIYVISKTIENMSGYQAPK  285

Query  1046  HENLDAYLSNKVPSLKSFKK-LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             H NL  Y+ +KVPSL+  ++    + + S  + L  V+ +L+R+EFK N+++W+  VK  
Sbjct  286   HMNLCEYIVSKVPSLRLHEQSAPQQNETSILKTLSSVMLSLQRYEFKANYEEWVKSVKRR  345

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L   + + +   +      I   + VR EMR AL  LLKD GILVIP+V D P K  AK+
Sbjct  346   LRGGVPSHVIAAINSTQDNIKALYKVRTEMRGALQSLLKDGGILVIPSVADGPLKLNAKK  405

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
                 ++  R    +S+AS+SG CQ +IPLG+HD C ISVSF++ +G D+FLLD +  ++ 
Sbjct  406   GYCSEFHDRTLALSSIASMSGCCQVTIPLGYHDDCCISVSFISIHGADKFLLDTILDMYT  465

Query  1583  PLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSAT  1762
              L+EQA     S    N       +E+ K +GN AFKEKQW+ A+  YTEAIKL   +AT
Sbjct  466   ALKEQAGSGFISMPLPNINGNTEPSELLKERGNAAFKEKQWENAVTHYTEAIKLNATNAT  525

Query  1763  YFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYAL  1942
             Y+ NRAAAYL+LG F QAE DC KAI  DKKNVKAY RRGTARE L  Y +A+EDF++AL
Sbjct  526   YYCNRAAAYLKLGRFQQAEEDCCKAILHDKKNVKAYLRRGTARESLLRYKEALEDFKHAL  585

Query  1943  VLEPTNKRAAQSAERLAKLF  2002
             VLEP NK A+ + +R+ KL 
Sbjct  586   VLEPQNKDASVAEKRVRKLL  605



>gb|KEH31213.1| translocon at the outer membrane ofs-like protein [Medicago truncatula]
Length=604

 Score =   501 bits (1290),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 282/562 (50%), Positives = 376/562 (67%), Gaps = 7/562 (1%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A K D GAF+ER +LLP PQ PPP A   L+ L+FA+SD+F ++G+VTGFGNP W +THE
Sbjct  44    APKPDFGAFIERFELLPFPQSPPPAAKQLLSSLTFAISDIFDVKGYVTGFGNPLWKRTHE  103

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A +T+ VVTAL+  GATCV KT++D+ +FG SG NK+Y  P NP   S +PGG SSG+A
Sbjct  104   EAEKTAMVVTALLFNGATCVGKTVMDEFSFGFSGENKYYGTPINPQMPSCVPGGSSSGSA  163

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDF++G DT G VR+PA  CGI GF PS GA+S +G++P +QSL+ +GWF RD
Sbjct  164   VAVAAGLVDFAIGTDTTGCVRIPASLCGIFGFRPSHGAISTIGVLPNAQSLETIGWFARD  223

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P VL RVG  LLQ+     +  R I+ A+DLFQS    T +   V+ KAIE   G Q  +
Sbjct  224   PSVLHRVGLALLQLNSVDTKKSRCIIFADDLFQSSKDATQKIIYVIGKAIENMSGYQSPK  283

Query  1046  HENLDAYLSNKVPSLK----SFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDV  1213
             H +L  Y+  KVPSL+    S  + NG + L T   L  V+ +++R+EFK N+++W+  V
Sbjct  284   HMDLCEYIVKKVPSLRLHEQSAHQQNGTSILKT---LSSVMLSIQRYEFKSNYEEWVKSV  340

Query  1214  KPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG  1393
             K  L   +   ++E +      I   + VR+EM +A   LLKD GILVIP+V D P K  
Sbjct  341   KRRLSRDVPKHVYEAITTTHDNIKALYKVRHEMHAAFQSLLKDGGILVIPSVADSPLKLN  400

Query  1394  AKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQA  1573
             AK+    ++  R+   +S+A++SG CQ +IPLG+HD C ISVSF++ +GGD+FLLD +  
Sbjct  401   AKKGFCSEFHDRSFALSSIATMSGCCQVTIPLGYHDGCCISVSFISNHGGDKFLLDTILD  460

Query  1574  LFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
             ++  LQEQA     S    N       +E+ K KGN AFKE+QW +A+  YT AI+L G 
Sbjct  461   MYTNLQEQASSGFNSMPLPNINGNTEPSELLKEKGNAAFKEQQWDKAVTHYTGAIELNGT  520

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+ NRAAA L+LG F  AE DC+KAI LDKKNVKAY RRGTARE L  Y +A+EDF+
Sbjct  521   NATYYCNRAAACLKLGCFQLAEEDCSKAILLDKKNVKAYLRRGTARESLLRYKEALEDFK  580

Query  1934  YALVLEPTNKRAAQSAERLAKL  1999
             +ALVLEP NK A+ + +R+ KL
Sbjct  581   HALVLEPQNKYASLAEQRVRKL  602



>ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Cucumis 
sativus]
 gb|KGN43724.1| hypothetical protein Csa_7G062900 [Cucumis sativus]
Length=606

 Score =   499 bits (1286),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 283/563 (50%), Positives = 368/563 (65%), Gaps = 13/563 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF++R +L P PQP PP A   L GL+FAV DVF ++ +VTGFGNPDW +TH+ A +
Sbjct  48    DFGAFIQRFELRPFPQPSPPAARQSLAGLTFAVKDVFDVKDYVTGFGNPDWKRTHDVAEK  107

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T  +VT L++ GA CV KT++D++ FGI+G NK Y  P NP  SS +PGG SSG+AVAVA
Sbjct  108   TDEMVTLLLKNGAACVGKTVMDELGFGITGENKQYGTPINPKLSSFVPGGSSSGSAVAVA  167

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
               LVDF+LG DT G +R+PA +CGI  F PS G +    ++  S SLD VGWF RDP  L
Sbjct  168   GELVDFALGTDTVGCIRIPASFCGIFAFRPSHGVIPMNRVLSNSPSLDTVGWFARDPSTL  227

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVGHVLL++     R  R +VIA+DLFQ   +P  +T  VV KAIE   G Q  +H N 
Sbjct  228   HRVGHVLLKLNSVEPRRMRRLVIADDLFQLSKVPLQKTVHVVEKAIENLSGYQSPKHMNF  287

Query  1058  DAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDP  1231
               YL++ VPSLK F   +   +   T L  L  V+  L+R EFK NH++WI  VKP L  
Sbjct  288   GEYLASNVPSLKGFHNQSPTLQKGITILKALSSVMILLQRSEFKINHEEWIKSVKPKLGS  347

Query  1232  IITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQS  1411
               +  +   ++ +  +I   + VR E R AL  LLKDDGILVIPTV DPPPK   K+  +
Sbjct  348   NASEDVLAAIKTSYDDIKTLYKVRMETRIALKSLLKDDGILVIPTVADPPPKFSTKKGIA  407

Query  1412  IDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQ  1591
              ++  R    +S++S+SG C+ ++PLG  D CPIS+S +  +G D+FLLD V  +F+ LQ
Sbjct  408   SEFRDRTFALSSISSMSGCCEVAVPLGKQDDCPISISLITFHGADKFLLDTVLDIFSALQ  467

Query  1592  EQAEIAVQSKSSNNAI------SKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
             EQ  +A     SNN +          ++E+ K KGN AFK +QW +A+ +YT+AIKL G 
Sbjct  468   EQVGVA-----SNNLLPFADTNGDMDASELLKEKGNAAFKGRQWNKAVNYYTDAIKLNGT  522

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+ NRAAAYLELG F QAE DC+KAI LDKK VKAY RRGTARE L  Y +AI+DF+
Sbjct  523   NATYYCNRAAAYLELGCFQQAEDDCSKAILLDKKTVKAYLRRGTARESLLLYKEAIKDFK  582

Query  1934  YALVLEPTNKRAAQSAERLAKLF  2002
             +ALVLEP NK A  + +RL KL 
Sbjct  583   HALVLEPQNKVANLAEKRLQKLI  605



>gb|EMS53790.1| RNA polymerase II-associated protein 3 [Triticum urartu]
Length=513

 Score =   496 bits (1276),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 259/474 (55%), Positives = 339/474 (72%), Gaps = 5/474 (1%)
 Frame = +2

Query  587   MAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYC  766
             MA+ I G NKH+  PTNPA+S R+PGG SSG+AVAVA  +VDF+LGID+ GGVRVP GYC
Sbjct  1     MAYSIHGENKHFGTPTNPAASDRVPGGCSSGSAVAVAGGMVDFALGIDSIGGVRVPGGYC  60

Query  767   GILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVI  946
             G+L F PS   +S+ G+IPV+ SLD +GWF +DP VLRRVGH+LL++ +T  R PR+  I
Sbjct  61    GVLAFRPSHAVISNSGVIPVAPSLDTIGWFAKDPIVLRRVGHLLLKLSYTDIRLPRHFYI  120

Query  947   ANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK--KLNGEA  1120
             A+D F+   IP  R +QVV K++EK +GRQ++ H NL  YL++K+PSL+++   + NG++
Sbjct  121   ADDCFEISKIPARRLTQVVTKSVEKLYGRQVLSHVNLGNYLASKIPSLRNYSNGQKNGDS  180

Query  1121  KLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAV  1300
             K S+ + L   +Q L +HEF+  H++WI+  K  +D  I   L +     D+ I+     
Sbjct  181   KFSSLQALSSAMQLLHKHEFRDQHNEWINSAKSAVDASIVGNLSDD---GDSTINIVQDA  237

Query  1301  RNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQAS  1480
             R E+R AL+ LLKDDGILVIPT +  PPK  A+E  S  Y +      SL+S+SG CQ +
Sbjct  238   RKEVRLALNTLLKDDGILVIPTALGCPPKLNARELSSTSYNAETLCLQSLSSMSGCCQVT  297

Query  1481  IPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAE  1660
             +P+G HDKCPISVSF+AR+GGDRFLLD  QA++A +QEQ E+  +S  S+     E +AE
Sbjct  298   VPIGTHDKCPISVSFIARHGGDRFLLDTTQAIYATIQEQVEVLAKSNPSSKEAMSEEAAE  357

Query  1661  IAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAI  1840
              AK KGN AFKEKQWQ+AI  YTEAIKL G  ATY+SNRAAA+LEL ++ QAE DCT AI
Sbjct  358   AAKEKGNSAFKEKQWQKAINLYTEAIKLNGKVATYYSNRAAAFLELANYRQAETDCTSAI  417

Query  1841  ELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             ++D K VKAY RRGTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  418   DIDPKIVKAYLRRGTAREMLGYYKEAVDDFSHALVLEPMNKTAGVAINRLKKLF  471



>ref|XP_006597350.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform 
X1 [Glycine max]
Length=598

 Score =   494 bits (1272),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 275/562 (49%), Positives = 375/562 (67%), Gaps = 10/562 (2%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             K  K D GAFVER +LLP PQP   +     + L+FA+ D+F ++G+VTGFGNP W K H
Sbjct  40    KLPKPDFGAFVERFELLPIPQPNQTQTL---SALTFAIKDIFDVKGYVTGFGNPQWKKMH  96

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
               A +T+ V+TAL+  GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG SSG+
Sbjct  97    NEAGKTAIVITALLSNGATCVGKTVMDEFSFGISGENKFYGTPTNPQMPSSIPGGSSSGS  156

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF++G DT G VR+PA +CGILGF PS G +S +G++P +QSLD VGWF R
Sbjct  157   AVAVAARLVDFAMGTDTTGCVRIPAAFCGILGFRPSHGVISTIGVLPNAQSLDTVGWFAR  216

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP VL RVG VLL +     +  R I+ A+DLFQ    P+ +T  ++ KAIE   G Q  
Sbjct  217   DPSVLHRVGLVLLPLNSVELKRTRRIIFADDLFQLCKAPSQKTVYIIGKAIENLSGYQFP  276

Query  1043  RHENLDAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             +H NL  Y+++ VPSLK F++   + +  +S  + L  V+  L+ +EFK NH++W+  VK
Sbjct  277   QHMNLCQYIASNVPSLKEFREKFTHQQNGVSILKALTSVMFYLQGYEFKTNHEEWVKSVK  336

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L   ++ +++  +      I   + VR EM  A   LLKDDGILVIPTV D P K   
Sbjct  337   PRLGRGMSERVNAAMNATHDNIKTLYKVRTEMWGAFQHLLKDDGILVIPTVADYPLKLNT  396

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             ++  S ++  RA   +S+AS+SG CQ +IPLG H+ C  SVS ++ +G D+FLL+ V  +
Sbjct  397   EKGFSSEFGDRAFALSSIASISGCCQVAIPLGCHNDCCASVSLISAHGADKFLLNTVLDM  456

Query  1577  FAPLQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYG  1750
             ++ LQEQ  +A  +    +N ++    ++E+ K KGN AFK + W +A+ +YTEAI L G
Sbjct  457   YSTLQEQVSVAYALPLPDTNGSM---GTSELLKEKGNAAFKGRLWNKAVDYYTEAINLNG  513

Query  1751  NSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDF  1930
              +ATY+SNRAAAYLELG F +AE DC  AI  DKKNVKAY RRGTARE+L  Y +A++DF
Sbjct  514   TNATYYSNRAAAYLELGCFQEAEEDCNMAILHDKKNVKAYLRRGTARELLLRYKEALKDF  573

Query  1931  RYALVLEPTNKRAAQSAERLAK  1996
             ++ALVLEP NK A+ + +RL K
Sbjct  574   QHALVLEPQNKTASLAEKRLRK  595



>ref|XP_010690507.1| PREDICTED: outer envelope protein 64, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   493 bits (1268),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 277/559 (50%), Positives = 378/559 (68%), Gaps = 3/559 (1%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER Q+LP PQPPPP AP PL GL+FAV D+F I+G +TGFGNPDW +THE  
Sbjct  45    RQDFGAFIERFQILPFPQPPPPAAPLPLHGLTFAVKDIFEIKGRITGFGNPDWKRTHEEG  104

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
              +T+ V+T L++ GATCV  T++D+++FGI+G N HY+ P NP++   +PGG SSG+AVA
Sbjct  105   EKTAVVITNLLKKGATCVGLTVLDELSFGITGENVHYETPINPSTPHHIPGGSSSGSAVA  164

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAA LVDF++G DT G  R+PA +CGI GF  S GAVS  G++P SQSLD +GWF RD  
Sbjct  165   VAAKLVDFAIGTDTIGCTRIPASFCGIFGFRASHGAVSMDGVLPNSQSLDTIGWFARDIS  224

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             VL RVG VLLQ+     R  R  V+A+DLF+   +   + S  V K  E   G Q  ++ 
Sbjct  225   VLHRVGQVLLQLK-AEHRRSRRFVVADDLFELSRVLKPKASHFVKKTTENLSGYQSPKNV  283

Query  1052  NLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             N+  Y+++ VPSLK F  K  N ++ +   + L  V+  L R+EFK NH +WI  VKP L
Sbjct  284   NIGQYIASNVPSLKVFCEKSSNMQSGVEALKALSSVMALLNRYEFKTNHGEWIMSVKPKL  343

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                ++ ++   ++    ++   + VR E+R+AL +LLK+DGILV+PT++D P K  +++ 
Sbjct  344   GADVSQRVRLAIDSLPEDVKVLYKVRVELRAALQNLLKEDGILVLPTIVDHPIKRNSRKG  403

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  RA + +S++S+SG CQ ++PL  HD  P S+SF+A +G D+FLLD V   ++ 
Sbjct  404   LSAEFYDRALVLSSISSMSGCCQVTVPLEEHDGFPTSISFIALHGADKFLLDTVLDCYST  463

Query  1586  LQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATY  1765
             L+EQ  +A +S    +A     ++E+ K KGN A+K KQW +AI +Y EAIKL G +ATY
Sbjct  464   LREQVRLASESMPLPDANGDLDASELLKEKGNDAYKGKQWNKAISYYGEAIKLNGINATY  523

Query  1766  FSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALV  1945
             + NRAAA LEL  F QAE DCTKAI LDKKNVKAY RRGTARE L  Y +A EDF++ALV
Sbjct  524   YCNRAAALLELACFQQAEDDCTKAISLDKKNVKAYLRRGTARESLLRYKEAAEDFKHALV  583

Query  1946  LEPTNKRAAQSAERLAKLF  2002
             LEP NK A+   +RL KL 
Sbjct  584   LEPHNKVASLGEKRLKKLM  602



>ref|XP_008802223.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial 
[Phoenix dactylifera]
Length=683

 Score =   487 bits (1254),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 270/554 (49%), Positives = 370/554 (67%), Gaps = 5/554 (1%)
 Frame = +2

Query  344   GAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTS  523
             GAFVER +L P PQPPPP A HPL GL+FAVSD F I+G+V GFGNPDW KTHEPA +T+
Sbjct  131   GAFVERFELAPSPQPPPPAARHPLAGLNFAVSDNFEIKGYVAGFGNPDWKKTHEPANRTA  190

Query  524   TVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaN  703
              VV+ L++ GA+CV +T++D++A+GI+G N H+  P NP   S +PGG SSG+AVAVAA 
Sbjct  191   VVVSMLLKNGASCVGRTVMDELAYGITGENLHHGTPVNPQLPSLVPGGSSSGSAVAVAAE  250

Query  704   LVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRR  883
             LVDF+LG DT GGVR+PA +C + GF PS G +S +G++  SQSLD VGW  RDP VL R
Sbjct  251   LVDFALGTDTVGGVRIPASFCEVFGFKPSHGVISSIGVLTNSQSLDTVGWLARDPSVLHR  310

Query  884   VGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDA  1063
             VGH+LLQ      +  R+ + A+D FQ L +P  +T  V+ KA E   G Q  +H N+  
Sbjct  311   VGHILLQASLVGLKRMRHFIFADDCFQFLKVPKHKTMHVISKATETLSGYQTPKHMNISQ  370

Query  1064  YLSNKVPSLKSFKKLNGEAK--LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPII  1237
             Y+++ VPSLK F + + + +  +ST + L  V+  L+R+EFK NH++WI+ VKP +   I
Sbjct  371   YIASNVPSLKEFHEPSTKLQQGMSTLKALSTVMTLLQRYEFKTNHEEWINTVKPRIGVNI  430

Query  1238  TAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSID  1417
             + ++   +      +   +  R E+R+AL+ LLKDDGILVIPT  D P    +K+   ++
Sbjct  431   STRVLAAVNSTHENVKSLYKSRMELRAALNSLLKDDGILVIPTTTDFPFNRNSKKKMPLE  490

Query  1418  YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
                R     S+A +SG CQ ++PLG HD  PISVSF+A +G D+FLLD V  +++ LQEQ
Sbjct  491   LEDRLYTLLSIAGMSGCCQVTVPLGKHDGLPISVSFIAAHGADKFLLDTVLDIYSSLQEQ  550

Query  1598  AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNR  1777
               I+  S  + +       +E+ K KGN AFK +QW +A+ FY+EAIK+   +ATY+ NR
Sbjct  551   ISISSNSVPTPDTNGNMELSELLKEKGNAAFKGRQWNKAVNFYSEAIKINNTNATYYCNR  610

Query  1778  AAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPT  1957
             AAAYLELG F QAEADC++AI LDKK +  +  RG++   L    +A  DF++ALVLEP 
Sbjct  611   AAAYLELGCFQQAEADCSQAILLDKKVIIRFLARGSSPARL---IRAXADFKHALVLEPQ  667

Query  1958  NKRAAQSAERLAKL  1999
             NK A  + +RL KL
Sbjct  668   NKTALAAEKRLRKL  681



>ref|XP_007148409.1| hypothetical protein PHAVU_006G206200g [Phaseolus vulgaris]
 gb|ESW20403.1| hypothetical protein PHAVU_006G206200g [Phaseolus vulgaris]
Length=599

 Score =   483 bits (1242),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 274/565 (48%), Positives = 369/565 (65%), Gaps = 13/565 (2%)
 Frame = +2

Query  323   KAVKADSGAFVERlqll---pppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             K  K D GA VER QLL    P Q         L+ L+FA+ D+F ++G+VTGFGNP W 
Sbjct  38    KLSKEDFGALVERFQLLPIPQPDQTQTQTQTQALSALTFAIKDIFDVKGYVTGFGNPHWK  97

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             +TH  A +T+ V+TAL+ +GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG S
Sbjct  98    RTHSEAGKTAIVITALLSSGATCVGKTVMDEFSFGISGENKFYGTPTNPYLPSSIPGGSS  157

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+AVAVAA LVDF++G DT G VR+PA +CGILGF PS G VS +G++P +QSLD VGW
Sbjct  158   SGSAVAVAAGLVDFAIGTDTTGCVRIPAAFCGILGFRPSHGIVSTIGVLPNAQSLDTVGW  217

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
             F RD  VL  VG VLL       +  R I+ A+DLFQ   +P+ +T  ++ +AIE   G 
Sbjct  218   FARDSSVLHHVGLVLLPKNLVELKRTRRIIFADDLFQLSKVPSQKTVYIIHRAIENLSGY  277

Query  1034  QMIRHENLDAYLSNKVPSLKSFK-KLNGEAK-LSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q  +H N+  Y+++ VPSLK F+ KL  +   +S  + L  V+ +L+ +EFK NH+ W  
Sbjct  278   QSPQHMNICQYIASNVPSLKGFRDKLTHQQNAVSILKDLTSVMFSLQGYEFKTNHEKWFK  337

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   ++ +++  +      +   + VR EMR A   LLKDDGILVIPTV D P K
Sbjct  338   SVKPRLGRTVSKRINSAMNSTHDRMKTLYKVRTEMRVAFQRLLKDDGILVIPTVPDDPLK  397

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
                  ++  D   RA   +S+AS+SG CQ +IPLG H+ C  SVSF++ +G D+FLL+ V
Sbjct  398   LNGFSSEFHD---RAFALSSIASISGCCQVAIPLGCHNDCCASVSFISAHGADKFLLNTV  454

Query  1568  QALFAPLQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIK  1741
               ++  +QEQ  +   +    +N  I    S+++ K KGN AFK + W +A+ +Y+EAI 
Sbjct  455   LDMYTTIQEQVSVTYTLPLPDANGGIE---SSDLLKEKGNAAFKGRLWNKAVNYYSEAIN  511

Query  1742  LYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAI  1921
             L G +ATYFSNRAAAYLELG F +AE DC KAI  DKKNVKAY RRGTARE+L  Y +A+
Sbjct  512   LNGTNATYFSNRAAAYLELGCFQEAEEDCNKAILHDKKNVKAYLRRGTARELLLRYEEAL  571

Query  1922  EDFRYALVLEPTNKRAAQSAERLAK  1996
             +DF++ALVLEP NK A+ + +RL K
Sbjct  572   KDFQHALVLEPQNKTASLAEKRLRK  596



>ref|XP_003570616.2| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Brachypodium distachyon]
Length=1016

 Score =   493 bits (1268),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 278/567 (49%), Positives = 383/567 (68%), Gaps = 14/567 (2%)
 Frame = +2

Query  320   KKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKT  499
             K  V ADSGAF ERL+L PPPQPPPP A   L+GL+FA SD F IEG+V GFGNPDW +T
Sbjct  46    KCTVPADSGAFCERLELAPPPQPPPPAARQLLSGLTFAASDNFEIEGYVAGFGNPDWKRT  105

Query  500   HEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssg  679
             H+ A++T+  VT L++ GATCV +T++D++ FG++G N H   P NP S + +PGG  SG
Sbjct  106   HKAASRTAVAVTMLLKQGATCVGRTVMDELGFGVTGENLHCGTPINPVSPTVVPGGSCSG  165

Query  680   aavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFT  859
             +AVAV+A LVDF+LG DT G +R+PA +CG+L F PS G VS +G I  SQSLD +GWF 
Sbjct  166   SAVAVSAQLVDFALGTDTTGDLRIPASFCGLLCFRPSHGVVSTLGTIANSQSLDTIGWFA  225

Query  860   RDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQM  1039
             RDP VL RVG VLL       +  + +V A+D F+ L +P  +T  ++  A+    G Q 
Sbjct  226   RDPRVLHRVGDVLLPAASGGLKEKKQLVFADDCFELLKVPKQKTMHIIENAVHTLPGYQP  285

Query  1040  IRHENLDAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
              +H N+  Y+S+ VPSLK F     KL G   +S  + L  V+  L+R+EFK NH+DW++
Sbjct  286   PKHINIGQYISSNVPSLKEFCQHATKLQG--GISALKALCAVMLLLQRYEFKANHEDWVN  343

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   I+ ++ + +   D  I   + VRNE R+AL +LLKD GILV+PT+   P K
Sbjct  344   TVKPKLGLDISTRVLQAVNFTDDNIKSLYIVRNEWRAALKNLLKDTGILVLPTMAGYPLK  403

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +++  S ++  R   F  +A+LSG CQA++PLG H   PIS+SFVA +G D+FLL A+
Sbjct  404   RNSRKRLSPEFEDRMYAFVCIAALSGCCQATVPLGNHSDHPISLSFVAPHGSDKFLLRAI  463

Query  1568  QALFAPLQEQ----AEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEA  1735
               +++ +QEQ    +++A++   +N+      ++E+ K KGN +FK K+W +AI FY+EA
Sbjct  464   LDMYSTIQEQLVFASKLALRPVINNDI----GASELLKEKGNNSFKIKEWSKAIEFYSEA  519

Query  1736  IKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQ  1915
             IKL   +A Y+SNRAAAYLELG F QAEADC KA+ LDKKNVKAY RRGTA+E++  Y +
Sbjct  520   IKLNDTNAAYYSNRAAAYLELGRFKQAEADCDKALLLDKKNVKAYLRRGTAKEVVLNYQE  579

Query  1916  AIEDFRYALVLEPTNKRAAQSAERLAK  1996
             A++DFR+AL LEP N+ A  + +RL K
Sbjct  580   ALQDFRHALALEPQNRAALAAEKRLQK  606



>ref|XP_006647919.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Oryza brachyantha]
Length=610

 Score =   478 bits (1229),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 279/561 (50%), Positives = 365/561 (65%), Gaps = 12/561 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF ER +L+P PQPPPP A   L+GL+FA SD F IEG V GFGNPDW +TH+ AT+
Sbjct  51    DFGAFCERHELVPAPQPPPPAARQLLSGLTFAASDSFDIEGCVAGFGNPDWKRTHKAATR  110

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  VT L + G T V  T++D++ FG++G N HY  P NPAS S  PGG  SG+AVAV+
Sbjct  111   TAVAVTMLRKQGGTYVGSTVMDELGFGVTGGNLHYGTPINPASPSLFPGGSCSGSAVAVS  170

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDF+LG DT G VR+PA +CG+L F  S G VS +G IP SQSLD +GWF RDP VL
Sbjct  171   AQLVDFALGTDTTGDVRIPACFCGVLCFKSSHGVVSTLGTIPNSQSLDAIGWFARDPSVL  230

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVG VLL          + +  A+D FQ L +P ++T  V+  AI    G Q  +H N+
Sbjct  231   HRVGDVLLPAATGGLIQTKQLFFADDCFQLLKVPNEKTINVIENAIHTLPGYQPPKHINI  290

Query  1058  DAYLSNKVPSLKSF-----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
               Y+S+ VPSLK F     K L G   +S  + L  V+  L R+EFK NH+DW++ VKP 
Sbjct  291   GQYISSHVPSLKDFCEPTMKMLEG---MSALKALSTVMLLLHRYEFKTNHEDWVNTVKPK  347

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L   I+ ++ + +      I   + VRNE+R+AL +LLKD GILV+PT    P K  AK+
Sbjct  348   LGLDISTRVLQAVNFTSDNIKSLYIVRNELRAALKNLLKDTGILVLPTTAGYPLKRNAKQ  407

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
               S  +  R C FA +A+LSG CQA IPLG HD  PIS+SFVA +G D+FLL  V  +++
Sbjct  408   RFSSGFEDRICAFAGIATLSGCCQAVIPLGNHDDHPISLSFVAAHGSDKFLLRNVLYMYS  467

Query  1583  PLQEQAEIAVQSKSSNNAISKEA---SAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
              ++EQ  +A Q  ++   I+++A   +AE+ K KGN AFK +QW +A+ FY++AIKL   
Sbjct  468   SIREQVVLASQLVTA-PVINRDADFGAAELLKEKGNSAFKGRQWSKAVEFYSDAIKLNDT  526

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+ NRAAAYLELG + QAEADC +A+ LDKKNVKAY RRG ARE +    +A++D R
Sbjct  527   NATYYCNRAAAYLELGRYKQAEADCDQALLLDKKNVKAYLRRGIAREAVLNNQEALQDIR  586

Query  1934  YALVLEPTNKRAAQSAERLAK  1996
              AL LEP NK    +  RL K
Sbjct  587   RALALEPQNKSGLLAERRLQK  607



>gb|EPS58820.1| hypothetical protein M569_15994, partial [Genlisea aurea]
Length=410

 Score =   467 bits (1202),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 270/416 (65%), Positives = 329/416 (79%), Gaps = 8/416 (2%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MAS SANLWVLLGLG+AGILIMT KLK+AVK D GAF++R QLLPPPQP PPKAPHPLTG
Sbjct  1     MASSSANLWVLLGLGIAGILIMTNKLKRAVKVDFGAFIQRFQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             LSFAVSD+FHIEGFVTGFGNPDW++THEPAT+TS VV A+V+ GATCV KT++DDMA  I
Sbjct  61    LSFAVSDIFHIEGFVTGFGNPDWSRTHEPATRTSFVVAAIVDGGATCVGKTVLDDMAISI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHY  PTNPA  +++PGG SSGAAVAVAA LVDFSLG+DTDGGVRVPA YCG+LGF
Sbjct  121   SGENKHYGTPTNPALPAKVPGGASSGAAVAVAAKLVDFSLGVDTDGGVRVPAAYCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G +S  G+IPVS SLD VGWF+RDP VLRRVGHVLLQ+P+ AQ NPRN  +A+D F
Sbjct  181   RPSHGTISLSGVIPVSGSLDTVGWFSRDPSVLRRVGHVLLQIPYGAQCNPRNFFVADDFF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             +   +P DR +QV++K+IE  + RQ++RH NL  Y+ +KVPSL +F  K  NGE K+S+ 
Sbjct  241   KLSKLPGDRVTQVLVKSIETLYERQVLRHHNLGDYIKSKVPSLNTFLEKPSNGEEKVSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMR  1315
               L +V+Q LKRHEF++NH+DWI+ VKP       AQL E  ++   +I+ C ++R E+R
Sbjct  301   TQLVNVMQMLKRHEFRKNHEDWINSVKPG-----DAQLSENSDLTAVDIENCDSIRKELR  355

Query  1316  SALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASI  1483
             SA+S+LLKDDG+L IPT  DPPPK GAKE  + +Y+ R   F+SLASLSG CQ  +
Sbjct  356   SAMSELLKDDGVLAIPTC-DPPPKLGAKEIYTEEYLIRTSTFSSLASLSGCCQVQV  410



>dbj|BAK05802.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score =   469 bits (1207),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 278/559 (50%), Positives = 370/559 (66%), Gaps = 11/559 (2%)
 Frame = +2

Query  341   SGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQT  520
             SGAF +RL+L PPPQPPPP A   L  L+FAVSD F IEG V GFGNPDW +TH+ A+ T
Sbjct  52    SGAFCDRLELAPPPQPPPPAARQQLLDLAFAVSDNFDIEGHVAGFGNPDWKRTHKAASHT  111

Query  521   STVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaa  700
             +  V  L++ GATCV +T++D++ FG++G N H   P NPAS S LPGG  SGAAVAV+A
Sbjct  112   AVAVKVLLKQGATCVGRTVMDELGFGVTGENLHCGTPINPASPSVLPGGSCSGAAVAVSA  171

Query  701   NLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLR  880
              LV+F+LG DT G +R+PA +CG+LGF  S G VS +G +P S SLD +GW  RDP +L 
Sbjct  172   QLVEFALGTDTTGDLRIPASFCGVLGFRSSHGVVSTLGTLPNSHSLDTIGWLARDPHILS  231

Query  881   RVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEK-QFGRQMIRHENL  1057
             RVG  LL V     +  R +V A+D F+ L IP  +T  V+  A+     G Q  +H N+
Sbjct  232   RVGDALLPVAACGLKGKRQLVFADDCFELLKIPNQKTVDVIENAVHTLPGGYQPPKHINI  291

Query  1058  DAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               Y+S+ VPSLK F     KL  E K S  + L  V+  L+R+EFK NH+DW++ VKP L
Sbjct  292   GQYISSNVPSLKEFCEPSTKLQ-EGK-SALKALCTVMLLLQRYEFKSNHEDWVNTVKPKL  349

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                ++ ++ + +   D  I   + VR E R+AL +LLKD GILV+PT+   P K  +K+ 
Sbjct  350   GLEVSTRVLQAVNFTDDNIKSLYIVRTEWRAALKNLLKDTGILVLPTMAGHPLKRNSKQR  409

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  +   F S+A+LSG CQA++PLG H+  PIS+SFVA +G D+FLL A+  +++ 
Sbjct  410   LSSEFEDKMYAFVSIAALSGCCQATVPLGNHNDHPISISFVAAHGSDKFLLRAILDMYST  469

Query  1586  LQEQAEIAVQSKSS-NNAISKEASA-EIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             +QEQ  I + SK +    I ++  A E+ K KGN +FK KQW +AI FY+ AIKL   +A
Sbjct  470   IQEQ--IVLASKLTLPPVIDRDVDASELLKEKGNNSFKRKQWSKAIEFYSGAIKLNETNA  527

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYA  1939
             TY+ NRAAAYLELG F QAEADC +A+ LDKKNVKAY RRGTA+E    Y +A++DFR+A
Sbjct  528   TYYCNRAAAYLELGRFKQAEADCDQALLLDKKNVKAYLRRGTAKESCMNYQEALQDFRHA  587

Query  1940  LVLEPTNKRAAQSAERLAK  1996
             L LEP NK A  +  RL K
Sbjct  588   LALEPQNKTALAAERRLQK  606



>ref|NP_001048155.1| Os02g0754500 [Oryza sativa Japonica Group]
 dbj|BAD17240.1| putative Toc64 [Oryza sativa Japonica Group]
 dbj|BAF10069.1| Os02g0754500 [Oryza sativa Japonica Group]
 dbj|BAG91702.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57827.1| hypothetical protein OsJ_08425 [Oryza sativa Japonica Group]
Length=613

 Score =   466 bits (1199),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 270/561 (48%), Positives = 364/561 (65%), Gaps = 6/561 (1%)
 Frame = +2

Query  329   VKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEP  508
             V  D GAF  R ++ P PQPPPP A   L+GL+FA SD F IEG+V GFGNPDW +TH+ 
Sbjct  51    VPPDFGAFCYRFEIAPAPQPPPPAARQLLSGLTFAASDNFEIEGYVAGFGNPDWKRTHKA  110

Query  509   ATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaav  688
             AT+T+  VT L + G T V  T++D++ FG+SG N H   P NPAS S  PGG  SG+AV
Sbjct  111   ATRTAVPVTMLQKQGGTYVGSTVMDELGFGVSGGNLHNGTPINPASPSLFPGGSCSGSAV  170

Query  689   avaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDP  868
             AV+A LVDF+LG DT G VR+PA +CG+L F  S G VS +G I  SQSLD +GWF RDP
Sbjct  171   AVSAQLVDFALGTDTTGDVRIPACFCGVLCFKSSHGVVSTLGTIANSQSLDTIGWFARDP  230

Query  869   DVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRH  1048
              VL RVG VLL          R +  A+D FQ L +P ++T  V+  AI+   G Q  +H
Sbjct  231   SVLHRVGDVLLPAATGGLTQTRQLFFADDCFQLLKVPNEKTVNVIENAIQTLPGYQPPKH  290

Query  1049  ENLDAYLSNKVPSLKSFKKLNGEA--KLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              N+  Y+S+ VPSLK F +   E    +S  + L  V+  L+R+EFK NH+DW++ VKP 
Sbjct  291   INIGEYISSHVPSLKDFCEPTVEMLEGMSALKALSTVMLLLQRYEFKTNHEDWVNTVKPK  350

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L    + ++ + +      I   + VRNE+R+AL +LLKD GILV+PT    P K  A++
Sbjct  351   LGLDTSTRVLQAVNSKSDNIKSLYIVRNELRAALKNLLKDTGILVLPTTAGYPLKRNARQ  410

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
               S  +  R   F  +A+LSG CQA IPLG H+  PIS+S +A +G D+FLL  V  +F+
Sbjct  411   RLSPGFEDRMSAFVGIATLSGCCQAVIPLGSHNDHPISLSLLAAHGSDKFLLRNVLYMFS  470

Query  1583  PLQEQAEIAVQSKSSNNAISKEA---SAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
              ++EQ  +A +  ++   I+++A   +AE+ K KGN AFK ++W +A+ FY++AIKL G 
Sbjct  471   SIKEQVVLASKLVTAP-VINRDADFGAAELLKEKGNSAFKGRKWSKAVEFYSDAIKLNGT  529

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+SNRAAAYLELG + QAEADC +A+ LDKKNVKAY RRG ARE +  + +A++D R
Sbjct  530   NATYYSNRAAAYLELGRYKQAEADCEQALLLDKKNVKAYLRRGIAREAVLNHQEALQDIR  589

Query  1934  YALVLEPTNKRAAQSAERLAK  1996
             +AL LEP NK    +  RL K
Sbjct  590   HALALEPQNKAGLLAERRLQK  610



>ref|XP_002987441.1| hypothetical protein SELMODRAFT_42040, partial [Selaginella moellendorffii]
 gb|EFJ11528.1| hypothetical protein SELMODRAFT_42040, partial [Selaginella moellendorffii]
Length=593

 Score =   465 bits (1196),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 277/595 (47%), Positives = 378/595 (64%), Gaps = 45/595 (8%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
              +R+ +K V+A +GAF++ L+L PPP PPPP+AP PL GL+FAV D+F IEGF+TGFGNP
Sbjct  13    FSRRQRKGVRAGNGAFIQYLELNPPPAPPPPRAPPPLAGLTFAVKDIFDIEGFITGFGNP  72

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW KTH PATQT+ VV  LV AGA C+ KT +D++A+ I+G NKHY  P NPAS +R+PG
Sbjct  73    DWLKTHGPATQTAFVVQLLVRAGAACIGKTHMDELAYSINGENKHYGTPINPASPNRVPG  132

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF+LG DT G VRVPA +CGI+GF PS G +S  G+IP++QS D 
Sbjct  133   GSSSGSAVAVAAGLVDFALGTDTGGSVRVPAAFCGIIGFRPSHGTISTSGVIPMAQSFDT  192

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             VGWF ++P+VLR+VG+ LLQ PF   R P+ +++A+D F   + P +RT  VV +  E+ 
Sbjct  193   VGWFAKEPNVLRQVGYALLQQPFMEPRQPQRVIMADDCFSLSSAPPERTKAVVARCFERV  252

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTL------------K  1168
              G++ + + ++  YL +K PSL++F      + L        ++Q               
Sbjct  253   LGKKTMSNMDIGPYLLSKSPSLQAFCDETASSPLVGLSKALSLIQRYCFLATASFIACHL  312

Query  1169  RHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDG  1348
             R EFK NH+ W+  V P L P I  ++   L+    EI    +V+ E+       L+DD 
Sbjct  313   RFEFKTNHEAWLSGVNPDLGPGILERVRAALKTTAEEIVLAMSVKAEVA------LQDDV  366

Query  1349  ILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFV  1528
             +LV+PT   PPPK   K     DY  +A    ++A +SG CQ S+P+G  D  P++ S +
Sbjct  367   LLVLPTTPGPPPKLNTKGKALDDYREKAFALLAIAGMSGCCQVSMPVGTFDDAPLAFSVM  426

Query  1529  ARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAI----SKEASAEIAKGKGNQAFKE  1696
             AR GGDRFLLDAV AL         + V+    N+A+    +K  +AE AK KGN AFK 
Sbjct  427   ARQGGDRFLLDAVLAL--------HVMVKEDLKNSALPLVNAKTNAAEAAKEKGNLAFKN  478

Query  1697  KQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFR  1876
             K + +A+  Y+EAI+L   ++TY++NRA A+L + SF+Q E DC+KAI+LDKKNVKAY R
Sbjct  479   KDYHKAVSHYSEAIRLDPLNSTYYNNRAVAHLSMCSFLQVEEDCSKAIDLDKKNVKAYLR  538

Query  1877  RGTAREMLGYYNQA---------------IEDFRYALVLEPTNKRAAQSAERLAK  1996
             RGTARE LG Y++A               + DFR ALVLEPTN+ A  + +RL K
Sbjct  539   RGTAREALGSYHEAHDARRCSCFHLLWFFLIDFRQALVLEPTNRTALDAVKRLKK  593



>gb|EEC74029.1| hypothetical protein OsI_08982 [Oryza sativa Indica Group]
Length=613

 Score =   464 bits (1193),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 270/561 (48%), Positives = 362/561 (65%), Gaps = 6/561 (1%)
 Frame = +2

Query  329   VKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEP  508
             V  D GAF  R ++ P PQPPPP A   L+GL+FA SD F IEG+V GFGNPDW +TH+ 
Sbjct  51    VPPDFGAFCYRFEIAPAPQPPPPAARQLLSGLTFAASDNFEIEGYVAGFGNPDWKRTHKA  110

Query  509   ATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaav  688
             AT+T+  VT L + G T V  T++D++ FG+SG N H   P NPAS S  PGG  SG+AV
Sbjct  111   ATRTAVPVTMLQKQGGTYVGSTVMDELGFGVSGGNLHNGTPINPASPSLFPGGSCSGSAV  170

Query  689   avaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDP  868
             AV+A LVDF+LG DT G VR+PA +CG+L F  S G VS +G I  SQSLD +GWF RDP
Sbjct  171   AVSAQLVDFALGTDTTGDVRIPACFCGVLCFKSSHGVVSTLGTIANSQSLDTIGWFARDP  230

Query  869   DVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRH  1048
              VL RVG VLL          R +  A+D FQ L +P ++T  V+  AI+   G Q  +H
Sbjct  231   SVLHRVGDVLLPAATGGLTQTRQLFFADDCFQLLKVPNEKTVNVIENAIQTLPGYQPPKH  290

Query  1049  ENLDAYLSNKVPSLKSFKKLNGEA--KLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              N+  Y+S+ VPSLK F +   E    +S  + L  V+  L+R+EFK NH+DW++ VKP 
Sbjct  291   INIGEYISSHVPSLKDFCEPTVEMLEGMSALKALSTVMLLLQRYEFKTNHEDWVNTVKPK  350

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P  + ++ + +      I   + VRNE+R+AL  LLKD GILV+PT    P K  A++
Sbjct  351   LGPDTSTRVLQAVNSKSDNIKSLYIVRNELRAALKTLLKDTGILVLPTTAGYPLKRNARQ  410

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
               S  +  R   F  +A+LSG CQA IPLG H+  PIS+S +A +G D+FLL  V  +F+
Sbjct  411   RLSPGFEDRMSAFVGIATLSGCCQAVIPLGSHNDDPISLSLLAAHGSDKFLLRNVLYMFS  470

Query  1583  PLQEQAEIAVQSKSSNNAISKEA---SAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGN  1753
              ++EQ  +A +  ++   I+++A   +AE+ K KGN AFK ++W +A+ FY++AIKL G 
Sbjct  471   SIKEQVVLASKLVTAP-IINRDADFGAAELLKEKGNSAFKGRKWSKAVEFYSDAIKLNGT  529

Query  1754  SATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFR  1933
             +ATY+SNRAAAYLEL  + QAEADC +A+ LDKKNVKAY RRG ARE    + +A++D R
Sbjct  530   NATYYSNRAAAYLELSRYKQAEADCEQALLLDKKNVKAYLRRGIAREAALNHQEALQDIR  589

Query  1934  YALVLEPTNKRAAQSAERLAK  1996
             +AL LEP NK    +  RL K
Sbjct  590   HALALEPQNKAGLLAERRLQK  610



>gb|KHN33528.1| Outer envelope protein 64, mitochondrial [Glycine soja]
Length=634

 Score =   463 bits (1192),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 261/540 (48%), Positives = 356/540 (66%), Gaps = 8/540 (1%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             K  K D GAFVER +LLP PQP   +     + L+FA+ D+F ++G+VTGFGNP W K H
Sbjct  35    KLPKPDFGAFVERFELLPIPQPNQTQTL---SALTFAIKDIFDVKGYVTGFGNPQWKKMH  91

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
               A +T+ V+TAL+  GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG SSG+
Sbjct  92    NEAGKTAIVITALLSNGATCVGKTVMDEFSFGISGENKFYGTPTNPQMPSSIPGGSSSGS  151

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF++G DT G VR+PA +CGILGF PS G +S +G++P +QSLD VGWF R
Sbjct  152   AVAVAARLVDFAMGTDTTGCVRIPAAFCGILGFRPSHGVISTIGVLPNAQSLDTVGWFAR  211

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP VL RVG VLL +     +  R I+ A+DLFQ    P+ +T  ++ KAIE   G Q  
Sbjct  212   DPSVLHRVGLVLLPLNSVELKRTRRIIFADDLFQLCKAPSQKTVYIIGKAIENLSGYQFP  271

Query  1043  RHENLDAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             +H NL  Y+++ VPSLK F++   + +  +S  + L  V+  L+ +EFK NH++W+  VK
Sbjct  272   QHMNLCQYIASNVPSLKEFREKFTHQQNGVSILKALTSVMFYLQGYEFKTNHEEWVKSVK  331

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L   ++ +++  +      I   + VR EM  A   LLKDDGILVIPTV D P K   
Sbjct  332   PRLGRGMSERVNAAMNATHDNIKTLYKVRTEMWGAFQHLLKDDGILVIPTVADYPLKLNT  391

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             ++  S ++  RA   +S+AS+SG CQ +IPLG H+ C  SVS ++ +G D+FLL+ V  +
Sbjct  392   EKGFSSEFGDRAFALSSIASISGCCQVAIPLGCHNDCCASVSLISAHGADKFLLNTVLDM  451

Query  1577  FAPLQEQAEI--AVQSKSSNNAI-SKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLY  1747
             ++ LQEQ  +  A+    +N ++ + E   E A  +GN AFK + W +A+ +YTEAI L 
Sbjct  452   YSTLQEQVSVAYALPLPDTNGSMGTSELLKEKASLQGNAAFKGRLWNKAVDYYTEAINLN  511

Query  1748  GNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIED  1927
             G +ATY+SNRAAAYLELG F +AE DC  AI  DKKNVKAY RRGTARE+L  Y +A+++
Sbjct  512   GTNATYYSNRAAAYLELGCFQEAEEDCNMAILHDKKNVKAYLRRGTARELLLRYKEALKE  571



>ref|XP_008643639.1| PREDICTED: LOC100281793 isoform X1 [Zea mays]
 gb|AFW73494.1| hypothetical protein ZEAMMB73_808672 [Zea mays]
Length=614

 Score =   462 bits (1190),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 267/561 (48%), Positives = 363/561 (65%), Gaps = 9/561 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D+G+F +R +L PP QPPPP A H L+GL+FA SD F IEG+V GFGNPDW KTHE A  
Sbjct  56    DAGSFCDRFELHPPAQPPPPAARHILSGLTFAASDNFEIEGYVAGFGNPDWKKTHETARH  115

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  VT L + GATCV +TI+D++ FG++G N H+  P NP SSS +PGG  SG+AVAVA
Sbjct  116   TAVAVTMLRKQGATCVGRTIMDELGFGVTGENLHHGTPANPVSSSLVPGGSCSGSAVAVA  175

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A L+DF++G DT G VR+PA +CG+L F PS+G +S +G I  SQSLD +GWF RDP +L
Sbjct  176   AQLIDFAIGTDTIGDVRIPASFCGLLCFRPSYGVISTLGTIANSQSLDTIGWFARDPCIL  235

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVG VLL       +  R  V A+D FQ L +   +T   +  A++   G Q  +H N+
Sbjct  236   HRVGEVLLPAAVGGLKQTRQFVFADDCFQLLKVSNQKTVHAIKNAVQALRGYQPPKHINI  295

Query  1058  DAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               Y+ + VPSLK F     KL  E   S  + +  V+  L+R+EFK NH++W++ VKP L
Sbjct  296   GQYIYSNVPSLKEFCEPATKL--EEGTSALKAISTVMLLLQRYEFKANHEEWVNTVKPKL  353

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                I+ ++ + +  A   I   +A+RNE+R AL +LLKD GILV+PT    P K  +KE 
Sbjct  354   GLDISTRVLQAVNFARENIKSLYAIRNELRVALKNLLKDTGILVLPTTAGYPLKRNSKER  413

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S  +  R   F  +A+LSG C+ +IP+   D   +S+SFVA +G D+FLL  +   ++ 
Sbjct  414   LSSGFEDRMYKFVGVAALSGCCEVTIPMENLDH-HVSLSFVAAHGSDKFLLRNILDTYSL  472

Query  1586  LQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             +Q+Q  +A  +++    N      ++E+ K KGN AFK +QW +AI FY+EAI L   +A
Sbjct  473   IQDQVVLASKLETAPVTNVDVDVNASELLKEKGNSAFKRRQWIKAIEFYSEAISLSDTNA  532

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYA  1939
             TY+ NRAAAYLELG F QAEADC +A+ LD+KNVKAY RRG ARE+   Y +A++DFR+A
Sbjct  533   TYYCNRAAAYLELGRFKQAEADCDRALLLDRKNVKAYLRRGFAREVTLNYKEALQDFRHA  592

Query  1940  LVLEPTNKRAAQSAERLAKLF  2002
             L LEP NK A  +  RL KL 
Sbjct  593   LALEPQNKTALAAERRLQKLL  613



>ref|XP_007036837.1| Translocon at the outer membrane of chloroplasts 64-III isoform 
4, partial [Theobroma cacao]
 gb|EOY21338.1| Translocon at the outer membrane of chloroplasts 64-III isoform 
4, partial [Theobroma cacao]
Length=405

 Score =   453 bits (1165),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 259/495 (52%), Positives = 324/495 (65%), Gaps = 93/495 (19%)
 Frame = +2

Query  527   VVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNL  706
             VV +LVE GATCV KT+VD++A+ I G NKHY  PTNPA+ +R+PGG SSGAAVAVAAN 
Sbjct  2     VVLSLVEGGATCVGKTVVDELAYSIHGENKHYSTPTNPAAPARIPGGSSSGAAVAVAANF  61

Query  707   VDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRV  886
             VDFSL                              GIIPV+ SLD VG   +  ++    
Sbjct  62    VDFSL------------------------------GIIPVASSLDTVGQVLKHENL----  87

Query  887   GHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAY  1066
                                   D F S  +P+            K+F RQ          
Sbjct  88    ---------------------EDYFSS-KVPS-----------LKEFYRQ----------  104

Query  1067  LSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQ  1246
                         K+N + K+S+ RLL +V Q L+R+EFK  H++WI   KP LD  ++ Q
Sbjct  105   ------------KINVDLKISSIRLLANVAQFLQRYEFKCAHEEWISSEKPVLDSAVSTQ  152

Query  1247  LHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVS  1426
             ++E L++ D EI+ C ++RNEMR A++ LLKDDGILVIPT   PPPK G+KE  S DY  
Sbjct  153   INETLDLTDKEIEICKSIRNEMRLAVNSLLKDDGILVIPTTAHPPPKLGSKEIFSEDY--  210

Query  1427  RACLFA--SLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQA  1600
               C+F+  S+AS+SG CQ ++PLG+HD  P+SVSF+AR+GGDRFLLD VQ +++ LQE A
Sbjct  211   HNCMFSLLSIASISGCCQVTLPLGYHDNYPVSVSFIARHGGDRFLLDTVQTMYSSLQEHA  270

Query  1601  EIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRA  1780
             +   +SK S NA+++E SAE+AK KGNQA+K+KQWQ+A+ FYTEAIKL GN+ATY+SNRA
Sbjct  271   DTVAKSKLSRNAVNQEQSAEVAKEKGNQAYKDKQWQKAVMFYTEAIKLNGNNATYYSNRA  330

Query  1781  AAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTN  1960
             AAYLELGSF+QAE DCTKAI+LDKKNVKAY RRGTAREMLGYY +AIEDFRYALVLEPTN
Sbjct  331   AAYLELGSFLQAETDCTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTN  390

Query  1961  KRAAQSAERLAKLFH  2005
             KRAA SAERL K+F 
Sbjct  391   KRAALSAERLRKVFQ  405



>gb|KDO41288.1| hypothetical protein CISIN_1g0074012mg [Citrus sinensis]
Length=575

 Score =   459 bits (1181),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 259/513 (50%), Positives = 346/513 (67%), Gaps = 8/513 (2%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER +L+P PQPPPP A  PL GL FA+ DVF ++G+VTGFG+PDW + H  A
Sbjct  46    RVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEA  105

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
              +T+ VVT L++ GATC+ KT++D+ AFGI+G NKHY  P NP   S +PGG SSG+AVA
Sbjct  106   ERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVA  165

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAA LVDF+LG DT G VRVPA +CGILG+ PS G VS +G++P SQSLD VG   R+  
Sbjct  166   VAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNAS  225

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             +L RVGHVLLQ+     R  R ++ A+D+FQ   +P  +T  V+ KAIE   G Q   H 
Sbjct  226   ILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHM  285

Query  1052  NLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             N+  Y+++ VPSLK  +    + E   +T + L  V+ +L+R+EFK  +++W+   KP L
Sbjct  286   NVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRL  345

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                +  ++ E +      I   + VRNEMR+AL  LLKDD ILVIPTV DPP K   K+T
Sbjct  346   GYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKT  405

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  R  + +S+ S+SG CQ +IP+G +++ PIS+SF+  +GGD+FLLD V  L+  
Sbjct  406   YSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDS  465

Query  1586  LQEQAEIA---VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNS  1756
             LQEQ  IA   V    +N +I    ++E+ K KGN AFK KQW +A+ +Y+EAIKL G S
Sbjct  466   LQEQVNIASNLVPLPDTNGSID---ASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTS  522

Query  1757  ATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             ATY+SNRAAAYLELG F QAE DC+K I LDKK
Sbjct  523   ATYYSNRAAAYLELGCFQQAEEDCSKTISLDKK  555



>gb|KDO41289.1| hypothetical protein CISIN_1g0074012mg, partial [Citrus sinensis]
Length=555

 Score =   458 bits (1179),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 259/513 (50%), Positives = 346/513 (67%), Gaps = 8/513 (2%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER +L+P PQPPPP A  PL GL FA+ DVF ++G+VTGFG+PDW + H  A
Sbjct  46    RVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEA  105

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
              +T+ VVT L++ GATC+ KT++D+ AFGI+G NKHY  P NP   S +PGG SSG+AVA
Sbjct  106   ERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVA  165

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAA LVDF+LG DT G VRVPA +CGILG+ PS G VS +G++P SQSLD VG   R+  
Sbjct  166   VAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNAS  225

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             +L RVGHVLLQ+     R  R ++ A+D+FQ   +P  +T  V+ KAIE   G Q   H 
Sbjct  226   ILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHM  285

Query  1052  NLDAYLSNKVPSLKSFK--KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             N+  Y+++ VPSLK  +    + E   +T + L  V+ +L+R+EFK  +++W+   KP L
Sbjct  286   NVGQYIASNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRL  345

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                +  ++ E +      I   + VRNEMR+AL  LLKDD ILVIPTV DPP K   K+T
Sbjct  346   GYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKT  405

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  R  + +S+ S+SG CQ +IP+G +++ PIS+SF+  +GGD+FLLD V  L+  
Sbjct  406   YSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDS  465

Query  1586  LQEQAEIA---VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNS  1756
             LQEQ  IA   V    +N +I    ++E+ K KGN AFK KQW +A+ +Y+EAIKL G S
Sbjct  466   LQEQVNIASNLVPLPDTNGSID---ASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTS  522

Query  1757  ATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             ATY+SNRAAAYLELG F QAE DC+K I LDKK
Sbjct  523   ATYYSNRAAAYLELGCFQQAEEDCSKTISLDKK  555



>gb|KCW56987.1| hypothetical protein EUGRSUZ_I02661 [Eucalyptus grandis]
Length=567

 Score =   457 bits (1177),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 342/498 (69%), Gaps = 2/498 (0%)
 Frame = +2

Query  323   KAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTH  502
             +A K D GAF+ER +LLP PQPPPP    PL GL+FA+ D+F ++G+VTGFGNPDW +TH
Sbjct  46    EAAKEDFGAFLERFELLPFPQPPPPALKQPLAGLTFAIKDIFEVKGYVTGFGNPDWERTH  105

Query  503   EPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssga  682
             E A +T+ V+ AL++ GA CV KT++D++AFG++G N H+  P NP   S +PGG SSG+
Sbjct  106   EAAEKTAVVINALLKNGAKCVGKTVLDELAFGMTGENIHHGTPVNPQMPSHIPGGSSSGS  165

Query  683   avavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             AVAVAA LVDF+LG DT G VR+PA +CGI+G+ PS G VS +G++P SQSLD VGWF R
Sbjct  166   AVAVAAELVDFALGTDTVGCVRIPASFCGIIGYRPSHGVVSTIGVLPNSQSLDTVGWFAR  225

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
             DP +L RVGH+LLQ+     R PR +V A+DLF+   +P  ++  VV KA EK  G Q  
Sbjct  226   DPSILHRVGHILLQLNTVEPRRPRRLVFADDLFELSKVPKHKSLYVVSKAAEKLSGYQPP  285

Query  1043  RHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             +H N   ++++ VPSLK F  +  N +  +ST + L   + +L+R EFK NH++W+  VK
Sbjct  286   KHINFGQHIASNVPSLKIFCEQSTNLQNGISTLKALSSAMLSLQRCEFKTNHEEWVTSVK  345

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P     +   +  +   I   + VR+EMR+AL  LLKDDGIL+IPTV DPP     
Sbjct  346   PRLGPRTANCVLTAVNTSLENIKTLYKVRSEMRAALQSLLKDDGILIIPTVADPPLPTNL  405

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             K+  S ++  RA    S++S+SG CQ SIPLG H+ CPISVSF++ +GGD+FLLD+V  +
Sbjct  406   KKHSSAEFFDRALALISISSMSGCCQVSIPLGKHEGCPISVSFISYHGGDKFLLDSVLDM  465

Query  1577  FAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNS  1756
             ++ LQEQA +A  S    +      ++E+ K KGN A+K +QW +A+ +Y+EAIKL G +
Sbjct  466   YSSLQEQATVASSSLPFADTNGNLDTSELLKEKGNAAYKGRQWNKAVTYYSEAIKLNGAN  525

Query  1757  ATYFSNRAAAYLELGSFV  1810
             ATY+ NRAAAYL+LG ++
Sbjct  526   ATYYCNRAAAYLQLGWYL  543



>ref|XP_004953960.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Setaria 
italica]
Length=614

 Score =   456 bits (1172),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 274/568 (48%), Positives = 360/568 (63%), Gaps = 11/568 (2%)
 Frame = +2

Query  320   KKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKT  499
             K     D GAF +R +L PPPQPPPP A H L+GL+FA SD F IEG+V GFGNPDW +T
Sbjct  50    KAGAPPDFGAFCDRFELSPPPQPPPPAARHLLSGLTFAASDNFEIEGYVAGFGNPDWKRT  109

Query  500   HEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssg  679
             HE    T+  VT L + GATCV +T++D++ FG++G N H   P NPASSS +PGG  SG
Sbjct  110   HEAPRHTAVTVTLLQKQGATCVGRTVMDELGFGVTGENLHCGTPINPASSSLVPGGSCSG  169

Query  680   aavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFT  859
             +AVAVAA LVDF+LG DT G VR+PA +CG+L F PS+G VS +G I  SQSLD VGWF 
Sbjct  170   SAVAVAAQLVDFALGTDTVGDVRIPASFCGLLCFRPSYGVVSTLGTIANSQSLDTVGWFA  229

Query  860   RDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQM  1039
             RDP VL RVG VLL       +  R  V A+D FQ L +   +T   +  A++   G Q 
Sbjct  230   RDPCVLHRVGEVLLPATAGGLKQTRQFVFADDCFQLLKVSNQKTVHAIKNAVQTLPGYQP  289

Query  1040  IRHENLDAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
              +H N+  YL + VPSLK F     KL  +  +S  + L  V+  L+R+EFK NH++W++
Sbjct  290   PKHINIGQYLYSNVPSLKEFCEPATKL--QEGMSALKALSTVMLLLQRYEFKENHENWVN  347

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   I+  +   +  A   I   +A+RNE+R+AL +LLKD GILV+PT    P K
Sbjct  348   TVKPKLGLDISTCVLRAVNFAHDNIKSLYAIRNELRAALKNLLKDSGILVLPTTAGYPLK  407

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               +KE  S  +  R   F  +A+LSG C+ +IP    D   +S+SFVA +G D+ LL  +
Sbjct  408   RNSKERLSSGFEDRMYKFVGIAALSGCCEVTIPWSNLDH-HVSLSFVAAHGSDKSLLRTI  466

Query  1568  QALFAPLQEQAEIA---VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAI  1738
                ++ +Q+Q  +A   V +   N  +  + S E+ K KGN AFK +QW +A  FY+EAI
Sbjct  467   VDTYSLIQDQVVLASKLVAAPVVNGDVDIDES-ELLKEKGNSAFKRRQWSKAAEFYSEAI  525

Query  1739  KLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQA  1918
              L   +ATY+ NRAAAYLELG F QAEADC +A+ LD+KNVKAY RRG ARE+   Y +A
Sbjct  526   SLSDTNATYYCNRAAAYLELGRFKQAEADCDQALLLDRKNVKAYLRRGCAREVTLNYKEA  585

Query  1919  IEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             ++DFR+AL LEP NK A  +  RL KL 
Sbjct  586   LQDFRHALALEPQNKTALAAERRLQKLL  613



>gb|ACN40706.1| unknown [Picea sitchensis]
Length=458

 Score =   444 bits (1141),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 322/438 (74%), Gaps = 4/438 (1%)
 Frame = +2

Query  308   TRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPD  487
             +R+ KK +K D GAF ER+QLLPPPQP PP++P+PLTGL+FA+ ++F IEG+VTGFGNPD
Sbjct  21    SRRRKKEIKEDFGAFTERIQLLPPPQPSPPESPYPLTGLTFAIKEIFDIEGYVTGFGNPD  80

Query  488   WAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpgg  667
             W +THEPA QT+ VVT +V+ GATCV +T++D+MA+ I+G NKHY  PTNPA+ SR+PGG
Sbjct  81    WQQTHEPAAQTAPVVTFVVQGGATCVGRTVMDEMAYSINGENKHYGTPTNPAAPSRIPGG  140

Query  668   pssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVV  847
              SSG+AVAVAA LVDF+LG DT G VRVPA +CGILGF PS GAVS +G++P++QS D V
Sbjct  141   SSSGSAVAVAAELVDFALGTDTGGSVRVPASFCGILGFRPSHGAVSTVGVVPMAQSFDTV  200

Query  848   GWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQF  1027
             G FTRDP++LR VGH+LLQ+PF   R PR I+IA+D FQ   IP D+T  VV ++ EK F
Sbjct  201   GLFTRDPNILRHVGHILLQLPFMEYRQPRGIIIADDCFQLTKIPNDQTVNVVTRSTEKLF  260

Query  1028  GRQMIRHENLDAYLSNKVPSLKSFKK----LNGEAKLSTTRLLGHVVQTLKRHEFKRNHD  1195
             GRQ++ H +L  Y++ +VPSLK F+      +GE  +S  + L   ++ L+R+EFK NH+
Sbjct  261   GRQVLNHISLGEYIATEVPSLKYFQNEEESRDGECGISALKALCSALRLLQRYEFKMNHE  320

Query  1196  DWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVID  1375
             +WI+ VKP L P I+ ++   LE  +  I+ C   ++E R A++ LLKDD IL+IPT   
Sbjct  321   EWINSVKPDLGPGISGRVRAALETNNENIEHCLKAKDEAREAVNSLLKDDAILIIPTTPG  380

Query  1376  PPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFL  1555
             P PK   KE    ++  RA     ++ +SG CQ SIP+G HDKCP++VS +AR+GGDRFL
Sbjct  381   PAPKLNMKEMLLEEFRIRAFTLLCISGMSGCCQVSIPVGQHDKCPLAVSMMARHGGDRFL  440

Query  1556  LDAVQALFAPLQEQAEIA  1609
             LD V+A++  LQE+ +IA
Sbjct  441   LDTVRAMYPTLQEEVKIA  458



>ref|XP_010678254.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=529

 Score =   437 bits (1125),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 256/326 (79%), Gaps = 2/326 (1%)
 Frame = +2

Query  1034  QMIRHENLDAYLSNKVPSLKSFKKL--NGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             Q+++HENL  YLS+KV SL     L  N + K S   LL HV+Q+L R+EFK NH +W++
Sbjct  204   QVLKHENLGKYLSSKVSSLLELSALQNNDQVKTSMFSLLAHVMQSLYRYEFKGNHGEWMN  263

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP +D  I A  HE + + ++EI K   +RNEMR AL+ LLKDDG+LVIPT  DPPPK
Sbjct  264   LVKPDVDARIAALFHESVVIDESEIQKMSRMRNEMRLALNSLLKDDGVLVIPTFADPPPK  323

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
              GAKE  S  Y+SR     S+ASLSG C+ ++PLG+ +KCP+SVSF+AR+GGDRFLLD V
Sbjct  324   VGAKELSSEIYLSRLYSLLSIASLSGCCEVTVPLGYFNKCPLSVSFIARHGGDRFLLDTV  383

Query  1568  QALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLY  1747
             Q +++ LQEQ ++  ++KS++N +S+E+SAEIAK KGNQAFK+KQWQ+AI FYTEAIKLY
Sbjct  384   QTMYSSLQEQLDVLSKTKSTSNTLSRESSAEIAKEKGNQAFKDKQWQKAINFYTEAIKLY  443

Query  1748  GNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIED  1927
             G+S TY+SNRAAAYLELGSFVQAEADCTKAI LDKKNVKAY RRGTAREMLGYY +A ED
Sbjct  444   GSSPTYYSNRAAAYLELGSFVQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEATED  503

Query  1928  FRYALVLEPTNKRAAQSAERLAKLFH  2005
             FRYALVLEPTNKRAA S ERL  LF 
Sbjct  504   FRYALVLEPTNKRAAVSVERLKNLFQ  529


 Score =   220 bits (560),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  242  MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
            MAS SAN+WV+LGLGLAGIL+MTRKLKK ++ D GAFV+RLQLLPPPQP PPKAP+PLT 
Sbjct  1    MASSSANIWVMLGLGLAGILLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPYPLTA  60

Query  422  LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
            L+FAVSD+F IEGFVTGFGNPDWA+THE A++T++VV+ LV+ GA+CV +T +D+MA+ +
Sbjct  61   LTFAVSDLFDIEGFVTGFGNPDWARTHEAASRTASVVSTLVDGGASCVGRTTIDEMAYSV  120

Query  602  SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
            SG NKHYD P+NP +  R+PGG  SGAAV VA+NLVDFS+G+D  GG+RVP+G+CG++GF
Sbjct  121  SGQNKHYDTPSNPGAPGRVPGGSCSGAAVCVASNLVDFSVGVDAVGGIRVPSGFCGVIGF  180

Query  782  HPSFGAVSHMGIIPVSQSLDVVG  850
              S GA+SH GIIPVS SLD +G
Sbjct  181  RASHGAISHSGIIPVSTSLDTIG  203



>ref|XP_006850734.1| hypothetical protein AMTR_s00025p00053190 [Amborella trichopoda]
 gb|ERN12315.1| hypothetical protein AMTR_s00025p00053190 [Amborella trichopoda]
Length=466

 Score =   416 bits (1069),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 284/399 (71%), Gaps = 2/399 (1%)
 Frame = +2

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             +GL+FAV D+F +EG+VTGFGNPDWA+THE A QT+  V AL+E GATC+ KT++D+MA+
Sbjct  67    SGLTFAVKDIFDVEGYVTGFGNPDWARTHEAAKQTAPAVLALIEEGATCIGKTVMDEMAY  126

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I+G NKHY  PTNP + SR+PGG SSG+AVAVAA LVDF+LG DT G VRVPA +CGIL
Sbjct  127   SINGENKHYGTPTNPCAPSRIPGGSSSGSAVAVAAGLVDFALGTDTGGSVRVPAAFCGIL  186

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF PS GAVS  G+IP+SQS D VGWF+RDP +L RVG VLL +     +    I+IA+D
Sbjct  187   GFRPSHGAVSTQGVIPMSQSFDTVGWFSRDPGILSRVGQVLLPLSHANSKKVGRIIIADD  246

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLS  1129
              FQ L I +DR +Q+VIK+IEK  G Q+I H N   Y+S+KVP+LK F  +  N    + 
Sbjct  247   CFQYLTISSDRVTQIVIKSIEKLIGSQVITHANFGEYMSSKVPTLKPFIEECENHGGMIP  306

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFKRNH++W++  KP L P I  ++   L+  D  ID CH +R+E
Sbjct  307   SFAALSSAMRLLQRYEFKRNHEEWVNTTKPDLGPGILERVQAALDTTDDNIDLCHNIRSE  366

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             MR+ALS+LL+DDGIL+IPT   PPP+   +     ++ ++A    ++A +SG CQ +IPL
Sbjct  367   MRAALSELLEDDGILIIPTAPGPPPELQTEGVWLENFRAKAFSALAIAGMSGSCQVTIPL  426

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEI  1606
             G H+ CP++VSF+AR+G D FLL+ VQ ++  LQEQ  +
Sbjct  427   GMHELCPVAVSFLARHGADFFLLETVQTMYGILQEQVAL  465



>ref|XP_010099753.1| Translocon at the outer membrane of chloroplasts 64 [Morus notabilis]
 gb|EXB80330.1| Translocon at the outer membrane of chloroplasts 64 [Morus notabilis]
Length=385

 Score =   410 bits (1053),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 257/338 (76%), Gaps = 8/338 (2%)
 Frame = +2

Query  1013  IEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLN---GEAKLSTTRLLGH----VVQTLKR  1171
             +EK   R  +R    D     +V +L ++K L+    E  L+   LL      + + L R
Sbjct  49    VEKWLERSKMRRFLWDGVEDGRVDNLVAWKTLSRPKEEGGLAIGNLLKKNQALLGKWLWR  108

Query  1172  HEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGI  1351
             HEF+ NH++WI+ VKP LDP+I++ LHE L++ D EI+ C ++RNE+RSAL+ LLKDDGI
Sbjct  109   HEFRHNHEEWINMVKPVLDPVISSALHETLDIEDEEIESCKSIRNEIRSALNSLLKDDGI  168

Query  1352  LVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVA  1531
             LVIPT+ DPPPK G KE QS ++ +RA    S+AS+SG CQ ++PLG  D CP+SVS +A
Sbjct  169   LVIPTIADPPPKVGGKEIQSEEFQNRAFALLSIASMSGCCQVTVPLGSDDNCPVSVSLIA  228

Query  1532  RNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQR  1711
             R+G DRFLLDA+ +L+  L+EQ ++A +SK S N +S+E SAEIAK KGNQA+KEKQW R
Sbjct  229   RHGADRFLLDALHSLYTTLREQTDVA-KSKVSKNIVSREQSAEIAKEKGNQAYKEKQWHR  287

Query  1712  AIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAR  1891
             AI +YTEAIKL G++ATY+SNRAAAYLE+GSF+QAEADCTKAI LDKK++K+Y RRGTAR
Sbjct  288   AISYYTEAIKLCGDNATYYSNRAAAYLEVGSFLQAEADCTKAINLDKKSIKSYLRRGTAR  347

Query  1892  EMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLFH  2005
             EMLGYY +AIEDF+YALVLEPTNKRAA SAE+L KLF 
Sbjct  348   EMLGYYKEAIEDFKYALVLEPTNKRAALSAEKLRKLFQ  385



>ref|XP_006597351.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform 
X2 [Glycine max]
Length=506

 Score =   413 bits (1061),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 228/470 (49%), Positives = 311/470 (66%), Gaps = 7/470 (1%)
 Frame = +2

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ISG NK Y  PTNP   S +PGG SSG+AVAVAA LVDF++G DT G VR+PA +CGILG
Sbjct  37    ISGENKFYGTPTNPQMPSSIPGGSSSGSAVAVAARLVDFAMGTDTTGCVRIPAAFCGILG  96

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS G +S +G++P +QSLD VGWF RDP VL RVG VLL +     +  R I+ A+DL
Sbjct  97    FRPSHGVISTIGVLPNAQSLDTVGWFARDPSVLHRVGLVLLPLNSVELKRTRRIIFADDL  156

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK--LNGEAKLST  1132
             FQ    P+ +T  ++ KAIE   G Q  +H NL  Y+++ VPSLK F++   + +  +S 
Sbjct  157   FQLCKAPSQKTVYIIGKAIENLSGYQFPQHMNLCQYIASNVPSLKEFREKFTHQQNGVSI  216

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
              + L  V+  L+ +EFK NH++W+  VKP L   ++ +++  +      I   + VR EM
Sbjct  217   LKALTSVMFYLQGYEFKTNHEEWVKSVKPRLGRGMSERVNAAMNATHDNIKTLYKVRTEM  276

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
               A   LLKDDGILVIPTV D P K   ++  S ++  RA   +S+AS+SG CQ +IPLG
Sbjct  277   WGAFQHLLKDDGILVIPTVADYPLKLNTEKGFSSEFGDRAFALSSIASISGCCQVAIPLG  336

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIA--VQSKSSNNAISKEASAEIA  1666
              H+ C  SVS ++ +G D+FLL+ V  +++ LQEQ  +A  +    +N ++    ++E+ 
Sbjct  337   CHNDCCASVSLISAHGADKFLLNTVLDMYSTLQEQVSVAYALPLPDTNGSM---GTSELL  393

Query  1667  KGKGNQAFKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIEL  1846
             K KGN AFK + W +A+ +YTEAI L G +ATY+SNRAAAYLELG F +AE DC  AI  
Sbjct  394   KEKGNAAFKGRLWNKAVDYYTEAINLNGTNATYYSNRAAAYLELGCFQEAEEDCNMAILH  453

Query  1847  DKKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAK  1996
             DKKNVKAY RRGTARE+L  Y +A++DF++ALVLEP NK A+ + +RL K
Sbjct  454   DKKNVKAYLRRGTARELLLRYKEALKDFQHALVLEPQNKTASLAEKRLRK  503



>ref|XP_007042952.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
2 [Theobroma cacao]
 gb|EOX98783.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
2 [Theobroma cacao]
Length=519

 Score =   410 bits (1055),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 303/437 (69%), Gaps = 2/437 (0%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             M RK     + D GAF+ER +L+P PQPPPP A  PL+GL+FA+ D+F ++G+VTGFGNP
Sbjct  38    MRRKAIIIKREDFGAFLERFELIPFPQPPPPAAKLPLSGLTFAIKDIFDVKGYVTGFGNP  97

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW +THEPA +T+ VVTAL++ GA CV KT++D++AFG++G NKHY  PTNP   S +PG
Sbjct  98    DWRRTHEPADKTAVVVTALLKNGAKCVGKTVMDELAFGVTGENKHYGTPTNPNMESNVPG  157

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF+LG DT G VR+PA +CGILGF PS GAVS +G++P SQSLD 
Sbjct  158   GSSSGSAVAVAAELVDFALGTDTIGCVRIPASFCGILGFRPSHGAVSTIGLLPNSQSLDA  217

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             +GWF RDP +L  VGHVLLQ+     R  R +V A+DLFQ   +P  +T  VV KAIEK 
Sbjct  218   IGWFARDPSILHCVGHVLLQLKAVEPRRARRLVFADDLFQLSKVPKQKTVYVVSKAIEKL  277

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
              G Q  +H N   Y+++ VPSLK F  +  + +  +S  + L  V+ +L+R+EFK NH++
Sbjct  278   SGYQPPKHINFAQYVASNVPSLKGFCQQSTHLQNGISILKALSSVMVSLQRYEFKTNHEE  337

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             W+ DVKP L   I+  +   +      +   + VR EMR+A+  LLKDDGILVIPT+ D 
Sbjct  338   WVKDVKPRLGAEISNHVLASINTTYGNVKNLYKVRTEMRAAVQSLLKDDGILVIPTIADA  397

Query  1379  PPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLL  1558
             P K  +K+  S ++  +A    S+AS+SGGCQ S+PLG HD CP+SVSFV  +G D+FLL
Sbjct  398   PLKLNSKKGYSTEFHDKAYALLSIASMSGGCQVSVPLGKHDDCPVSVSFVTYHGADKFLL  457

Query  1559  DAVQALFAPLQEQAEIA  1609
             D V  ++A LQ+Q  IA
Sbjct  458   DTVLDMYASLQDQVSIA  474



>ref|NP_001148185.1| LOC100281793 [Zea mays]
 gb|ACG26749.1| amidase [Zea mays]
 gb|ACG29300.1| amidase [Zea mays]
 gb|ACG30101.1| amidase [Zea mays]
Length=587

 Score =   410 bits (1053),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 331/513 (65%), Gaps = 9/513 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             AD+G+F +R +L PP QPPPP A H L+GL+FA SD F IEG+V GFGNPDW KTHE A 
Sbjct  55    ADAGSFCDRFELHPPAQPPPPAARHILSGLTFAASDNFEIEGYVAGFGNPDWKKTHETAR  114

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  VT L + GATCV +TI+D++ FG++G N H+  P NP SSS +PGG  SG+AVAV
Sbjct  115   HTAVAVTMLRKQGATCVGRTIMDELGFGVTGENLHHGTPANPVSSSLVPGGSCSGSAVAV  174

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
             AA LVDF++G DT G VR+PA +CG+L F PS+G +S +G I  SQSLD +GWF RDP +
Sbjct  175   AAQLVDFAIGTDTIGDVRIPASFCGLLCFRPSYGVISTLGTIANSQSLDTIGWFARDPCI  234

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L RVG VLL       +  R  V A+D FQ L +   +T   +  A++   G Q  +H N
Sbjct  235   LHRVGEVLLPAAVGGLKQTRQFVFADDCFQLLKVSNQKTVHAIKNAVQALHGYQPPKHIN  294

Query  1055  LDAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             +  Y+ + VPSLK F     KL  E   S  + +  V+  L+R+EFK NH++W++ VKP 
Sbjct  295   IGQYIYSNVPSLKEFCEPATKL--EEGTSALKAISTVMLLLQRYEFKANHEEWVNTVKPK  352

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L   I+ ++ + +  A   I   +A+RNE+R+AL +LLKD GILV+PT    P K  +KE
Sbjct  353   LGLDISTRVLQAVNFARENIKSLYAIRNELRAALKNLLKDTGILVLPTTAGYPLKRNSKE  412

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
               S  +  R   F  +A+LSG C+ +IP+   D   +S+SFVA +G D+FLL  +   ++
Sbjct  413   RLSSGFEDRMYKFVGVAALSGCCEVTIPMENLDH-HVSLSFVAAHGSDKFLLRNILDTYS  471

Query  1583  PLQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNS  1756
              +Q+Q  +A  +++    N      ++E+ K KGN AFK +QW +AI FY+EAI L   +
Sbjct  472   LIQDQVVLASKLETAPVTNVDVDVNASELLKEKGNSAFKRRQWIKAIEFYSEAISLSDTN  531

Query  1757  ATYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             ATY+ NRAAAYLELG F QAEADC +A+ LD+K
Sbjct  532   ATYYCNRAAAYLELGRFKQAEADCDRALLLDRK  564



>ref|XP_008643640.1| PREDICTED: LOC100281793 isoform X2 [Zea mays]
Length=589

 Score =   407 bits (1045),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 239/512 (47%), Positives = 329/512 (64%), Gaps = 9/512 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D+G+F +R +L PP QPPPP A H L+GL+FA SD F IEG+V GFGNPDW KTHE A  
Sbjct  56    DAGSFCDRFELHPPAQPPPPAARHILSGLTFAASDNFEIEGYVAGFGNPDWKKTHETARH  115

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  VT L + GATCV +TI+D++ FG++G N H+  P NP SSS +PGG  SG+AVAVA
Sbjct  116   TAVAVTMLRKQGATCVGRTIMDELGFGVTGENLHHGTPANPVSSSLVPGGSCSGSAVAVA  175

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A L+DF++G DT G VR+PA +CG+L F PS+G +S +G I  SQSLD +GWF RDP +L
Sbjct  176   AQLIDFAIGTDTIGDVRIPASFCGLLCFRPSYGVISTLGTIANSQSLDTIGWFARDPCIL  235

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVG VLL       +  R  V A+D FQ L +   +T   +  A++   G Q  +H N+
Sbjct  236   HRVGEVLLPAAVGGLKQTRQFVFADDCFQLLKVSNQKTVHAIKNAVQALRGYQPPKHINI  295

Query  1058  DAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               Y+ + VPSLK F     KL  E   S  + +  V+  L+R+EFK NH++W++ VKP L
Sbjct  296   GQYIYSNVPSLKEFCEPATKL--EEGTSALKAISTVMLLLQRYEFKANHEEWVNTVKPKL  353

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                I+ ++ + +  A   I   +A+RNE+R AL +LLKD GILV+PT    P K  +KE 
Sbjct  354   GLDISTRVLQAVNFARENIKSLYAIRNELRVALKNLLKDTGILVLPTTAGYPLKRNSKER  413

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S  +  R   F  +A+LSG C+ +IP+   D   +S+SFVA +G D+FLL  +   ++ 
Sbjct  414   LSSGFEDRMYKFVGVAALSGCCEVTIPMENLDH-HVSLSFVAAHGSDKFLLRNILDTYSL  472

Query  1586  LQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             +Q+Q  +A  +++    N      ++E+ K KGN AFK +QW +AI FY+EAI L   +A
Sbjct  473   IQDQVVLASKLETAPVTNVDVDVNASELLKEKGNSAFKRRQWIKAIEFYSEAISLSDTNA  532

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             TY+ NRAAAYLELG F QAEADC +A+ LD+K
Sbjct  533   TYYCNRAAAYLELGRFKQAEADCDRALLLDRK  564



>gb|AFW73495.1| amidase [Zea mays]
Length=587

 Score =   406 bits (1044),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 239/512 (47%), Positives = 329/512 (64%), Gaps = 9/512 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D+G+F +R +L PP QPPPP A H L+GL+FA SD F IEG+V GFGNPDW KTHE A  
Sbjct  56    DAGSFCDRFELHPPAQPPPPAARHILSGLTFAASDNFEIEGYVAGFGNPDWKKTHETARH  115

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  VT L + GATCV +TI+D++ FG++G N H+  P NP SSS +PGG  SG+AVAVA
Sbjct  116   TAVAVTMLRKQGATCVGRTIMDELGFGVTGENLHHGTPANPVSSSLVPGGSCSGSAVAVA  175

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A L+DF++G DT G VR+PA +CG+L F PS+G +S +G I  SQSLD +GWF RDP +L
Sbjct  176   AQLIDFAIGTDTIGDVRIPASFCGLLCFRPSYGVISTLGTIANSQSLDTIGWFARDPCIL  235

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVG VLL       +  R  V A+D FQ L +   +T   +  A++   G Q  +H N+
Sbjct  236   HRVGEVLLPAAVGGLKQTRQFVFADDCFQLLKVSNQKTVHAIKNAVQALRGYQPPKHINI  295

Query  1058  DAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               Y+ + VPSLK F     KL  E   S  + +  V+  L+R+EFK NH++W++ VKP L
Sbjct  296   GQYIYSNVPSLKEFCEPATKL--EEGTSALKAISTVMLLLQRYEFKANHEEWVNTVKPKL  353

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                I+ ++ + +  A   I   +A+RNE+R AL +LLKD GILV+PT    P K  +KE 
Sbjct  354   GLDISTRVLQAVNFARENIKSLYAIRNELRVALKNLLKDTGILVLPTTAGYPLKRNSKER  413

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S  +  R   F  +A+LSG C+ +IP+   D   +S+SFVA +G D+FLL  +   ++ 
Sbjct  414   LSSGFEDRMYKFVGVAALSGCCEVTIPMENLDH-HVSLSFVAAHGSDKFLLRNILDTYSL  472

Query  1586  LQEQAEIA--VQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             +Q+Q  +A  +++    N      ++E+ K KGN AFK +QW +AI FY+EAI L   +A
Sbjct  473   IQDQVVLASKLETAPVTNVDVDVNASELLKEKGNSAFKRRQWIKAIEFYSEAISLSDTNA  532

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKK  1855
             TY+ NRAAAYLELG F QAEADC +A+ LD+K
Sbjct  533   TYYCNRAAAYLELGRFKQAEADCDRALLLDRK  564



>ref|XP_010278157.1| PREDICTED: amidase 1 isoform X2 [Nelumbo nucifera]
Length=430

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 215/431 (50%), Positives = 296/431 (69%), Gaps = 10/431 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  +D GAF+ER  L PP Q P         GL+FAV D+F +EG+VTGFGNPDWA+TH 
Sbjct  2     ATLSDFGAFMERFILHPPQQLPLK-------GLTFAVKDIFDVEGYVTGFGNPDWARTHG  54

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V A++ AGATCV KT++D+MA+ I+G NKHY  PTNP +  R+PGG SSG+A
Sbjct  55    AAVSTAPAVLAVLNAGATCVGKTVMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSA  114

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV+A LVDFSLG DT G VRVPA +CGI GF PS G VS  G+ P++QS D VGWF RD
Sbjct  115   VAVSAELVDFSLGTDTGGSVRVPAAFCGIYGFRPSHGIVSTTGVTPMAQSFDTVGWFARD  174

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L R+GH+LLQ+P     +P  I+I +D FQ L+IP+DR +QV+ K++EK FG ++++
Sbjct  175   PIILNRIGHLLLQLPDMDPVHPNRIIIPDDCFQLLSIPSDRVTQVLFKSLEKLFGGEVVK  234

Query  1046  HENLDAYLSNKVPSLKSFKKLNGEAK---LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL  Y++++VPSLK F   + E K   + +   L   ++ L+R+EFK NH DW+  +K
Sbjct  235   HINLGDYVNDRVPSLKHFMDKSNEQKEYNIPSLVALSSSMRLLQRYEFKNNHGDWVLSIK  294

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I+ ++ E +   D +I+ CH VRNE+ +AL+ LL+D GIL IPTV  PPPK   
Sbjct  295   PDLGPGISERIWEAIRTTDEKINICHTVRNELHAALTSLLEDFGILAIPTVPGPPPKLQT  354

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             + T+   +   A    S+A +SG CQ +IPLG +D  P++VS +A++G D FLL+ V++L
Sbjct  355   EATKLETFRVGAFSLLSIAGVSGFCQVTIPLGMYDNLPVAVSLLAKHGSDGFLLNLVESL  414

Query  1577  FAPLQEQAEIA  1609
             + PL+EQ +IA
Sbjct  415   YVPLKEQIKIA  425



>ref|XP_010043096.1| PREDICTED: amidase 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW85155.1| hypothetical protein EUGRSUZ_B01996 [Eucalyptus grandis]
Length=432

 Score =   394 bits (1012),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 280/404 (69%), Gaps = 5/404 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F IEG VTGFGNPDWA+THEPA+ T+  V  +++AGATCV KT++D+MA+ 
Sbjct  29    GLTFAVKDIFDIEGHVTGFGNPDWARTHEPASSTAPAVLNVLKAGATCVGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ++G NKHY  P NP +   +PGG SSG+AVAV A LVDFSLG DT G VRVPA  CGILG
Sbjct  89    LTGDNKHYGTPRNPCAPDYVPGGSSSGSAVAVGAMLVDFSLGSDTGGSVRVPASNCGILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS  A+S +G+IP++QSLD VGWF R+P +L++VG VLL++P      P  I+I  D 
Sbjct  149   FRPSHNAISTVGVIPMAQSLDTVGWFAREPSILKQVGRVLLELPEADPNRPSQIIIPTDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK-KLNGEAKLSTT  1135
             FQ LNIP++R +Q +++++EK FG  +I+H  L  Y+ + VP+L SF  ++N +   S  
Sbjct  209   FQLLNIPSERLTQALVRSVEKLFGGAIIKHAVLGDYIRDSVPALSSFLCQINEDQVDSIP  268

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L    Q L+R+EFK +H+DW+  VKP LDPII+ ++ + LE+ +  ID C +V+ E
Sbjct  269   SLAALSSARQLLQRYEFKNHHEDWVSAVKPDLDPIISERVRQALELTEENIDICWSVKKE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY-VSRACLFASLASLSGGCQASIP  1486
             + SAL+ LL D G+L IPTV  PPPK    +  S+D  V +A    S+A LS  CQ SIP
Sbjct  329   LHSALTSLLGDFGVLAIPTVPGPPPKL-QTDASSLDVSVEKAFNLLSIAGLSEFCQVSIP  387

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQS  1618
             +G HD  PIS+S +A+NG D FLLD V+ L+  LQEQA I  +S
Sbjct  388   MGLHDNLPISISLLAKNGADGFLLDLVETLYESLQEQAAIVEKS  431



>ref|XP_008813665.1| PREDICTED: amidase 1-like [Phoenix dactylifera]
 ref|XP_008778647.1| PREDICTED: amidase 1-like [Phoenix dactylifera]
Length=436

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 218/427 (51%), Positives = 279/427 (65%), Gaps = 6/427 (1%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+ER +L PP   PP +      GL+FAV D+F I G VTGFGNPDWA+TH PAT 
Sbjct  8     DYGAFIERFELRPPNHSPPNQPLQ---GLTFAVKDIFDISGHVTGFGNPDWARTHGPATS  64

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             TS VV A ++AGA CV KT++D+MA+ I+G N HY  PTNP    R+PGG SSG+AVAVA
Sbjct  65    TSPVVLAAIDAGAICVGKTVMDEMAYSINGENVHYGTPTNPCVPDRVPGGSSSGSAVAVA  124

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDFSLG DT G VRVPA YC I GF PS G VS   +IP++QS D +GWF RDP  L
Sbjct  125   AKLVDFSLGTDTGGSVRVPAAYCAIFGFRPSHGIVSTTNVIPMAQSFDTIGWFARDPFTL  184

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVGHVLL+VP  A + P  +VI  D FQ L   +D+ S ++ K +EK FG  +I HENL
Sbjct  185   TRVGHVLLKVPIEATKQPTRVVIPEDCFQCLTSLSDQISHILKKTMEKLFGSHIINHENL  244

Query  1058  DAYLSNKVPSLKSFK---KLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLD  1228
               Y+ +KVPSL  F     +N  + + +   L H ++ L+R EFK NH +W++ +KP L 
Sbjct  245   GDYIHHKVPSLGKFMSSISVNQTSAIPSLAALSHSMRLLQRSEFKANHGEWVNTIKPNLG  304

Query  1229  PIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQ  1408
             P I+ ++ E L      I+ CHAVR E+ +AL  LL+D G+L IPTV  PPPK   +   
Sbjct  305   PGISERVSEALSTTYENIEWCHAVRTELHAALCALLEDHGVLAIPTVPGPPPKLHVEART  364

Query  1409  SIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPL  1588
                Y ++A    S+A +SG CQ +IPLG HD  P+SVS +AR+G D FLL+  Q L+  L
Sbjct  365   LELYRAKAFSLLSIAGMSGFCQINIPLGMHDNLPVSVSLLARHGADHFLLNLAQTLYPTL  424

Query  1589  QEQAEIA  1609
             +EQA IA
Sbjct  425   KEQAIIA  431



>emb|CAN77023.1| hypothetical protein VITISV_015334 [Vitis vinifera]
Length=433

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 210/431 (49%), Positives = 283/431 (66%), Gaps = 7/431 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  +D GAF+ER  L P              GL+FAV D+F ++G+VTGFGNPDWA+TH+
Sbjct  2     AKASDYGAFMERFILQPSSSSHELPL----NGLTFAVKDIFDVDGYVTGFGNPDWARTHQ  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V A+++ GATCV KT++D+MA+ I+G NKHY  PTNP +  R+PGG SSG+A
Sbjct  58    AAMLTAPSVLAVLKGGATCVGKTVMDEMAYSINGENKHYGTPTNPQAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A LVDFSLG DT G VRVPA YCGI G  PS G VS  G+IP++QS D VGWF RD
Sbjct  118   VAVGAMLVDFSLGTDTGGSVRVPASYCGIFGIRPSHGVVSTTGVIPMAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P++L RVGHVLL  P      P  I+I  D F+ L+IP DR +QV+IK++EK FG  +++
Sbjct  178   PEILNRVGHVLLPFPDVNPVKPSQIIIPEDCFRLLSIPIDRVTQVLIKSVEKLFGSDIVK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H +L  Y+ +KV SLK F   +    E  + +   L   ++ L+R+EFK NH +W+  V+
Sbjct  238   HVSLGDYVEDKVTSLKPFMSKENQTQEYNIPSLAALSTAMRLLQRYEFKNNHGEWVRAVQ  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E L   D +ID C +++ E RSAL+DLL D G+LV+PTV  PPPK   
Sbjct  298   PDLGPGIRERVWEALGTTDEKIDVCQSLKTEFRSALTDLLGDSGVLVLPTVPGPPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA    S+A +SG CQ SIPLG +D  P++VS +A++G D FLL+ VQ L
Sbjct  358   DPTTLESFRARAFSLLSIAGVSGFCQVSIPLGLYDNLPVAVSLLAKHGSDGFLLNLVQTL  417

Query  1577  FAPLQEQAEIA  1609
             +  ++EQ E+A
Sbjct  418   YGSIKEQVEVA  428



>ref|XP_002284823.2| PREDICTED: amidase 1 [Vitis vinifera]
 emb|CBI36757.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   393 bits (1009),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 209/431 (48%), Positives = 284/431 (66%), Gaps = 7/431 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  ++ GAF+ER  L P              GL+FAV D+F ++G+VTGFGNPDWA+TH+
Sbjct  2     AKASNYGAFMERFILQPSSSSHELPL----NGLTFAVKDIFDVDGYVTGFGNPDWARTHQ  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V A+++ GATCV KT++D+MA+ I+G NKHY  PTNP +  R+PGG SSG+A
Sbjct  58    AAMLTAPSVLAVLKGGATCVGKTVMDEMAYSINGENKHYGTPTNPQAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A LVDFSLG DT G VRVPA YCGI G  PS G VS  G+IP++QS D VGWF RD
Sbjct  118   VAVGAMLVDFSLGTDTGGSVRVPASYCGIFGIRPSHGVVSTTGVIPMAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P++L RVGHVLL  P      P  I+I  D F+ L+IP DR +QV+IK++EK FG  +++
Sbjct  178   PEILNRVGHVLLPFPDVNPVKPSQIIIPEDCFRLLSIPIDRVTQVLIKSVEKLFGSDIVK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H +L  Y+ +KV SLK F   +    E  + +   L   ++ L+R+EFK NH +W+ +V+
Sbjct  238   HVSLGDYVEDKVTSLKPFMSKENQTQEYNIPSLAALSTAMRLLQRYEFKNNHGEWVREVQ  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E L   D +ID C +++ E RSAL+DLL D G+LV+PTV  PPPK   
Sbjct  298   PDLGPGIRERVWEALGTTDEKIDVCQSLKTEFRSALTDLLGDSGVLVLPTVPGPPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA    S+A +SG CQ SIPLG +D  P++VS +A++G D FLL+ VQ L
Sbjct  358   DPTTLESFRARAFSLLSIAGVSGFCQVSIPLGLYDNLPVAVSLLAKHGSDGFLLNLVQTL  417

Query  1577  FAPLQEQAEIA  1609
             +  ++EQ E+A
Sbjct  418   YGSIKEQVEVA  428



>gb|KHG21461.1| Amidase 1 -like protein [Gossypium arboreum]
Length=523

 Score =   396 bits (1017),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 220/431 (51%), Positives = 297/431 (69%), Gaps = 3/431 (1%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER  L+P PQPP P A  PL GL+FA+ D+F ++G+VTGFGNPDW +THEP+
Sbjct  47    RQDFGAFLERFDLIPFPQPPTPPAKLPLQGLTFAIKDIFDVKGYVTGFGNPDWRRTHEPS  106

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
              + + V+TAL++ GA CV KT++D++AFGI+G NKHY  P NP   S +PGG SSG+AVA
Sbjct  107   DKMALVLTALLQNGAKCVGKTVMDELAFGITGENKHYGTPINPKVQSNIPGGSSSGSAVA  166

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAA  VDF+LG DT G +R+PA +CGILGF PS  AVS +G+IP SQSLD +GWF RDP 
Sbjct  167   VAAEFVDFALGTDTIGCIRIPASFCGILGFRPSHRAVSTIGLIPHSQSLDTIGWFARDPS  226

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             VL RVGHVLL+V     +  R +V A+DLFQ   +   +T  VV KAIEK    Q  +  
Sbjct  227   VLHRVGHVLLKVKAVEPKRERRLVFADDLFQLSKVTKQKTIYVVSKAIEK-LSDQPPQQI  285

Query  1052  NLDAYLSNKVPSLKSFKK--LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             N   Y+++ VPSLK+F +   N +  +S  + L  V+ +L+ +EFK NH++W+ +VKP L
Sbjct  286   NFSQYVASNVPSLKAFGQNSTNLQYGISALKALSSVMVSLQSYEFKTNHEEWVKNVKPRL  345

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
              P I+ ++   +      +   + V  EMR+AL  LLKDDGILVIPT++DPPPK  + + 
Sbjct  346   GPQISHRVLAAINTKYENVKVLYKVGTEMRAALQSLLKDDGILVIPTIVDPPPKLNSMKD  405

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  RAC   S+AS+SGGCQA +PLG    CP+SVSFV+ +G D+FLLDAV  ++A 
Sbjct  406   YSTEFHDRACAVLSIASMSGGCQACVPLGNDAGCPVSVSFVSYHGADKFLLDAVLDMYAS  465

Query  1586  LQEQAEIAVQS  1618
             LQ+Q  IA +S
Sbjct  466   LQDQVSIASKS  476



>ref|XP_010278148.1| PREDICTED: amidase 1 isoform X1 [Nelumbo nucifera]
Length=434

 Score =   393 bits (1009),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 215/435 (49%), Positives = 296/435 (68%), Gaps = 14/435 (3%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  +D GAF+ER  L PP Q P         GL+FAV D+F +EG+VTGFGNPDWA+TH 
Sbjct  2     ATLSDFGAFMERFILHPPQQLPLK-------GLTFAVKDIFDVEGYVTGFGNPDWARTHG  54

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V A++ AGATCV KT++D+MA+ I+G NKHY  PTNP +  R+PGG SSG+A
Sbjct  55    AAVSTAPAVLAVLNAGATCVGKTVMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSA  114

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV+A LVDFSLG DT G VRVPA +CGI GF PS G VS  G+ P++QS D VGWF RD
Sbjct  115   VAVSAELVDFSLGTDTGGSVRVPAAFCGIYGFRPSHGIVSTTGVTPMAQSFDTVGWFARD  174

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG----R  1033
             P +L R+GH+LLQ+P     +P  I+I +D FQ L+IP+DR +QV+ K++EK FG     
Sbjct  175   PIILNRIGHLLLQLPDMDPVHPNRIIIPDDCFQLLSIPSDRVTQVLFKSLEKLFGVVFPG  234

Query  1034  QMIRHENLDAYLSNKVPSLKSFKKLNGEAK---LSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
             ++++H NL  Y++++VPSLK F   + E K   + +   L   ++ L+R+EFK NH DW+
Sbjct  235   EVVKHINLGDYVNDRVPSLKHFMDKSNEQKEYNIPSLVALSSSMRLLQRYEFKNNHGDWV  294

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
               +KP L P I+ ++ E +   D +I+ CH VRNE+ +AL+ LL+D GIL IPTV  PPP
Sbjct  295   LSIKPDLGPGISERIWEAIRTTDEKINICHTVRNELHAALTSLLEDFGILAIPTVPGPPP  354

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   + T+   +   A    S+A +SG CQ +IPLG +D  P++VS +A++G D FLL+ 
Sbjct  355   KLQTEATKLETFRVGAFSLLSIAGVSGFCQVTIPLGMYDNLPVAVSLLAKHGSDGFLLNL  414

Query  1565  VQALFAPLQEQAEIA  1609
             V++L+ PL+EQ +IA
Sbjct  415   VESLYVPLKEQIKIA  429



>gb|EMT16420.1| Small glutamine-rich tetratricopeptide repeat-containing protein 
beta [Aegilops tauschii]
Length=677

 Score =   400 bits (1029),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 250/559 (45%), Positives = 342/559 (61%), Gaps = 53/559 (9%)
 Frame = +2

Query  341   SGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQT  520
             SGAF  R  L P PQPPPP A   L  L+FAVSD F IEG+V GFGNPDW +TH+ A+ T
Sbjct  52    SGAFCARRGLAPSPQPPPPAARQQLPDLTFAVSDNFEIEGYVAGFGNPDWKRTHKAASHT  111

Query  521   STVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaa  700
             +  V AL++ GATCV +T++D++ FG++G N H   P NPAS S +PGG  SG+AVAV+A
Sbjct  112   AAAVKALLKQGATCVGRTVMDELGFGVTGENLHCGTPINPASPSVVPGGSCSGSAVAVSA  171

Query  701   NLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLR  880
              LV+F+LG                                          W  RDP +L 
Sbjct  172   QLVEFALG------------------------------------------WLARDPHILS  189

Query  881   RVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEK-QFGRQMIRHENL  1057
             RVG  LL       +  R +V A+D F+ L IP  +T  V+  A+    +G Q  +H N+
Sbjct  190   RVGDALLPAAACGLKGKRQLVFADDCFELLKIPNQKTVDVIENAVRTLPYGFQPPKHINI  249

Query  1058  DAYLSNKVPSLKSF----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
               Y+S+ VPSLK F     KL  E K S  + L  V+  L+R+EFK NH+DW++ VKP L
Sbjct  250   GQYISSNVPSLKEFCEPSTKLQ-EGK-SALKALCTVMLLLQRYEFKANHEDWVNTVKPKL  307

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
                ++ ++ + +   D  I   + VR E R+AL +LLKD GILV+PT+   P K  +K+ 
Sbjct  308   GLEVSTRVLQAVNFTDDNIKSLYIVRTEWRAALKNLLKDTGILVLPTMAGHPLKRNSKQR  367

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
              S ++  +   F S+A+LSG CQA++PLG H+  PIS+SFVA +G D+FLL A+  +++ 
Sbjct  368   LSSEFEDKMYAFVSIAALSGCCQATVPLGNHNDHPISISFVAAHGSDKFLLRAILDMYSA  427

Query  1586  LQEQAEIAVQSKSS-NNAISKEA-SAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             +QEQ  I + SK +    I ++  ++E+ K KGN +FK KQW +AI FY+ AIKL   +A
Sbjct  428   IQEQ--IVLASKLALPPVIDRDVDTSELLKEKGNNSFKRKQWSKAIEFYSGAIKLNDTNA  485

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYA  1939
             TY+ NRAAAYLELG F QAEADC +A+ LDKKNVKAY RRGTA+E +  Y +A++DFR+A
Sbjct  486   TYYCNRAAAYLELGRFKQAEADCDQALLLDKKNVKAYLRRGTAKESVLNYQEALQDFRHA  545

Query  1940  LVLEPTNKRAAQSAERLAK  1996
             L LEP N+ A  + +RL K
Sbjct  546   LALEPQNRTALAAEKRLQK  564



>ref|XP_002454250.1| hypothetical protein SORBIDRAFT_04g027530 [Sorghum bicolor]
 gb|EES07226.1| hypothetical protein SORBIDRAFT_04g027530 [Sorghum bicolor]
Length=572

 Score =   391 bits (1005),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 237/561 (42%), Positives = 327/561 (58%), Gaps = 51/561 (9%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D+G+F +R +L PPPQPPPP A H L+GL+FA SD F +EG+V GFGNPDW  THE A  
Sbjct  56    DAGSFCDRFELHPPPQPPPPAARHLLSGLTFAASDNFEVEGYVAGFGNPDWKNTHEAARH  115

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  VT L + GATCV +TI+D++ FG++G N H+  P NP                   
Sbjct  116   TAVAVTMLRKQGATCVGRTIMDELGFGVTGENLHHGTPANP-------------------  156

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLD-VVGWFTRDPDV  874
                V  SL         VP G C            S   +   +Q +D  +GWF RDP +
Sbjct  157   ---VSPSL---------VPGGSC------------SGSAVAVAAQLVDFAIGWFARDPCI  192

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L RVG VLL       +  R IV A+D FQ L +   +T   +  A++   G Q  +H N
Sbjct  193   LHRVGEVLLPTAAGGLKQTRQIVFADDCFQLLKVSNQKTVHAIKNAVQALRGYQPPKHIN  252

Query  1055  LDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLD  1228
             +  Y+ + VPSLK F +   + +  T+ L  +  V+  L+R+EFK NH++W++ VKP L 
Sbjct  253   IGQYICSNVPSLKEFCEPATKLQEGTSALKAISTVMLLLQRYEFKANHEEWVNTVKPKLG  312

Query  1229  PIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQ  1408
               I+ ++ + +  A   I   +AVRNE+R+AL +LLKD GILV+PT    P K  +KE  
Sbjct  313   LDISTRVLQAVNFAHENIKSLYAVRNELRAALKNLLKDTGILVLPTTAGYPLKRNSKERL  372

Query  1409  SIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPL  1588
             S  +  R   F  +A+LSG C+ +IP+   D   +S+SFVA +G D+FLL  V   ++ +
Sbjct  373   SSGFEDRMYKFVGIAALSGCCEVTIPMENLDH-HVSLSFVAAHGLDKFLLHTVLDTYSLI  431

Query  1589  QEQAEIAVQSKS---SNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFYTEAIKLYGNSA  1759
             Q+Q  +A + ++   +N  I   AS E+ K KGN AFK +QW +AI FY+EAI L   +A
Sbjct  432   QDQVVLASKLETAPVTNVDIDVNAS-ELLKEKGNSAFKRRQWSKAIEFYSEAISLSDTNA  490

Query  1760  TYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGYYNQAIEDFRYA  1939
             TY+ NRAAAYLELG   Q E DC +A+ LD+KNVKAY RRG ARE+   Y +A++DFR+A
Sbjct  491   TYYCNRAAAYLELGRLKQVEGDCDRALLLDRKNVKAYLRRGCAREVTLNYKEALQDFRHA  550

Query  1940  LVLEPTNKRAAQSAERLAKLF  2002
             L LEP NK A  +  RL KL 
Sbjct  551   LALEPQNKTALAAERRLQKLL  571



>gb|KHN26750.1| Outer envelope protein 64, mitochondrial [Glycine soja]
Length=577

 Score =   390 bits (1001),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 258/607 (43%), Positives = 339/607 (56%), Gaps = 110/607 (18%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R+ +   K D GAFVER++LLP PQP   +     + L+FA+ D+F ++G+VTGFGNP W
Sbjct  33    RRHRNLPKEDFGAFVERIELLPIPQPNQTQTL---SALTFAIKDIFDVKGYVTGFGNPQW  89

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTH  A +T+ V+TAL+  GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG 
Sbjct  90    KKTHGEAGKTAIVITALLSDGATCVGKTVMDEFSFGISGENKFYGTPTNPQMPSSIPGGS  149

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AVAVAA LVDF++G DT G VR+PA +CGILGF PS G +S +G++P +QSLD VG
Sbjct  150   SSGSAVAVAARLVDFAIGTDTTGCVRIPAAFCGILGFRPSHGVISTIGVLPNAQSLDTVG  209

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL RVG VLL +     +  R I+ A+DLFQ    P+ +T+ ++ KAIE    
Sbjct  210   WFARDPSVLHRVGLVLLPLTSVELKRTRRIIFADDLFQLSKAPSQKTAYIIGKAIE----  265

Query  1031  RQMIRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDD  1210
                    NL  Y S                       L H+           N   +I  
Sbjct  266   -------NLSGYQS-----------------------LQHM-----------NLCQYIAS  284

Query  1211  VKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKA  1390
               P+L        HE L      +           S L  L  DDGILVIPTV D P K 
Sbjct  285   NVPSLK-----GFHEKLTQQQNGL-----------SILKALTSDDGILVIPTVADYPLKL  328

Query  1391  GAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQ  1570
               ++  S ++  RA   +S+AS+SG CQ +IPLG H+ C  S+S ++ +G D+FLL+ V 
Sbjct  329   NTEKGFSSEFHDRAFALSSIASISGCCQVAIPLGCHNDCCASISLISAHGVDKFLLNTVL  388

Query  1571  ALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGK---------------------GNQA  1687
              +++ LQEQ  +A      +   S E S E+ K K                     GN A
Sbjct  389   DMYSTLQEQVSVAYALPLLDTNGSMETS-ELLKEKMFYAYNLSCSNMKILSRAFLQGNTA  447

Query  1688  FKEKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKK----  1855
             FK + W +A+ +YTEAI L G +ATY+SNRAAAYLELG F +AE DC  AI  DKK    
Sbjct  448   FKGRLWNKAVDYYTEAINLNGTNATYYSNRAAAYLELGCFQEAEEDCNMAILHDKKVRRW  507

Query  1856  --------------------NVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQ  1975
                                 NVKAY RRGTARE+L  Y +A++DF++ALVLEP NK A+ 
Sbjct  508   ACQHVTDKIMENLYSKPAINNVKAYLRRGTAREVLLCYKEALKDFQHALVLEPQNKTASL  567

Query  1976  SAERLAK  1996
             + +RL K
Sbjct  568   AEKRLRK  574



>ref|XP_010938781.1| PREDICTED: amidase 1-like isoform X1 [Elaeis guineensis]
Length=436

 Score =   383 bits (984),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 217/427 (51%), Positives = 279/427 (65%), Gaps = 6/427 (1%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+ER +L PPP  PP +      GL+FAV D+F I G VTGFG+P+WA+TH PAT 
Sbjct  8     DYGAFIERFELRPPPHSPPHQPLQ---GLTFAVKDIFDISGHVTGFGSPEWARTHRPATS  64

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             TS VV A ++AGA CV KT++D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVAVA
Sbjct  65    TSPVVLAAIDAGAICVGKTVMDEMAYSINGENVHYGTPTNPCAPDRVPGGSSSGSAVAVA  124

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDFSLG DT G VRVPA YCGI GF PS G +S   +IP++QS D VGWF RDP  L
Sbjct  125   AKLVDFSLGTDTGGSVRVPAAYCGIFGFRPSHGIISTTNVIPMAQSFDTVGWFARDPITL  184

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RVG+VLLQ+P    + P  IVI  D FQ L  P D+ S +V K++EK FG  +I HENL
Sbjct  185   TRVGNVLLQLPIDTTKQPTRIVIPEDCFQCLTSPIDQISHIVNKSMEKLFGSDIINHENL  244

Query  1058  DAYLSNKVPSLKSFKKLNGEAKLS---TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLD  1228
               Y+ +KVPSL  F     E + S   +   + H ++ L+R EFK NH +W++ +KP L 
Sbjct  245   GDYIHHKVPSLGKFMSNTSENQTSGIPSLAAISHSMRLLQRSEFKANHGEWVNTIKPNLG  304

Query  1229  PIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQ  1408
             P I+ ++ E L      I+ C A+R E+ +AL  LL+D G+L IPTV  PPPK   +   
Sbjct  305   PGISERVSEALSETCENIEWCCAMRTELHAALCALLEDHGVLAIPTVPGPPPKLRVEAHT  364

Query  1409  SIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPL  1588
                Y +RA    S+A +S  CQ +IPLG  D  P+SVS +AR+G D FLL+  QAL+  L
Sbjct  365   LELYRARAFSLLSIAGMSRFCQINIPLGMRDNLPVSVSLLARHGADHFLLNLAQALYPTL  424

Query  1589  QEQAEIA  1609
             +EQA IA
Sbjct  425   KEQASIA  431



>ref|XP_010043094.1| PREDICTED: amidase 1 [Eucalyptus grandis]
 gb|KCW85153.1| hypothetical protein EUGRSUZ_B01994 [Eucalyptus grandis]
Length=432

 Score =   383 bits (983),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 197/403 (49%), Positives = 275/403 (68%), Gaps = 3/403 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG VTGFGNPDWA+TH PA+ T+  V  +++AGATCV KT++D+MA+ 
Sbjct  29    GLTFAVKDIFDVEGHVTGFGNPDWARTHAPASSTAPAVLNVLKAGATCVGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G NKHY  P NP +  R+PGG SSG+AVAV A L DFSLG DT G VRVPA YCGILG
Sbjct  89    INGENKHYGTPRNPCAPDRVPGGSSSGSAVAVGAMLADFSLGSDTGGSVRVPASYCGILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS  A+S +G+IP++Q+ D VGWF R+P +L++VG VLL++P      P  I+I  D 
Sbjct  149   FRPSHNAISTVGVIPMAQAFDTVGWFAREPSILKQVGRVLLELPEADPNRPSQIIIPRDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK-KLNGEA--KLS  1129
             FQ L+IP++R +Q  ++++EK FG  +I+H  L  Y+ + VP+L SF  ++N +    + 
Sbjct  209   FQLLDIPSERLTQAFVRSVEKLFGGDIIKHTVLGDYVRDNVPALSSFLFQINEDQVDNIP  268

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH DW+  VKP L P I+ ++ E L+  +  ID C +V+ E
Sbjct  269   SLAALSSAMRLLQRYEFKNNHKDWVSAVKPDLGPGISERVREALQTTEENIDICQSVKKE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             + SAL+ LL D GIL IPTV  PPPK     +    + ++A    S+A +SG CQ SIP+
Sbjct  329   LHSALTSLLGDFGILAIPTVPGPPPKLQTDASSLEVFRAKAFSLLSIAGVSGFCQVSIPM  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQS  1618
             G HD  PIS+S +A++G D FLLD V+ L+  L+EQA +A +S
Sbjct  389   GLHDNLPISISLLAKHGADGFLLDLVETLYESLKEQAAVAEKS  431



>ref|XP_011023584.1| PREDICTED: LOW QUALITY PROTEIN: amidase 1-like [Populus euphratica]
Length=430

 Score =   381 bits (979),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 267/399 (67%), Gaps = 3/399 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG+VTGFGNPDWA TH  AT T+  V A++  GATCV KT++D+MA+ 
Sbjct  29    GLTFAVKDIFDVEGYVTGFGNPDWASTHSAATSTAPAVLAVLRGGATCVGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP +   +PGG SSG+AVAV A +VDFS+G DT G VRVPA YCGILG
Sbjct  89    INGENMHYGTPTNPCAPDCVPGGSSSGSAVAVGAKIVDFSMGTDTGGSVRVPASYCGILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS  AV   G+IP++QS D VGWF RDP +L RVG +LLQ P      P  ++IA D 
Sbjct  149   FRPSHNAVPSAGVIPMAQSFDTVGWFARDPVILSRVGRILLQSPVMDPIKPSQVIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKL-NGEAKLS  1129
             FQ  NIP DR  QV++K++EK +G  +++H  L  Y+   VPSLK F  K++   E  + 
Sbjct  209   FQLSNIPNDRLGQVLVKSVEKIYGGHVVKHTVLGDYVKENVPSLKHFMSKEIKEQEYNIP  268

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L + +++L+R+EFK NH +WI  VKP L P I+ ++ E +      +D CH+V+ E
Sbjct  269   SLAALSNAMRSLQRYEFKDNHGEWITSVKPELGPGISERVWEAVRTTGDNVDACHSVKTE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             + +AL+ LL+D GIL IPTV   PPK     T    + ++A    S+A +SG CQ SIPL
Sbjct  329   LHAALATLLQDFGILAIPTVPGLPPKLQTDPTTLEIFRAKAFSLLSIAGVSGFCQVSIPL  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEI  1606
             G HD  P++VS +A++G D FLL+ V++L+  L+EQ EI
Sbjct  389   GMHDNLPVAVSLLAKHGSDAFLLNVVESLYGTLKEQVEI  427



>gb|KCW85156.1| hypothetical protein EUGRSUZ_B01996 [Eucalyptus grandis]
Length=423

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 272/395 (69%), Gaps = 5/395 (1%)
 Frame = +2

Query  446   FHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYD  625
             F IEG VTGFGNPDWA+THEPA+ T+  V  +++AGATCV KT++D+MA+ ++G NKHY 
Sbjct  29    FDIEGHVTGFGNPDWARTHEPASSTAPAVLNVLKAGATCVGKTVMDEMAYSLTGDNKHYG  88

Query  626   APTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVS  805
              P NP +   +PGG SSG+AVAV A LVDFSLG DT G VRVPA  CGILGF PS  A+S
Sbjct  89    TPRNPCAPDYVPGGSSSGSAVAVGAMLVDFSLGSDTGGSVRVPASNCGILGFRPSHNAIS  148

Query  806   HMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTD  985
              +G+IP++QSLD VGWF R+P +L++VG VLL++P      P  I+I  D FQ LNIP++
Sbjct  149   TVGVIPMAQSLDTVGWFAREPSILKQVGRVLLELPEADPNRPSQIIIPTDCFQLLNIPSE  208

Query  986   RTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK-KLNGEAKLSTTRL--LGHVV  1156
             R +Q +++++EK FG  +I+H  L  Y+ + VP+L SF  ++N +   S   L  L    
Sbjct  209   RLTQALVRSVEKLFGGAIIKHAVLGDYIRDSVPALSSFLCQINEDQVDSIPSLAALSSAR  268

Query  1157  QTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLL  1336
             Q L+R+EFK +H+DW+  VKP LDPII+ ++ + LE+ +  ID C +V+ E+ SAL+ LL
Sbjct  269   QLLQRYEFKNHHEDWVSAVKPDLDPIISERVRQALELTEENIDICWSVKKELHSALTSLL  328

Query  1337  KDDGILVIPTVIDPPPKAGAKETQSIDY-VSRACLFASLASLSGGCQASIPLGFHDKCPI  1513
              D G+L IPTV  PPPK    +  S+D  V +A    S+A LS  CQ SIP+G HD  PI
Sbjct  329   GDFGVLAIPTVPGPPPKL-QTDASSLDVSVEKAFNLLSIAGLSEFCQVSIPMGLHDNLPI  387

Query  1514  SVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQS  1618
             S+S +A+NG D FLLD V+ L+  LQEQA I  +S
Sbjct  388   SISLLAKNGADGFLLDLVETLYESLQEQAAIVEKS  422



>ref|XP_004302440.1| PREDICTED: amidase 1-like [Fragaria vesca subsp. vesca]
Length=434

 Score =   380 bits (975),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 274/426 (64%), Gaps = 7/426 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             AD+GAFVE+  L P             +GL+FAV D+F + G+VTGFGNPDWA+TH  A 
Sbjct  5     ADNGAFVEKFLLQPSSSSHELPL----SGLTFAVKDIFDVAGYVTGFGNPDWARTHPGAE  60

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  ++ ++  GATC+ KT++D+MA+ I+G NKHY  P NP +  R+PGG SSG+AV V
Sbjct  61    STAPSISTILRGGATCIGKTVMDEMAYSINGENKHYGTPVNPCAPDRVPGGSSSGSAVVV  120

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A+L DFSLG DT G VRVPA YCGI GF PS GA+S  G+ P++QS D VGWF RDP +
Sbjct  121   GADLADFSLGTDTGGSVRVPASYCGIFGFRPSHGAISTSGVTPMAQSFDTVGWFARDPVL  180

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L RVG  LLQ+P      P  ++IA D FQ  +IPTDR  QV++ ++EK FG  +++H N
Sbjct  181   LSRVGRALLQIPDAHPVRPVQLIIAEDCFQLSSIPTDRVKQVLVHSVEKLFGGHVLKHAN  240

Query  1055  LDAYLSNKVPSLKS-FKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             L   + +KVPSL   F K N   + +   L  L   ++ L+RHEFK NH +WI  ++P L
Sbjct  241   LGDIVKDKVPSLNCFFSKGNASQEFNIPSLAALSSAMRILQRHEFKTNHGEWIKTIRPDL  300

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
              P I+ ++ E +  AD   + CH+V+ E+R+ L++LL D G+L IPTV  PPPK     T
Sbjct  301   GPGISERVWEAVRAADENTNVCHSVKTELRATLTELLGDAGVLAIPTVPGPPPKLQMDPT  360

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAP  1585
                 + +RA    S+A +SG CQ SIPLG H+  P+SVS +A +G D FLL  V+ L+  
Sbjct  361   TLETFRARAFSLLSIAGVSGFCQVSIPLGMHEGLPVSVSLLATHGSDGFLLSLVETLYGT  420

Query  1586  LQEQAE  1603
             L+EQ E
Sbjct  421   LKEQVE  426



>ref|XP_011023586.1| PREDICTED: amidase 1-like isoform X1 [Populus euphratica]
Length=434

 Score =   378 bits (970),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/401 (50%), Positives = 268/401 (67%), Gaps = 7/401 (2%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+ AV D+F +EG+VTGFG+PDWA+TH  AT T+  V A++ AGATCV KT++D+MA+ 
Sbjct  29    GLTVAVKDIFDMEGYVTGFGHPDWARTHSAATSTAPAVLAVLRAGATCVGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I G N HY  P NP +  R+PGG SSG+AVAV A +VDFSLG DT G VRVPA YCGILG
Sbjct  89    IDGENIHYGTPINPCAPDRVPGGSSSGSAVAVGAKIVDFSLGTDTGGSVRVPASYCGILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS+ AV   G++P++QS D VGWF RDP +L RVGHVLLQ P      P  ++IA D 
Sbjct  149   FRPSYDAVPSAGVVPLAQSFDTVGWFARDPVILSRVGHVLLQSPVMDPIKPSQVIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-----KKLNGEAK  1123
             FQ  NIP DR  QV++K++EK +G  +++H  L  Y+  KVPSLK F     K+L  E  
Sbjct  209   FQLSNIPNDRLGQVLVKSVEKIYGGHILKHMVLGDYVKEKVPSLKHFMSNEIKEL--EHN  266

Query  1124  LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVR  1303
             + +   L + +++L+R+EFK NH +WI  VKP L P I+  + + +      ID CH+V+
Sbjct  267   IPSLAALSNAMRSLERYEFKDNHSEWITTVKPELGPGISEWVWKAIRSTGENIDACHSVK  326

Query  1304  NEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASI  1483
              E+ +AL+ LL+D GIL IPTV   PPK     T    + ++A    S+A +SG CQ SI
Sbjct  327   TELHAALATLLQDFGILAIPTVPGLPPKLQTDPTTLEIFRAKAFSLLSIAGVSGFCQVSI  386

Query  1484  PLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEI  1606
             PLG +D  P++VS +A+ G D FLL+ V++L+  L+EQ EI
Sbjct  387   PLGMYDNLPVAVSLLAKQGSDAFLLNVVESLYGTLKEQVEI  427



>ref|XP_009391586.1| PREDICTED: amidase 1 [Musa acuminata subsp. malaccensis]
Length=440

 Score =   377 bits (968),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 270/400 (68%), Gaps = 3/400 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F I G VTGFGNPDWA+THE A+ TS VV A + AGATCV KT++D+MA+ 
Sbjct  36    GLTFAVKDIFDISGCVTGFGNPDWARTHEAASSTSPVVLAAIGAGATCVGKTVMDEMAYS  95

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP +  R+PGG SSG+AVAVAANL DF+LG DT G VRVPA YCGI G
Sbjct  96    INGENYHYGTPTNPCAPDRVPGGSSSGSAVAVAANLADFALGTDTGGSVRVPAAYCGIFG  155

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS G +S  G+IP++QS D VGWF RDP  L RVG VLLQ    A   P+  VI  D 
Sbjct  156   FRPSHGIISATGVIPMAQSFDTVGWFARDPITLTRVGQVLLQSSSDATMPPKRFVIPEDC  215

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGE--AKLS  1129
             FQ L+ P+D+ SQ++ K++E+ FG  ++ HENL  ++ + VPSL++F    +G+  + + 
Sbjct  216   FQYLSSPSDQISQILKKSVEEVFGCSILHHENLGDHIYHNVPSLQNFISSFSGDQASTMP  275

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
                 L H ++ L+R EFK NH DW+   KPTL P +  ++ E L     +++ C+ VR E
Sbjct  276   VLAALSHAMRLLQRFEFKTNHGDWLISTKPTLGPGMFERVSEVLNSTYEDLEYCYPVRAE  335

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +++ LS LL+D+GIL +PT+   PPK   +  +   + +RA    S+A +SG CQ SIPL
Sbjct  336   LQAFLSTLLQDNGILALPTIPGVPPKLNMEVDELDSFRARAFSLLSIAGMSGFCQISIPL  395

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIA  1609
             G HD  P+SVS +A++  D FLLD VQ L+A L+EQA IA
Sbjct  396   GMHDDLPVSVSLLAKHNADHFLLDIVQTLYATLKEQASIA  435



>ref|XP_010674770.1| PREDICTED: amidase 1 [Beta vulgaris subsp. vulgaris]
Length=431

 Score =   374 bits (959),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 204/434 (47%), Positives = 279/434 (64%), Gaps = 7/434 (2%)
 Frame = +2

Query  329   VKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEP  508
             +++D GAF+E+  L P             TGL+FAV ++F +EGFVTGFGNPDWA+TH  
Sbjct  1     MESDYGAFMEKFTLSPSSSSGELSL----TGLNFAVKEIFDVEGFVTGFGNPDWARTHTT  56

Query  509   ATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaav  688
             A  T+  V AL+ AGATCV +T++D+MA+ I+G N HY  P NP S+ R+PGG SSG+AV
Sbjct  57    ANSTAPAVLALLRAGATCVGRTVMDEMAYSINGENIHYGTPRNPCSADRVPGGSSSGSAV  116

Query  689   avaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDP  868
             AV AN+VDFSLG DT G VRVPA +C I G  PS G VS  G++P++QS D VGWF RDP
Sbjct  117   AVGANIVDFSLGTDTGGSVRVPAAFCKIYGIRPSHGVVSVDGVVPMAQSFDTVGWFARDP  176

Query  869   DVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRH  1048
              +L+RVG VLL        NP +I+ A D F+ LNIP DR  QV++  +EK FG Q++++
Sbjct  177   AILKRVGDVLLPTVDAPLANPSSIIFAEDCFKLLNIPIDRVKQVLVNTLEKLFGGQVLKY  236

Query  1049  ENLDAYLSNKVPSLKSFKKLNGEAK---LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKP  1219
              ++  Y+   V SLK F    G+AK   + +   L   ++ L+R+EFK NH +W+   KP
Sbjct  237   MDIGNYVEENVSSLKHFMSQGGDAKEYSIPSLVALSSAMRLLQRYEFKINHGEWVSSTKP  296

Query  1220  TLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
              L P I  ++ E +   D +ID CH+VR E+R+AL+ LL D GIL IPTV  PPPK   +
Sbjct  297   ILGPGINERVWEAVRATDDKIDICHSVRTELRAALASLLGDVGILAIPTVPGPPPKLQTE  356

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
              +    + +RA    S+A +SG CQ SIPLG +D  P+SVS +A++G D FL+  V+ L 
Sbjct  357   PSTLETFRARAFSLLSIAGVSGFCQVSIPLGLYDDLPVSVSLLAKHGSDMFLMSLVENLC  416

Query  1580  APLQEQAEIAVQSK  1621
               L+E  + A +S 
Sbjct  417   PTLKEHIDAATRSS  430



>ref|XP_004135624.1| PREDICTED: amidase 1-like [Cucumis sativus]
 gb|KGN66086.1| hypothetical protein Csa_1G570110 [Cucumis sativus]
Length=428

 Score =   373 bits (958),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/399 (48%), Positives = 269/399 (67%), Gaps = 3/399 (1%)
 Frame = +2

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL+FAV D+F ++G VTGFGNP+W +TH PA  T+  V+ ++  GATC+ +TI+D+MA+
Sbjct  27    TGLTFAVKDIFDMDGHVTGFGNPEWLRTHPPANHTAPTVSTILRGGATCIGRTIMDEMAY  86

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I+G N HY  P NP +S R+PGG SSG+AVAV ANLVDFSLG DT G VRVPA YCGIL
Sbjct  87    SINGENFHYGTPQNPCASDRVPGGSSSGSAVAVGANLVDFSLGTDTGGSVRVPASYCGIL  146

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF PS GAVS  G++P++QS+D VGWF RDP VL++VG +LLQ P    + PR ++IA D
Sbjct  147   GFRPSHGAVSTSGVVPMAQSMDTVGWFARDPVVLKKVGWLLLQQPEVEHQKPRQVLIAED  206

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK---KLNGEAKL  1126
              F+  +IP++R +Q  + +++K FG   I+  +L  Y+  KVPSLK F        E  +
Sbjct  207   CFKLSSIPSERLTQAFVNSVKKLFGGHPIKEVSLGNYVEEKVPSLKHFMIEGNAGNEHSI  266

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
              +   L   +Q L+R+EFK NH++W+    P L P I+ ++ E +   D  ID CH++R 
Sbjct  267   PSLAALARSLQLLQRYEFKINHEEWVRTYNPHLGPGISERVSEAMRATDENIDLCHSIRI  326

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E+R AL+ LL+D G+L IPTV  PPPK     ++  D+ ++A    S+A +SG CQ SIP
Sbjct  327   ELRKALAALLEDFGVLAIPTVPGPPPKLNTDVSELQDFRAKAFSLLSIAGVSGFCQVSIP  386

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAE  1603
             LG ++  P+S+S VA +G D FLL+ V +L+  L+E+ +
Sbjct  387   LGLYNGLPVSISLVANHGSDGFLLNVVHSLYNTLEEEVK  425



>ref|XP_007030866.1| Amidase 1 [Theobroma cacao]
 gb|EOY11368.1| Amidase 1 [Theobroma cacao]
Length=430

 Score =   373 bits (958),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 270/403 (67%), Gaps = 3/403 (1%)
 Frame = +2

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             +GL+FAV D+F IEG+VTGFGNPDWA+TH  AT T+  V  L++ GATC+ KT++D+MA+
Sbjct  28    SGLTFAVKDIFDIEGYVTGFGNPDWARTHSAATTTAPAVMDLLKGGATCLGKTVMDEMAY  87

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              + G NKHY  PTNP +  R+PGG SSG+AVAV A LVDFSLG DT   VRVPA YCGIL
Sbjct  88    CMYGVNKHYGTPTNPCAPDRVPGGSSSGSAVAVGAMLVDFSLGTDTGASVRVPASYCGIL  147

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF PS GA+S +G++P+SQS D VGWF RDP +L RVG VLL +P      P +I+IA D
Sbjct  148   GFRPSLGAISTVGVVPMSQSFDTVGWFARDPVILNRVGRVLLHLPDVDPIKPNHIIIAED  207

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNGEAKL  1126
              F   ++P+DRT+Q+++K+I K FG Q ++H  L  Y+ +KVPSL+ F   +  + E  +
Sbjct  208   CFHLSSVPSDRTAQILVKSIRKLFGGQCVKHVILGDYVKDKVPSLQHFMDKENEDQEDNI  267

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
              +   L   ++ L+R+EFK NH +W+  V P   P I+ ++ + ++V    +D CH+VR 
Sbjct  268   PSLAALSSAMRLLQRYEFKNNHAEWVAKVNPDFGPGISERIWDAIKVTGENVDVCHSVRT  327

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E+ +AL+DLL D GIL +PT    PPK  A  +    + S+     S+A +SG CQ SIP
Sbjct  328   ELCAALTDLLGDHGILALPTTPGEPPKVQANPSTLDLFFSKPFSLLSIAGVSGFCQVSIP  387

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQ  1615
             LG +   P+++S  A++G D FLL+ V+ L+  L+EQ E+  +
Sbjct  388   LGMYHNVPVAISLAAKHGSDAFLLNLVETLYDSLKEQIELLTE  430



>ref|XP_004166037.1| PREDICTED: amidase 1-like [Cucumis sativus]
Length=428

 Score =   373 bits (958),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 268/397 (68%), Gaps = 3/397 (1%)
 Frame = +2

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL+FAV D+F ++G VTGFGNP+W +TH PA  T+  V+ ++  GATC+ +TI+D+MA+
Sbjct  27    TGLTFAVKDIFDMDGHVTGFGNPEWLRTHPPANHTAPTVSTILRGGATCIGRTIMDEMAY  86

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I+G N HY  P NP +S R+PGG SSG+AVAV ANLVDFSLG DT G VRVPA YCGIL
Sbjct  87    SINGENFHYGTPQNPCASDRVPGGSSSGSAVAVGANLVDFSLGTDTGGSVRVPASYCGIL  146

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF PS GAVS  G++P++QS+D VGWF RDP VL++VG +LLQ P    + PR ++IA D
Sbjct  147   GFRPSHGAVSTSGVVPMAQSMDTVGWFARDPVVLKKVGWLLLQQPEVEHQKPRQVLIAED  206

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK---KLNGEAKL  1126
              F+  +IP++R +Q  + +++K FG   I+  +L  Y+  KVPSLK F        E  +
Sbjct  207   CFKLSSIPSERLTQAFVNSVKKLFGGHPIKEVSLGNYVEEKVPSLKHFMIEGNAGNEHSI  266

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
              +   L   +Q L+R+EFK NH++W+    P L P I+ ++ E +   D  ID CH++R 
Sbjct  267   PSLAALARSLQLLQRYEFKINHEEWVRTYNPHLGPGISERVSEAMRATDENIDLCHSIRI  326

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E+R AL+ LL+D G+L IPTV  PPPK     ++  D+ ++A    S+A +SG CQ SIP
Sbjct  327   ELRKALAALLEDFGVLAIPTVPGPPPKLNTDVSELQDFRAKAFSLLSIAGVSGFCQVSIP  386

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             LG ++  P+S+S VA +G D FLL+ V +L+  L+E+
Sbjct  387   LGLYNGLPVSISLVANHGSDGFLLNVVHSLYNTLEEE  423



>dbj|BAG84637.1| indole-3-acetamide hydrolase [Nicotiana tabacum]
Length=425

 Score =   372 bits (955),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 265/396 (67%), Gaps = 3/396 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG +TGFGNPDWAKTH  AT T+T V  L++AGATC+AKT++D+MA+ 
Sbjct  29    GLTFAVKDIFDVEGHITGFGNPDWAKTHSAATSTATTVLTLLKAGATCIAKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  P NP S  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI G
Sbjct  89    INGENVHYGTPVNPVSPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIYG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
               PS G VS +G+ P++QS D VGWF RDP +L++VG VLLQ P     +P NI+IA D 
Sbjct  149   IRPSHGVVSTVGVTPMAQSFDTVGWFARDPLILKQVGRVLLQSPQVNSVHPTNIIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKL---NGEAKLS  1129
             F+ L+  +++  +V++ ++EK +G  MI++ ++   +   VPSLK F  L   N E+ + 
Sbjct  209   FKLLDSKSNQLIEVLVSSVEKLYGSHMIKYASVGDCIEGNVPSLKKFMTLGTGNDESYIP  268

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH +W+  VKP+L P I  ++ E L+  D  ID CH+V+ E
Sbjct  269   SLLALSAAMRLLQRYEFKENHGEWVSTVKPSLGPGIAERVWEALKATDENIDVCHSVKAE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +R+AL+ LL D GIL IPTV  PPPK     +    +  +A    S+A +SG CQ SIPL
Sbjct  329   LRAALTALLGDSGILAIPTVPGPPPKLRTDTSALEGFRVKAFSLLSIAGVSGFCQVSIPL  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             G  D  PISVS + ++G D  LLDAV+A+   L+ Q
Sbjct  389   GMQDNLPISVSLLGKHGSDWLLLDAVEAIHNVLKGQ  424



>ref|XP_008450658.1| PREDICTED: amidase 1-like [Cucumis melo]
Length=427

 Score =   371 bits (953),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 189/399 (47%), Positives = 267/399 (67%), Gaps = 3/399 (1%)
 Frame = +2

Query  416   TGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAF  595
             TGL+FAV D+F ++G VTGFGNP+W +TH PA  T+  V+ ++  GATC+ +TI+D+MA+
Sbjct  26    TGLTFAVKDIFDMDGHVTGFGNPEWLRTHPPANHTAPTVSTILRGGATCIGRTIMDEMAY  85

Query  596   GISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGIL  775
              I+G N HY  P NP +S R+PGG SSG+AVAV ANLVDFSLG DT G VRVPA YCGIL
Sbjct  86    SINGENFHYGTPQNPCASDRVPGGSSSGSAVAVGANLVDFSLGTDTGGSVRVPASYCGIL  145

Query  776   GFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIAND  955
             GF PS GAVS  G++P++QS D VGWF RDP V ++VG +LLQ P    + P  ++IA D
Sbjct  146   GFRPSHGAVSTSGVVPMAQSFDTVGWFARDPVVFKKVGLLLLQQPEVEHQKPTQVLIAED  205

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK---KLNGEAKL  1126
              F+  +IP++R +Q  + +++K FG  +I+  NL  Y+  KVPSLK F        E  +
Sbjct  206   CFKLSSIPSERLTQAFVNSVKKLFGGHLIKQVNLGNYVEEKVPSLKQFMIEGNAGNEHSI  265

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
              +   L   +Q L+R+EFK NH++W+    P L P I+ ++ E +   D  ID CH+++ 
Sbjct  266   PSLAALARSLQLLQRYEFKINHEEWVRTYNPHLGPGISERVSEAMRATDENIDLCHSIKI  325

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E+R AL+ LL+D G+L IPTV  PPPK     ++  D+ ++A    S+A +SG CQ SIP
Sbjct  326   ELRRALAALLEDFGVLAIPTVPGPPPKLNTDVSELHDFRAKAFSLLSIAGVSGFCQVSIP  385

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAE  1603
             LG ++  P+S+S VA +G D FLL+ V +L+  L+E+ +
Sbjct  386   LGLYNGLPVSISLVANHGSDGFLLNVVHSLYNTLEEEVK  424



>ref|XP_008370498.1| PREDICTED: amidase 1-like [Malus domestica]
Length=428

 Score =   371 bits (952),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 280/427 (66%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ ++ GAFVE++ L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSNHGAFVEKILLQPPSPSRDLPL----SGLTFAVKDIFDVAGHVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GATC+  T++D+MA+ I+G N+HY  PTNP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATCIGITVMDEMAYSINGENEHYGTPTNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A+L DFSLG DT G VRVP+ YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VAVGADLADFSLGTDTGGSVRVPSSYCGIFGFRPSHGVISTSGVTPMAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P      P   +IA D FQ  +IP++R  QV++ ++EK FG  +IR
Sbjct  178   PAILNRVGQVLLQLPDMGPVVPTQFIIAEDCFQLSSIPSNRVEQVLVDSVEKLFGGHVIR  237

Query  1046  HENLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + ++VPSL +F  K N   + +   L  L   ++ L+R+EFK NH +W+  V+
Sbjct  238   HANLRDVVKDRVPSLNTFLDKGNASQEYNIPPLTALSSAMRLLQRYEFKNNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E ++ AD  +D CH+++ E+R+AL++LL D G+L IPTV   PPK   
Sbjct  298   PDLGPXIAERVWEAVQSADENVDVCHSIKTELRAALTELLGDFGVLAIPTVPGAPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA    S+A LSG CQ SIPLG +D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLETFRARAFSLLSIAGLSGLCQVSIPLGLYDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+EQ
Sbjct  418   YDTLKEQ  424



>emb|CDP20120.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   370 bits (951),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 283/426 (66%), Gaps = 7/426 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D+GAF+++  L               +GL+FAV D+F ++G+VTGFGNPDWA+TH  AT
Sbjct  6     SDNGAFMDKFILKSGSSSSQLPL----SGLTFAVKDIFDVDGYVTGFGNPDWARTHSAAT  61

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V AL+ AGATCV KT++D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVAV
Sbjct  62    STAPAVLALLNAGATCVGKTVMDEMAYSINGENVHYGTPTNPCAPDRVPGGSSSGSAVAV  121

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A  VDFSLG DT G VRVPA YCGILGF PS G VS  G+IP++QS D VGWF RDP +
Sbjct  122   GAMTVDFSLGTDTGGSVRVPASYCGILGFRPSHGIVSTKGVIPMAQSFDTVGWFARDPVI  181

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L+ VG +LL+V   +   P NIVIA D F+ ++ P D+ ++V+ +++EK +GR  I+  +
Sbjct  182   LKHVGRILLEVHDASSVAPSNIVIAEDCFKLMDFPGDQLTRVITQSVEKSYGRHCIKFAS  241

Query  1055  LDAYLSNKVPSLKSFKKL-NGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDP  1231
             L  Y+  KVP+LK F+   N E  +++   L   ++ L+R+EFK NH +W+   KP L P
Sbjct  242   LGDYVEEKVPNLKHFRSTGNQEYSIASLAALSSAMRLLQRYEFKENHGEWVTTAKPNLGP  301

Query  1232  IITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQS  1411
              I+ ++ E +   D  ID CH+V++E+ +AL+  L+D GIL +PTV  PP K   +E  S
Sbjct  302   GISERIWEAVRTMDEHIDVCHSVKSELIAALTAFLEDFGILALPTVAGPPRKL-QQEASS  360

Query  1412  ID-YVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPL  1588
             ++ + ++A    S+A +SG CQ S+PLG ++  PI+VS +A+ G D  LL+ V+ ++  L
Sbjct  361   LEIFRAKAFSLLSVAGVSGFCQVSVPLGMYENLPIAVSLLAKKGMDWLLLNVVETMYTTL  420

Query  1589  QEQAEI  1606
             +EQ E+
Sbjct  421   KEQFEL  426



>ref|XP_009589965.1| PREDICTED: amidase 1 [Nicotiana tomentosiformis]
Length=428

 Score =   370 bits (949),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 264/396 (67%), Gaps = 3/396 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG +TGFGNPDWAKTH  AT T+T V  L++AGATC+AKT++D+MA+ 
Sbjct  32    GLTFAVKDIFDVEGHITGFGNPDWAKTHSAATSTATTVLTLLKAGATCIAKTVMDEMAYS  91

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  P NP S  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI G
Sbjct  92    INGENVHYGTPVNPVSPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIYG  151

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
               PS G VS  G+ P++QS D VGWF RDP +L++VG VLLQ P     +P NI+IA D 
Sbjct  152   IRPSHGVVSTAGVTPMAQSFDTVGWFARDPLILKQVGRVLLQSPQVNSVHPTNIIIAEDC  211

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKL---NGEAKLS  1129
             F+ L+  +++  ++++ ++EK +G  MI++ ++   +   VPSLK F  L   N E+ + 
Sbjct  212   FKLLDSKSNQLIELLVSSVEKLYGSHMIKYASVGDCIEGNVPSLKKFMTLGTGNDESYIP  271

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH +W+  VKP+L P I  ++ E L+  D  ID CH+V+ E
Sbjct  272   SLLALSAAMRLLQRYEFKENHGEWVSTVKPSLGPGIAERVWEALKATDENIDVCHSVKAE  331

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +R+AL+ LL D GIL IPTV  PPPK     +    +  +A    S+A +SG CQ SIPL
Sbjct  332   LRAALTALLGDSGILAIPTVPGPPPKLRTDTSALEGFRVKAFSLLSIAGVSGFCQVSIPL  391

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             G  D  PISVS + ++G D  LLDAV+A+   L+ Q
Sbjct  392   GMQDNLPISVSLLGKHGSDWLLLDAVEAIHNVLKGQ  427



>ref|XP_007030865.1| Amidase 1 [Theobroma cacao]
 gb|EOY11367.1| Amidase 1 [Theobroma cacao]
Length=432

 Score =   369 bits (947),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 195/407 (48%), Positives = 267/407 (66%), Gaps = 5/407 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GLSFAV D+F ++G+VTGFGNPDW +TH  A  T+  V  ++ AGATCV KT++D+MA+ 
Sbjct  28    GLSFAVKDIFDVDGYVTGFGNPDWKRTHSAAISTAPAVLDVLRAGATCVGKTVMDEMAYC  87

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGILG
Sbjct  88    INGENIHYGTPTNPCAPDRVPGGSSSGSAVAVGARLVDFSLGTDTGGSVRVPASYCGILG  147

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS  AVS  G+IP++QS D VGWF RDP VL +VG VLL +P      P  I+I  D 
Sbjct  148   FRPSHDAVSTSGVIPMAQSFDTVGWFARDPVVLNKVGRVLLHLPNVDPVRPSQIIIPEDC  207

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEA---KLS  1129
             F   +IP DRT+QV++K++EK FG Q+++H  L  Y+  KVPSL+ F     E     + 
Sbjct  208   FSLSSIPNDRTTQVLVKSVEKLFGGQILKHVILGDYVKEKVPSLQHFMSGGNEEHFYNIP  267

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH +W+  V P L P ++ ++   +   +  ID CH V+NE
Sbjct  268   SLAALSSAMRLLQRYEFKNNHAEWVTTVNPNLGPGLSERIWAAIRTPEENIDVCHTVQNE  327

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
              R+AL+ LL+D GIL +PT+   PPK  +       + +RA    S+A +SG CQ SIPL
Sbjct  328   FRAALTALLEDKGILALPTIPGDPPKLQSNPAALEVFRARAFSLLSIAGVSGFCQVSIPL  387

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSN  1630
             G H+  P+S+S VA++G D FLL+ V+ L+  ++E  E+ +  ++SN
Sbjct  388   GMHNDLPVSISLVAKHGSDAFLLNLVETLYDTIKE--EVGIAERTSN  432



>ref|XP_007205225.1| hypothetical protein PRUPE_ppa005982mg [Prunus persica]
 gb|EMJ06424.1| hypothetical protein PRUPE_ppa005982mg [Prunus persica]
Length=434

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 274/427 (64%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ ++ GAF+E+  L P             +GL+FA+ D+F + G+VTGFGNPDWA+TH 
Sbjct  2     AIGSNYGAFMEKFVLQPHSSSHDLPL----SGLTFAIKDIFDVAGYVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              +  T+  V+A++  GATC  KT++D+MA+ I+G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    ASESTAPAVSAILRGGATCNGKTVMDEMAYSINGENKHYGTPINPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V V  +L DFSLG DT G VRVPA YCGI GF PS G +S  G+IP++QS D VGWF R+
Sbjct  118   VVVGGDLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVIPMAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+   +   P  ++IA+D FQ  +IP++R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLSNMSPVGPTQLIIADDCFQLSSIPSNRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF-KKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL  F  K N   E  + +   L   ++ L+R+EFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNCFLDKGNAGQEYNIPSLAALSSAMRLLQRYEFKNNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E +   D  +D CH+V+ E+R AL+DLL D G+L IPTV   PPK   
Sbjct  298   PDLGPGIAERVWEAVRTTDENVDVCHSVKTELRVALTDLLGDFGVLAIPTVPGAPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA    S+A +SG CQ SIPLG HD  P+SVS +A++G D  LL+ V+ L
Sbjct  358   DPTTLETFRARAFSLLSIAGVSGFCQVSIPLGLHDDLPVSVSLLAKHGSDGLLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+EQ
Sbjct  418   YDTLKEQ  424



>ref|XP_004495736.1| PREDICTED: amidase 1-like [Cicer arietinum]
Length=423

 Score =   367 bits (943),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/418 (48%), Positives = 269/418 (64%), Gaps = 7/418 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P    P          L+FAV D+F ++G+V GFGNPDWA+TH+ A 
Sbjct  5     SDYGAFIEKFILPPTSSSPDHPL----NSLTFAVKDIFDVKGYVAGFGNPDWARTHQVAV  60

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V AL+ AGATCV KT++D+MA+ I+G N HY  P NP +  R+PGG SSG+AVAV
Sbjct  61    STAPTVLALLNAGATCVGKTVMDEMAYSINGENIHYGTPRNPCAEDRVPGGSSSGSAVAV  120

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS GA+   G++P++QS D VGWF RDP +
Sbjct  121   GAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAILKSGVVPMAQSFDTVGWFARDPKI  180

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L RVGHVLLQ P      P  I+IA D FQ   +P D  ++ VIKAI+K +G  ++RHE 
Sbjct  181   LSRVGHVLLQSPHVTSVRPTQIIIAEDCFQLSTVPFDVVTRTVIKAIQKLYGDDVLRHEI  240

Query  1055  LDAYLSNKVPSLKSFKKLNGE---AKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTL  1225
             L  Y+  KVPSL+ F   +      K+ +   L   ++ L+R+EFK NH +WI+ VKP L
Sbjct  241   LGEYVKAKVPSLEHFMSEDNADQLYKIPSLTALSSAMRLLQRYEFKNNHGEWINAVKPDL  300

Query  1226  DPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKET  1405
              P I+ ++ E L      I+  H+++ E+  AL+DLL D G+L+IPTV  PPPK   K +
Sbjct  301   GPGISERVSEALSTTGEGIETYHSIKRELHDALTDLLGDFGVLMIPTVPGPPPKLQTKPS  360

Query  1406  QSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
             +   + +RA    S+  +SG CQ +IPLG ++  P+SVS VARNG D FLL  V+ ++
Sbjct  361   ELDVFRARAFSLLSIVGVSGFCQVNIPLGMYNDLPVSVSLVARNGADGFLLHLVENIY  418



>gb|KDP23530.1| hypothetical protein JCGZ_23363 [Jatropha curcas]
Length=431

 Score =   365 bits (938),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/403 (49%), Positives = 273/403 (68%), Gaps = 3/403 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F ++G+VTGFGNPDWA+TH  AT T+  V A++  GATC+ KT++D+MA+ 
Sbjct  29    GLTFAVKDIFDVDGYVTGFGNPDWARTHLAATSTAPAVLAILREGATCIGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G NKHY  P NP +   +PGG SSG+AVAV A LVDFSLG DT G VRVPA YC ILG
Sbjct  89    INGENKHYGTPINPCAPDCVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCSILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS G VS  G+IP++QS D VGWF R+P +L  VG VLLQ+P      P  I+IA D 
Sbjct  149   FRPSHGVVSTAGVIPLAQSFDTVGWFARNPVILNHVGRVLLQLPDVDLVRPSQIIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEA-KLS  1129
             FQ  +IP  R SQ+++K++EK FG  +++H  L  ++ NKVPSLK F  K++  +   ++
Sbjct  209   FQLSSIPNGRVSQILVKSVEKLFGGHVVKHLTLGDFVENKVPSLKHFMSKEIKEQGYDIA  268

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH +W+  V+P L P I+ ++ E +++    ID C++V+ E
Sbjct  269   SLAALSSAMRLLQRYEFKNNHGEWVTTVEPDLGPGISERVWEAVKMTGGNIDACYSVKTE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             + +AL+ LL+D GIL IPTV  PPPK     T    + + A    S+A +SG CQ SIPL
Sbjct  329   LLAALTTLLEDFGILAIPTVPGPPPKLNTDPTTLAVFRAEAFSLLSIAGVSGFCQVSIPL  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQS  1618
             G HD  P+S+S +A+NG D FLL+ VQ L+  LQEQ  +++++
Sbjct  389   GMHDDLPLSISLLAKNGSDGFLLNVVQILYDTLQEQVAVSLRN  431



>gb|EYU39138.1| hypothetical protein MIMGU_mgv1a019997mg [Erythranthe guttata]
Length=527

 Score =   369 bits (947),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 294/457 (64%), Gaps = 5/457 (1%)
 Frame = +2

Query  314   KLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWA  493
             + K +V  D GAFV R +LLP PQPPPP A  PL+GL+FA+SD   ++ +VTG+G+  W 
Sbjct  40    RAKSSVNEDFGAFVARFELLPFPQPPPPAARLPLSGLTFAISDNIDVKNYVTGYGSTYWK  99

Query  494   KTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggps  673
             +TH+ A  T+  VT ++  G+TC  KT++D++ FGI G N+ Y  P NP   S +PGG S
Sbjct  100   RTHKAAEITAMAVTTMLRNGSTCKGKTVMDELGFGILGENRSYGTPINPQKPSHVPGGSS  159

Query  674   sgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGW  853
             SG+A AVAA+LVDF+LG DT G +R+P+ +CGILGF PS G VS +G++P SQSLD VG 
Sbjct  160   SGSAAAVAAHLVDFALGTDTTGCIRLPSSFCGILGFRPSHGVVSTIGVLPNSQSLDTVGC  219

Query  854   FTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGR  1033
                DP VL RVGHVLLQ+ F   +  R+I+IA+DLFQ   +P  +T  VV KA EK  G 
Sbjct  220   LASDPSVLHRVGHVLLQLNFLEPKKTRSIIIADDLFQLSKVPIQKTVHVVRKATEKLSGY  279

Query  1034  QMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  +H N   Y+++ VPSLK F  +  N +  +ST + L  V+  L+R+EFK NH++WI 
Sbjct  280   KTPKHMNFGNYIASNVPSLKRFCEESRNQQNGISTMKALSSVMLILQRYEFKTNHEEWIR  339

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP L   I+ ++   +      +   + VR EMR+AL  LLKDDGILVIPTV DPP K
Sbjct  340   SVKPKLGFDISNRVWAAINTTQENVKSLYKVRTEMRAALQSLLKDDGILVIPTVADPPIK  399

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
                K+    +   R     S+ASLSGGCQ ++P G HD CPISVSF+A +G D+FLLD V
Sbjct  400   LNTKKGLFTEVYDRIHALLSIASLSGGCQVAVPFGSHDGCPISVSFIASHGADKFLLDTV  459

Query  1568  QALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKG  1678
               +++ LQE+        ++N  I    +AE+ K KG
Sbjct  460   LDMYSSLQEEVGTLQLPYNTNGTID---AAELLKEKG  493



>ref|XP_002512364.1| amidase, putative [Ricinus communis]
 gb|EEF49816.1| amidase, putative [Ricinus communis]
Length=500

 Score =   367 bits (942),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 278/427 (65%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+  L P               L+FAV D+F ++G+VTGFGNPDWA+TH 
Sbjct  74    AISPDYGAFMEKFVLKPSSSSDQLPLH----SLTFAVKDIFDVDGYVTGFGNPDWARTHS  129

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V A++  GATCV K I+D+MA+ I+G N HY  PTNP++  R+PGG SSG+A
Sbjct  130   AATATAPAVLAVLRGGATCVGKVIMDEMAYSINGENAHYGTPTNPSAPDRVPGGSSSGSA  189

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A LVDFSLG DT G VRVPA YCGILGF PS G VS  G+IP++QS D VGWF+R+
Sbjct  190   VAVGAKLVDFSLGSDTGGSVRVPASYCGILGFRPSHGVVSVSGVIPMAQSFDTVGWFSRN  249

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L+ VG +LLQ+P   +  P  I IA D FQ  +IP  R SQV++K++EK FG  +++
Sbjct  250   PVILKHVGRLLLQLPDVDRTKPNQIFIAEDCFQLSSIPKKRVSQVLVKSVEKLFGGDIVK  309

Query  1046  HENLDAYLSNKVPSLKSF--KKL-NGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL  Y+ +KVPSL+ F  K++   E  ++    L   ++ L+R+EFK NH +W+  VK
Sbjct  310   HVNLGDYVEDKVPSLRHFMSKEIKEQEYNIAPLAALSSAMRMLQRYEFKTNHGEWVTTVK  369

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P   P +  ++ E +   +  ID   +VR E+R+AL++LL++ GI+ IPTV   PPK   
Sbjct  370   PDFGPGLKERIWEAVRSTEENIDAFQSVRTELRAALTNLLEEFGIIAIPTVPGVPPKLNT  429

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + ++A    S+  +SG CQ SIPLG HD  P+S+S +A++G D FLL+ V+ L
Sbjct  430   DPTTLEIFRAKAFSLLSITGVSGFCQVSIPLGMHDGLPVSISLLAKHGSDVFLLNVVETL  489

Query  1577  FAPLQEQ  1597
             +  LQE+
Sbjct  490   YDTLQEE  496



>gb|KHG20058.1| Amidase 1 -like protein [Gossypium arboreum]
Length=432

 Score =   364 bits (935),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 206/430 (48%), Positives = 277/430 (64%), Gaps = 6/430 (1%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  ++SGAFVE+  L P             +GL+FAV D+F ++G+VTGFGNPDW +TH 
Sbjct  2     AKTSESGAFVEKFILQPTSSSQQLPL----SGLTFAVKDIFDVDGYVTGFGNPDWKRTHS  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V  ++E GATCV KTI+D+MA+ I+G N HY  PTNP +S R+PGG SSG+A
Sbjct  58    AATLTAPAVLDVLEGGATCVGKTIMDEMAYCINGENIHYGTPTNPCASDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A LVDFSLG DT G VRVPA YCGILGF PS  A+S  G+IP++QS D VGWF RD
Sbjct  118   VAVGAGLVDFSLGSDTGGSVRVPASYCGILGFRPSHDAISTSGVIPMAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P VL RVG  LL +P      P  I I  D F   +IP+ RT+ V+IK+IEK  G  +++
Sbjct  178   PTVLNRVGRALLHLPNVNPVTPSQIFIPEDCFSLSSIPSARTTGVLIKSIEKLVGGSILK  237

Query  1046  HENLDAYLSNKVPSLKSF-KKLNGEA-KLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKP  1219
             H NL  Y+  KVPSL  F  K N  A  + +   L   ++ L+R EFK+NH +W+  V P
Sbjct  238   HVNLGDYVKEKVPSLHHFMAKGNDHAYNIPSLAALSSSMRLLQRCEFKKNHAEWLTTVNP  297

Query  1220  TLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
              L P ++ ++ + +   +  I  C +V+ E+R+AL+DLLKD+GILV+PTV   PPK    
Sbjct  298   NLGPRLSKRIWDAVRSPEENIGICRSVQTELRAALTDLLKDEGILVLPTVPGDPPKLQTD  357

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                   + +RA    S+A +SG CQ SIPLG H+  P+S+S +A++G D FLL+ V+A +
Sbjct  358   LASLEVFRARAFSLLSIAGVSGFCQVSIPLGMHNNLPVSISLLAKHGSDAFLLNLVEAFY  417

Query  1580  APLQEQAEIA  1609
               +QE+A  A
Sbjct  418   DTIQEEAGFA  427



>ref|XP_003591093.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
 gb|AES61344.1| translocon at the outer membrane ofs-like protein [Medicago truncatula]
 gb|AFK47351.1| unknown [Medicago truncatula]
Length=423

 Score =   364 bits (934),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/389 (49%), Positives = 258/389 (66%), Gaps = 3/389 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAV D+F ++G+V GFGNPDWA+TH+ AT T+  V A++ AGATCV KT++D+MA+ I
Sbjct  30    LTFAVKDIFDVKGYVAGFGNPDWARTHQAATSTAPTVLAILSAGATCVGKTVMDEMAYSI  89

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  90    NGENIHYGTPRNPCAEDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGF  149

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS G +S  G++P++QS D VGWF RDP +L  VGHVLLQ P      P  I+IA D F
Sbjct  150   RPSHGRISKSGVVPMAQSFDTVGWFARDPKILSAVGHVLLQSPRITPIRPTQIIIAEDCF  209

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNGEAKLST  1132
             Q  ++P D  S++VIKAI+K +G  ++R+E L  Y+  +VP LK F   +K +    + +
Sbjct  210   QLSSVPFDVVSRIVIKAIQKLYGDGLLRYEFLGEYVKAQVPGLKHFMSQEKTDQIYNIPS  269

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
                L   ++ L+R+EFK NH +WI+ VKP L P I+ ++ + L   +  ID C ++  E+
Sbjct  270   LAALSSAMRLLQRYEFKNNHGEWINAVKPELGPGISERVSDALRTTEENIDICRSIIREL  329

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
             R AL+ LL D G+L+IPTV  PPPK     +    + +RA    S+  +SG CQ SIPLG
Sbjct  330   RDALTSLLGDFGVLMIPTVPGPPPKLQTNSSDLEIFRARAFSLLSIVGVSGFCQVSIPLG  389

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALF  1579
              ++  P SVS VARNG D FLL  V++++
Sbjct  390   MYNDLPASVSLVARNGADEFLLHLVESIY  418



>ref|XP_006585446.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform 
X2 [Glycine max]
Length=507

 Score =   366 bits (939),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 207/435 (48%), Positives = 287/435 (66%), Gaps = 5/435 (1%)
 Frame = +2

Query  311   RKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDW  490
             R+ +   K D GAFVER++LLP PQP   +     + L+FA+ D+F ++G+VTGFGNP W
Sbjct  36    RRHRNLPKEDFGAFVERIELLPIPQPNQTQTL---SALTFAIKDIFDVKGYVTGFGNPQW  92

Query  491   AKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggp  670
              KTH  A +T+ V+TAL+  GATCV KT++D+ +FGISG NK Y  PTNP   S +PGG 
Sbjct  93    KKTHGEAGKTAIVITALLSDGATCVGKTVMDEFSFGISGENKFYGTPTNPQMPSSIPGGS  152

Query  671   ssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVG  850
             SSG+AVAVAA LVDF++G DT G VR+PA +CGILGF PS G +S +G++P +QSLD VG
Sbjct  153   SSGSAVAVAARLVDFAIGTDTTGCVRIPAAFCGILGFRPSHGVISTIGVLPNAQSLDTVG  212

Query  851   WFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG  1030
             WF RDP VL RVG VLL +     +  R I+ A+DLFQ    P+ +T+ ++ KAIE   G
Sbjct  213   WFARDPSVLHRVGLVLLPLTSVELKRTRRIIFADDLFQLSKAPSQKTAYIIGKAIENLSG  272

Query  1031  RQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
              Q ++H NL  Y+++ VPSLK F  K    +  LS  + L  V+ +L+ +EFK NH++W+
Sbjct  273   YQSLQHMNLCQYIASNVPSLKGFHEKLTQQQNGLSILKALTSVMFSLQGYEFKTNHEEWV  332

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
               VKP L   ++ +++  +      I   + VR EMR A   LLKDDGILVIPTV D P 
Sbjct  333   KSVKPRLGRGVSERVNAAMNATHDNIKTLYKVRTEMRGAFQHLLKDDGILVIPTVADYPL  392

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
             K   ++  S ++  RA   +S+AS+SG CQ +IPLG H+ C  S+S ++ +G D+FLL+ 
Sbjct  393   KLNTEKGFSSEFHDRAFALSSIASISGCCQVAIPLGCHNDCCASISLISAHGVDKFLLNT  452

Query  1565  VQALFAPLQEQAEIA  1609
             V  +++ LQEQ  +A
Sbjct  453   VLDMYSTLQEQVSVA  467



>ref|XP_011084291.1| PREDICTED: amidase 1 isoform X1 [Sesamum indicum]
Length=431

 Score =   363 bits (931),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 266/398 (67%), Gaps = 3/398 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG VTGFGNPDWA+TH  AT T+  V ++++AGA CV KT++D+MA+ 
Sbjct  32    GLTFAVKDIFDVEGKVTGFGNPDWARTHSVATSTAPAVLSVLKAGAVCVGKTVMDEMAYS  91

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP ++ R+PGG SSG+AVAV A L DFSLG DT G VRVPA YCGILG
Sbjct  92    INGENIHYGTPTNPCAADRVPGGSSSGSAVAVGAMLADFSLGTDTGGSVRVPASYCGILG  151

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS G VS  G+IP++QS D VGWF RDP +L++VG VLLQ+          ++IA D 
Sbjct  152   FRPSHGVVSTSGVIPMAQSFDTVGWFARDPFILKQVGKVLLQLQDDNPTTLSQLIIAEDC  211

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKKLNGEAK---LS  1129
             F  LNIP+ R + V+I ++EK +G Q I++ +L  ++  KVPSL  F   N + +   + 
Sbjct  212   FNLLNIPSHRLTDVLISSVEKLYGSQQIQYTSLGNFIEAKVPSLMHFMDDNTKKQADNIP  271

Query  1130  TTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
             +   L   ++ L+R+EFK NH +W+  V P L P I+ ++ + L   D  ID C  +++E
Sbjct  272   SLAALSSAMRLLQRYEFKNNHGEWVRSVNPHLGPGISERVWDALRTTDESIDVCCLLKSE  331

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +R+AL DLL D GIL IPTV  PPPK   + T    + ++A    S+A +SG CQ S+PL
Sbjct  332   LRAALGDLLGDFGILAIPTVPGPPPKLQTEPTTLETFRAKAFSLLSVAGVSGFCQVSVPL  391

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAE  1603
             G HD  PI+VS VA++G D FLL  V+ L+  L++Q+E
Sbjct  392   GMHDDLPIAVSLVAKHGCDGFLLSFVETLYEVLKKQSE  429



>ref|XP_008246489.1| PREDICTED: amidase 1 isoform X1 [Prunus mume]
Length=434

 Score =   363 bits (931),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/427 (46%), Positives = 273/427 (64%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ ++ GAF+E+  L P             +GL+FAV D+F + G+VTGFGNPDWA+TH 
Sbjct  2     AIGSNYGAFMEKFVLQPHSSSHDLPL----SGLTFAVKDIFDVAGYVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              +  T+  V+A++  GATC  KT++D+MA+ I+G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    ASESTAPAVSAILRGGATCNGKTVMDEMAYSINGENKHYGTPINPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V V  +L DFSLG DT G VRVPA YCGI GF PS G +S  G+IP++QS D VGWF R+
Sbjct  118   VVVGGDLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVIPMAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L R G VLLQ+   +   P  ++IA+D FQ  +IP++R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRAGRVLLQLSDMSPVGPTQLIIADDCFQLSSIPSNRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF-KKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL  F  K N   E  + +   L   ++ L+R+EFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNCFLDKGNAGQEYNIPSLVALSSAMRLLQRYEFKNNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E +   D  +  C +V+ E+R AL+DLL D G+L IPTV   PPK   
Sbjct  298   PDLGPGIAERVWEAVRTTDENVYVCQSVKTELRVALTDLLGDFGVLAIPTVPGAPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA    S+A +SG CQ SIPLG HD+ P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLETFRARAFSLLSIAGVSGFCQVSIPLGLHDELPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+EQ
Sbjct  418   YDTLKEQ  424



>ref|XP_006433291.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
 ref|XP_006433292.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
 ref|XP_006471977.1| PREDICTED: amidase 1-like isoform X3 [Citrus sinensis]
 gb|ESR46531.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
 gb|ESR46532.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
Length=429

 Score =   362 bits (928),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 205/427 (48%), Positives = 275/427 (64%), Gaps = 8/427 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P             +GL+FA+ D+F ++G VTGFGNPDWA+TH  AT
Sbjct  6     SDYGAFMEKFVLQPSSSAHQLPL----SGLTFAIKDIFDVDGHVTGFGNPDWARTHSAAT  61

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V A++  GAT + KTI+D+MA+ I+G NKHY  PTNP +  R+PGG SSG+AVAV
Sbjct  62    STAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPWAPDRVPGGSSSGSAVAV  121

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS GAVS  G+IP++QS D VGWF  DP +
Sbjct  122   GAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTAGVIPMAQSFDTVGWFAWDPKI  181

Query  875   LRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             L RVG VLLQ+P  A    P  ++ A D  Q  +IP+DR +Q ++K++EK FG Q++ + 
Sbjct  182   LNRVGRVLLQLPDDASLVRPSQVIFAEDCLQLSSIPSDRITQGLVKSVEKLFGGQIVENV  241

Query  1052  NLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              L  Y+ +KVPSL+ F  + N E + S   L  L      L R+EFK NH DW+  VKP 
Sbjct  242   ILGDYVKDKVPSLQHFIGEGNREQEYSIPSLAALSSARGLLLRYEFKNNHGDWVTTVKPD  301

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+  + E +  +   ID C +V+ E+R+ALS LL D GILVIPTV  PPPK     
Sbjct  302   LGPGISEHVWEAVRTSAENIDVCQSVKTELRAALSALLGDYGILVIPTVPGPPPKLQMDP  361

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             +    + ++A    S+A +SG CQ SIPLG HD  P+++S +A++G D FLL+ V+ L  
Sbjct  362   SALEVFHAQAFSLLSIAVVSGFCQVSIPLGLHDNLPVAISLLAKHGSDGFLLNLVETLHD  421

Query  1583  PLQEQAE  1603
              L+E+ +
Sbjct  422   TLKEELQ  428



>ref|XP_003556503.1| PREDICTED: amidase 1-like isoform X1 [Glycine max]
 gb|KHN20211.1| Amidase 1 [Glycine soja]
Length=433

 Score =   362 bits (928),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 207/433 (48%), Positives = 278/433 (64%), Gaps = 9/433 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P   P  P        L+FAV ++F +EG+VTGFGNPDWA+TH  AT
Sbjct  5     SDYGAFMEKFTLPPNSAPSLPL-----NSLTFAVKEIFDVEGYVTGFGNPDWARTHTVAT  59

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V AL+ AGATCV KT++D+MA+ I+G N HY  P NP +  R+PGG SSG+AVAV
Sbjct  60    STAPTVLALLRAGATCVGKTVMDEMAYSINGENIHYGTPRNPCAPDRVPGGSSSGSAVAV  119

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS GA+S  G+IP+SQS D VGWF RDP +
Sbjct  120   GAELVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAISESGVIPMSQSFDTVGWFARDPMI  179

Query  875   LRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             L RVG V+LQ+P  A    P  I+IA D FQ  + P D  +  VI+A+EK +G  +++HE
Sbjct  180   LSRVGGVILQLPDVAPPIRPTCIIIAEDCFQLSSTPFDVVTGTVIQAVEKLYGGDVLKHE  239

Query  1052  NLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              L  Y+   VPSLK F  K N +   S   L  L   ++ L+R+EFK NH +WI  VKP 
Sbjct  240   ILGDYVKTNVPSLKHFMSKENTDQIYSIPSLAALSSAMRLLQRYEFKNNHGEWISAVKPD  299

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+ ++ + L      ID C++++ E+  AL+ LL D G L+IPTV  PPPK     
Sbjct  300   LGPGISERVSDALRTTGENIDICYSIKKELHDALAALLGDFGALMIPTVPGPPPKLQTNT  359

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             +    + +RA    S+A +SG CQ SIPLG ++  P+S+S VAR+G DRFLL  V++L+ 
Sbjct  360   SDLEIFRARAFSLLSIAGVSGFCQVSIPLGMYNNLPLSISLVARHGADRFLLHLVESLYD  419

Query  1583  PLQEQAEIAVQSK  1621
              ++++ +   + K
Sbjct  420   SIKDRKQHITEHK  432



>ref|XP_006433295.1| hypothetical protein CICLE_v10001213mg [Citrus clementina]
 ref|XP_006471976.1| PREDICTED: amidase 1-like isoform X2 [Citrus sinensis]
 gb|ESR46535.1| hypothetical protein CICLE_v10001213mg [Citrus clementina]
Length=431

 Score =   362 bits (928),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 203/427 (48%), Positives = 276/427 (65%), Gaps = 8/427 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P             +GL+FA+ D+F ++G VTGFGNPDWA+TH  AT
Sbjct  6     SDYGAFMEKFVLQPSSSAHQLPL----SGLTFAIKDIFDVDGHVTGFGNPDWARTHSAAT  61

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V A++  GAT + KTI+D+MA+ I+G NKHY  PTNP +  R+PGG SSG+AVAV
Sbjct  62    STAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSAVAV  121

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS  AVS  G+IP++QS D VGWF  DP +
Sbjct  122   GAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHSAVSTAGVIPMAQSFDTVGWFAWDPKI  181

Query  875   LRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             L RVG VLLQ+        P  ++ A D  Q  +IP+DR +Q ++K++EK FG  +I + 
Sbjct  182   LNRVGRVLLQLADDVNLVRPSQVIFAEDCLQLSSIPSDRVTQGLVKSVEKLFGGHIIENV  241

Query  1052  NLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              L  Y+ +KVPSL+ F  + N E + S   L  L   ++ L+R+EFK NH DW+  VKP 
Sbjct  242   ILGDYVKDKVPSLQHFLSEGNKEQEYSIPSLAALSSAMRLLQRYEFKNNHGDWVTTVKPD  301

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+ ++ E +  +  +ID C +V+ E+R+ALS LL D GILVIPTV  PPPK     
Sbjct  302   LGPGISERVWEAVRTSAQKIDVCQSVKTELRAALSALLGDHGILVIPTVPGPPPKLQMDP  361

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             +    + +RA    S+A +SG CQ SIPLG HD  P+++S +A++G D FLL+ V+ L  
Sbjct  362   SALEVFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVAISLLAKHGSDGFLLNLVETLHN  421

Query  1583  PLQEQAE  1603
              L+E+ +
Sbjct  422   TLKEELQ  428



>ref|XP_007144743.1| hypothetical protein PHAVU_007G180900g [Phaseolus vulgaris]
 gb|ESW16737.1| hypothetical protein PHAVU_007G180900g [Phaseolus vulgaris]
Length=427

 Score =   361 bits (927),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/395 (48%), Positives = 262/395 (66%), Gaps = 3/395 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FA+ ++F +EG+VTG GNPDWA+TH  AT T+  V AL+ AGATCV KT++D+MA+ I
Sbjct  30    LTFAIKEIFDVEGYVTGMGNPDWARTHPVATSTAPTVLALLGAGATCVGKTVMDEMAYSI  89

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  90    NGENIHYGTPRNPCAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGF  149

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GA+S  G+IP++QS D VGWF RDP +L +VG +++Q+P  A   P   +IA D F
Sbjct  150   RPSHGAISVSGVIPMAQSFDTVGWFARDPMILSKVGGIIVQLPDIAPVRPSCFIIAEDCF  209

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNGEAKLST  1132
             Q   IP D  +Q V+KA+EK +G  +++ E L  Y+   VPSLK F   +  +    + +
Sbjct  210   QLSVIPYDVVTQPVVKAVEKLYGGDVLKQEILGDYVKTNVPSLKHFMSKETTDQIYNIPS  269

Query  1133  TRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEM  1312
                L   ++ L+R+EFK NH +WI  VKP   P I+ ++ + L      ID C++V+ E+
Sbjct  270   LSALSSAMRLLQRYEFKNNHGEWITAVKPDFGPGISERVLDALRTTGENIDTCYSVKREL  329

Query  1313  RSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLG  1492
               AL+ LL D G+L+IPTV  PPPK     ++   + +RA    S+A +SG CQ SIPLG
Sbjct  330   HDALAALLGDFGVLMIPTVPGPPPKLQTNSSELEIFRARAFSLLSIAGVSGFCQVSIPLG  389

Query  1493  FHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
              ++  P+S+S VAR+G DRFLL  V++L+A ++EQ
Sbjct  390   MYNNLPLSISLVARHGADRFLLHLVESLYASIKEQ  424



>ref|XP_003536085.1| PREDICTED: amidase 1-like [Glycine max]
Length=433

 Score =   358 bits (918),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 265/404 (66%), Gaps = 4/404 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAV ++F  EG+VTGFGNPDWA+TH  AT T+    AL+ AGATCV KT++D+MA+ I
Sbjct  29    LTFAVKEIFDTEGYVTGFGNPDWARTHPVATSTAPTALALLRAGATCVGKTVMDEMAYSI  88

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  89    NGENIHYGTPRNPCAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGF  148

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQR-NPRNIVIANDL  958
              PS GAVS  G+IP+SQS D VGWF RDP +L RVG V+LQ+P  A    P +I+IA D 
Sbjct  149   RPSHGAVSESGVIPMSQSFDTVGWFARDPMILSRVGGVILQLPDVAPPIRPTSIIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
             FQ  + P D  +  VIKA+EK +G  +++ E L  Y+   VPSLK F  K N +   +  
Sbjct  209   FQLSSTPFDVVTGTVIKAVEKLYGGDVLKPEILGDYVKTNVPSLKHFMSKDNTDQIYNIP  268

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L   ++ L+R EFK NH +WI  VKP L P I+ ++ + L      ID C++++ E
Sbjct  269   SLAALSSAMRLLQRFEFKNNHGEWISAVKPDLGPGISERVSDALRTTGENIDICYSIKRE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +  ALS LL D G+L+IPTV  PPPK     +    + +RA    S+A +SG CQ SIPL
Sbjct  329   LHDALSALLGDFGVLMIPTVPGPPPKLQTNTSDLEIFRARAFSLLSIAGVSGFCQVSIPL  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSK  1621
             G ++  P+S+S VAR+G D+FLL  V++L+  ++++ +  ++ K
Sbjct  389   GMYNNLPLSISLVARHGADKFLLHLVESLYDSIEDRKQHIIEHK  432



>gb|EYU39870.1| hypothetical protein MIMGU_mgv1a006860mg [Erythranthe guttata]
Length=428

 Score =   357 bits (917),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 274/425 (64%), Gaps = 7/425 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  LLP              GL+F+V D+F +EG+VTGFGNPDWAKTH  +T
Sbjct  7     SDYGAFMEKFTLLPDTNSSQKLPL---NGLTFSVKDIFDVEGYVTGFGNPDWAKTHSVST  63

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V +++ AGATCV KT++D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVAV
Sbjct  64    STAPAVMSVLNAGATCVGKTVMDEMAYSINGENIHYGTPTNPCAPDRVPGGSSSGSAVAV  123

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
             AANL DFSLG DT G VRVPA YCGI GF PS G VS  G+ P++QS D VGWF RDP +
Sbjct  124   AANLADFSLGTDTGGSVRVPASYCGIFGFRPSHGIVSTAGVTPMAQSFDTVGWFARDPTI  183

Query  875   LRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             L++VG +LL +          + IA+D F  LN+P+ R  ++++ ++EK +G + I++ N
Sbjct  184   LKQVGKILLHLEDDNPVKLGQLTIADDCFDLLNMPSHRLKEILVASVEKLYGSEKIQYTN  243

Query  1055  LDAYLSNKVPSLKSFKKLNGEAK----LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             L +++   VPSLK F   N   K    + +   L   ++ L+R+EFK NH +W+  V P 
Sbjct  244   LGSFVEANVPSLKHFMGNNTTEKRGDNIPSLVALSSAMRLLQRYEFKNNHGEWVRSVNPD  303

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+ ++ E +E  D  I++C+ ++NE+R+AL DLL + GIL +PTV  PPPK   + 
Sbjct  304   LGPGISERVWEAVESTDENIEECYTLKNELRAALGDLLGEFGILAMPTVPGPPPKVKTEP  363

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             +   ++ ++A    S+A +SG CQ SIPLG  D  PI+VS +A++G D  LL  V+AL  
Sbjct  364   STLENFRAKAFSLLSVAGVSGFCQVSIPLGMQDDLPIAVSLLAKHGSDGLLLSFVEALHT  423

Query  1583  PLQEQ  1597
              L  Q
Sbjct  424   SLNPQ  428



>ref|XP_009349393.1| PREDICTED: amidase 1-like isoform X4 [Pyrus x bretschneideri]
Length=428

 Score =   357 bits (916),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+    PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLPRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VRVPA YCGI GF PS G +S  G+ P++QS D VGWF RD
Sbjct  118   VVVAAGLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D F+  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIAEDCFRFSSVPSSRVKQVLVGSVEKVFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L RHEFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRHEFKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+R+AL++LL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERVWAIVRSTDENVDVCHSVMTELRAALTNLLGDFGVLAMPTVPRDPPKLRT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG HD  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDAFHARAFSFLSIAVVSGFCQVSIPLGMHDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_006433294.1| hypothetical protein CICLE_v10001213mg [Citrus clementina]
 gb|ESR46534.1| hypothetical protein CICLE_v10001213mg [Citrus clementina]
Length=432

 Score =   357 bits (916),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 203/428 (47%), Positives = 276/428 (64%), Gaps = 9/428 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDV-FHIEGFVTGFGNPDWAKTHEPA  511
             +D GAF+E+  L P             +GL+FA+ D+ F ++G VTGFGNPDWA+TH  A
Sbjct  6     SDYGAFMEKFVLQPSSSAHQLPL----SGLTFAIKDIRFDVDGHVTGFGNPDWARTHSAA  61

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
             T T+  V A++  GAT + KTI+D+MA+ I+G NKHY  PTNP +  R+PGG SSG+AVA
Sbjct  62    TSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSAVA  121

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             V A LVDFSLG DT G VRVPA YCGI GF PS  AVS  G+IP++QS D VGWF  DP 
Sbjct  122   VGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHSAVSTAGVIPMAQSFDTVGWFAWDPK  181

Query  872   VLRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRH  1048
             +L RVG VLLQ+        P  ++ A D  Q  +IP+DR +Q ++K++EK FG  +I +
Sbjct  182   ILNRVGRVLLQLADDVNLVRPSQVIFAEDCLQLSSIPSDRVTQGLVKSVEKLFGGHIIEN  241

Query  1049  ENLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKP  1219
               L  Y+ +KVPSL+ F  + N E + S   L  L   ++ L+R+EFK NH DW+  VKP
Sbjct  242   VILGDYVKDKVPSLQHFLSEGNKEQEYSIPSLAALSSAMRLLQRYEFKNNHGDWVTTVKP  301

Query  1220  TLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
              L P I+ ++ E +  +  +ID C +V+ E+R+ALS LL D GILVIPTV  PPPK    
Sbjct  302   DLGPGISERVWEAVRTSAQKIDVCQSVKTELRAALSALLGDHGILVIPTVPGPPPKLQMD  361

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
              +    + +RA    S+A +SG CQ SIPLG HD  P+++S +A++G D FLL+ V+ L 
Sbjct  362   PSALEVFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVAISLLAKHGSDGFLLNLVETLH  421

Query  1580  APLQEQAE  1603
               L+E+ +
Sbjct  422   NTLKEELQ  429



>gb|KHN16134.1| Amidase 1 [Glycine soja]
Length=433

 Score =   357 bits (915),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 264/404 (65%), Gaps = 4/404 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAV ++F  EG+VTGFGNPDWA+TH  AT T+    AL+ AGATCV KT++D+MA+ I
Sbjct  29    LTFAVKEIFDTEGYVTGFGNPDWARTHPVATSTAPTALALLRAGATCVGKTVMDEMAYSI  88

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  89    NGENIHYGTPRNPCAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGF  148

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQR-NPRNIVIANDL  958
              PS GAVS  G+IP+SQS D VGWF RDP +L RVG V+LQ+P  A    P +I+IA D 
Sbjct  149   RPSHGAVSESGVIPMSQSFDTVGWFARDPMILSRVGGVILQLPDVAPPIRPTSIIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
             FQ  + P D  +  VIKA+EK +G  +++ E L  Y+   VPSLK F  K N +   +  
Sbjct  209   FQLSSTPFDVVTGTVIKAVEKLYGGDVLKPEILGDYVKTNVPSLKHFMSKDNTDQIYNIP  268

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L   ++ L+R EFK NH +WI  VKP L P I+ ++ + L      ID C++++ E
Sbjct  269   SLAALSSAMRLLQRFEFKNNHGEWISAVKPDLGPGISERVSDALRTTGENIDICYSIKRE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +  ALS LL D G+L+IPTV  PPPK          + +RA    S+A +SG CQ SIPL
Sbjct  329   LHDALSALLGDFGVLMIPTVPGPPPKLQTNTADLEIFRARAFSLLSIAGVSGFCQVSIPL  388

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSK  1621
             G ++  P+S+S VAR+G D+FLL  V++L+  ++++ +  ++ K
Sbjct  389   GMYNNLPLSISLVARHGADKFLLHLVESLYDSIEDRKQHIIEHK  432



>ref|XP_010549880.1| PREDICTED: amidase 1 [Tarenaya hassleriana]
Length=427

 Score =   357 bits (915),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 261/397 (66%), Gaps = 4/397 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FA+ D+F +EG VTGFGNPDW +TH  AT T+ VV+AL+ AGAT V  T++D+MA+ 
Sbjct  28    GLTFAIKDIFDVEGHVTGFGNPDWLRTHSAATSTAPVVSALLAAGATSVGSTVMDEMAYS  87

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  P NP +  R+PGG SSG+AVAVAA L DFS+G DT G VRVPA YCG+ G
Sbjct  88    INGENAHYGTPRNPIALDRVPGGSSSGSAVAVAAGLADFSVGTDTGGSVRVPASYCGVFG  147

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
               PS G V+  G++P++QS D VGWF R+P +LRRVG VLLQ+P      P  ++IA+D 
Sbjct  148   IRPSHGIVTTTGVVPMAQSFDTVGWFAREPAILRRVGCVLLQLPDLNDMKPSKMIIADDC  207

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK----LNGEAKL  1126
             F+  ++P D   + +++A EK FG +++++ NL  Y+  KVPSLK F       + E  +
Sbjct  208   FKLSSVPPDWMIRSIVRAAEKLFGGEIVKNVNLGDYIEEKVPSLKHFMTGDVVTSREFNI  267

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
                  L   ++ L+R EFK+NH +WI+  KP   P I+ ++ + ++    +ID C +   
Sbjct  268   PLLEALSSSMRLLQRFEFKKNHGEWIESTKPVFGPGISERVEQAMQTTFEKIDACRSATV  327

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E+RSALSDLL DDG+L+IPT+  PPPK     +Q   +  RA    S+A +SG CQ SIP
Sbjct  328   ELRSALSDLLGDDGVLIIPTMPGPPPKLQTDASQLEIFRGRAFGLLSVAGVSGFCQVSIP  387

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             LG H+  P+SVS VA++G D  LL+ V+AL+  +  Q
Sbjct  388   LGLHENLPVSVSMVAKHGSDGLLLNLVEALWKDIGPQ  424



>ref|XP_009349392.1| PREDICTED: amidase 1-like isoform X3 [Pyrus x bretschneideri]
Length=428

 Score =   355 bits (910),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+    PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLPRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ++G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCMNGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA L DFSLG DT G VRVPA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VAVAAGLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ   +P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVIPTQLIIAEDCFQLSTVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L RHEFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRHEFKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+R+AL++LL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERVWAIVRSTDENVDVCHSVMTELRAALTNLLGDFGVLAMPTVPRDPPKLRT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG HD  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDAFHARAFSFLSIAVVSGFCQVSIPLGMHDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009349391.1| PREDICTED: amidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=428

 Score =   353 bits (907),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA  ++G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILNGGATSIGITVMDEMACCMNGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA L DFSLG DT G VRVPA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VAVAAGLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ   +P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVIPTQLIIAEDCFQLSTVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L RHEFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLNRHEFKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+R+AL++LL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERVWAIVRSTDENVDVCHSVMTELRAALTNLLGDFGVLAMPTVPRDPPKLRT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG HD  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDAFHARAFSFLSIAVVSGFCQVSIPLGMHDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009349390.1| PREDICTED: amidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=428

 Score =   353 bits (905),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA  ++G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILNGGATSIGITVMDEMACCMNGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA L DFSLG DT G VRVPA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VAVAAGLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ   +P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVIPTQLIIAEDCFQLSTVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L RHEFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRHEFKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+R+AL++LL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERVWAIVRSTDENVDVCHSVMTELRAALTNLLGDFGVLAMPTVPRDPPKLRT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG HD  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDAFHARAFSFLSIAVVSGFCQVSIPLGMHDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009350393.1| PREDICTED: amidase 1-like [Pyrus x bretschneideri]
Length=428

 Score =   352 bits (904),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ I+G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILNGGATSIGITVMDEMAYCINGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVA    DFSLG DT G VRVPA YCGI GF PS G +S  G+ P++QS D VGWF RD
Sbjct  118   VAVAVGQADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D F+  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIAEDCFRFSSVPSSRVKQVLVGSVEKVFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L      L R+EFKRNH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTAFHLLGRYEFKRNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+R+AL++LL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIGERIWAAVRSTDENVDVCHSVMTELRAALTNLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T   ++ +RA  F S+A +SG CQ +IPLG +D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLHNFRARAFSFLSIAVVSGFCQVTIPLGMYDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
                L+E 
Sbjct  418   CDTLKEH  424



>ref|XP_004135625.1| PREDICTED: amidase 1-like [Cucumis sativus]
 gb|KGN66087.1| hypothetical protein Csa_1G570120 [Cucumis sativus]
Length=430

 Score =   352 bits (902),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 273/427 (64%), Gaps = 9/427 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+E+  L               +GL+FAV D+F IEG+V GFGNP+W +TH PA Q
Sbjct  5     DYGAFIEKFLLQMSSPSDKLPL----SGLTFAVKDIFDIEGYVAGFGNPEWLRTHPPANQ  60

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  V  ++  GATC+ KTI+D+MAF I+G N HY  P NP +S R+PGG SSG+ VAVA
Sbjct  61    TAPAVLTILRGGATCIGKTIMDEMAFSINGENFHYGTPQNPHASDRIPGGSSSGSGVAVA  120

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDFSLG DT G VRVPA YCGILGF PS G VS  G+IP++QS D VGWF RD  +L
Sbjct  121   AKLVDFSLGTDTGGSVRVPASYCGILGFRPSHGVVSTSGVIPMTQSFDTVGWFARDSAIL  180

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSL-NIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             +RVG +LLQ P      P  + IA D F+ L NI ++R +Q  + ++EK FG  +I+  +
Sbjct  181   KRVGWLLLQEPEIEHYKPTKVFIAEDCFKLLSNITSERLTQAFVSSVEKLFGGHLIKQIS  240

Query  1055  LDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQT---LKRHEFKRNHDDWIDDVKPTL  1225
             L  Y+ +KVPSLK F     +    +   L  +V++   L+RHEF  NH +W+      L
Sbjct  241   LGKYVEDKVPSLKHFMIEENDGYKHSIPSLAALVRSKRFLQRHEFNINHGEWVRSYHSHL  300

Query  1226  DPIITAQLHEGL-EVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
              P I+ ++ E + EV D  ID   +++ E+R AL+ LL+D G+L IPTV  PPPK     
Sbjct  301   GPGISERILEFIREVTDENIDLSRSIQIELREALAALLEDFGVLAIPTVPGPPPKLNTDI  360

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             ++  D+ ++A    ++A++SG CQ S+PLG ++  P+S+S +A++G D FLL+ V +L++
Sbjct  361   SEQYDFRAKAFSLLTIAAVSGVCQVSVPLGLYNGLPVSISLLAKHGADGFLLNLVDSLYS  420

Query  1583  PLQEQAE  1603
              L+E+ E
Sbjct  421   TLKEEVE  427



>ref|XP_006471975.1| PREDICTED: amidase 1-like isoform X1 [Citrus sinensis]
Length=457

 Score =   352 bits (902),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 261/398 (66%), Gaps = 4/398 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+ A   VF ++G VTGFGNPDWA+TH  AT T+  V A++  GAT + KTI+D+MA+ I
Sbjct  57    LTIASIAVFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSI  116

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G NKHY  PTNP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  117   NGENKHYGTPTNPCAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGF  176

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQR-NPRNIVIANDL  958
              PS  AVS  G+IP++QS D VGWF  DP +L RVG VLLQ+        P  ++ A D 
Sbjct  177   RPSHSAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLADDVNLVRPSQVIFAEDC  236

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
              Q  +IP+DR +Q ++K++EK FG  +I +  L  Y+ +KVPSL+ F  + N E + S  
Sbjct  237   LQLSSIPSDRVTQGLVKSVEKLFGGHIIENVILGDYVKDKVPSLQHFLSEGNKEQEYSIP  296

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L   ++ L+R+EFK NH DW+  VKP L P I+ ++ E +  +  +ID C +V+ E
Sbjct  297   SLAALSSAMRLLQRYEFKNNHGDWVTTVKPDLGPGISERVWEAVRTSAQKIDVCQSVKTE  356

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPL  1489
             +R+ALS LL D GILVIPTV  PPPK     +    + +RA    S+A +SG CQ SIPL
Sbjct  357   LRAALSALLGDHGILVIPTVPGPPPKLQMDPSALEVFRARAFSLLSIAGVSGFCQVSIPL  416

Query  1490  GFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAE  1603
             G HD  P+++S +A++G D FLL+ V+ L   L+E+ +
Sbjct  417   GLHDNLPVAISLLAKHGSDGFLLNLVETLHNTLKEELQ  454



>ref|XP_004166038.1| PREDICTED: amidase 1-like [Cucumis sativus]
Length=430

 Score =   350 bits (898),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 273/427 (64%), Gaps = 9/427 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+E+  L               +GL+FAV D+F IEG+V GFGNP+W +TH PA Q
Sbjct  5     DYGAFIEKFLLQMSSPSDKLPL----SGLTFAVKDIFDIEGYVAGFGNPEWLRTHPPANQ  60

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  V  ++  GATC+ KTI+D+MAF I+G N HY  P NP +S R+PGG SSG+ VAVA
Sbjct  61    TAPAVLTILRGGATCIGKTIMDEMAFSINGENFHYGTPQNPHASDRIPGGSSSGSGVAVA  120

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDFSLG DT G VRVPA YCGILGF PS G VS  G+IP++QS D VGWF RD  +L
Sbjct  121   AKLVDFSLGTDTGGSVRVPASYCGILGFRPSHGVVSTSGVIPMTQSFDTVGWFARDSAIL  180

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSL-NIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             +RVG +LLQ P      P  + IA D F+ L NI ++R +Q  + ++EK FG  +I+  +
Sbjct  181   KRVGWLLLQEPEIEHYKPTKVFIAEDCFKLLSNITSERLTQAFVSSVEKLFGGHLIKQIS  240

Query  1055  LDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQT---LKRHEFKRNHDDWIDDVKPTL  1225
             L  Y+ +KVPSLK F     +    +   L  +V++   L+RHEF  NH +W+      L
Sbjct  241   LGKYVEDKVPSLKHFMIEENDGYKHSIPSLAALVRSKRFLQRHEFNINHGEWVRSYHSHL  300

Query  1226  DPIITAQLHEGL-EVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
              P I+ ++ E + EV D  ID   +++ E+R AL+ L++D G+L IPTV  PPPK     
Sbjct  301   GPGISERILEFIREVTDENIDLSRSIQIELREALAALVEDFGVLAIPTVPGPPPKLNTDI  360

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             ++  D+ ++A    ++A++SG CQ S+PLG ++  P+S+S +A++G D FLL+ V +L++
Sbjct  361   SEQYDFRAKAFSLLTIAAVSGVCQVSVPLGLYNGLPVSISLLAKHGADGFLLNLVDSLYS  420

Query  1583  PLQEQAE  1603
              L+E+ E
Sbjct  421   TLKEEVE  427



>ref|XP_009350390.1| PREDICTED: amidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=428

 Score =   350 bits (897),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AMDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA+D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIADDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLNRYELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+EQ
Sbjct  418   YDTLKEQ  424



>ref|XP_009349985.1| PREDICTED: amidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=428

 Score =   349 bits (896),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA+D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PTILNRVGRVLLQLPDTGPVVPTQLIIADDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRYELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+AL
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLLAKHGSDGFLLNLVEAL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009349986.1| PREDICTED: amidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=428

 Score =   349 bits (895),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 195/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA+D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PTILNRVGRVLLQLPDTGPVVPTQLIIADDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRYELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ +IPLG +D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVTIPLGMYDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009350389.1| PREDICTED: amidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=428

 Score =   348 bits (894),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 269/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AMDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA+D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIADDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRYELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+EQ
Sbjct  418   YDTLKEQ  424



>ref|XP_010099754.1| Outer envelope protein 64 [Morus notabilis]
 gb|EXB80331.1| Outer envelope protein 64 [Morus notabilis]
Length=385

 Score =   346 bits (888),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 260/321 (81%), Gaps = 2/321 (1%)
 Frame = +2

Query  242   MASQSANLWVllglglagiliMTRKLKKAVKADSGAFVERlqllpppqppppkaphplTG  421
             MASQSANLWVLLGLGLAGIL +TR+LKKA++ D GAFVE+LQLLPPPQP PPKAPHPLTG
Sbjct  1     MASQSANLWVLLGLGLAGILFVTRRLKKAIREDYGAFVEKLQLLPPPQPAPPKAPHPLTG  60

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAVSDVF IEG VTGFG+PDW +THE A+ T  VV+ LVE GATCV KT+VD++A+GI
Sbjct  61    LTFAVSDVFQIEGHVTGFGHPDWVRTHEAASGTCPVVSTLVEGGATCVGKTVVDELAYGI  120

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             SG NKHYD PTNPA   R+PGG SSGAAVAVAA LVDFSLGIDT GGVRVPAG+CG+LGF
Sbjct  121   SGENKHYDTPTNPAVPQRIPGGSSSGAAVAVAAKLVDFSLGIDTVGGVRVPAGFCGVLGF  180

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLF  961
              PS GAVSH+GIIPVS SLD VGWF  D  VLRRVGHVLLQ+P+T QR+P  I+IA D F
Sbjct  181   RPSHGAVSHVGIIPVSTSLDTVGWFANDHAVLRRVGHVLLQLPYTVQRSPGQIIIAADCF  240

Query  962   QSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTT  1135
             Q   IP+DR  Q VIK+ EK FGRQ+++HENL+AYLS+KVPSLK F  KK NG+  +S+ 
Sbjct  241   QLGRIPSDRIVQAVIKSSEKIFGRQVLKHENLEAYLSSKVPSLKVFQIKKTNGQVNVSSI  300

Query  1136  RLLGHVVQTLKRHEFKRNHDD  1198
              LL  V+Q L+     R  ++
Sbjct  301   GLLAKVMQFLQNKSETRGLEE  321



>ref|XP_008450659.1| PREDICTED: amidase 1-like [Cucumis melo]
Length=430

 Score =   347 bits (890),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/427 (45%), Positives = 270/427 (63%), Gaps = 9/427 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+E+  L               +GL+FAV D+F IEG V GFGNP+W +TH PA Q
Sbjct  5     DCGAFIEKFLLQMSSPSDQLPL----SGLTFAVKDIFDIEGHVAGFGNPEWLRTHPPANQ  60

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             T+  V  ++  GATC+ KT++D+MAF I+G N HY  P NP +S R+PGG SSG+ VAVA
Sbjct  61    TAPAVLTILRGGATCIGKTMMDEMAFSINGENFHYGTPQNPCASGRIPGGSSSGSGVAVA  120

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             A LVDFSLG DT G VRVPA YCG+LGF PS G VS  G+IP++QS D VGWF RD  +L
Sbjct  121   AKLVDFSLGTDTGGSVRVPASYCGVLGFRPSHGVVSTSGVIPMTQSFDTVGWFARDSAIL  180

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSL-NIPTDRTSQVVIKAIEKQFGRQMIRHEN  1054
             +RVG +LLQ P      P  + IA D F+ L +I ++R +Q  + ++EK FG  +I+  +
Sbjct  181   KRVGWLLLQEPEVEHYKPTKVFIAEDCFKLLSSITSERLTQAFVSSVEKLFGGHLIKQIS  240

Query  1055  LDAYLSNKVPSLKSFKKLNGEAKLSTTRLLGHVVQT---LKRHEFKRNHDDWIDDVKPTL  1225
             L  Y+ +KVPSLK F     +    +   L  +V++   L+RHEFK NH +W+      L
Sbjct  241   LGKYVEDKVPSLKHFMIEENDGYKHSIPSLAALVRSKRLLQRHEFKINHGEWVGSYSSHL  300

Query  1226  DPIITAQLHEGL-EVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
              P I+ Q+ E + E  D  ID   +++ E+R  L+ LL+D G+L IPTV  PPPK     
Sbjct  301   GPGISEQILEFIREATDENIDLSRSIQIELREVLAALLEDFGVLAIPTVPGPPPKLNTDI  360

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFA  1582
             ++  D+ ++A    ++A++SG CQ SIPLG ++  P+S+S +A++G D FLL+ V  L++
Sbjct  361   SEQFDFRAKAFSLLTIAAVSGVCQVSIPLGLYNGLPVSISLLAKHGSDGFLLNLVDCLYS  420

Query  1583  PLQEQAE  1603
              L+E+ E
Sbjct  421   TLKEEVE  427



>ref|XP_002889727.1| hypothetical protein ARALYDRAFT_888131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65986.1| hypothetical protein ARALYDRAFT_888131 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   347 bits (889),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 198/425 (47%), Positives = 267/425 (63%), Gaps = 9/425 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E++ + P      P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATNNDFGAFIEKVTISPTSTSSLPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHT  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTAPVVSSLLEAGATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA LVDFS+G DT G VRVPA YCGI GF PS GAVS +G+ P++QS D VGWF RD
Sbjct  119   VVVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLLQ        P  ++IA+D F+  ++P D   Q ++ ++EK FG   ++
Sbjct  179   TATLKRVGCVLLQQDHLNPIEPSQLIIADDCFKLCSVPHDLLVQPLVGSVEKSFGGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKKLNG-----EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F   +      E  + +   L   ++ L+RHEFK NH  WI 
Sbjct  239   KEVNLGEYIEQNVPSLKHFMTSDDVTTQQELCIPSLMALSSSMRLLQRHEFKINHGAWIS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+A++ E +  ++ +ID C +V++E+ +ALS LL + G+LVIPTV  PPP 
Sbjct  299   LVKPEFGPGISARIEEAIRTSEEKIDLCRSVKSELITALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA+ G D FLL  V
Sbjct  359   LQANVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVAKYGSDGFLLSLV  418

Query  1568  QALFA  1582
              +L A
Sbjct  419   DSLAA  423



>ref|XP_009350391.1| PREDICTED: amidase 1-like isoform X3 [Pyrus x bretschneideri]
Length=428

 Score =   346 bits (888),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/427 (46%), Positives = 268/427 (63%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AMDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA+D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIADDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLVRYELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ +IPLG +D  P+SVS +A +G D FLL+ V+ L
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVTIPLGMYDNLPVSVSLLATHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|NP_563831.1| amidase 1 [Arabidopsis thaliana]
 sp|Q9FR37.1|AMI1_ARATH RecName: Full=Amidase 1; Short=AtAMI1; AltName: Full=Translocon 
at the outer membrane of chloroplasts 64-I; Short=AtTOC64-I 
[Arabidopsis thaliana]
 gb|AAG35612.1|AF202077_1 amidase [Arabidopsis thaliana]
 gb|AAK59783.1| At1g08980/F7G19_15 [Arabidopsis thaliana]
 gb|AAO42800.1| At1g08980/F7G19_15 [Arabidopsis thaliana]
 gb|AEE28378.1| amidase 1 [Arabidopsis thaliana]
Length=425

 Score =   345 bits (886),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 199/425 (47%), Positives = 267/425 (63%), Gaps = 9/425 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E++ + P      P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATNNDFGAFIEKVTISPTSTSSSPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHS  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTAPVVSSLLEAGATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS GAVS +G+ P++QS D VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGLTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLLQ        P  ++IA+D F+  ++P D   Q ++ ++EK FG   ++
Sbjct  179   TATLKRVGCVLLQQHHLNPIEPSQLIIADDCFKLCSVPHDLLVQPLVGSVEKSFGGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKKLNG-----EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F   +      E  + +   L   ++ L+RHEFK NH  WI 
Sbjct  239   KKVNLGEYIGQNVPSLKHFMTSDDVTTQQEFCIPSLMALSSSMRLLQRHEFKINHGAWIS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+ ++ E +  +D +ID C +V++E+ +ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGISERIEEAIRTSDEKIDHCRSVKSELITALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA+ G D FLL  V
Sbjct  359   LQANVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVAKYGSDGFLLSLV  418

Query  1568  QALFA  1582
              +L A
Sbjct  419   DSLAA  423



>ref|XP_009349388.1| PREDICTED: amidase 1-like [Pyrus x bretschneideri]
Length=428

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 196/427 (46%), Positives = 265/427 (62%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AMDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA+ ISG NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMDEMAYCISGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PTILNRVGRVLLQLPDTGPVVPTQLIIAEDCFQISSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLNRFELKSNHGEWVRTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D  H+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGIAERIWAVVRSTDENVDVIHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDGFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
                L+E 
Sbjct  418   HDTLKEH  424



>ref|XP_008348348.1| PREDICTED: amidase 1-like isoform X1 [Malus domestica]
 ref|XP_008348985.1| PREDICTED: amidase 1-like isoform X1 [Malus domestica]
Length=428

 Score =   344 bits (882),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 265/427 (62%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A  +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AXDSDHGAFVEKFLLRPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++ +MA+ I+G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILSGGATSIGITVMGEMAYSINGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VR+PA YCGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLTDFSLGTDTGGSVRIPASYCGIFGFRPSHGVISTSGVTPLAQSCDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ  ++P+ R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIAEDCFQLSSVPSSRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL SF      + E  + +   L    + L R+E K NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTANRLLIRYELKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P    ++   +   D  +D CH+V  E+R+AL+DLL D G+L +PTV   PPK   
Sbjct  298   PDLGPGTAERIWAVVRSTDENVDVCHSVMTELRAALTDLLGDFGVLAMPTVPGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLGAFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLLAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>ref|XP_009118331.1| PREDICTED: amidase 1 [Brassica rapa]
Length=421

 Score =   343 bits (880),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 196/420 (47%), Positives = 265/420 (63%), Gaps = 7/420 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+  + P P    P       GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     AISNDYGAFIEKSTISPTPSSSFPSLK----GLTFAIKDIFDVEGRVTGFGNPDWLRTHS  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +S R+PGG SSG+A
Sbjct  58    AATSTAPVVSSLLEAGATSLGITIMDEMAYSINGENAHYGTPVNPVASERVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI G  PS G VS +G+ P++QS D VGWF RD
Sbjct  118   VAVAAGLVDFSIGTDTGGSVRVPASYCGIFGLRPSHGVVSTVGVTPMAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLLQ      + P  ++IA+D F+  ++P +     V+++++K FG   +I
Sbjct  178   TATLKRVGCVLLQQHDVDAKEPSQLIIADDCFKLCSVPRELLVLPVVQSVDKSFGGNTVI  237

Query  1043  RHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVK  1216
                +L  Y+   VPSLK F     + +     L  L   ++ L+R+EFK NH +W+  VK
Sbjct  238   NKVDLGEYIQENVPSLKHFMTSETQREFCIPSLMALSSSMRMLQRYEFKMNHGEWVSSVK  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P   P I+ ++ E + V+D +ID C  V+ E+ +ALS LL ++G+LVIPTV  PPP   A
Sbjct  298   PEFGPGISERIEEAIRVSDEKIDLCRLVKTELLTALSTLLGENGVLVIPTVPGPPPHLQA  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
                    + SRA    S+A +SG CQ SIPLG H+  PISVS VA +G D FLL  V +L
Sbjct  358   DVVALESFRSRAFSLLSIAGVSGLCQVSIPLGLHENLPISVSLVANHGSDGFLLSLVDSL  417



>ref|XP_010458166.1| PREDICTED: amidase 1-like [Camelina sativa]
Length=431

 Score =   343 bits (880),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 266/423 (63%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDFGAFIEKLTISPIPPSSFPPSLL---GLTFAIKDIFDVEGRVTGFGNPDWLRTHT  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTAPAVSSLLEAGATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QS D VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVSTAGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLL+ P      P  ++IA+D F+  ++P D   Q ++ ++EK FG   ++
Sbjct  179   TATLKRVGSVLLEKPHLNCIKPDQLIIADDCFKLCSVPRDMLVQPLVGSVEKLFGGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKK-----LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F          E  + +   L   ++ L+R+EFK NH +W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSHDVTTQQEFSIPSLMALSSSMRLLQRYEFKINHGEWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+A++ E +  +D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGISARIEEAINTSDEKIDLCRSVKSELKAALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA  G D FLL  V
Sbjct  359   LKADVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVATYGSDGFLLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>ref|XP_010489566.1| PREDICTED: amidase 1-like isoform X1 [Camelina sativa]
Length=427

 Score =   342 bits (876),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 266/423 (63%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDDDYGAFIEKLTISPTPPSSFPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHT  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTALVVSSLLEAGATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VA AA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QS D VGWF RD
Sbjct  119   VAAAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVSTAGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQF-GRQMI  1042
                L+RVG VLL+ P      P  ++IA+D F+  ++P D   Q ++ ++EK F G  ++
Sbjct  179   TTTLKRVGSVLLEQPQLNCIKPDQLIIADDCFKLCSVPRDLLVQPLVGSVEKLFRGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSF-----KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F          E  + +   L   ++ L+R+EFK NH +W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSHDDTTQQEFSIPSLMALTGSMRLLQRYEFKINHGEWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+A++ E +  +D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGISARIEEAINTSDEKIDLCRSVKSELKTALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA  G D FLL  V
Sbjct  359   LKADVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVATYGSDGFLLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>gb|KFK43202.1| hypothetical protein AALP_AA1G093600 [Arabis alpina]
Length=425

 Score =   341 bits (875),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/423 (47%), Positives = 270/423 (64%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P + H   GL+FA+ D+F ++G VTGFGNPDW +TH 
Sbjct  2     ATNNDFGAFIEKLTISPTPSSSVPPSLH---GLTFAIKDIFDVKGRVTGFGNPDWLRTHS  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +S R+PGG SSG+A
Sbjct  59    AATSTAPVVSSLLEAGATSLGITIMDEMAYSINGENAHYGTPKNPIASDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS G VS  G+ P++QS D VGWF RD
Sbjct  119   VAVAAGLVDFSIGTDTGGSVRVPASYCGIFGFRPSHGVVSTTGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLL  P   +  P  ++IA+D F+  ++P D   Q V++++EK FG +  I
Sbjct  179   TATLKRVGCVLLPQPHLDRIEPSELIIADDCFKLSSVPHDLLVQPVLQSVEKSFGGKTAI  238

Query  1043  RHENLDAYLSNKVPSLKSFKKLNG-----EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  +L  ++   VPSLK F   +      E  + +   L   ++ L+R+EFK NH +W+ 
Sbjct  239   KKMDLGEFIEENVPSLKHFMTSDDVTTQQEFCIQSLMALSSSMRLLQRYEFKMNHGEWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I A++ E + ++D +ID C +V+ E+R+ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGIAARIDEAIRMSDEKIDLCRSVKLELRAALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       +  RA    S+A +SG CQ SIPLG H+  P+SVS VA++G D FLL  V
Sbjct  359   LRADVASLETFRGRAFSLLSIAGVSGCCQVSIPLGLHENLPVSVSLVAKHGSDVFLLGLV  418

Query  1568  QAL  1576
               L
Sbjct  419   DLL  421



>ref|XP_004967877.1| PREDICTED: amidase 1-like [Setaria italica]
Length=442

 Score =   342 bits (876),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/408 (47%), Positives = 254/408 (62%), Gaps = 4/408 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FA+ D+F I G VTGFGNPD A+TH PA  TS VV A + AGAT V KT++D+MA+ 
Sbjct  34    GLTFAIKDIFDISGRVTGFGNPDGARTHAPAAATSPVVLATLAAGATSVGKTVMDEMAYS  93

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP +  R+PGG SSG+AVAVAA LVDF+LG DT G VRVPA YCGI G
Sbjct  94    INGENAHYGTPTNPCAPDRVPGGSSSGSAVAVAAKLVDFALGTDTGGSVRVPAAYCGIFG  153

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQ-RNPRNIVIAND  955
               PS G VS   + P+SQ  D VGWF RD   L RV  VLL +P     + P    I  D
Sbjct  154   LRPSHGVVSTENVTPMSQMFDTVGWFARDLSTLSRVSDVLLPLPADNNIKQPTQFTIPKD  213

Query  956   LFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFKK---LNGEAKL  1126
              F+ L    D+T Q++  ++ K+FG   + + NL  ++SN VP++  F      N    +
Sbjct  214   CFEILGSLKDQTYQILNASVAKRFGSDAVDNRNLGEFVSNNVPTIGKFISDFSKNEAPSV  273

Query  1127  STTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRN  1306
                 ++ +V++ L+R EFK NH +WI+ VKP L P I  ++HE +   D  ++  HA+R 
Sbjct  274   PALSVISYVMRCLQRSEFKANHAEWINTVKPNLGPGIRERVHEAITSEDGPMEDFHALRT  333

Query  1307  EMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIP  1486
             E +SAL+ L+KDDGIL IPTV   PPK   +     ++ +RA    S+A LSG CQ SIP
Sbjct  334   EFKSALAALVKDDGILAIPTVPGSPPKLRMEAAALENFRARAFSLLSIAGLSGFCQLSIP  393

Query  1487  LGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSN  1630
             LG  D  P+SVS VAR+G DRFLL   Q L+  L+E+ + A  S  S+
Sbjct  394   LGVRDGVPVSVSLVARHGADRFLLSVAQELYETLKEETKKAWSSMGSS  441



>tpg|DAA50921.1| TPA: toc64 isoform 1 [Zea mays]
 tpg|DAA50922.1| TPA: toc64 isoform 2 [Zea mays]
Length=281

 Score =   335 bits (858),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 202/281 (72%), Gaps = 3/281 (1%)
 Frame = +2

Query  1160  TLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLK  1339
             +L + EFK  H +WI+ VKP +D  I + L E     D++ID C  VR E RSALS LLK
Sbjct  3     SLHKQEFKDKHMEWINSVKPAVDARIVSDLSED---GDSDIDGCQNVRKEARSALSGLLK  59

Query  1340  DDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISV  1519
             DDGILVIPT +  PPK  AKE  S  Y S+     SLAS+SG CQ SIPLG HDKCPISV
Sbjct  60    DDGILVIPTALGCPPKLNAKELSSESYNSQTLRLLSLASMSGCCQVSIPLGTHDKCPISV  119

Query  1520  SFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEK  1699
             S +AR+GGDRFLLD  Q ++  +QEQ EI  +S  S+     E +AE AK KGN AFKEK
Sbjct  120   SLIARHGGDRFLLDTTQTMYTTIQEQVEILAKSSVSSKQAMNEEAAEAAKEKGNAAFKEK  179

Query  1700  QWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRR  1879
             QWQ+A+ FYTEAIKL G  ATY+SNRAAA+LEL S+ QAEADCT AIELD K+VKAY RR
Sbjct  180   QWQKAVNFYTEAIKLNGKVATYYSNRAAAFLELTSYRQAEADCTSAIELDSKSVKAYLRR  239

Query  1880  GTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             GTAREMLGYY +A++DF +ALVLEP NK A  +  RL KLF
Sbjct  240   GTAREMLGYYKEAVDDFNHALVLEPMNKTAGVAINRLKKLF  280



>ref|XP_006417625.1| hypothetical protein EUTSA_v10007679mg [Eutrema salsugineum]
 gb|ESQ35978.1| hypothetical protein EUTSA_v10007679mg [Eutrema salsugineum]
Length=434

 Score =   340 bits (872),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 262/424 (62%), Gaps = 11/424 (3%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+  + P P            GL+FA+ D+F +EG +TGFGNPDW +TH 
Sbjct  2     AMNNDFGAFIEKSTISPTPSYSSHSLK----GLTFAIKDIFDVEGRITGFGNPDWLRTHS  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  58    AATSTAPAVSSLLEAGATSLGITIMDEMAYSINGENAHYGTPINPIAFDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS G VS  G+ P++QS D VGWF RD
Sbjct  118   VAVAAALVDFSIGTDTGGSVRVPASYCGIFGFRPSHGVVSTAGVTPMAQSFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQV-PFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
                L+RVG VLLQ  P      P  ++IA+D F+  + P D   Q ++ ++EK FG   +
Sbjct  178   TATLKRVGCVLLQQQPHLNHIEPTQLIIADDCFKLCSAPRDLLVQPLVLSVEKSFGGNTV  237

Query  1043  RHE-NLDAYLSNKVPSLKSFKK-----LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWI  1204
                 NL  Y+   VPSLK F          +  + +   L   ++ L+R+EFK NH +W+
Sbjct  238   TENVNLGEYIQENVPSLKHFMTGDDVTTQQDFCIPSLMALSSSMRLLQRYEFKMNHGEWV  297

Query  1205  DDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPP  1384
               VKP   P I+A++ E +  +D ++D C +V++E+ +ALS LL D G+LVIPTV  PPP
Sbjct  298   SSVKPEFGPGISARIEEAIRTSDEKVDHCRSVKSELSTALSTLLGDKGVLVIPTVPGPPP  357

Query  1385  KAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDA  1564
                A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA++G D FLL  
Sbjct  358   HLKADVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVAKHGSDGFLLSL  417

Query  1565  VQAL  1576
             V +L
Sbjct  418   VDSL  421



>ref|XP_009350394.1| PREDICTED: amidase 1-like [Pyrus x bretschneideri]
 ref|XP_009350395.1| PREDICTED: amidase 1-like [Pyrus x bretschneideri]
Length=428

 Score =   340 bits (871),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 192/427 (45%), Positives = 264/427 (62%), Gaps = 7/427 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ +D GAFVE+  L PP            +GL+FAV D+F + G VTGFGNPDWA+TH 
Sbjct  2     AIDSDHGAFVEKFLLQPPSSSHDLPL----SGLTFAVKDIFDVAGRVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              A  T+  V+A++  GAT +  T++D+MA  ++G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    AAESTAPAVSAILNGGATSIGITVMDEMACCMNGENKHYGTPRNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V VAA L DFSLG DT G VRVPA +CGI GF PS G +S  G+ P++QS D VGWF R+
Sbjct  118   VVVAAGLADFSLGTDTGGSVRVPASHCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L RVG VLLQ+P T    P  ++IA D FQ  ++P+ R  Q ++ ++EK FG  +I+
Sbjct  178   PAILNRVGRVLLQLPDTGPVVPTQLIIAEDCFQISSVPSSRVKQALVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H  L   + +KVPSL SF      + E  + +   L      L  +EFK NH +W+  V+
Sbjct  238   HAILGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTAFHLLGSYEFKSNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++   +   D  +D CH+V  E+ +AL+DLL D G+L +PTV+  PPK   
Sbjct  298   PDLGPGIAERVWAIVRSTDENVDVCHSVMTELHAALTDLLGDFGVLAMPTVLGDPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
               T    + +RA  F S+A +SG CQ SIPLG  D  P+SVS +A++G D FLL+ V+ L
Sbjct  358   DPTTLDGFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLMAKHGSDGFLLNLVETL  417

Query  1577  FAPLQEQ  1597
             +  L+E 
Sbjct  418   YDTLKEH  424



>emb|CDY06342.1| BnaA09g48610D [Brassica napus]
Length=422

 Score =   338 bits (868),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/421 (47%), Positives = 265/421 (63%), Gaps = 8/421 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+  + P P    P       GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     AISNDYGAFIEKSTISPTPSSSFPSLK----GLTFAIKDIFDVEGRVTGFGNPDWLRTHS  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +S R+PGG SSG+A
Sbjct  58    AATSTAPVVSSLLEAGATSLGITIMDEMAYSINGENAHYGTPVNPVASERVPGGSSSGSA  117

Query  686   vavaaNLVDFSL-GIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             VAVAA LVDFS+ G DT G VRVPA YCGI G  PS G VS +G+ P++QS D VGWF R
Sbjct  118   VAVAAGLVDFSIAGTDTGGSVRVPASYCGIFGLRPSHGVVSTVGVTPMAQSFDTVGWFAR  177

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQM  1039
             D   L+RVG VLLQ      + P  ++IA+D F+  ++P +     V+++++K FG   +
Sbjct  178   DTATLKRVGCVLLQQHDVDAKEPSQLIIADDCFKLCSVPRELLVLPVVQSVDKSFGGNTV  237

Query  1040  IRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDV  1213
             I   +L  Y+   VPSLK F     + +     L  L   ++ L+R+EFK NH +W+  V
Sbjct  238   INKVDLGEYIQENVPSLKHFMTSETQREFCIPSLMALSSSMRMLQRYEFKMNHGEWVSSV  297

Query  1214  KPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG  1393
             KP   P I+ ++ E + V+D +ID C  V+ E+ +ALS LL ++G+LVIPTV  PPP   
Sbjct  298   KPEFGPGISERIEEAIRVSDEKIDLCRLVKTELLTALSTLLGENGVLVIPTVPGPPPHLQ  357

Query  1394  AKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQA  1573
             A       + SRA    S+A +SG CQ SIPLG H+  PISVS VA +G D FLL  V +
Sbjct  358   ADVVALESFRSRAFSLLSIAGVSGLCQVSIPLGLHENLPISVSLVANHGSDGFLLSLVDS  417

Query  1574  L  1576
             L
Sbjct  418   L  418



>ref|XP_010043097.1| PREDICTED: amidase 1-like isoform X2 [Eucalyptus grandis]
Length=384

 Score =   337 bits (865),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 246/356 (69%), Gaps = 5/356 (1%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F IEG VTGFGNPDWA+THEPA+ T+  V  +++AGATCV KT++D+MA+ 
Sbjct  29    GLTFAVKDIFDIEGHVTGFGNPDWARTHEPASSTAPAVLNVLKAGATCVGKTVMDEMAYS  88

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             ++G NKHY  P NP +   +PGG SSG+AVAV A LVDFSLG DT G VRVPA  CGILG
Sbjct  89    LTGDNKHYGTPRNPCAPDYVPGGSSSGSAVAVGAMLVDFSLGSDTGGSVRVPASNCGILG  148

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
             F PS  A+S +G+IP++QSLD VGWF R+P +L++VG VLL++P      P  I+I  D 
Sbjct  149   FRPSHNAISTVGVIPMAQSLDTVGWFAREPSILKQVGRVLLELPEADPNRPSQIIIPTDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK-KLNGEAKLSTT  1135
             FQ LNIP++R +Q +++++EK FG  +I+H  L  Y+ + VP+L SF  ++N +   S  
Sbjct  209   FQLLNIPSERLTQALVRSVEKLFGGAIIKHAVLGDYIRDSVPALSSFLCQINEDQVDSIP  268

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L    Q L+R+EFK +H+DW+  VKP LDPII+ ++ + LE+ +  ID C +V+ E
Sbjct  269   SLAALSSARQLLQRYEFKNHHEDWVSAVKPDLDPIISERVRQALELTEENIDICWSVKKE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY-VSRACLFASLASLSGGCQ  1474
             + SAL+ LL D G+L IPTV  PPPK    +  S+D  V +A    S+A LS  CQ
Sbjct  329   LHSALTSLLGDFGVLAIPTVPGPPPKL-QTDASSLDVSVEKAFNLLSIAGLSEFCQ  383



>emb|CDY22653.1| BnaC08g42870D [Brassica napus]
Length=422

 Score =   338 bits (868),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/421 (47%), Positives = 264/421 (63%), Gaps = 8/421 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+  + P P    P        L+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     AISNDYGAFIEKSTISPRPSSSFPSLKD----LTFAIKDIFDVEGRVTGFGNPDWLRTHS  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+ VV++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +S R+PGG SSG+A
Sbjct  58    AATSTAPVVSSLLEAGATSLGITIMDEMAYSINGENAHYGTPVNPVASERVPGGSSSGSA  117

Query  686   vavaaNLVDFSL-GIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTR  862
             VAVAA LVDFS+ G DT G VRVPA YCGI G  PS G VS +G+ P++QS D VGWF R
Sbjct  118   VAVAAGLVDFSIAGTDTGGSVRVPASYCGIFGLRPSHGVVSTVGVTPMAQSFDTVGWFAR  177

Query  863   DPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQM  1039
             D   L+RVG VLLQ P      P  ++IA+D F+  ++P +     ++++++K FG   +
Sbjct  178   DTATLKRVGCVLLQQPHLDATEPSQLIIADDCFKLCSVPRELLVLPLVQSVDKSFGGNTV  237

Query  1040  IRHENLDAYLSNKVPSLKSFKKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDV  1213
             I   +L AY+   VPSLK F     + +     L  L   ++ L+R EFK NH +W+  V
Sbjct  238   INKVDLGAYIEEHVPSLKHFMTSETQREFCIPSLMALSSSMRMLQRFEFKMNHGEWVSLV  297

Query  1214  KPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG  1393
             KP   P I+ ++ E + V+D +ID C  V+ E+ +ALS LL D+G+LVIPTV  PPP   
Sbjct  298   KPEFGPGISERIEEAIRVSDEKIDLCRLVKTELLTALSTLLGDNGVLVIPTVPGPPPHLQ  357

Query  1394  AKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQA  1573
             A       + SRA    S+A +SG CQ SIPLG H+  PISVS VA +G D FLL  V +
Sbjct  358   ADVVALESFRSRAFSLLSIAGVSGLCQVSIPLGLHENLPISVSLVATHGSDGFLLSLVDS  417

Query  1574  L  1576
             L
Sbjct  418   L  418



>ref|XP_008388968.1| PREDICTED: amidase 1-like [Malus domestica]
Length=436

 Score =   338 bits (868),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/390 (46%), Positives = 249/390 (64%), Gaps = 3/390 (1%)
 Frame = +2

Query  437   SDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANK  616
             S  F + G VTGFGNPDWA+TH  A  T+  V+A++  GAT +  T++D+MA+ I+G NK
Sbjct  43    SSKFDVAGRVTGFGNPDWARTHXAAESTAPAVSAILSGGATSIGITVMDEMAYCINGENK  102

Query  617   HYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFG  796
             HY  P NP +  R+PGG SSG+AVAVA  L DFSLG DT G  RVPA YCG  GF PS G
Sbjct  103   HYGTPRNPCAPDRVPGGSSSGSAVAVAVGLXDFSLGTDTGGSXRVPASYCGXFGFRPSHG  162

Query  797   AVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNI  976
              +S  G+ P++QS D VGWF RDP +L RVG VLLQ+P T    P  ++IA D FQ  ++
Sbjct  163   VISTSGVTPLAQSFDTVGWFARDPAILNRVGRVLLQLPDTGPVVPTQLIIAEDCFQLSSV  222

Query  977   PTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLG  1147
             P+ R  QV++ ++EK FG  +I+H NL   + +KVPSL SF      + E  + +   L 
Sbjct  223   PSSRVKQVLVDSVEKLFGGHVIKHANLGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALS  282

Query  1148  HVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALS  1327
                + L+R+EFK NH +W+  V+P L P I  ++   +   D  +D CH+V  E+R+AL+
Sbjct  283   TADRLLERYEFKSNHGEWVSTVRPDLGPGIGERIWAAVRSTDENVDVCHSVMTELRAALT  342

Query  1328  DLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKC  1507
             DLL D G+L +PTV   PPK     T   ++ +RA  F S+A +SG CQ +IPLG +D  
Sbjct  343   DLLGDFGVLAMPTVPGDPPKLQTDPTTLHNFRARAFSFLSIAVVSGFCQVTIPLGMYDNL  402

Query  1508  PISVSFVARNGGDRFLLDAVQALFAPLQEQ  1597
             P+SVS +A++G D FLL+ V+ L+  L+E 
Sbjct  403   PVSVSLLAKHGSDGFLLNLVETLYDTLKEH  432



>ref|XP_010475716.1| PREDICTED: amidase 1 [Camelina sativa]
Length=425

 Score =   338 bits (867),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 266/423 (63%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDFGAFIEKLTISPIPPSSFPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHT  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V+ L+EAGAT +  T++D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTAPAVSCLLEAGATALGVTMMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QS D VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVSTAGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLL+ P      P  ++IA+D F+  ++P D   Q ++ ++EK FG   ++
Sbjct  179   TSTLKRVGSVLLEQPHLNCIKPDQLIIADDCFKLCSVPRDMLVQPLVGSVEKLFGGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKK-----LNGEAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F          +  + +   L   ++ L+R+EFK NH +W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSHDVTTQQDFCIPSLMALSSSMRLLQRYEFKINHGEWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+A++ E +  +D +ID C +V++E+++ALS LL + G+LVIPTV  P P 
Sbjct  299   SVKPEFGPGISARIEEAINTSDEKIDLCRSVKSELKTALSTLLGEKGVLVIPTVPGPSPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SVS VA++G D FLL  V
Sbjct  359   LKADVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVAKSGSDGFLLSLV  418

Query  1568  QAL  1576
              ++
Sbjct  419   DSI  421



>gb|EAY92845.1| hypothetical protein OsI_14646 [Oryza sativa Indica Group]
Length=435

 Score =   337 bits (864),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 271/427 (63%), Gaps = 9/427 (2%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER  L PPP    P       GL+FA+ D+F I G VTGFGNPDWA+TH PA
Sbjct  8     RGDYGAFMERFVLPPPPSQQLPLH-----GLTFAIKDIFDIAGRVTGFGNPDWARTHAPA  62

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
               TS VV A + AGAT +  TI+D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVA
Sbjct  63    AATSPVVLAALAAGATSLGTTIMDEMAYSINGENTHYGTPTNPCAPGRVPGGSSSGSAVA  122

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAANLVDFSLG DT G VRVPA YCGI G  PS G VS   +IP++Q  D VGWF+RD  
Sbjct  123   VAANLVDFSLGTDTGGSVRVPAAYCGIFGLRPSHGLVSAENVIPMAQMFDTVGWFSRDLS  182

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
              L RV  VLL +P    + P  + I  D FQ L    DRT Q++  ++ K+F  Q+I + 
Sbjct  183   TLSRVTKVLLPLPDDIVKQPTQVTIPMDCFQILGSLNDRTYQIINASVAKRFDSQIIDNR  242

Query  1052  NLDAYLSNKVPSLKSFKKLNGEAKLSTT---RLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             NL  ++S+ VPS+  F     E++L +     ++ HV++ L+R +FK NH +W++ VKP 
Sbjct  243   NLGDFISDNVPSIGKFITDFSESELPSVPALSVISHVMRGLQRSQFKANHAEWVNTVKPN  302

Query  1223  LDPIITAQLHEGLEVADTE-IDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
             L P +  ++ E +   D E ++   A+R E +SAL+ LLKD GIL IPTV  PPPK G +
Sbjct  303   LGPGLRERILEAIASGDNESLEDFQAIRAEFKSALAALLKDHGILAIPTVPGPPPKVGME  362

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                  ++ +RA    S+A LSG CQ SIPLG  +  P+SVS VAR+G D FLL+ V+ L+
Sbjct  363   AAPLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLPVSVSLVARHGADHFLLNVVEELY  422

Query  1580  APLQEQA  1600
               L ++A
Sbjct  423   QTLIDEA  429



>emb|CAH66005.1| H0613H07.3 [Oryza sativa Indica Group]
Length=435

 Score =   337 bits (864),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 271/427 (63%), Gaps = 9/427 (2%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER  L PPP    P       GL+FA+ D+F I G VTGFGNPDWA+TH PA
Sbjct  8     RGDYGAFMERFVLPPPPSQQLPLH-----GLTFAIKDIFDIAGRVTGFGNPDWARTHAPA  62

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
               TS VV A + AGAT +  TI+D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVA
Sbjct  63    AATSPVVLAALAAGATSLGTTIMDEMAYSINGENTHYGTPTNPCAPGRVPGGSSSGSAVA  122

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAANLVDFSLG DT G VRVPA YCGI G  PS G VS   +IP++Q  D VGWF+RD  
Sbjct  123   VAANLVDFSLGTDTGGSVRVPAAYCGIFGLRPSHGLVSAENVIPMAQMFDTVGWFSRDLS  182

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
              L RV  VLL +P    + P  + I  D FQ L    DRT Q++  ++ K+F  Q+I + 
Sbjct  183   TLSRVTKVLLPLPDDIVKQPTQVTIPMDCFQILGSLNDRTYQIINASVAKRFDSQIIDNR  242

Query  1052  NLDAYLSNKVPSLKSFKKLNGEAKLSTT---RLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             NL  ++S+ VPS+  F     E++L +     ++ HV++ L+R +FK NH +W++ VKP 
Sbjct  243   NLGDFISDNVPSIGKFITDFSESELPSVPALSVISHVMRGLQRSQFKANHAEWVNTVKPN  302

Query  1223  LDPIITAQLHEGLEVADTE-IDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
             L P +  ++ E +   D E ++   A+R E +SAL+ LLKD GIL IPTV  PPPK G +
Sbjct  303   LGPGLRERILEAIASGDNESLEDFQAIRAEFKSALAALLKDHGILAIPTVPGPPPKVGME  362

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                  ++ +RA    S+A LSG CQ SIPLG  +  P+SVS VAR+G D FLL+ V+ L+
Sbjct  363   AAPLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLPVSVSLVARHGADHFLLNVVEELY  422

Query  1580  APLQEQA  1600
               L ++A
Sbjct  423   QTLIDEA  429



>gb|EPS64745.1| hypothetical protein M569_10030, partial [Genlisea aurea]
Length=427

 Score =   336 bits (862),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 260/399 (65%), Gaps = 14/399 (4%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F IEG++TGFGNPDW KTH  AT T+  V +L+EAGATC+ KT++D+MA+ 
Sbjct  25    GLTFAVKDIFDIEGYITGFGNPDWVKTHSVATSTAPAVVSLIEAGATCIGKTVMDEMAYS  84

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  PTNP ++ R+PGG SSG+AVAV A L DFSLG DT G VRVPA YCGI G
Sbjct  85    INGENAHYGTPTNPRAADRVPGGSSSGSAVAVGALLADFSLGTDTGGSVRVPASYCGIFG  144

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQV-----PFTAQRNPRNIV  943
             F PS G VS  G+IP++ S D VGWF RDP +LR+VGHVLLQ+       TA+ +   I+
Sbjct  145   FRPSHGTVSSSGVIPMAPSFDTVGWFARDPIILRQVGHVLLQLKDDDHELTAKFS--RII  202

Query  944   IANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF---KKLNG  1114
             +A D    L+    + +QV+I +IE+ +G +   H NL  Y+  +VPSLK F    +++G
Sbjct  203   VAKDCLSLLDTRHQQLTQVLISSIEELYGNRKTEHINLGEYIEPRVPSLKHFIGNIRMDG  262

Query  1115  EAK---LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEID  1285
             +       +   L + ++ L+R+EFK++H +WI+ V+P L   I  ++   LE  D  I 
Sbjct  263   KEDDNIPPSLAALSNSMRLLQRYEFKKHHSEWINSVQPHLGTGIAERVRYSLETTDENIG  322

Query  1286  KCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSG  1465
              C ++++E+ SAL+DLL D GIL +PTV  PPPK   +      Y ++A    S+A +SG
Sbjct  323   TCLSLKSELNSALTDLLGDFGILAMPTVPGPPPKLQMEPVLLERYRAKAFGLLSVAGMSG  382

Query  1466  GCQASIPLGFH-DKCPISVSFVARNGGDRFLLDAVQALF  1579
              CQA IPLG   D  P+ VS +A++G D FLL  V+ ++
Sbjct  383   FCQAHIPLGMDGDDLPVGVSLIAKSGSDGFLLSFVETIY  421



>ref|XP_007042954.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
4 [Theobroma cacao]
 gb|EOX98785.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
4 [Theobroma cacao]
Length=410

 Score =   335 bits (859),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 255/368 (69%), Gaps = 2/368 (1%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             M RK     + D GAF+ER +L+P PQPPPP A  PL+GL+FA+ D+F ++G+VTGFGNP
Sbjct  38    MRRKAIIIKREDFGAFLERFELIPFPQPPPPAAKLPLSGLTFAIKDIFDVKGYVTGFGNP  97

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW +THEPA +T+ VVTAL++ GA CV KT++D++AFG++G NKHY  PTNP   S +PG
Sbjct  98    DWRRTHEPADKTAVVVTALLKNGAKCVGKTVMDELAFGVTGENKHYGTPTNPNMESNVPG  157

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF+LG DT G VR+PA +CGILGF PS GAVS +G++P SQSLD 
Sbjct  158   GSSSGSAVAVAAELVDFALGTDTIGCVRIPASFCGILGFRPSHGAVSTIGLLPNSQSLDA  217

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             +GWF RDP +L  VGHVLLQ+     R  R +V A+DLFQ   +P  +T  VV KAIEK 
Sbjct  218   IGWFARDPSILHCVGHVLLQLKAVEPRRARRLVFADDLFQLSKVPKQKTVYVVSKAIEKL  277

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
              G Q  +H N   Y+++ VPSLK F  +  + +  +S  + L  V+ +L+R+EFK NH++
Sbjct  278   SGYQPPKHINFAQYVASNVPSLKGFCQQSTHLQNGISILKALSSVMVSLQRYEFKTNHEE  337

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             W+ DVKP L   I+  +   +      +   + VR EMR+A+  LLKDDGILVIPT+ D 
Sbjct  338   WVKDVKPRLGAEISNHVLASINTTYGNVKNLYKVRTEMRAAVQSLLKDDGILVIPTIADA  397

Query  1379  PPKAGAKE  1402
             P K  +K+
Sbjct  398   PLKLNSKK  405



>ref|NP_001052056.1| Os04g0118100 [Oryza sativa Japonica Group]
 emb|CAE01284.1| OSJNBa0020P07.1 [Oryza sativa Japonica Group]
 dbj|BAF13970.1| Os04g0118100 [Oryza sativa Japonica Group]
Length=435

 Score =   335 bits (860),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 203/427 (48%), Positives = 271/427 (63%), Gaps = 9/427 (2%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER  L PPP    P       GL+FA+ D+F I G VTGFGNPDWA+TH PA
Sbjct  8     RGDYGAFMERFVLPPPPSQQLPLH-----GLTFAIKDIFDIAGRVTGFGNPDWARTHAPA  62

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
               TS VV A + AGAT +  TI+D+MA+ I+G N HY  PTNP +  R+PGG SSG+AVA
Sbjct  63    AATSPVVLAALAAGATSLGTTIMDEMAYSINGENTHYGTPTNPCAPGRVPGGSSSGSAVA  122

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAANLVDFSLG DT G VRVPA YCGI G  PS G VS   +IP++Q  D VGWF+RD  
Sbjct  123   VAANLVDFSLGTDTGGSVRVPAAYCGIFGLRPSHGLVSAENVIPMAQMFDTVGWFSRDLS  182

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
              L RV  VLL +P    + P  + I  D FQ L    DRT Q++  ++ K+F  Q++ + 
Sbjct  183   TLSRVTKVLLPLPDDIVKQPTQVTIPMDCFQILGSLDDRTYQIINASVAKRFDSQILDNR  242

Query  1052  NLDAYLSNKVPSLKSFKKLNGEAKLSTT---RLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             NL  ++S+ VPS+  F     E++L +     ++ HV++ L+R +FK NH +W++ VKP 
Sbjct  243   NLGDFISDNVPSIGKFITDFSESELPSVPALSVISHVMRGLQRSQFKANHAEWVNTVKPN  302

Query  1223  LDPIITAQLHEGLEVADTE-IDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
             L P +  ++ E +   D E ++   A+R E +SAL+ LLKD GIL IPTV  PPPK G +
Sbjct  303   LGPGLRERILEAIASGDNESLEDFQAIRAEFKSALAALLKDHGILAIPTVPGPPPKVGME  362

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                  ++ +RA    S+A LSG CQ SIPLG  +  P+SVS VAR+G D FLL+ V+ L+
Sbjct  363   AAPLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLPVSVSLVARHGADHFLLNVVEELY  422

Query  1580  APLQEQA  1600
               L ++A
Sbjct  423   QTLIDEA  429



>ref|XP_010475719.1| PREDICTED: amidase 1-like [Camelina sativa]
Length=425

 Score =   335 bits (858),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 263/423 (62%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDYGAFIEKLTISPTPSSLVPPSLQ---GLTFAIKDIFDVEGHVTGFGNPDWLRTHS  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT    TI+D+MA  I+G N HY  P NP +  RLPGG SSG+A
Sbjct  59    AATSTAPAVSSLLEAGATAFGFTIMDEMACSINGDNVHYGTPRNPIAFDRLPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QSLD VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVSTAGVTPLAQSLDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQM-I  1042
                L+RVG VLL+ P      P  ++IA+D F+  ++P D   Q ++ A+EK FG    +
Sbjct  179   TSTLKRVGCVLLKQPHLNCIEPDQLIIADDCFKLCSVPRDLLVQPLVGAVEKSFGGNTEV  238

Query  1043  RHENLDAYLSNKVPSLKSF---KKLNGEAKLSTTRLLGHVVQTLKR--HEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F   + +  + + S   L+      L    HEFK NH  W+ 
Sbjct  239   KKVNLGGYIKENVPSLKHFMTSEDVTAQQEFSIPSLMALSSSMLLSVMHEFKINHSAWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P ++A +   + ++D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGLSALMEVAIRMSDEKIDHCRSVKSELKTALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + S+A    S+A +SG CQ +IPLG H+  P+SVS VA++G D FLL  V
Sbjct  359   LKADVAALESFSSKAFSLLSIAGVSGFCQVTIPLGLHENLPVSVSLVAKSGSDGFLLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>ref|XP_010489596.1| PREDICTED: amidase 1-like [Camelina sativa]
Length=425

 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 263/423 (62%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDFGAFIEKLTISPTPSSLVPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHS  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT +  TI+D+MA  I+G N HY  P NP +  RLPGG SSG+A
Sbjct  59    AATSTAPAVSSLLEAGATALGFTIMDEMACSINGDNVHYGTPRNPIAFDRLPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QSLD VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSSNAVSTAGVTPLAQSLDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLL+ P      P  ++IA+D F+  +I  D   Q ++ A+EK FG + ++
Sbjct  179   TATLKRVGCVLLEQPHLKCIEPDQLIIADDCFKLCSISRDLLVQPLVGAVEKSFGGKTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKK---LNGEAKLSTTRLLGHVVQTLKR--HEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F     +  + + S   L+      L    HEFK NH  W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSDDVTTQQEFSIPSLMALSSSMLLSVMHEFKINHSAWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+A +   +  +D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGISALMEVAIRTSDEKIDHCRSVKSELKTALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + SRA    S+A +SG CQ SIPLG H+  P+SV+ VA++G D FLL  V
Sbjct  359   LKADVAALESFSSRAFGLLSIAGVSGFCQVSIPLGLHENLPVSVALVAKSGSDGFLLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>gb|ABR18072.1| unknown [Picea sitchensis]
Length=274

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 201/272 (74%), Gaps = 0/272 (0%)
 Frame = +2

Query  1187  NHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPT  1366
             NH++WI+ VKP L P I+A++   LE  +  I  C   ++E R AL+ LLKDD IL IPT
Sbjct  2     NHEEWINSVKPDLGPGISARVRAALETNNENIGHCLKAKDEAREALNALLKDDAILFIPT  61

Query  1367  VIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGD  1546
                P PK   K+    D+  RA    S+A +SG CQ SIP+G HDKCP++VS +AR+GGD
Sbjct  62    TPGPAPKLNMKQNLLDDFHIRAFTLLSIAGMSGCCQVSIPVGQHDKCPLAVSLMARHGGD  121

Query  1547  RFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFKEKQWQRAIGFY  1726
             RFLLD V+A++  LQE+ +IA  ++ + +   K  +A+IAK KGN A+K+KQWQ+AI FY
Sbjct  122   RFLLDTVRAMYPTLQEEVKIASSTQPTTSVNGKIEAADIAKEKGNAAYKDKQWQKAINFY  181

Query  1727  TEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYFRRGTAREMLGY  1906
             +EAIKL G +ATY+SNRAAAYLELGSF QAE DCT AI+LDKKNVKA+ RRGTAREMLGY
Sbjct  182   SEAIKLNGKNATYYSNRAAAYLELGSFAQAEEDCTAAIDLDKKNVKAHLRRGTAREMLGY  241

Query  1907  YNQAIEDFRYALVLEPTNKRAAQSAERLAKLF  2002
             Y +AIEDF+YALVLEPTNK A  +A RL KLF
Sbjct  242   YKEAIEDFQYALVLEPTNKAANLAANRLRKLF  273



>ref|XP_007042953.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
3, partial [Theobroma cacao]
 gb|EOX98784.1| Translocon at the outer membrane of chloroplasts 64-V isoform 
3, partial [Theobroma cacao]
Length=479

 Score =   334 bits (856),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 255/368 (69%), Gaps = 2/368 (1%)
 Frame = +2

Query  305   MTRKLKKAVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNP  484
             M RK     + D GAF+ER +L+P PQPPPP A  PL+GL+FA+ D+F ++G+VTGFGNP
Sbjct  107   MRRKAIIIKREDFGAFLERFELIPFPQPPPPAAKLPLSGLTFAIKDIFDVKGYVTGFGNP  166

Query  485   DWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpg  664
             DW +THEPA +T+ VVTAL++ GA CV KT++D++AFG++G NKHY  PTNP   S +PG
Sbjct  167   DWRRTHEPADKTAVVVTALLKNGAKCVGKTVMDELAFGVTGENKHYGTPTNPNMESNVPG  226

Query  665   gpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDV  844
             G SSG+AVAVAA LVDF+LG DT G VR+PA +CGILGF PS GAVS +G++P SQSLD 
Sbjct  227   GSSSGSAVAVAAELVDFALGTDTIGCVRIPASFCGILGFRPSHGAVSTIGLLPNSQSLDA  286

Query  845   VGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQ  1024
             +GWF RDP +L  VGHVLLQ+     R  R +V A+DLFQ   +P  +T  VV KAIEK 
Sbjct  287   IGWFARDPSILHCVGHVLLQLKAVEPRRARRLVFADDLFQLSKVPKQKTVYVVSKAIEKL  346

Query  1025  FGRQMIRHENLDAYLSNKVPSLKSF--KKLNGEAKLSTTRLLGHVVQTLKRHEFKRNHDD  1198
              G Q  +H N   Y+++ VPSLK F  +  + +  +S  + L  V+ +L+R+EFK NH++
Sbjct  347   SGYQPPKHINFAQYVASNVPSLKGFCQQSTHLQNGISILKALSSVMVSLQRYEFKTNHEE  406

Query  1199  WIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDP  1378
             W+ DVKP L   I+  +   +      +   + VR EMR+A+  LLKDDGILVIPT+ D 
Sbjct  407   WVKDVKPRLGAEISNHVLASINTTYGNVKNLYKVRTEMRAAVQSLLKDDGILVIPTIADA  466

Query  1379  PPKAGAKE  1402
             P K  +K+
Sbjct  467   PLKLNSKK  474



>ref|XP_010458167.1| PREDICTED: amidase 1-like [Camelina sativa]
Length=425

 Score =   330 bits (845),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 261/423 (62%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P      +      L+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDYGAFIEKLTISPTPPSLFSPSLQS---LTFAIKDIFDVEGHVTGFGNPDWLRTHS  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT +  TI+D+MA  I+G N HY  P NP +S RLPGG SSG+A
Sbjct  59    AATSTAPAVSSLLEAGATALGFTIMDEMACSINGDNVHYGTPRNPIASDRLPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AVS  G+ P++QSLD VGWF R+
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVSTAGVTPLAQSLDTVGWFARE  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI-  1042
                L+RVG VLL+ P      P  ++IA+D F+  +I  D   Q ++ A+E  FG +++ 
Sbjct  179   TATLKRVGSVLLEQPHLKCIEPDQLIIADDCFKLCSISRDLLVQPLVGAVENSFGGKIVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKK---LNGEAKLSTTRLLGHVVQTLKR--HEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F     +  + + S   L+      L    HEFK NH  W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSDDVTTQQEFSIPSLMALSSSMLLSVMHEFKTNHSAWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P ++A +   +  +D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPQLSALMEVAIRTSDEKIDHCRSVKSELKTALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
               A       + S+A    S+A +SG CQ SIPLG H+  P+SVS VA++G D FLL  V
Sbjct  359   LKADVAALESFSSKAFSLLSIAGVSGFCQVSIPLGLHENLPVSVSLVAKSGSDGFLLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>ref|XP_006307599.1| hypothetical protein CARUB_v10009223mg [Capsella rubella]
 gb|EOA40497.1| hypothetical protein CARUB_v10009223mg [Capsella rubella]
Length=425

 Score =   329 bits (843),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 259/423 (61%), Gaps = 9/423 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A   D GAF+E+L + P P    P +     GL+FA+ D+F +EG VTGFGNPDW +TH 
Sbjct  2     ATDNDFGAFIEKLTISPTPPASFPPSLQ---GLTFAIKDIFDVEGRVTGFGNPDWLRTHP  58

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              AT T+  V++L+EAGAT +  TI+D+MA+ I+G N HY  P NP +  R+PGG SSG+A
Sbjct  59    AATSTAPAVSSLLEAGATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSA  118

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAVAA LVDFS+G DT G VRVPA YCGI GF PS  AV   G+ P++QS D VGWF RD
Sbjct  119   VAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHNAVFTAGVTPMAQSFDTVGWFARD  178

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFG-RQMI  1042
                L+RVG VLL+ P      P  ++IA+D F+  ++P D   Q ++ ++EK FG   ++
Sbjct  179   TATLKRVGCVLLEQPHLNCIEPDQLIIADDCFKLSSVPRDMLVQPLVGSVEKSFGGNTVV  238

Query  1043  RHENLDAYLSNKVPSLKSFKKLNG-----EAKLSTTRLLGHVVQTLKRHEFKRNHDDWID  1207
             +  NL  Y+   VPSLK F   +      E  + +   L + +  L  HE K NH  W+ 
Sbjct  239   KKVNLGEYIEENVPSLKHFMTSDDDTTQQEFSIPSLMALSNSMILLLMHELKINHSAWVS  298

Query  1208  DVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPK  1387
              VKP   P I+  + E +  +D +ID C +V++E+++ALS LL + G+LVIPTV  PPP 
Sbjct  299   SVKPEFGPGISEGIEEAIRTSDEKIDLCRSVKSELKTALSTLLGEKGVLVIPTVPGPPPH  358

Query  1388  AGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAV  1567
                       + SRA    S+A +SG CQ SIPLG HD  P+SVS V + G D F+L  V
Sbjct  359   LKGDVAALESFRSRAFNLLSIAGVSGFCQVSIPLGLHDNLPVSVSLVGKYGSDGFVLSLV  418

Query  1568  QAL  1576
              +L
Sbjct  419   DSL  421



>ref|XP_006433293.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
 gb|ESR46533.1| hypothetical protein CICLE_v10001239mg [Citrus clementina]
Length=408

 Score =   328 bits (840),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 192/404 (48%), Positives = 254/404 (63%), Gaps = 8/404 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P             +GL+FA+ D+F ++G VTGFGNPDWA+TH  AT
Sbjct  6     SDYGAFMEKFVLQPSSSAHQLPL----SGLTFAIKDIFDVDGHVTGFGNPDWARTHSAAT  61

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V A++  GAT + KTI+D+MA+ I+G NKHY  PTNP +  R+PGG SSG+AVAV
Sbjct  62    STAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPWAPDRVPGGSSSGSAVAV  121

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS GAVS  G+IP++QS D VGWF  DP +
Sbjct  122   GAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTAGVIPMAQSFDTVGWFAWDPKI  181

Query  875   LRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             L RVG VLLQ+P  A    P  ++ A D  Q  +IP+DR +Q ++K++EK FG Q++ + 
Sbjct  182   LNRVGRVLLQLPDDASLVRPSQVIFAEDCLQLSSIPSDRITQGLVKSVEKLFGGQIVENV  241

Query  1052  NLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              L  Y+ +KVPSL+ F  + N E + S   L  L      L R+EFK NH DW+  VKP 
Sbjct  242   ILGDYVKDKVPSLQHFIGEGNREQEYSIPSLAALSSARGLLLRYEFKNNHGDWVTTVKPD  301

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+  + E +  +   ID C +V+ E+R+ALS LL D GILVIPTV  PPPK     
Sbjct  302   LGPGISEHVWEAVRTSAENIDVCQSVKTELRAALSALLGDYGILVIPTVPGPPPKLQMDP  361

Query  1403  TQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVAR  1534
             +    + ++A    S+A +SG CQ S   GF++K  +   F  R
Sbjct  362   SALEVFHAQAFSLLSIAVVSGFCQVSFFFGFYNKILLIYFFPLR  405



>ref|XP_002461034.1| hypothetical protein SORBIDRAFT_02g039510 [Sorghum bicolor]
 gb|EER97555.1| hypothetical protein SORBIDRAFT_02g039510 [Sorghum bicolor]
Length=437

 Score =   327 bits (837),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 267/439 (61%), Gaps = 8/439 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+  D GAF+E+ +LLPP             GL+FA+ D+F I G VTGFGNPDWA+TH 
Sbjct  2     AMGGDYGAFMEKFELLPPQSQQHLPLH----GLTFAIKDIFDISGRVTGFGNPDWARTHA  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
             PA  TS VV A + AGA  + KT++D+MA+ I+G N HY  PTNP +  R+PGG SSG+A
Sbjct  58    PAGATSPVVLATLAAGAISIGKTVMDEMAYSINGENAHYGTPTNPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             VAV A LVDF+LG DT G VRVPA YCGI G  PS G VS   +IP+SQ  D VGWF RD
Sbjct  118   VAVGAKLVDFALGTDTGGSVRVPAAYCGIFGLRPSHGLVSTENVIPMSQMFDTVGWFARD  177

Query  866   PDVLRRVGHVLLQVPF-TAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMI  1042
                L RV +VLL +P     + P +  I  D F+ L    D+T Q++  ++ K+FG   +
Sbjct  178   LSTLSRVSNVLLPLPADNTIKRPTHFKIPKDCFEILGSLNDQTYQILNASVAKRFGNDAV  237

Query  1043  RHENLDAYLSNKVPSLKSFKK--LNGEA-KLSTTRLLGHVVQTLKRHEFKRNHDDWIDDV  1213
              + NL  ++S+ VP++  F       EA  +    ++ +V++ L+R EFK NH +W++ V
Sbjct  238   DNRNLGEFVSSNVPTVGKFISDFSRSEAPSVPALSVISYVMRCLQRSEFKANHAEWVNTV  297

Query  1214  KPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG  1393
             +P L P I  +++E +   D  ++  H ++ E + ALS L+KDDGILVIPTV   PPK  
Sbjct  298   RPNLGPGIRERVYEAIASEDGPMEDFHVLKTEFKLALSALIKDDGILVIPTVPGSPPKLR  357

Query  1394  AKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQA  1573
              +     ++ +RA    S+A LSG CQ SIPLG     P+SVS VA +G DRFLL   Q 
Sbjct  358   MEAVALENFRARAFSLLSIAGLSGFCQLSIPLGVRGGVPVSVSLVACHGADRFLLSVAQE  417

Query  1574  LFAPLQEQAEIAVQSKSSN  1630
             L+  L+E+ +    S  S+
Sbjct  418   LYETLKEETKKGWSSPDSS  436



>gb|KDO59507.1| hypothetical protein CISIN_1g0442941mg, partial [Citrus sinensis]
Length=385

 Score =   320 bits (820),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 184/384 (48%), Positives = 246/384 (64%), Gaps = 8/384 (2%)
 Frame = +2

Query  335   ADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPAT  514
             +D GAF+E+  L P             +GL+FA+ D+F ++G VTGFGNPDWA+TH  AT
Sbjct  6     SDYGAFMEKFVLQPSSSAHQLPL----SGLTFAIKDIFDVDGHVTGFGNPDWARTHSAAT  61

Query  515   QTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavav  694
              T+  V A++  GAT + KTI+D+MA+ I+G NKHY  PTNP +  R+PGG SSG+AVAV
Sbjct  62    STAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSAVAV  121

Query  695   aaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDV  874
              A LVDFSLG DT G VRVPA YCGI GF PS  AVS  G+IP++QS D VGWF  DP +
Sbjct  122   GAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHSAVSTAGVIPMAQSFDTVGWFAWDPKI  181

Query  875   LRRVGHVLLQVPFTAQR-NPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
             L RVG VLLQ+        P  ++ A D  Q  +IP+DR +Q ++K++EK FG  +I + 
Sbjct  182   LNRVGRVLLQLADDVNLVRPSQVIFAEDCLQLSSIPSDRVTQGLVKSVEKLFGGHIIENV  241

Query  1052  NLDAYLSNKVPSLKSF-KKLNGEAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
              L  Y+ +KVPSL+ F  + N E + S   L  L   ++ L+R+EFK NH DW+  VKP 
Sbjct  242   ILGDYVKDKVPSLQHFLSEGNKEQEYSIPSLAALSSAMRLLQRYEFKNNHGDWVTTVKPD  301

Query  1223  LDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKE  1402
             L P I+ ++ E +  +  +ID C +V+ E+R+ALS LL D GILVIPTV  PPPK     
Sbjct  302   LGPGISERVWEAVRTSAQKIDVCQSVKTELRAALSALLGDHGILVIPTVPGPPPKLQMDP  361

Query  1403  TQSIDYVSRACLFASLASLSGGCQ  1474
             +    + +RA    S+A +SG CQ
Sbjct  362   SALEVFRARAFSLLSIAGVSGFCQ  385



>ref|XP_006606510.1| PREDICTED: amidase 1-like isoform X2 [Glycine max]
Length=387

 Score =   319 bits (817),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 232/355 (65%), Gaps = 4/355 (1%)
 Frame = +2

Query  422   LSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGI  601
             L+FAV ++F +EG+VTGFGNPDWA+TH  AT T+  V AL+ AGATCV KT++D+MA+ I
Sbjct  29    LTFAVKEIFDVEGYVTGFGNPDWARTHTVATSTAPTVLALLRAGATCVGKTVMDEMAYSI  88

Query  602   SGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGF  781
             +G N HY  P NP +  R+PGG SSG+AVAV A LVDFSLG DT G VRVPA YCGI GF
Sbjct  89    NGENIHYGTPRNPCAPDRVPGGSSSGSAVAVGAELVDFSLGTDTGGSVRVPASYCGIFGF  148

Query  782   HPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQR-NPRNIVIANDL  958
              PS GA+S  G+IP+SQS D VGWF RDP +L RVG V+LQ+P  A    P  I+IA D 
Sbjct  149   RPSHGAISESGVIPMSQSFDTVGWFARDPMILSRVGGVILQLPDVAPPIRPTCIIIAEDC  208

Query  959   FQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSF-KKLNGEAKLSTT  1135
             FQ  + P D  +  VI+A+EK +G  +++HE L  Y+   VPSLK F  K N +   S  
Sbjct  209   FQLSSTPFDVVTGTVIQAVEKLYGGDVLKHEILGDYVKTNVPSLKHFMSKENTDQIYSIP  268

Query  1136  RL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNE  1309
              L  L   ++ L+R+EFK NH +WI  VKP L P I+ ++ + L      ID C++++ E
Sbjct  269   SLAALSSAMRLLQRYEFKNNHGEWISAVKPDLGPGISERVSDALRTTGENIDICYSIKKE  328

Query  1310  MRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQ  1474
             +  AL+ LL D G L+IPTV  PPPK     +    + +RA    S+A +SG CQ
Sbjct  329   LHDALAALLGDFGALMIPTVPGPPPKLQTNTSDLEIFRARAFSLLSIAGVSGFCQ  383



>ref|NP_001052054.2| Os04g0117800 [Oryza sativa Japonica Group]
 emb|CAH66004.1| H0613H07.2 [Oryza sativa Indica Group]
 gb|EAY92844.1| hypothetical protein OsI_14645 [Oryza sativa Indica Group]
 gb|EAZ29515.1| hypothetical protein OsJ_13589 [Oryza sativa Japonica Group]
 dbj|BAH01616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF13968.2| Os04g0117800 [Oryza sativa Japonica Group]
Length=434

 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 205/433 (47%), Positives = 268/433 (62%), Gaps = 8/433 (2%)
 Frame = +2

Query  338   DSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQ  517
             D GAF+ER  L PPP P   + P    GL+FA+ D+F I G VTGFGNPDWA+TH PA  
Sbjct  4     DFGAFMERFVLPPPPPPSSQQLPLH--GLTFAIKDIFDIAGRVTGFGNPDWARTHAPAAA  61

Query  518   TSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaavava  697
             TS VV A + AGAT +  TI+D+MA+ I G N HY  P NP +  R+PGG SSG+AVAVA
Sbjct  62    TSPVVLAALAAGATSLGTTIMDEMAYSIYGENAHYGTPANPCAPGRVPGGSSSGSAVAVA  121

Query  698   aNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVL  877
             ANLVDFSLG DT G VRVPA YCGI G   S G VS   +IP++Q  D VGWF RD   L
Sbjct  122   ANLVDFSLGTDTGGSVRVPAAYCGIFGLRTSHGLVSAQNVIPMAQMFDTVGWFARDLSTL  181

Query  878   RRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENL  1057
              RV  VLL +P    ++P ++ I  D FQ L  P D T Q+V  ++ K+FG   I + NL
Sbjct  182   SRVTKVLLPLPDDTVKHPTHVTIPMDCFQILGSPDDHTYQIVNASVAKKFGSHAIDNANL  241

Query  1058  DAYLSNKVPSLKSFKKLNGEAKLSTT---RLLGHVVQTLKRHEFKRNHDDWIDDVKPTLD  1228
               ++S+ VPS+  F     E++L +     ++ HV+ +L R +FK NH +W++ VKP L 
Sbjct  242   GDFVSDNVPSIGKFIADFSESELPSVPALSVISHVMFSLLRSQFKANHAEWVNSVKPNLG  301

Query  1229  PIITAQLHEGLEVADTE-IDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAG--AK  1399
             P +   +H  +   D E +++  AVR E +SAL+ LLKD GIL IPTV  PPP  G  A+
Sbjct  302   PGLRENIHGAVASGDDEPLEEFLAVRAEFKSALAALLKDHGILAIPTVPGPPPMVGIQAQ  361

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                  +Y +RA     +A +SG CQ SIPLG  +  P+SVS VAR+G D FLL+  + L+
Sbjct  362   AAPLDNYQARAFSLLDIAVVSGFCQVSIPLGKRNGLPVSVSLVARHGADHFLLNVAEELY  421

Query  1580  APLQEQAEIAVQS  1618
               L ++A  A  S
Sbjct  422   QTLIDEAAKAWAS  434



>ref|XP_008246490.1| PREDICTED: amidase 1 isoform X2 [Prunus mume]
Length=385

 Score =   317 bits (811),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/386 (45%), Positives = 242/386 (63%), Gaps = 7/386 (2%)
 Frame = +2

Query  326   AVKADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHE  505
             A+ ++ GAF+E+  L P             +GL+FAV D+F + G+VTGFGNPDWA+TH 
Sbjct  2     AIGSNYGAFMEKFVLQPHSSSHDLPL----SGLTFAVKDIFDVAGYVTGFGNPDWARTHP  57

Query  506   PATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaa  685
              +  T+  V+A++  GATC  KT++D+MA+ I+G NKHY  P NP +  R+PGG SSG+A
Sbjct  58    ASESTAPAVSAILRGGATCNGKTVMDEMAYSINGENKHYGTPINPCAPDRVPGGSSSGSA  117

Query  686   vavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRD  865
             V V  +L DFSLG DT G VRVPA YCGI GF PS G +S  G+IP++QS D VGWF R+
Sbjct  118   VVVGGDLADFSLGTDTGGSVRVPASYCGIFGFRPSHGVISTSGVIPMAQSFDTVGWFARN  177

Query  866   PDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIR  1045
             P +L R G VLLQ+   +   P  ++IA+D FQ  +IP++R  QV++ ++EK FG  +I+
Sbjct  178   PAILNRAGRVLLQLSDMSPVGPTQLIIADDCFQLSSIPSNRVKQVLVDSVEKLFGGHVIK  237

Query  1046  HENLDAYLSNKVPSLKSF-KKLNG--EAKLSTTRLLGHVVQTLKRHEFKRNHDDWIDDVK  1216
             H NL   + +KVPSL  F  K N   E  + +   L   ++ L+R+EFK NH +W+  V+
Sbjct  238   HANLGDVVKDKVPSLNCFLDKGNAGQEYNIPSLVALSSAMRLLQRYEFKNNHGEWVSTVR  297

Query  1217  PTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGA  1396
             P L P I  ++ E +   D  +  C +V+ E+R AL+DLL D G+L IPTV   PPK   
Sbjct  298   PDLGPGIAERVWEAVRTTDENVYVCQSVKTELRVALTDLLGDFGVLAIPTVPGAPPKLQT  357

Query  1397  KETQSIDYVSRACLFASLASLSGGCQ  1474
               T    + +RA    S+A +SG CQ
Sbjct  358   DPTTLETFRARAFSLLSIAGVSGFCQ  383



>gb|EEE60408.1| hypothetical protein OsJ_13590 [Oryza sativa Japonica Group]
Length=416

 Score =   317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 257/427 (60%), Gaps = 28/427 (7%)
 Frame = +2

Query  332   KADSGAFVERlqllpppqppppkaphplTGLSFAVSDVFHIEGFVTGFGNPDWAKTHEPA  511
             + D GAF+ER  L PPP    P       GL+FA+ D+F I G VTGFGNPDWA+TH PA
Sbjct  8     RGDYGAFMERFVLPPPPSQQLPLH-----GLTFAIKDIFDIAGRVTGFGNPDWARTHAPA  62

Query  512   TQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKHYDAPTNpasssrlpggpssgaava  691
               TS VV A                    I+G N HY  PTNP +  R+PGG SSG+AVA
Sbjct  63    AATSPVVLA-------------------AINGENTHYGTPTNPCAPGRVPGGSSSGSAVA  103

Query  692   vaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPD  871
             VAANLVDFSLG DT G VRVPA YCGI G  PS G VS   +IP++Q  D VGWF+RD  
Sbjct  104   VAANLVDFSLGTDTGGSVRVPAAYCGIFGLRPSHGLVSAENVIPMAQMFDTVGWFSRDLS  163

Query  872   VLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHE  1051
              L RV  VLL +P    + P  + I  D FQ L    DRT Q++  ++ K+F  Q++ + 
Sbjct  164   TLSRVTKVLLPLPDDIVKQPTQVTIPMDCFQILGSLDDRTYQIINASVAKRFDSQILDNR  223

Query  1052  NLDAYLSNKVPSLKSFKKLNGEAKLSTT---RLLGHVVQTLKRHEFKRNHDDWIDDVKPT  1222
             NL  ++S+ VPS+  F     E++L +     ++ HV++ L+R +FK NH +W++ VKP 
Sbjct  224   NLGDFISDNVPSIGKFITDFSESELPSVPALSVISHVMRGLQRSQFKANHAEWVNTVKPN  283

Query  1223  LDPIITAQLHEGLEVADTE-IDKCHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAK  1399
             L P +  ++ E +   D E ++   A+R E +SAL+ LLKD GIL IPTV  PPPK G +
Sbjct  284   LGPGLRERILEAIASGDNESLEDFQAIRAEFKSALAALLKDHGILAIPTVPGPPPKVGME  343

Query  1400  ETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALF  1579
                  ++ +RA    S+A LSG CQ SIPLG  +  P+SVS VAR+G D FLL+ V+ L+
Sbjct  344   AAPLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLPVSVSLVARHGADHFLLNVVEELY  403

Query  1580  APLQEQA  1600
               L ++A
Sbjct  404   QTLIDEA  410



>gb|KCW85157.1| hypothetical protein EUGRSUZ_B01996 [Eucalyptus grandis]
 gb|KCW85158.1| hypothetical protein EUGRSUZ_B01996 [Eucalyptus grandis]
Length=351

 Score =   315 bits (806),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 236/351 (67%), Gaps = 5/351 (1%)
 Frame = +2

Query  578   VDDMAFGISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPA  757
             +D+MA+ ++G NKHY  P NP +   +PGG SSG+AVAV A LVDFSLG DT G VRVPA
Sbjct  1     MDEMAYSLTGDNKHYGTPRNPCAPDYVPGGSSSGSAVAVGAMLVDFSLGSDTGGSVRVPA  60

Query  758   GYCGILGFHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRN  937
               CGILGF PS  A+S +G+IP++QSLD VGWF R+P +L++VG VLL++P      P  
Sbjct  61    SNCGILGFRPSHNAISTVGVIPMAQSLDTVGWFAREPSILKQVGRVLLELPEADPNRPSQ  120

Query  938   IVIANDLFQSLNIPTDRTSQVVIKAIEKQFGRQMIRHENLDAYLSNKVPSLKSFK-KLNG  1114
             I+I  D FQ LNIP++R +Q +++++EK FG  +I+H  L  Y+ + VP+L SF  ++N 
Sbjct  121   IIIPTDCFQLLNIPSERLTQALVRSVEKLFGGAIIKHAVLGDYIRDSVPALSSFLCQINE  180

Query  1115  EAKLSTTRL--LGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDK  1288
             +   S   L  L    Q L+R+EFK +H+DW+  VKP LDPII+ ++ + LE+ +  ID 
Sbjct  181   DQVDSIPSLAALSSARQLLQRYEFKNHHEDWVSAVKPDLDPIISERVRQALELTEENIDI  240

Query  1289  CHAVRNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDY-VSRACLFASLASLSG  1465
             C +V+ E+ SAL+ LL D G+L IPTV  PPPK    +  S+D  V +A    S+A LS 
Sbjct  241   CWSVKKELHSALTSLLGDFGVLAIPTVPGPPPKL-QTDASSLDVSVEKAFNLLSIAGLSE  299

Query  1466  GCQASIPLGFHDKCPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQS  1618
              CQ SIP+G HD  PIS+S +A+NG D FLLD V+ L+  LQEQA I  +S
Sbjct  300   FCQVSIPMGLHDNLPISISLLAKNGADGFLLDLVETLYESLQEQAAIVEKS  350



>ref|XP_010312345.1| PREDICTED: amidase 1 [Solanum lycopersicum]
Length=429

 Score =   317 bits (812),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 252/392 (64%), Gaps = 7/392 (2%)
 Frame = +2

Query  419   GLSFAVSDVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFG  598
             GL+FAV D+F +EG +TGFGNPDW KTH  A  T+  V +L+++GATC+  T++D+MA+ 
Sbjct  33    GLTFAVKDIFDLEGQITGFGNPDWGKTHSAAICTAPTVLSLLKSGATCIGITVMDEMAYS  92

Query  599   ISGANKHYDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILG  778
             I+G N HY  P NP +  R+PGG SSG+AVAV A +VDF+LG DT G VRVPA YCGI G
Sbjct  93    INGENFHYGTPVNPVAPDRVPGGSSSGSAVAVGAKIVDFALGTDTGGSVRVPASYCGIYG  152

Query  779   FHPSFGAVSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDL  958
               PS G VS  G+IP++QS D VGWF  +  +L++VG VLLQ    + +     ++A D 
Sbjct  153   IRPSHGVVSVDGVIPMAQSFDTVGWFATNACILKQVGRVLLQSDHES-KGLTKFIVAEDC  211

Query  959   FQSLNIPTDR-TSQVVIKAIEKQFGR-QMIRHENLDAYLSNKVPSLKSFKKLNGEAK---  1123
             F+ L+  ++R T  +++ ++ + +G  QMI + ++  Y+   VPSLK F  +   +    
Sbjct  212   FKLLDSKSNRQTIGILVDSVRELYGSDQMIEYVSIGDYIEKNVPSLKKFMTIETCSNNNI  271

Query  1124  LSTTRLLGHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVA-DTEIDKCHAV  1300
              S+ R L   ++ L+++EFK NH +W+ +VKP+L P I  ++ E L    D +ID C  V
Sbjct  272   PSSLRALSAAMRLLQKYEFKENHGEWVSEVKPSLGPGIAERVQEALRTTKDEDIDVCQTV  331

Query  1301  RNEMRSALSDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQAS  1480
             + E+R +LS LL D GIL IPTV  PPPK   + T    + ++A    S+A +SG CQ S
Sbjct  332   KTELRVSLSGLLGDCGILAIPTVPGPPPKLKTETTTLEGFRAKAFSLLSIAGVSGFCQVS  391

Query  1481  IPLGFHDKCPISVSFVARNGGDRFLLDAVQAL  1576
             IPLG  D  PISVS +A +G D FLL+ V+A+
Sbjct  392   IPLGIQDNLPISVSLLANHGSDWFLLNVVEAI  423



>ref|XP_006853167.1| hypothetical protein AMTR_s00038p00191060 [Amborella trichopoda]
 gb|ERN14634.1| hypothetical protein AMTR_s00038p00191060 [Amborella trichopoda]
Length=285

 Score =   311 bits (796),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 198/281 (70%), Gaps = 0/281 (0%)
 Frame = +2

Query  1154  VQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSALSDL  1333
             ++ L R+EFK NH+DW   VKP+L   I+A++   L   +  +  C+ VR +MR+A+S+L
Sbjct  1     MRLLHRYEFKTNHEDWFKSVKPSLSSNISARVLAALNTTNENVKTCYTVRTQMRAAMSNL  60

Query  1334  LKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDKCPI  1513
             LK+DGILVIPT  DPP    +K T   +  +RA +  S+A +SG CQA+IPLG HD CPI
Sbjct  61    LKEDGILVIPTTPDPPLMLKSKRTSCDELENRAFILLSIAGMSGCCQATIPLGKHDGCPI  120

Query  1514  SVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQAFK  1693
             S+SF+A  GGDRFLL  +  L++ LQ+ A I    +  +++     +AE+ K KGN AFK
Sbjct  121   SLSFIASYGGDRFLLGTLLDLYSSLQKHASIISDMQPLSDSEGDMETAELFKEKGNAAFK  180

Query  1694  EKQWQRAIGFYTEAIKLYGNSATYFSNRAAAYLELGSFVQAEADCTKAIELDKKNVKAYF  1873
              KQW +A+ FYTEAIK+ G SAT++SNRAAAYLELG F QAEADC +AI LDKKNVKAY 
Sbjct  181   RKQWNKAVNFYTEAIKINGESATFYSNRAAAYLELGCFQQAEADCNQAILLDKKNVKAYL  240

Query  1874  RRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAK  1996
             RRGTARE L  Y +A +DFR+ALVLEP NK A Q+ +RL K
Sbjct  241   RRGTARENLLSYKEAAQDFRHALVLEPQNKAALQAEKRLKK  281



>gb|EMS46388.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Triticum urartu]
Length=528

 Score =   318 bits (816),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 208/529 (39%), Positives = 296/529 (56%), Gaps = 73/529 (14%)
 Frame = +2

Query  440   DVFHIEGFVTGFGNPDWAKTHEPATQTSTVVTALVEAGATCVAKTIVDDMAFGISGANKH  619
             D F IEG+V GFGNPDW +TH+ A+ T+  V AL++ GATCV +T++D++ FG++G N H
Sbjct  23    DSFEIEGYVAGFGNPDWKRTHKAASHTAAAVKALLKQGATCVGRTVMDELGFGVTGENLH  82

Query  620   YDAPTNpasssrlpggpssgaavavaaNLVDFSLGIDTDGGVRVPAGYCGILGFHPSFGA  799
                P NPAS S +PGG  SG+AVAV+A LV+F+LG                         
Sbjct  83    CGTPINPASPSVVPGGSCSGSAVAVSAQLVEFALG-------------------------  117

Query  800   VSHMGIIPVSQSLDVVGWFTRDPDVLRRVGHVLLQVPFTAQRNPRNIVIANDLFQSLNIP  979
                              W  RDP +L RVG  LL       R  R +V A+D F+ L IP
Sbjct  118   -----------------WLARDPHILSRVGDALLPAAACGLRGKRQLVFADDCFELLKIP  160

Query  980   TDRTSQVVIKAIEK-QFGRQMIRHENLDAYLSNKVPSLKSF----KKLNGEAKLSTTRLL  1144
               +T  V+  A+    +G Q  +H N+  Y+ + VPSLK F     KL  E K S  + L
Sbjct  161   NQKTVDVIENAVRTLPYGFQPPKHINIGQYICSNVPSLKEFCEPSTKLQ-EGK-SALKAL  218

Query  1145  GHVVQTLKRHEFKRNHDDWIDDVKPTLDPIITAQLHEGLEVADTEIDKCHAVRNEMRSAL  1324
               V+  L+R+EFK NH+DW++ VKP L   ++ ++ + +   D  I   + VR E R+AL
Sbjct  219   CTVMLLLQRYEFKANHEDWVNTVKPKLGLEVSTRVLQAVNFTDDNIKSLYIVRTEWRAAL  278

Query  1325  SDLLKDDGILVIPTVIDPPPKAGAKETQSIDYVSRACLFASLASLSGGCQASIPLGFHDK  1504
              +LLKD GILV+PT+   P K  +K+  S ++  +   F S+A+LSG CQA++PLG H+ 
Sbjct  279   KNLLKDTGILVLPTMAGHPLKRNSKQRLSSEFEDKMYAFVSIAALSGCCQATVPLGNHND  338

Query  1505  CPISVSFVARNGGDRFLLDAVQALFAPLQEQAEIAVQSKSSNNAISKEASAEIAKGKGNQ  1684
              PIS+SFVA +G D+FLL A+  +++ +QEQ  +A     S  A+      ++     ++
Sbjct  339   HPISISFVAAHGSDKFLLRAILDMYSAVQEQIVLA-----SKLALPPVIDRDV---DTSE  390

Query  1685  AFKEKQWQRAIGFYTEAIK---LYGNSATYFSNRAAAYLELGS--FVQAEADCTKAIELD  1849
               KEK       F+ +      L GN+     +      +LG   F QAEADC +A+ LD
Sbjct  391   LLKEK-------FFVDNDTLPFLVGNNQVLCGSSG----KLGQPVFKQAEADCDQALLLD  439

Query  1850  KKNVKAYFRRGTAREMLGYYNQAIEDFRYALVLEPTNKRAAQSAERLAK  1996
             KKNVKAY RRGTA+E +  Y +A++DFR+AL LEP NK A  + +RL K
Sbjct  440   KKNVKAYLRRGTAKESVLNYQEALQDFRHALALEPQNKTALAAEKRLQK  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8061681400880