BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21985_g1_i3 len=1708 path=[2054:0-676 3776:677-753 2731:754-967
178:968-1049 448:1050-1707]

Length=1708
                                                                      Score     E

emb|CDP12056.1|  unnamed protein product                                306   8e-150   
ref|XP_004245577.1|  PREDICTED: phosphoglycerate mutase-like prot...    293   5e-145   
ref|XP_006343946.1|  PREDICTED: uncharacterized protein LOC102588114    289   8e-144   
ref|XP_009800801.1|  PREDICTED: uncharacterized protein LOC104246...    295   1e-143   
ref|XP_009628160.1|  PREDICTED: uncharacterized protein LOC104118...    295   2e-143   
gb|EYU40074.1|  hypothetical protein MIMGU_mgv1a009658mg                290   3e-140   
emb|CBI34372.3|  unnamed protein product                                269   4e-135   
ref|XP_011073097.1|  PREDICTED: phosphoglycerate mutase-like prot...    268   1e-134   
ref|XP_002273245.1|  PREDICTED: phosphoglycerate mutase-like prot...    268   1e-134   Vitis vinifera
ref|XP_011073106.1|  PREDICTED: phosphoglycerate mutase-like prot...    269   8e-132   
ref|XP_011022634.1|  PREDICTED: phosphoglycerate mutase-like prot...    276   8e-131   
ref|XP_002304514.2|  hypothetical protein POPTR_0003s13110g             275   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010255254.1|  PREDICTED: phosphoglycerate mutase-like prot...    268   9e-129   
ref|XP_008238968.1|  PREDICTED: uncharacterized protein LOC103337582    269   2e-127   
ref|XP_007040320.1|  Phosphoglycerate mutase family protein             264   1e-126   
ref|XP_009341342.1|  PREDICTED: uncharacterized protein LOC103933380    261   3e-125   
gb|KDP25400.1|  hypothetical protein JCGZ_20556                         254   1e-122   
ref|XP_009628161.1|  PREDICTED: uncharacterized protein LOC104118...    293   2e-122   
ref|XP_004300809.1|  PREDICTED: uncharacterized protein LOC101314857    259   2e-122   
ref|XP_009800802.1|  PREDICTED: uncharacterized protein LOC104246...    295   6e-122   
ref|XP_009363412.1|  PREDICTED: uncharacterized protein LOC103953403    240   1e-119   
ref|XP_004300810.1|  PREDICTED: LOW QUALITY PROTEIN: broad-range ...    248   5e-119   
gb|KHN25687.1|  Putative phosphoglycerate mutase DET1                   256   1e-118   
ref|XP_003517475.1|  PREDICTED: broad-range acid phosphatase DET1...    256   2e-118   
gb|KGN50072.1|  hypothetical protein Csa_5G152870                       244   2e-118   
ref|XP_008796901.1|  PREDICTED: broad-range acid phosphatase DET1...    249   5e-118   
ref|XP_011073114.1|  PREDICTED: phosphoglycerate mutase-like prot...    268   9e-118   
ref|XP_008437314.1|  PREDICTED: uncharacterized protein LOC103482772    243   2e-117   
ref|XP_009385740.1|  PREDICTED: broad-range acid phosphatase DET1...    249   8e-117   
ref|XP_010089066.1|  hypothetical protein L484_024239                   232   8e-117   
ref|XP_010934931.1|  PREDICTED: phosphoglycerate mutase-like prot...    247   2e-116   
ref|XP_006829094.1|  hypothetical protein AMTR_s00001p00262580          238   4e-116   
ref|XP_010055680.1|  PREDICTED: uncharacterized protein LOC104443835    251   5e-115   
ref|XP_003611071.1|  6-phosphofructo-2-kinase/fructose-2,6-biphos...    246   1e-113   
ref|XP_007158518.1|  hypothetical protein PHAVU_002G158900g             236   2e-113   
gb|AFK43634.1|  unknown                                                 241   1e-112   
ref|XP_006476517.1|  PREDICTED: uncharacterized protein LOC102620270    229   1e-110   
ref|XP_003538692.2|  PREDICTED: broad-range acid phosphatase DET1...    227   3e-110   
gb|KDO76300.1|  hypothetical protein CISIN_1g019037mg                   228   6e-110   
ref|XP_002509842.1|  phosphoglycerate mutase, putative                  239   9e-110   Ricinus communis
ref|XP_006439496.1|  hypothetical protein CICLE_v10020727mg             223   2e-108   
ref|XP_008796902.1|  PREDICTED: broad-range acid phosphatase DET1...    248   5e-108   
ref|XP_009385739.1|  PREDICTED: broad-range acid phosphatase DET1...    249   1e-107   
ref|XP_004964301.1|  PREDICTED: broad-range acid phosphatase DET1...    225   5e-107   
ref|XP_009385742.1|  PREDICTED: broad-range acid phosphatase DET1...    250   8e-105   
ref|XP_001754608.1|  predicted protein                                  232   1e-104   
gb|KDO76301.1|  hypothetical protein CISIN_1g019037mg                   228   1e-102   
ref|XP_006590506.1|  PREDICTED: broad-range acid phosphatase DET1...    227   2e-102   
ref|NP_001056573.2|  Os06g0109000                                       201   2e-98    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD67688.1|  hypothetical protein                                   201   2e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EEE64959.1|  hypothetical protein OsJ_19850                          199   7e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002968785.1|  hypothetical protein SELMODRAFT_66964              224   9e-96    
ref|XP_007209559.1|  hypothetical protein PRUPE_ppa010955mg             211   2e-95    
gb|KDO76302.1|  hypothetical protein CISIN_1g019037mg                   227   4e-92    
dbj|BAJ86007.1|  predicted protein                                      190   2e-91    
dbj|BAJ90090.1|  predicted protein                                      190   3e-91    
ref|XP_009800803.1|  PREDICTED: uncharacterized protein LOC104246...    293   7e-91    
ref|XP_009628163.1|  PREDICTED: uncharacterized protein LOC104118...    292   2e-90    
gb|EMT11962.1|  hypothetical protein F775_08310                         189   1e-86    
ref|XP_003561228.1|  PREDICTED: phosphoglycerate mutase-like prot...    174   7e-86    
ref|XP_002966946.1|  hypothetical protein SELMODRAFT_86459              195   3e-79    
ref|XP_002961061.1|  hypothetical protein SELMODRAFT_73590              195   3e-79    
ref|XP_006382636.1|  hypothetical protein POPTR_0005s04020g             180   6e-73    
ref|XP_002512328.1|  phosphoglycerate mutase, putative                  180   6e-73    Ricinus communis
gb|KFK37920.1|  hypothetical protein AALP_AA3G047500                    176   2e-72    
ref|XP_010550965.1|  PREDICTED: phosphoglycerate mutase-like prot...    169   5e-72    
ref|XP_006408105.1|  hypothetical protein EUTSA_v10021179mg             174   2e-71    
dbj|BAF01531.1|  hypothetical protein                                   173   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464036.1|  PREDICTED: phosphoglycerate mutase-like prot...    174   2e-71    
ref|NP_187168.1|  phosphoglycerate mutase family protein                173   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002262723.1|  PREDICTED: phosphoglycerate mutase-like prot...    172   2e-71    Vitis vinifera
ref|XP_002882400.1|  phosphoglycerate/bisphosphoglycerate mutase ...    173   3e-71    
ref|XP_010424476.1|  PREDICTED: phosphoglycerate mutase-like prot...    173   4e-71    
ref|XP_006361882.1|  PREDICTED: broad-range acid phosphatase DET1...    174   5e-71    
ref|XP_007030786.1|  Phosphoglycerate mutase family protein isofo...    177   7e-71    
ref|XP_006298173.1|  hypothetical protein CARUB_v10014223mg             172   7e-71    
ref|XP_009147267.1|  PREDICTED: uncharacterized protein LOC103870846    173   3e-70    
ref|XP_009757980.1|  PREDICTED: broad-range acid phosphatase DET1...    173   5e-70    
ref|XP_003554670.1|  PREDICTED: uncharacterized protein LOC100785272    176   9e-70    
ref|XP_004230163.2|  PREDICTED: phosphoglycerate mutase-like prot...    171   1e-69    
ref|XP_004135635.1|  PREDICTED: uncharacterized protein LOC101211877    173   1e-69    
ref|XP_004495754.1|  PREDICTED: broad-range acid phosphatase DET1...    172   2e-69    
ref|XP_010111865.1|  hypothetical protein L484_020658                   169   2e-69    
gb|KHG03047.1|  Putative phosphoglycerate mutase DET1                   174   2e-69    
ref|XP_004248821.1|  PREDICTED: phosphoglycerate mutase-like prot...    179   2e-69    
emb|CDP17973.1|  unnamed protein product                                172   3e-69    
ref|XP_003591056.1|  hypothetical protein MTR_1g082360                  170   3e-69    
ref|XP_009124067.1|  PREDICTED: uncharacterized protein LOC103848992    169   4e-69    
emb|CDY53231.1|  BnaCnng24640D                                          168   4e-69    
ref|XP_001778688.1|  predicted protein                                  180   4e-69    
emb|CDY18784.1|  BnaAnng02490D                                          168   5e-69    
emb|CDY41943.1|  BnaC05g46610D                                          167   5e-69    
ref|XP_003556497.1|  PREDICTED: broad-range acid phosphatase DET1...    166   7e-69    
gb|KHG00939.1|  Putative phosphoglycerate mutase DET1                   172   8e-69    
emb|CDY27789.1|  BnaA05g31980D                                          168   1e-68    
ref|XP_009613887.1|  PREDICTED: broad-range acid phosphatase DET1...    174   1e-68    
ref|XP_008450693.1|  PREDICTED: broad-range acid phosphatase DET1       172   1e-68    
ref|XP_009772304.1|  PREDICTED: broad-range acid phosphatase DET1...    173   2e-68    
gb|KHN20196.1|  Putative phosphoglycerate mutase DET1                   164   2e-68    
ref|XP_007147082.1|  hypothetical protein PHAVU_006G094900g             171   3e-68    
ref|XP_006433195.1|  hypothetical protein CICLE_v10001975mg             163   4e-68    
dbj|BAO45876.1|  phosphoglycerate mutase                                171   5e-68    
ref|XP_006850858.1|  hypothetical protein AMTR_s00025p00142320          153   1e-67    
ref|XP_006654027.1|  PREDICTED: uncharacterized protein LOC102711804    157   1e-67    
ref|XP_010674997.1|  PREDICTED: phosphoglycerate mutase-like prot...    167   1e-67    
ref|XP_001757629.1|  predicted protein                                  160   2e-67    
ref|XP_011078746.1|  PREDICTED: phosphoglycerate mutase-like prot...    168   2e-67    
ref|XP_009335642.1|  PREDICTED: uncharacterized protein LOC103928334    167   2e-67    
ref|XP_007144765.1|  hypothetical protein PHAVU_007G182800g             167   2e-67    
ref|XP_007205634.1|  hypothetical protein PRUPE_ppa009217mg             165   6e-67    
ref|XP_003626327.1|  hypothetical protein MTR_7g113920                  171   9e-67    
gb|KDP23559.1|  hypothetical protein JCGZ_23392                         162   9e-67    
ref|XP_010025142.1|  PREDICTED: uncharacterized protein LOC104415518    159   9e-67    
gb|EYU21001.1|  hypothetical protein MIMGU_mgv1a011084mg                160   1e-66    
gb|AFK43154.1|  unknown                                                 171   2e-66    
gb|KCW61746.1|  hypothetical protein EUGRSUZ_H04451                     159   2e-66    
ref|XP_008246529.1|  PREDICTED: uncharacterized protein LOC103344690    166   2e-66    
ref|XP_008368646.1|  PREDICTED: uncharacterized protein LOC103432243    163   3e-66    
ref|XP_009373960.1|  PREDICTED: uncharacterized protein LOC103962903    169   1e-65    
ref|XP_007030787.1|  Phosphoglycerate mutase family protein isofo...    159   1e-65    
ref|XP_004302463.1|  PREDICTED: uncharacterized protein LOC101306246    168   2e-65    
ref|XP_004494645.1|  PREDICTED: uncharacterized protein LOC101512622    167   2e-65    
emb|CDX95020.1|  BnaC05g06510D                                          174   2e-65    
emb|CDX93526.1|  BnaA06g05220D                                          173   5e-65    
ref|XP_008388602.1|  PREDICTED: uncharacterized protein LOC103450968    166   8e-65    
gb|KHN43259.1|  Putative phosphoglycerate mutase DET1                   159   8e-65    
gb|KFK43199.1|  hypothetical protein AALP_AA1G093200                    177   1e-64    
gb|EPS66293.1|  hypothetical protein M569_08481                         166   2e-64    
ref|XP_010550016.1|  PREDICTED: phosphoglycerate mutase-like prot...    165   4e-64    
ref|XP_009148152.1|  PREDICTED: uncharacterized protein LOC103871633    168   1e-63    
ref|XP_007206718.1|  hypothetical protein PRUPE_ppa024546mg             151   3e-63    
ref|XP_008218207.1|  PREDICTED: uncharacterized protein LOC103318582    152   4e-63    
ref|XP_010458160.1|  PREDICTED: phosphoglycerate mutase-like prot...    172   1e-62    
ref|XP_006417629.1|  hypothetical protein EUTSA_v10008391mg             171   1e-62    
ref|XP_002889724.1|  phosphoglycerate/bisphosphoglycerate mutase ...    170   2e-62    
ref|XP_010475712.1|  PREDICTED: phosphoglycerate mutase-like prot...    171   3e-62    
ref|XP_006303260.1|  hypothetical protein CARUB_v10009965mg             169   3e-62    
ref|XP_010489549.1|  PREDICTED: phosphoglycerate mutase-like prot...    171   3e-62    
ref|NP_172369.1|  phosphoglycerate mutase-like protein                  172   4e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941733.1|  PREDICTED: phosphoglycerate mutase-like prot...    145   5e-62    
ref|XP_010255255.1|  PREDICTED: phosphoglycerate mutase-like prot...    219   5e-62    
ref|XP_008809146.1|  PREDICTED: uncharacterized protein LOC103720944    143   7e-62    
ref|NP_001150740.1|  glycerolphosphate mutase                           218   8e-62    Zea mays [maize]
gb|AFW86181.1|  glycerolphosphate mutase                                218   2e-61    
ref|XP_010242541.1|  PREDICTED: phosphoglycerate mutase-like prot...    141   6e-61    
ref|XP_006656552.1|  PREDICTED: broad-range acid phosphatase DET1...    203   6e-60    
gb|EAY96505.1|  hypothetical protein OsI_18407                          137   2e-59    Oryza sativa Indica Group [Indian rice]
gb|EEE62282.1|  hypothetical protein OsJ_17070                          137   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010231735.1|  PREDICTED: phosphoglycerate mutase-like prot...    137   3e-59    
ref|XP_002500018.1|  predicted protein                                  138   4e-59    Micromonas commoda
ref|XP_006361884.1|  PREDICTED: uncharacterized protein LOC102590...    136   4e-59    
ref|XP_009412070.1|  PREDICTED: broad-range acid phosphatase DET1...    140   5e-59    
dbj|BAJ85350.1|  predicted protein                                      134   6e-59    
ref|NP_001054606.1|  Os05g0141700                                       135   9e-59    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146798.1|  hypothetical protein                               140   1e-58    Zea mays [maize]
gb|ACL52890.1|  unknown                                                 140   2e-58    Zea mays [maize]
ref|XP_004960443.1|  PREDICTED: uncharacterized protein LOC101777...    138   3e-58    
gb|AFW82672.1|  hypothetical protein ZEAMMB73_958380                    139   6e-58    
ref|XP_006654026.1|  PREDICTED: uncharacterized protein LOC102711346    132   4e-57    
gb|ACF78655.1|  unknown                                                 137   5e-57    Zea mays [maize]
ref|XP_009393256.1|  PREDICTED: uncharacterized protein LOC103978992    142   5e-57    
ref|XP_002439257.1|  hypothetical protein SORBIDRAFT_09g003230          132   2e-56    Sorghum bicolor [broomcorn]
gb|EMT21664.1|  Putative phosphoglycerate mutase DET1                   127   5e-56    
ref|XP_009771138.1|  PREDICTED: broad-range acid phosphatase DET1...    155   1e-55    
ref|XP_006341338.1|  PREDICTED: broad-range acid phosphatase DET1...    157   2e-55    
ref|XP_003057908.1|  predicted protein                                  127   5e-55    
ref|XP_004248834.1|  PREDICTED: phosphoglycerate mutase-like prot...    154   3e-54    
gb|ACJ84275.1|  unknown                                                 170   3e-54    Medicago truncatula
ref|XP_002499391.1|  phosphoglycerate mutase family protein             174   5e-54    Micromonas commoda
ref|XP_003078295.1|  unnamed protein product                            180   1e-53    
ref|XP_003565626.1|  PREDICTED: phosphoglycerate mutase-like prot...    135   2e-53    
ref|XP_003055812.1|  predicted protein                                  170   2e-53    
ref|XP_009604162.1|  PREDICTED: broad-range acid phosphatase DET1...    151   1e-52    
ref|XP_009798734.1|  PREDICTED: broad-range acid phosphatase DET1...    148   2e-52    
ref|XP_007511089.1|  predicted protein                                  171   3e-52    
ref|XP_006361885.1|  PREDICTED: uncharacterized protein LOC102591300    139   1e-50    
ref|XP_006361883.1|  PREDICTED: uncharacterized protein LOC102590...    137   2e-50    
ref|XP_001417008.1|  predicted protein                                  182   4e-50    Ostreococcus lucimarinus CCE9901
ref|XP_002946902.1|  hypothetical protein VOLCADRAFT_86965              158   5e-50    
emb|CEF97227.1|  Phosphoglycerate/bisphosphoglycerate mutase, act...    182   7e-49    
ref|XP_011102210.1|  PREDICTED: phosphoglycerate mutase-like prot...    139   7e-49    
ref|XP_005647575.1|  phosphoglycerate mutase-like protein               167   1e-48    
ref|XP_004230164.1|  PREDICTED: phosphoglycerate mutase-like prot...    136   1e-48    
ref|XP_011101658.1|  PREDICTED: phosphoglycerate mutase-like prot...    136   5e-48    
ref|XP_009792382.1|  PREDICTED: broad-range acid phosphatase DET1...    130   5e-48    
ref|XP_009592808.1|  PREDICTED: broad-range acid phosphatase DET1...    132   7e-48    
ref|XP_011036746.1|  PREDICTED: phosphoglycerate mutase-like prot...    175   8e-48    
gb|KFM25028.1|  Broad-range acid phosphatase DET1                       149   4e-47    
ref|XP_009792383.1|  PREDICTED: broad-range acid phosphatase DET1...    127   1e-46    
ref|XP_009606097.1|  PREDICTED: broad-range acid phosphatase DET1...    172   2e-46    
ref|XP_009592804.1|  PREDICTED: broad-range acid phosphatase DET1...    125   3e-46    
ref|WP_030421247.1|  phosphoglycerate mutase                            154   4e-46    
ref|XP_005847519.1|  hypothetical protein CHLNCDRAFT_134554             150   5e-46    
ref|WP_030342899.1|  phosphoglycerate mutase                            152   7e-46    
ref|WP_029393377.1|  MULTISPECIES: phosphoglycerate mutase              151   7e-46    
ref|WP_030750765.1|  phosphoglycerate mutase                            153   2e-45    
ref|WP_003956106.1|  phosphoglycerate mutase                            147   2e-45    
ref|WP_030947189.1|  phosphoglycerate mutase                            151   2e-45    
ref|WP_030609003.1|  phosphoglycerate mutase                            152   2e-45    
ref|WP_037710795.1|  phosphoglycerate mutase                            152   2e-45    
gb|AJE81830.1|  hypothetical protein SLNWT_1454                         145   3e-45    
ref|WP_030826137.1|  phosphoglycerate mutase                            150   3e-45    
ref|XP_001702950.1|  predicted protein                                  152   4e-45    Chlamydomonas reinhardtii
ref|WP_030796603.1|  phosphoglycerate mutase                            151   4e-45    
ref|WP_040256397.1|  phosphoglycerate mutase                            145   5e-45    
ref|WP_030647607.1|  MULTISPECIES: phosphoglycerate mutase              153   5e-45    
gb|AIS00945.1|  alpha-ribazole phosphatase                              151   6e-45    
ref|WP_033286209.1|  phosphoglycerate mutase                            149   6e-45    
ref|WP_030902585.1|  phosphoglycerate mutase                            150   6e-45    
gb|EDY61370.1|  alpha-ribazole phosphatase                              150   6e-45    Streptomyces sviceus ATCC 29083
ref|WP_030870582.1|  phosphoglycerate mutase                            150   7e-45    
ref|WP_030974094.1|  phosphoglycerate mutase                            149   7e-45    
ref|WP_019061000.1|  phosphoglycerate mutase                            149   1e-44    
ref|WP_020942656.1|  hypothetical protein                               148   1e-44    
ref|WP_023538202.1|  phosphoglycerate mutase                            149   1e-44    
ref|WP_030670372.1|  phosphoglycerate mutase                            149   1e-44    
ref|WP_030785422.1|  phosphoglycerate mutase                            150   1e-44    
ref|WP_030931697.1|  phosphoglycerate mutase                            149   1e-44    
ref|WP_037701328.1|  phosphoglycerate mutase                            148   1e-44    
ref|WP_026179190.1|  phosphoglycerate mutase                            148   1e-44    
ref|WP_024885646.1|  phosphoglycerate mutase                            152   1e-44    
ref|WP_030220830.1|  phosphoglycerate mutase                            150   1e-44    
ref|WP_030778611.1|  phosphoglycerate mutase                            147   1e-44    
ref|WP_039652538.1|  phosphoglycerate mutase                            149   1e-44    
ref|WP_028424398.1|  phosphoglycerate mutase                            148   2e-44    
ref|WP_023546149.1|  phosphoglycerate mutase                            147   2e-44    
ref|WP_030235303.1|  MULTISPECIES: phosphoglycerate mutase              149   2e-44    
ref|WP_005311052.1|  phosphoglycerate mutase                            147   2e-44    
gb|KFG73310.1|  phosphoglycerate mutase                                 148   2e-44    
ref|WP_030038944.1|  phosphoglycerate mutase                            149   2e-44    
ref|WP_028809895.1|  phosphoglycerate mutase                            151   2e-44    
ref|WP_009191060.1|  phosphoglycerate mutase                            147   2e-44    
ref|WP_041131610.1|  phosphoglycerate mutase                            149   2e-44    
ref|WP_006382567.1|  phosphoglycerate mutase family protein             147   2e-44    
ref|WP_030362796.1|  MULTISPECIES: phosphoglycerate mutase              148   2e-44    
ref|WP_014675460.1|  phosphoglycerate mutase                            150   3e-44    
ref|WP_004982581.1|  phosphoglycerate mutase                            149   3e-44    
ref|WP_016432232.1|  hypothetical protein                               150   3e-44    
ref|WP_024489020.1|  phosphoglycerate mutase                            145   3e-44    
ref|WP_028960141.1|  phosphoglycerate mutase                            149   4e-44    
ref|WP_024754940.1|  phosphoglycerate mutase                            148   4e-44    
ref|WP_030605426.1|  phosphoglycerate mutase                            148   4e-44    
ref|WP_016824385.1|  phosphoglycerate mutase                            149   4e-44    
ref|WP_027738606.1|  phosphoglycerate mutase                            145   5e-44    
ref|WP_030326754.1|  phosphoglycerate mutase                            152   5e-44    
ref|WP_030895065.1|  phosphoglycerate mutase                            148   5e-44    
ref|WP_015657410.1|  alpha-ribazole phosphatase                         149   5e-44    
ref|WP_015036668.1|  phosphoglycerate mutase                            150   5e-44    
ref|WP_030548201.1|  phosphoglycerate mutase                            146   6e-44    
ref|WP_026244045.1|  phosphoglycerate mutase                            149   6e-44    
gb|KDO44989.1|  hypothetical protein CISIN_1g046442mg                   165   6e-44    
ref|WP_017949392.1|  MULTISPECIES: phosphoglycerate mutase              147   6e-44    
ref|WP_030859608.1|  phosphoglycerate mutase                            145   6e-44    
ref|WP_006142591.1|  phosphoglycerate mutase                            147   7e-44    
ref|WP_030325338.1|  phosphoglycerate mutase                            150   7e-44    
ref|WP_037886324.1|  phosphoglycerate mutase                            147   7e-44    
ref|WP_030944720.1|  phosphoglycerate mutase                            147   8e-44    
ref|WP_018564685.1|  MULTISPECIES: phosphoglycerate mutase              146   9e-44    
ref|WP_037672114.1|  phosphoglycerate mutase                            146   1e-43    
ref|WP_030301399.1|  phosphoglycerate mutase                            144   1e-43    
ref|WP_030171967.1|  phosphoglycerate mutase                            145   1e-43    
ref|WP_031057332.1|  phosphoglycerate mutase                            149   1e-43    
ref|WP_030687282.1|  phosphoglycerate mutase                            147   1e-43    
ref|WP_030211698.1|  phosphoglycerate mutase                            145   1e-43    
ref|WP_037663228.1|  phosphoglycerate mutase                            147   1e-43    
ref|WP_030260746.1|  phosphoglycerate mutase                            149   1e-43    
ref|WP_030046958.1|  phosphoglycerate mutase                            146   1e-43    
ref|WP_037856777.1|  phosphoglycerate mutase                            145   1e-43    
ref|WP_004924603.1|  phosphoglycerate mutase                            146   1e-43    
ref|WP_030204473.1|  phosphoglycerate mutase                            145   1e-43    
ref|WP_019981898.1|  phosphoglycerate mutase                            144   2e-43    
ref|WP_010358918.1|  phosphoglycerate mutase                            144   2e-43    
ref|WP_030680453.1|  phosphoglycerate mutase                            145   2e-43    
ref|WP_018850380.1|  phosphoglycerate mutase                            142   2e-43    
ref|WP_030563123.1|  phosphoglycerate mutase                            145   2e-43    
ref|WP_016640994.1|  putative Broad-range acid phosphatase DET1         145   2e-43    
ref|WP_030927154.1|  phosphoglycerate mutase                            146   2e-43    
ref|WP_033305201.1|  phosphoglycerate mutase                            144   2e-43    
ref|WP_006130004.1|  MULTISPECIES: hypothetical protein                 147   2e-43    
ref|WP_033277042.1|  MULTISPECIES: phosphoglycerate mutase              147   2e-43    
gb|KEG39664.1|  phosphoglycerate mutase                                 147   2e-43    
ref|WP_030618721.1|  phosphoglycerate mutase                            148   3e-43    
ref|WP_028802307.1|  phosphoglycerate mutase                            145   3e-43    
ref|WP_019359954.1|  MULTISPECIES: phosphoglycerate mutase              145   3e-43    
ref|WP_003973214.1|  MULTISPECIES: phosphoglycerate mutase              144   3e-43    
gb|EMF53205.1|  alpha-ribazole phosphatase                              145   3e-43    
ref|WP_030288195.1|  phosphoglycerate mutase                            144   3e-43    
ref|WP_037732488.1|  phosphoglycerate mutase                            145   3e-43    
ref|WP_016470252.1|  MULTISPECIES: hypothetical protein                 144   3e-43    
ref|WP_028814181.1|  phosphoglycerate mutase                            143   3e-43    
gb|EHN75523.1|  hypothetical protein SMCF_5009                          144   4e-43    
ref|WP_010983895.1|  phosphoglycerate mutase                            145   4e-43    
ref|WP_030495091.1|  phosphoglycerate mutase                            144   4e-43    
ref|WP_028437447.1|  phosphoglycerate mutase                            143   4e-43    
ref|WP_030582728.1|  phosphoglycerate mutase                            147   4e-43    
ref|WP_030845426.1|  phosphoglycerate mutase                            145   4e-43    
ref|WP_030877128.1|  phosphoglycerate mutase                            142   5e-43    
ref|WP_030891598.1|  phosphoglycerate mutase                            142   5e-43    
ref|WP_031035387.1|  MULTISPECIES: phosphoglycerate mutase              145   5e-43    
ref|WP_018535941.1|  phosphoglycerate mutase                            145   5e-43    
gb|KFF97667.1|  phosphoglycerate mutase                                 144   6e-43    
ref|WP_030709621.1|  phosphoglycerate mutase                            139   6e-43    
ref|WP_028806031.1|  phosphoglycerate mutase                            145   6e-43    
ref|WP_037723997.1|  phosphoglycerate mutase                            144   6e-43    
ref|WP_031080700.1|  phosphoglycerate mutase                            141   6e-43    
ref|WP_037798251.1|  phosphoglycerate mutase                            139   7e-43    
ref|WP_018516303.1|  phosphoglycerate mutase                            143   7e-43    
ref|WP_031134809.1|  phosphoglycerate mutase                            144   7e-43    
ref|WP_009298473.1|  phosphoglycerate mutase family protein             144   7e-43    
ref|WP_030154285.1|  phosphoglycerate mutase                            141   8e-43    
ref|WP_040028946.1|  phosphoglycerate mutase                            145   8e-43    
ref|WP_010034874.1|  MULTISPECIES: phosphoglycerate mutase              144   9e-43    
ref|WP_031116911.1|  MULTISPECIES: phosphoglycerate mutase              143   9e-43    
ref|WP_003983947.1|  MULTISPECIES: hypothetical protein                 144   9e-43    
ref|WP_030798848.1|  phosphoglycerate mutase                            143   1e-42    
ref|WP_030766518.1|  phosphoglycerate mutase                            143   1e-42    
ref|WP_031010824.1|  phosphoglycerate mutase                            142   1e-42    
ref|WP_030184418.1|  phosphoglycerate mutase                            141   1e-42    
ref|WP_031107593.1|  phosphoglycerate mutase                            143   1e-42    
ref|WP_030412892.1|  phosphoglycerate mutase                            143   1e-42    
ref|WP_019889968.1|  phosphoglycerate mutase                            144   1e-42    
ref|WP_030571341.1|  phosphoglycerate mutase                            142   1e-42    
ref|WP_030376255.1|  phosphoglycerate mutase                            143   1e-42    
ref|WP_008745259.1|  phosphoglycerate mutase                            138   1e-42    
ref|WP_028432448.1|  phosphoglycerate mutase                            144   2e-42    
ref|WP_033308316.1|  phosphoglycerate mutase                            143   2e-42    
ref|WP_014175907.1|  phosphoglycerate mutase                            144   2e-42    
ref|WP_030754389.1|  phosphoglycerate mutase                            142   2e-42    
ref|WP_007266992.1|  phosphoglycerate mutase                            141   2e-42    
ref|WP_003993449.1|  phosphoglycerate mutase                            143   2e-42    
ref|WP_018538261.1|  phosphoglycerate mutase                            144   2e-42    
ref|WP_003951289.1|  MULTISPECIES: phosphoglycerate mutase              140   2e-42    
ref|WP_008410822.1|  MULTISPECIES: phosphoglycerate mutase              140   2e-42    
ref|WP_030603660.1|  phosphoglycerate mutase                            143   2e-42    
ref|WP_031037795.1|  phosphoglycerate mutase                            142   3e-42    
ref|WP_030679389.1|  phosphoglycerate mutase                            142   3e-42    
gb|KIF06900.1|  phosphoglycerate mutase                                 140   3e-42    
ref|WP_018105333.1|  MULTISPECIES: phosphoglycerate mutase              138   3e-42    
ref|WP_031009169.1|  phosphoglycerate mutase                            142   3e-42    
ref|WP_018962017.1|  phosphoglycerate mutase                            141   4e-42    
gb|EHM23848.1|  hypothetical protein SPW_7755                           140   4e-42    
ref|WP_018551512.1|  phosphoglycerate mutase                            140   4e-42    
ref|WP_030227735.1|  phosphoglycerate mutase                            144   4e-42    
gb|AAO65326.1|  unknown                                                 140   4e-42    
ref|WP_030068883.1|  phosphoglycerate mutase                            142   4e-42    
ref|WP_030402610.1|  MULTISPECIES: phosphoglycerate mutase              140   4e-42    
ref|WP_003965783.1|  phosphoglycerate mutase                            142   5e-42    
ref|WP_017237812.1|  MULTISPECIES: phosphoglycerate mutase              141   5e-42    
ref|WP_030078333.1|  phosphoglycerate mutase                            141   6e-42    
ref|WP_030239586.1|  phosphoglycerate mutase                            139   6e-42    
ref|WP_030803219.1|  phosphoglycerate mutase                            142   7e-42    
ref|WP_006602677.1|  phosphoglycerate mutase                            141   7e-42    
ref|WP_030730238.1|  phosphoglycerate mutase                            141   8e-42    
ref|WP_030020372.1|  phosphoglycerate mutase                            143   8e-42    
ref|WP_030383518.1|  MULTISPECIES: phosphoglycerate mutase              140   8e-42    
ref|WP_032781063.1|  phosphoglycerate mutase                            139   9e-42    
ref|WP_026170220.1|  phosphoglycerate mutase                            140   9e-42    
ref|WP_030716018.1|  phosphoglycerate mutase                            139   1e-41    
ref|WP_030990447.1|  phosphoglycerate mutase                            140   1e-41    
ref|WP_031142345.1|  phosphoglycerate mutase                            139   1e-41    
ref|WP_032789555.1|  phosphoglycerate mutase                            138   1e-41    
ref|WP_037929786.1|  phosphoglycerate mutase                            139   1e-41    
ref|WP_006128066.1|  MULTISPECIES: phosphoglycerate mutase              138   1e-41    
ref|WP_030838130.1|  phosphoglycerate mutase                            139   1e-41    
ref|WP_039821988.1|  phosphoglycerate mutase                            140   1e-41    
gb|KDS89448.1|  phosphoglycerate mutase                                 140   2e-41    
ref|WP_015611912.1|  MULTISPECIES: Phosphoglycerate mutase              140   2e-41    
ref|WP_039632091.1|  phosphoglycerate mutase                            140   2e-41    
ref|WP_032767606.1|  phosphoglycerate mutase                            138   2e-41    
ref|WP_031089326.1|  phosphoglycerate mutase                            136   2e-41    
ref|WP_018520803.1|  MULTISPECIES: phosphoglycerate mutase              137   2e-41    
ref|WP_032794927.1|  phosphoglycerate mutase                            138   2e-41    
ref|WP_030650345.1|  MULTISPECIES: phosphoglycerate mutase              139   2e-41    
ref|WP_030713336.1|  phosphoglycerate mutase                            137   2e-41    
ref|WP_030766031.1|  MULTISPECIES: phosphoglycerate mutase              139   2e-41    
ref|WP_030577153.1|  phosphoglycerate mutase                            138   2e-41    
ref|WP_030581162.1|  phosphoglycerate mutase                            137   2e-41    
ref|WP_030008847.1|  phosphoglycerate mutase                            136   2e-41    
ref|WP_030821283.1|  MULTISPECIES: phosphoglycerate mutase              139   3e-41    
ref|WP_030026997.1|  phosphoglycerate mutase                            138   3e-41    
ref|WP_030350130.1|  phosphoglycerate mutase                            135   3e-41    
ref|WP_029380879.1|  phosphoglycerate mutase                            139   3e-41    
emb|CBJ32671.1|  conserved unknown protein                              141   3e-41    
ref|WP_030119781.1|  MULTISPECIES: phosphoglycerate mutase              136   3e-41    
ref|WP_030884449.1|  phosphoglycerate mutase                            141   4e-41    
ref|WP_016910098.1|  phosphoglycerate mutase                            145   4e-41    
ref|WP_019762221.1|  phosphoglycerate mutase                            137   4e-41    
ref|WP_031146453.1|  phosphoglycerate mutase                            137   4e-41    
ref|WP_030080117.1|  phosphoglycerate mutase                            137   5e-41    
ref|WP_030389422.1|  phosphoglycerate mutase                            138   5e-41    
ref|WP_030633342.1|  phosphoglycerate mutase                            136   5e-41    
ref|WP_030345315.1|  phosphoglycerate mutase                            136   6e-41    
ref|WP_010063458.1|  hypothetical protein                               136   7e-41    
ref|XP_011048937.1|  PREDICTED: phosphoglycerate mutase-like prot...    127   8e-41    
ref|WP_009069043.1|  MULTISPECIES: phosphoglycerate mutase              133   9e-41    
ref|WP_030961937.1|  phosphoglycerate mutase                            136   9e-41    
ref|WP_037830522.1|  phosphoglycerate mutase                            135   9e-41    
ref|WP_015579033.1|  MULTISPECIES: hypothetical protein                 134   1e-40    
gb|AJE42895.1|  phosphoglycerate mutase                                 138   1e-40    
ref|WP_033217435.1|  phosphoglycerate mutase                            136   1e-40    
emb|CDK26423.1|  unnamed protein product                                130   1e-40    
ref|WP_019547286.1|  phosphoglycerate mutase                            143   1e-40    
ref|WP_031125822.1|  phosphoglycerate mutase                            137   1e-40    
ref|XP_002293928.1|  hypothetical protein THAPSDRAFT_17193              140   2e-40    
ref|WP_031513028.1|  phosphoglycerate mutase                            134   2e-40    
ref|WP_016575346.1|  phosphoglycerate mutase                            139   2e-40    
ref|WP_028419071.1|  phosphoglycerate mutase                            135   2e-40    
ref|WP_018488316.1|  phosphoglycerate mutase                            135   2e-40    
ref|WP_030802274.1|  phosphoglycerate mutase                            137   2e-40    
ref|WP_019435123.1|  phosphoglycerate mutase                            136   2e-40    
emb|CCH44288.1|  hypothetical protein BN7_3850                          131   2e-40    
ref|WP_028428098.1|  phosphoglycerate mutase                            138   2e-40    
ref|XP_002677469.1|  predicted protein                                  139   3e-40    
gb|KIF67516.1|  phosphoglycerate mutase                                 138   3e-40    
ref|WP_030368658.1|  phosphoglycerate mutase                            133   4e-40    
ref|WP_033267364.1|  phosphoglycerate mutase                            135   5e-40    
ref|XP_009037269.1|  hypothetical protein AURANDRAFT_13634              154   8e-40    
ref|XP_505302.2|  YALI0F11781p                                          132   8e-40    
ref|WP_033173979.1|  phosphoglycerate mutase                            134   9e-40    
gb|EFL22758.1|  LOW QUALITY PROTEIN: putative phosphoglycerate mu...    143   2e-39    
ref|WP_026163079.1|  phosphoglycerate mutase                            129   6e-39    
ref|WP_026251517.1|  phosphoglycerate mutase                            130   7e-39    
ref|WP_030198834.1|  phosphoglycerate mutase                            130   1e-38    
emb|CDR47631.1|  CYFA0S35e00364g1_1                                     130   1e-38    
ref|XP_005849319.1|  hypothetical protein CHLNCDRAFT_12448              138   2e-38    
ref|WP_012920739.1|  phosphoglycerate mutase                            130   5e-38    
ref|WP_020142156.1|  hypothetical protein                               128   6e-38    
ref|WP_030745350.1|  phosphoglycerate mutase                            148   1e-37    
emb|CBH17207.1|  glycerolphosphate mutase, putative                     130   3e-37    
ref|XP_828374.1|  glycerolphosphate mutase                              129   3e-37    
ref|WP_026553974.1|  phosphoglycerate mutase                            125   4e-37    
ref|WP_037958226.1|  phosphoglycerate mutase                            147   5e-37    
ref|WP_028441191.1|  MULTISPECIES: phosphoglycerate mutase              147   5e-37    
ref|WP_030623891.1|  MULTISPECIES: phosphoglycerate mutase              147   6e-37    
ref|XP_005824704.1|  hypothetical protein GUITHDRAFT_158572             134   6e-37    
ref|WP_026248839.1|  phosphoglycerate mutase                            146   1e-36    
gb|KHL01176.1|  phosphoglycerate mutase                                 122   1e-36    
ref|XP_007841738.1|  hypothetical protein PFICI_14966                   134   1e-36    
gb|KEQ89927.1|  phosphoglycerate mutase-like protein                    127   1e-36    
ref|WP_030259119.1|  phosphoglycerate mutase                            123   1e-36    
emb|CBI34342.3|  unnamed protein product                                127   1e-36    
ref|WP_034090265.1|  phosphoglycerate mutase                            126   2e-36    
ref|WP_030842733.1|  phosphoglycerate mutase                            145   3e-36    
ref|XP_460654.2|  DEHA2F06776p                                          122   4e-36    
ref|WP_037930352.1|  phosphoglycerate mutase                            144   4e-36    
ref|WP_031183523.1|  phosphoglycerate mutase                            144   4e-36    
emb|CDR06001.1|  Phosphoglycerate mutase                                144   4e-36    
gb|ACK99521.1|  conserved hypothetical protein                          122   5e-36    
ref|XP_010941731.1|  PREDICTED: uncharacterized protein LOC105059...    146   5e-36    
gb|KEQ99755.1|  hypothetical protein AUEXF2481DRAFT_35688               125   6e-36    
gb|KES07720.1|  phosphoglycerate mutase                                 144   7e-36    
ref|WP_014055374.1|  phosphoglycerate mutase                            143   9e-36    
ref|XP_010485946.1|  PREDICTED: phosphoglycerate mutase-like prot...    125   9e-36    
ref|WP_014048747.1|  MULTISPECIES: phosphoglycerate mutase              143   1e-35    
ref|XP_007672024.1|  hypothetical protein BAUCODRAFT_46450              125   1e-35    
gb|ESQ00563.1|  hypothetical protein B591_05879                         117   1e-35    
ref|XP_005823921.1|  hypothetical protein GUITHDRAFT_89880              148   1e-35    
ref|XP_003350852.1|  hypothetical protein SMAC_02521                    126   1e-35    
ref|XP_009852221.1|  hypothetical protein NEUTE1DRAFT_123127            125   1e-35    
ref|XP_956629.1|  hypothetical protein NCU01845                         125   2e-35    
ref|XP_005788277.1|  hypothetical protein EMIHUDRAFT_467332             131   2e-35    
gb|KIN03682.1|  hypothetical protein OIDMADRAFT_158425                  128   2e-35    
ref|XP_002493190.1|  Protein of unknown function                        118   2e-35    
ref|WP_037941998.1|  phosphoglycerate mutase                            117   4e-35    
ref|WP_020121870.1|  phosphoglycerate mutase                            117   5e-35    
ref|XP_004199232.1|  Piso0_002651                                       120   7e-35    
ref|WP_004949067.1|  phosphoglycerate mutase                            140   7e-35    
gb|KEQ70091.1|  phosphoglycerate mutase-like protein                    122   8e-35    
ref|WP_011691175.1|  histidine phosphatase                              120   1e-34    
ref|WP_037901621.1|  phosphoglycerate mutase                            115   1e-34    
ref|XP_004200085.1|  Piso0_002651                                       119   1e-34    
gb|ACG39006.1|  hypothetical protein                                    138   2e-34    
gb|ACC43945.1|  phosphoglycerate-bisphosphoglycerate mutase famil...    141   3e-34    
ref|NP_001141103.1|  uncharacterized protein LOC100273186               139   4e-34    
ref|WP_037685583.1|  phosphoglycerate mutase                            113   5e-34    
gb|ACC43988.1|  phosphoglycerate-bisphosphoglycerate mutase             140   6e-34    
ref|WP_037745346.1|  phosphoglycerate mutase                            115   6e-34    
gb|ACF85400.1|  unknown                                                 137   7e-34    
gb|EJK46459.1|  hypothetical protein THAOC_34875                        139   1e-33    
gb|ELS56994.1|  hypothetical protein STVIR_2008                         113   1e-33    
ref|WP_037827234.1|  phosphoglycerate mutase                            107   2e-33    
ref|XP_003387731.1|  PREDICTED: putative phosphoglycerate mutase ...    121   2e-33    
gb|EWC46853.1|  hypothetical protein DRE_03865                          110   3e-33    
gb|ESL07684.1|  glycerolphosphate mutase                                137   4e-33    
ref|WP_033525147.1|  phosphoglycerate mutase                            110   4e-33    
ref|WP_037640771.1|  phosphoglycerate mutase                            110   5e-33    
ref|WP_033249411.1|  MULTISPECIES: phosphoglycerate mutase              135   7e-33    
ref|XP_002461742.1|  hypothetical protein SORBIDRAFT_02g007292          132   8e-33    
ref|WP_020114124.1|  phosphoglycerate mutase                            110   8e-33    
ref|WP_014153656.1|  MULTISPECIES: phosphoglycerate mutase              135   8e-33    
gb|EYU43454.1|  hypothetical protein MIMGU_mgv1a024624mg                135   1e-32    
ref|WP_033318882.1|  phosphoglycerate mutase                            112   1e-32    
ref|WP_037700887.1|  phosphoglycerate mutase                            109   1e-32    
ref|WP_020867988.1|  phosphoglycerate mutase                            108   1e-32    
ref|XP_812116.1|  glycerolphosphate mutase                              135   3e-32    
ref|XP_807292.1|  glycerolphosphate mutase                              135   4e-32    
gb|EKF31924.1|  glycerolphosphate mutase, putative                      135   4e-32    
gb|EPJ37251.1|  putative Broad-range acid phosphatase DET1              108   4e-32    
ref|WP_013000261.1|  phosphoglycerate mutase                            108   5e-32    
emb|CCC94875.1|  putative glycerolphosphate mutase                      135   5e-32    



>emb|CDP12056.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   306 bits (785),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 168/187 (90%), Gaps = 6/187 (3%)
 Frame = +1

Query  133  SPTSVRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVK-PPRPRRIILVRHGQSQG  300
            S + +RCCDD  TAR+NI+P + NG   FPEK L  NPA  K PPRPRRIILVRHGQS+G
Sbjct  28   SNSIIRCCDD--TARLNIRPHEDNGSASFPEKNLLLNPAAFKKPPRPRRIILVRHGQSEG  85

Query  301  NVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETL  480
            NVDE+VYTRVADPKVG+TEQGVAEAEE GR+IR+MIE+D AEDWKVYFYVSPYRRGLETL
Sbjct  86   NVDEAVYTRVADPKVGLTEQGVAEAEERGRKIRKMIEEDGAEDWKVYFYVSPYRRGLETL  145

Query  481  RNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAAD  660
            RNLAKAFERSRIAGVREEPRLREQDFGNFQ+ EQMKIEKA+R RYGRFFYRFPNGESAAD
Sbjct  146  RNLAKAFERSRIAGVREEPRLREQDFGNFQNEEQMKIEKAIRARYGRFFYRFPNGESAAD  205

Query  661  VYDRITG  681
            VYDRITG
Sbjct  206  VYDRITG  212


 Score =   253 bits (647),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPG+QSPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGLHN G
Sbjct  210   ITGFRETLRTDIDIGRFQPPGKQSPNMNLVLVSHGLTLRVFLMRWYKWTVEQFEGLHNFG  269

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERGYGGRYSLL+HH+KEEL KFGLT++MLIDQEWQ IAKPGELNYDCLITGPS
Sbjct  270   NGKMVVMERGYGGRYSLLVHHSKEELKKFGLTEEMLIDQEWQTIAKPGELNYDCLITGPS  329

Query  1110  YFTHFDDDNK  1139
             YFTHFDDD++
Sbjct  330   YFTHFDDDSR  339



>ref|XP_004245577.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Solanum 
lycopersicum]
Length=341

 Score =   293 bits (749),  Expect(2) = 5e-145, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 174/210 (83%), Gaps = 5/210 (2%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDD---DATARVNIKPPDYNGFPEK-ILKHN  234
            M+ LFS + PPS +    +   + +++RCC +   D  +         NGFPEK +++H 
Sbjct  1    MSNLFSKIYPPSITINHQKLQQNSSTIRCCSNSNHDEHSSTEHNGWILNGFPEKNLVQHQ  60

Query  235  PATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEK  414
               VKPPRP+RIILVRHG+S+GNVDESVYTRVADPKVG+TE+GV EAEECGR++REMIEK
Sbjct  61   HGIVKPPRPKRIILVRHGESEGNVDESVYTRVADPKVGLTEKGVIEAEECGRKMREMIEK  120

Query  415  DEA-EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            ++  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQDREQMKI
Sbjct  121  NDGNDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDREQMKI  180

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRITG  681
            EKAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  181  EKAVRARYGRFFYRFPNGESAADVYDRITG  210


 Score =   251 bits (642),  Expect(2) = 5e-145, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRFEPPG+QSPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGLHN+ 
Sbjct  208   ITGFRETLRSDIDIGRFEPPGQQSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLHNMT  267

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L MHHTKEEL KFG+TD+MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  268   NGGMIVMERGYGGRYCLSMHHTKEELQKFGMTDEMLIDQEWQKIAKPGELNYDCLITGPS  327

Query  1110  YFTHFDDDNK  1139
             YFTHFDD++K
Sbjct  328   YFTHFDDEDK  337



>ref|XP_006343946.1| PREDICTED: uncharacterized protein LOC102588114 [Solanum tuberosum]
Length=340

 Score =   289 bits (739),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 171/209 (82%), Gaps = 4/209 (2%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCC---DDDATARVNIKPPDYNGFPEK-ILKHN  234
            M+ LFS + PPS +    +   + +++RCC   ++D  +           FPEK +++H 
Sbjct  1    MSNLFSKIYPPSITINHQKLQQNSSTIRCCSNSNNDEHSSTEHNGWVLGSFPEKNLVQHQ  60

Query  235  PATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEK  414
               +KPPRP+RIILVRHG+S+GNVDESVYTRVADPKVG+TE+GV EAE CGR++REMIEK
Sbjct  61   HGIIKPPRPKRIILVRHGESEGNVDESVYTRVADPKVGLTEKGVIEAEGCGRKMREMIEK  120

Query  415  DEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
            +  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQDREQMKIE
Sbjct  121  NGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDREQMKIE  180

Query  595  KAVRERYGRFFYRFPNGESAADVYDRITG  681
            KAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  181  KAVRARYGRFFYRFPNGESAADVYDRITG  209


 Score =   251 bits (641),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRFEPPG+QSPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGLHN+ 
Sbjct  207   ITGFRETLRSDIDIGRFEPPGQQSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLHNMT  266

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L MHHTKEEL KFG+TD+MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  267   NGGMIVMERGYGGRYCLSMHHTKEELQKFGMTDEMLIDQEWQKIAKPGELNYDCLITGPS  326

Query  1110  YFTHFDDDNK  1139
             YFTHFDD++K
Sbjct  327   YFTHFDDEDK  336



>ref|XP_009800801.1| PREDICTED: uncharacterized protein LOC104246640 isoform X1 [Nicotiana 
sylvestris]
Length=341

 Score =   295 bits (754),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 8/211 (4%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTS-VRCCDDDATARVNIKPPDYNG----FPEK-ILK  228
            M+ LFS + P S   V  +KP+  +S +RCC+D+ + +V  K  + NG    FPEK ++ 
Sbjct  1    MSNLFSKIYPTSFG-VNHQKPHPKSSAIRCCNDEYS-KVQHKSTELNGWVSSFPEKNLVL  58

Query  229  HNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI  408
              P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADPKVG+TE+GV EAEECGR++RE+I
Sbjct  59   SYPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPKVGLTEKGVEEAEECGRKMREII  118

Query  409  EKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
            EK+  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMK
Sbjct  119  EKNGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMK  178

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            IEKAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  179  IEKAVRARYGRFFYRFPNGESAADVYDRITG  209


 Score =   245 bits (625),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPG+QSPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGLHN+ 
Sbjct  207   ITGFRETLRSDIDIGRFQPPGQQSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLHNMS  266

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQK AKPGELNYDCLITGPS
Sbjct  267   NGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKTAKPGELNYDCLITGPS  326

Query  1110  YFTHFDDDNK  1139
             YFTHFDD+ +
Sbjct  327   YFTHFDDEEE  336



>ref|XP_009628160.1| PREDICTED: uncharacterized protein LOC104118593 isoform X1 [Nicotiana 
tomentosiformis]
Length=341

 Score =   295 bits (754),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 173/210 (82%), Gaps = 6/210 (3%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPDYNG----FPEK-ILKH  231
            M+ LFS + P S      +   + +++RCC+D+ +  V  K  + NG    FPEK ++  
Sbjct  1    MSNLFSKIYPTSFGVNHQKLHPNSSTIRCCNDEYSG-VQHKSTELNGWVSSFPEKNLVLS  59

Query  232  NPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE  411
             P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADP VG+TE+GV EAEECGR++REMIE
Sbjct  60   YPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPNVGLTEKGVEEAEECGRKMREMIE  119

Query  412  KDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            KD  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMKI
Sbjct  120  KDGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMKI  179

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRITG  681
            EKAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  180  EKAVRARYGRFFYRFPNGESAADVYDRITG  209


 Score =   244 bits (623),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPG+QS NMNL++VSHGLTLRVFLMRWYKWTVEQFEGLHN+ 
Sbjct  207   ITGFRETLRSDIDIGRFQPPGQQSSNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLHNMS  266

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  267   NGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKIAKPGELNYDCLITGPS  326

Query  1110  YFTHFDDD  1133
             YFTHFDDD
Sbjct  327   YFTHFDDD  334



>gb|EYU40074.1| hypothetical protein MIMGU_mgv1a009658mg [Erythranthe guttata]
Length=335

 Score =   290 bits (742),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 164/206 (80%), Gaps = 4/206 (2%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRK-PYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPAT  243
            M  LFSTL    SSP+  RK P +   ++CC + A    N    D NGFPEK L  NP  
Sbjct  1    MATLFSTL---PSSPIQHRKIPCNSCPIKCCHEKANHNHNSPIVDENGFPEKNLLSNPRG  57

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
             KPPRPRRIILVRHGQSQGNVDE VYTRVADPKV +T+QG++EAEECG  IR MIEKD  
Sbjct  58   SKPPRPRRIILVRHGQSQGNVDECVYTRVADPKVMLTQQGISEAEECGEEIRRMIEKDGN  117

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
             DWKVYFYVSPY+R LETLRNLAK FERSRIAGVREEPRLREQDFGNFQD+EQMKI+KA 
Sbjct  118  SDWKVYFYVSPYKRSLETLRNLAKPFERSRIAGVREEPRLREQDFGNFQDQEQMKIQKAA  177

Query  604  RERYGRFFYRFPNGESAADVYDRITG  681
            R+ YGRFFYRFPNGESAADVYDRITG
Sbjct  178  RKLYGRFFYRFPNGESAADVYDRITG  203


 Score =   238 bits (607),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPGEQSP+MNL++VSHGLTLRVFLMRWYKWTV+QFEGLHN G
Sbjct  201   ITGFRETLRSDIDIGRFQPPGEQSPDMNLVIVSHGLTLRVFLMRWYKWTVDQFEGLHNFG  260

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY LLMHHT+EEL KFGLTD ML+DQEWQK AKPGEL YD  ITGPS
Sbjct  261   NGKMLVMERGYGGRYCLLMHHTREELKKFGLTDAMLVDQEWQKYAKPGELYYDSEITGPS  320

Query  1110  YFTHFDDDNKN  1142
             YFTHF+DD ++
Sbjct  321   YFTHFNDDRES  331



>emb|CBI34372.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   269 bits (687),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATA---RVNIKPPD--YNGFPEKILKH  231
            M   + TL P S   V  +K  S  S++CC D       RV  +P D     FPEK    
Sbjct  16   MATFYLTLNPASFLAVSSQKRLSSNSIQCCQDTNGQPRPRVTHEPSDNWLTSFPEKNPII  75

Query  232  NPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE  411
            +  TV PPRPRRIILVRHGQS+GNVDESVYT+V DPK+ +TE+G+A+AEECG+ IR+MIE
Sbjct  76   SSPTVLPPRPRRIILVRHGQSEGNVDESVYTQVPDPKIKLTEKGMAQAEECGKNIRKMIE  135

Query  412  KDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            KD  +DWKVYFYVSPYRR LETLR LA+AF+R RIAG REEPRLREQDFGNFQDRE+M+I
Sbjct  136  KDGVDDWKVYFYVSPYRRTLETLRCLARAFKRRRIAGWREEPRLREQDFGNFQDREKMRI  195

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRITG  681
            EKA R  YGRFFYRFPNGESAADVYDRITG
Sbjct  196  EKATRVLYGRFFYRFPNGESAADVYDRITG  225


 Score =   242 bits (617),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++PNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  223   ITGFRETLRADIDIGRFQPPGERNPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  282

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+GYGGRYSLLMHHT+EEL  FGLT++MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  283   NGDMIVMEKGYGGRYSLLMHHTEEELRNFGLTEEMLIDQEWQKIAKPGELNYDCLITGPS  342

Query  1110  YFTHFDDDN  1136
             +FTHF+D++
Sbjct  343   FFTHFEDED  351



>ref|XP_011073097.1| PREDICTED: phosphoglycerate mutase-like protein AT74H isoform 
X1 [Sesamum indicum]
Length=325

 Score =   268 bits (686),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 162/207 (78%), Gaps = 16/207 (8%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPD--YNGFPEKILKHNPA  240
            M  LFST      SP V R+  SP S +CC +  +      P D    GFPEK    N  
Sbjct  1    MATLFST------SPAVLRR--SPCSTKCCLNHNS------PVDGGLAGFPEKRFASNRP  46

Query  241  TVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE  420
              KPPRPRRIILVRHGQSQGNVDE VYTRVADPKV +TEQGVAEAEECG  IR MIEKD 
Sbjct  47   RAKPPRPRRIILVRHGQSQGNVDECVYTRVADPKVALTEQGVAEAEECGGEIRRMIEKDG  106

Query  421  AEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
             ++WKVYFYVSPYRR LETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD+EQMKI+KA
Sbjct  107  GDEWKVYFYVSPYRRSLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDQEQMKIQKA  166

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             R+RYGRFFYRFPNGESAADVYDRITG
Sbjct  167  ARKRYGRFFYRFPNGESAADVYDRITG  193


 Score =   241 bits (615),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DI+IGRF+PPGEQSP+MNL++VSHGLTLRVFLMRWYKWTV+QFE LHNIG
Sbjct  191   ITGFRETLRSDIEIGRFQPPGEQSPDMNLVIVSHGLTLRVFLMRWYKWTVQQFEALHNIG  250

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERG+GGRYSLL+HHT+EEL +FGLTD ML DQEWQK A+PGELNYDC ITG S
Sbjct  251   NGKMVVMERGHGGRYSLLVHHTREELKEFGLTDAMLTDQEWQKHARPGELNYDCQITGAS  310

Query  1110  YFTHFDDDNKN  1142
             YFTHFDDD +N
Sbjct  311   YFTHFDDDQEN  321



>ref|XP_002273245.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Vitis vinifera]
Length=339

 Score =   268 bits (684),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATA---RVNIKPPD--YNGFPEKILKH  231
            M   + TL P S   V  +K  S  S++CC D       RV  +P D     FPEK    
Sbjct  1    MATFYLTLNPASFLAVSSQKRLSSNSIQCCQDTNGQPRPRVTHEPSDNWLTSFPEKNPII  60

Query  232  NPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE  411
            +  TV PPRPRRIILVRHGQS+GNVDESVYT+V DPK+ +TE+G+A+AEECG+ IR+MIE
Sbjct  61   SSPTVLPPRPRRIILVRHGQSEGNVDESVYTQVPDPKIKLTEKGMAQAEECGKNIRKMIE  120

Query  412  KDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            KD  +DWKVYFYVSPYRR LETLR LA+AF+R RIAG REEPRLREQDFGNFQDRE+M+I
Sbjct  121  KDGVDDWKVYFYVSPYRRTLETLRCLARAFKRRRIAGWREEPRLREQDFGNFQDREKMRI  180

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRITG  681
            EKA R  YGRFFYRFPNGESAADVYDRITG
Sbjct  181  EKATRVLYGRFFYRFPNGESAADVYDRITG  210


 Score =   241 bits (616),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++PNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  208   ITGFRETLRADIDIGRFQPPGERNPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  267

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+GYGGRYSLLMHHT+EEL  FGLT++MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  268   NGDMIVMEKGYGGRYSLLMHHTEEELRNFGLTEEMLIDQEWQKIAKPGELNYDCLITGPS  327

Query  1110  YFTHFDDDN  1136
             +FTHF+D++
Sbjct  328   FFTHFEDED  336



>ref|XP_011073106.1| PREDICTED: phosphoglycerate mutase-like protein AT74H isoform 
X2 [Sesamum indicum]
Length=323

 Score =   269 bits (687),  Expect(2) = 8e-132, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 162/207 (78%), Gaps = 16/207 (8%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPD--YNGFPEKILKHNPA  240
            M  LFST      SP V R+  SP S +CC +  +      P D    GFPEK    N  
Sbjct  1    MATLFST------SPAVLRR--SPCSTKCCLNHNS------PVDGGLAGFPEKRFASNRP  46

Query  241  TVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE  420
              KPPRPRRIILVRHGQSQGNVDE VYTRVADPKV +TEQGVAEAEECG  IR MIEKD 
Sbjct  47   RAKPPRPRRIILVRHGQSQGNVDECVYTRVADPKVALTEQGVAEAEECGGEIRRMIEKDG  106

Query  421  AEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
             ++WKVYFYVSPYRR LETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD+EQMKI+KA
Sbjct  107  GDEWKVYFYVSPYRRSLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDQEQMKIQKA  166

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             R+RYGRFFYRFPNGESAADVYDRITG
Sbjct  167  ARKRYGRFFYRFPNGESAADVYDRITG  193


 Score =   231 bits (590),  Expect(2) = 8e-132, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DI+IGRF+PPGEQSP+MNL++VSHGLTLRVFLMRWYKWTV+QFE LHNIG
Sbjct  191   ITGFRETLRSDIEIGRFQPPGEQSPDMNLVIVSHGLTLRVFLMRWYKWTVQQFEALHNIG  250

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERG+GG  SLL+HHT+EEL +FGLTD ML DQEWQK A+PGELNYDC ITG S
Sbjct  251   NGKMVVMERGHGG--SLLVHHTREELKEFGLTDAMLTDQEWQKHARPGELNYDCQITGAS  308

Query  1110  YFTHFDDDNKN  1142
             YFTHFDDD +N
Sbjct  309   YFTHFDDDQEN  319



>ref|XP_011022634.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Populus 
euphratica]
 ref|XP_011015244.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Populus 
euphratica]
Length=331

 Score =   276 bits (705),  Expect(2) = 8e-131, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQG  300
            RK    + ++CC     + + +       FPEK L+  P+  +PPRPRRIILVRHGQSQG
Sbjct  19   RKLIKSSFIQCCKTQNES-IELSANGKASFPEKSLQKQPSNNRPPRPRRIILVRHGQSQG  77

Query  301  NVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETL  480
            NVDESVYTR+ADPK+ +T +G A+AEECG+RIREMIEKDEA+DWKVYFYVSPY+R  ETL
Sbjct  78   NVDESVYTRIADPKIALTAKGKAQAEECGKRIREMIEKDEADDWKVYFYVSPYKRTRETL  137

Query  481  RNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAAD  660
            +NLA+AFERSRIAG+REEPRLREQDFGNFQDRE+M+ EKA+R  YGRFF+RFPNGESAAD
Sbjct  138  QNLARAFERSRIAGMREEPRLREQDFGNFQDRERMRAEKAIRMLYGRFFFRFPNGESAAD  197

Query  661  VYDRITG  681
            VYDRITG
Sbjct  198  VYDRITG  204


 Score =   221 bits (562),  Expect(2) = 8e-131, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGEQSPNMNL++VSHGLTLRVFLMRWYKWTVEQ+E LHN G
Sbjct  202   ITGFRETLRADIDIGRFQPPGEQSPNMNLVIVSHGLTLRVFLMRWYKWTVEQYEKLHNFG  261

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERG+GGRYSLLMHHT+EEL +FGLTD+ML DQEWQK A+PGELNYD  +   S
Sbjct  262   NGGMVVMERGFGGRYSLLMHHTEEELKEFGLTDEMLKDQEWQKFARPGELNYDFPMMN-S  320

Query  1110  YFTHFDDDNKN  1142
             +FTHF  D++ 
Sbjct  321   FFTHFKHDDRQ  331



>ref|XP_002304514.2| hypothetical protein POPTR_0003s13110g [Populus trichocarpa]
 gb|EEE79493.2| hypothetical protein POPTR_0003s13110g [Populus trichocarpa]
Length=331

 Score =   275 bits (704),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQG  300
            RK    + ++CC     + + +       FPEK L+  P    PPRPRRIILVRHGQSQG
Sbjct  19   RKLIKSSFIQCCKTQNES-IELSTNGKASFPEKSLQKQPLNNLPPRPRRIILVRHGQSQG  77

Query  301  NVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETL  480
            NVDESVYTR+ADPK+ +TE+G A+AEECG+RIREMIEKDEA+DWKVYFYVSPY+R  ETL
Sbjct  78   NVDESVYTRIADPKIALTEKGKAQAEECGKRIREMIEKDEADDWKVYFYVSPYKRTRETL  137

Query  481  RNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAAD  660
            +NLA+AFERSRIAG+REEPRLREQDFGNFQDRE+M+ EKA+R  YGRFF+RFPNGESAAD
Sbjct  138  QNLARAFERSRIAGMREEPRLREQDFGNFQDRERMRAEKAIRMLYGRFFFRFPNGESAAD  197

Query  661  VYDRITG  681
            VYDR+TG
Sbjct  198  VYDRVTG  204


 Score =   220 bits (560),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 5/134 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GFRETLR DIDIGRF+PPGEQSPNMNL++VSHGLTLRVFLMRWYKWTVEQ+E LHN G
Sbjct  202   VTGFRETLRADIDIGRFQPPGEQSPNMNLVIVSHGLTLRVFLMRWYKWTVEQYEKLHNFG  261

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERG+GGRYSLLMHHT+EEL +FGLTD+ML+DQEWQK A+PGELNYD  +   S
Sbjct  262   NGGMVVMERGFGGRYSLLMHHTEEELKEFGLTDEMLMDQEWQKFARPGELNYDFPMMN-S  320

Query  1110  YFTHFDDDNKN*DC  1151
             +FTHF  D    DC
Sbjct  321   FFTHFKHD----DC  330



>ref|XP_010255254.1| PREDICTED: phosphoglycerate mutase-like protein AT74 isoform 
X1 [Nelumbo nucifera]
Length=367

 Score =   268 bits (686),  Expect(2) = 9e-129, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 151/194 (78%), Gaps = 11/194 (6%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDA-------TARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILV  279
            RK +  + + CC+D          A +N       GFPEK     P +  PPRPRRIILV
Sbjct  49   RKLFHSSHIHCCEDTVGRPRKPQLASLN----GLAGFPEKNALLTPTSALPPRPRRIILV  104

Query  280  RHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPY  459
            RHGQS+GNVDES YTRV DPK+G+T++G+ EAE+CG RIREMIEKD A DWKVYFYVSPY
Sbjct  105  RHGQSEGNVDESAYTRVPDPKIGLTKKGMQEAEDCGIRIREMIEKDGAPDWKVYFYVSPY  164

Query  460  RRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFP  639
            +R LETL+ L KAFE SRIAGVREEPRLREQDFGNFQDRE+M++EKA+R  YGRFFYRFP
Sbjct  165  KRTLETLQGLGKAFEPSRIAGVREEPRLREQDFGNFQDREKMRVEKAIRVLYGRFFYRFP  224

Query  640  NGESAADVYDRITG  681
            NGESAADVYDRITG
Sbjct  225  NGESAADVYDRITG  238


 Score =   221 bits (564),  Expect(2) = 9e-129, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPG+++PNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N  
Sbjct  236   ITGFRETLRADIDIGRFQPPGQRNPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFS  295

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VM+ GYGGRYSLL+HHT EEL +FGLTD+ML DQEWQK A+PGELNYD L TG S
Sbjct  296   NGGMIVMQTGYGGRYSLLVHHTPEELREFGLTDEMLTDQEWQKFARPGELNYDILTTGQS  355

Query  1110  YFTHFDDDN  1136
             +FTHFD  N
Sbjct  356   FFTHFDTGN  364



>ref|XP_008238968.1| PREDICTED: uncharacterized protein LOC103337582 [Prunus mume]
Length=356

 Score =   269 bits (687),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 158/190 (83%), Gaps = 10/190 (5%)
 Frame = +1

Query  130  YSPTSVRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVK---PPRPRRIILVRHGQ  291
            +S  +++CC    + R  I+  D NG   FPEK L    AT     PPRPRRIILVRHGQ
Sbjct  35   FSFNTIQCC---TSQREAIEHSD-NGLASFPEKHLHRKSATSTKAPPPRPRRIILVRHGQ  90

Query  292  SQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGL  471
            S+GNVDESVYTRV+DPK+G+TE+G+ +AE+CG+RIREMIEKD+  +WKVYFYVSPYRRG+
Sbjct  91   SEGNVDESVYTRVSDPKIGLTEKGLEDAEQCGKRIREMIEKDKVHNWKVYFYVSPYRRGI  150

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            ETL+ L +AFERSRIAG+REEPRLREQDFGNFQDRE+M++EKA+R  YGRFFYRFPNGES
Sbjct  151  ETLKGLGRAFERSRIAGMREEPRLREQDFGNFQDREKMRVEKAIRMLYGRFFYRFPNGES  210

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  211  AADVYDRITG  220


 Score =   216 bits (551),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++PN+NL++VSHGLTLRVFLMRWYKWTVEQFE L+N G
Sbjct  218   ITGFRETLRADIDIGRFQPPGERNPNINLVIVSHGLTLRVFLMRWYKWTVEQFERLNNFG  277

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG +VVMERGYGGRYSLL+HHT+EEL +FGLTD ML DQEWQK AKPGELNYDC  T  S
Sbjct  278   NGGVVVMERGYGGRYSLLVHHTEEELREFGLTDDMLSDQEWQKYAKPGELNYDC-PTLNS  336

Query  1110  YFTHFDDD  1133
             +F+HFD+D
Sbjct  337   FFSHFDND  344



>ref|XP_007040320.1| Phosphoglycerate mutase family protein [Theobroma cacao]
 gb|EOY24821.1| Phosphoglycerate mutase family protein [Theobroma cacao]
Length=335

 Score =   264 bits (674),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVKPPRPRRIILVRHGQ  291
            RK    + ++C     T +  I+ P  NG   FPEK L     T  PP PRRIILVRHGQ
Sbjct  19   RKLAGLSPIQCL---GTPKEAIRIPSSNGKAMFPEKGLLARAETSSPPTPRRIILVRHGQ  75

Query  292  SQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGL  471
            S+GNVDES YTRVADPK+ +TE+G AEAEECG RIREMIEKD A+DWKVYFYVSPY+R L
Sbjct  76   SEGNVDESAYTRVADPKISLTEKGKAEAEECGWRIREMIEKDGADDWKVYFYVSPYKRTL  135

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            ETL++L +AFERSRIAG+REEPR+REQDFGNFQDRE+M+++KA+R RYGRFFYRFP GES
Sbjct  136  ETLQHLGRAFERSRIAGMREEPRIREQDFGNFQDREKMRVDKALRLRYGRFFYRFPEGES  195

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  196  AADVYDRITG  205


 Score =   219 bits (558),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE+SPNMNLI+VSHGL LRVFLMRWYKWTVEQFE L+N+G
Sbjct  203   ITGFRETLRADIDIGRFQPPGERSPNMNLIIVSHGLALRVFLMRWYKWTVEQFERLNNMG  262

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG+++VME+GYGGRYSLLMHHT+EEL +FGLTD+MLI+QEWQ  A+PGELNYDC +   S
Sbjct  263   NGNIIVMEKGYGGRYSLLMHHTEEELREFGLTDEMLINQEWQNTARPGELNYDCPVVN-S  321

Query  1110  YFTHFDDD  1133
             +FTHF+D+
Sbjct  322   FFTHFEDE  329



>ref|XP_009341342.1| PREDICTED: uncharacterized protein LOC103933380 [Pyrus x bretschneideri]
Length=367

 Score =   261 bits (666),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  CDDDATARVNIKPPDYNGFPEKILKHNPATVK---PPRPRRIILVRHGQSQGNVDESVYT  324
            C       +         FPEK L    AT     PPRPRRIILVRHGQS+GNVDES YT
Sbjct  50   CSASQNGTIEYSDNGLASFPEKHLHRKSATSLKSPPPRPRRIILVRHGQSEGNVDESAYT  109

Query  325  RVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFE  504
            R++DPK+G+TE+G+A+AE+CGRRIREMIE+D+  +WKVYFYVSPYRR ++TL+ L +AFE
Sbjct  110  RISDPKIGLTEKGLADAEQCGRRIREMIERDKVHNWKVYFYVSPYRRTVQTLKGLGRAFE  169

Query  505  RSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            RSRIAG+REEPRLREQDFGNFQDRE+M++EK +R  YGRFFYRFPNGESAADVYDRITG
Sbjct  170  RSRIAGMREEPRLREQDFGNFQDREKMRVEKTIRMLYGRFFYRFPNGESAADVYDRITG  228


 Score =   218 bits (554),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++PN+NL++VSHGLTLRVFLMRWYKWTVEQFE L+N G
Sbjct  226   ITGFRETLRADIDIGRFQPPGERNPNINLVLVSHGLTLRVFLMRWYKWTVEQFERLNNFG  285

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NGSMVVMERGYGGRYSLL+HHT+EEL +FGLTD+ML+DQEWQK AKPGELNYDC +   S
Sbjct  286   NGSMVVMERGYGGRYSLLVHHTEEELRQFGLTDEMLVDQEWQKYAKPGELNYDCPMLN-S  344

Query  1110  YFTHF  1124
             +FTH 
Sbjct  345   FFTHL  349



>gb|KDP25400.1| hypothetical protein JCGZ_20556 [Jatropha curcas]
Length=325

 Score =   254 bits (649),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  250  PPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED  429
            PPRPRRIILVRHG+S+GNVDESVYT+VADPK+ +T++G A+AEECG+RIREMIEKD A D
Sbjct  54   PPRPRRIILVRHGESEGNVDESVYTKVADPKIALTKKGKAQAEECGKRIREMIEKDGASD  113

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVYFYVSPY+R LETL+NLA++FER RIAG+REEPRLREQDFGNFQDRE+M++EKA+R 
Sbjct  114  WKVYFYVSPYKRTLETLQNLARSFERQRIAGLREEPRLREQDFGNFQDRERMRVEKALRI  173

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
             YGRFFYRFPNGESAADVYDRITG
Sbjct  174  LYGRFFYRFPNGESAADVYDRITG  197


 Score =   215 bits (547),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETL+ DIDIGRF+PPGE+SPNMNL++VSHGLTLRVFLMRWYKWTV+Q+EGL N  
Sbjct  195   ITGFRETLKADIDIGRFQPPGERSPNMNLVIVSHGLTLRVFLMRWYKWTVKQYEGLCNFN  254

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG ++VME+GYGGRYSLLMHH +EEL +FGLTD MLIDQ+WQKIA+PGELNYDC  T  S
Sbjct  255   NGGILVMEKGYGGRYSLLMHHKEEELRQFGLTDDMLIDQQWQKIARPGELNYDC-PTMNS  313

Query  1110  YFTHFDDD  1133
             +FTHF+D+
Sbjct  314   FFTHFEDE  321



>ref|XP_009628161.1| PREDICTED: uncharacterized protein LOC104118593 isoform X2 [Nicotiana 
tomentosiformis]
Length=312

 Score =   293 bits (751),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 173/210 (82%), Gaps = 6/210 (3%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPDYNG----FPEK-ILKH  231
            M+ LFS + P S      +   + +++RCC+D+ +  V  K  + NG    FPEK ++  
Sbjct  1    MSNLFSKIYPTSFGVNHQKLHPNSSTIRCCNDEYSG-VQHKSTELNGWVSSFPEKNLVLS  59

Query  232  NPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE  411
             P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADP VG+TE+GV EAEECGR++REMIE
Sbjct  60   YPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPNVGLTEKGVEEAEECGRKMREMIE  119

Query  412  KDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            KD  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMKI
Sbjct  120  KDGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMKI  179

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRITG  681
            EKAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  180  EKAVRARYGRFFYRFPNGESAADVYDRITG  209


 Score =   175 bits (444),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 93/128 (73%), Gaps = 29/128 (23%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PP                             VEQFEGLHN+ 
Sbjct  207   ITGFRETLRSDIDIGRFQPP-----------------------------VEQFEGLHNMS  237

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQKIAKPGELNYDCLITGPS
Sbjct  238   NGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKIAKPGELNYDCLITGPS  297

Query  1110  YFTHFDDD  1133
             YFTHFDDD
Sbjct  298   YFTHFDDD  305



>ref|XP_004300809.1| PREDICTED: uncharacterized protein LOC101314857 [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   259 bits (661),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +1

Query  250  PPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED  429
            PPRPRRIILVRHGQS+GNVDE VYTRV+DPK+G+TE+GVA+AEECGRRIREM+E+D+  +
Sbjct  80   PPRPRRIILVRHGQSEGNVDEGVYTRVSDPKIGLTEKGVADAEECGRRIREMLEEDQVHN  139

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVYFYVSPY+R ++TL+ L KAFERSRIAG+REEPRLREQDFGNFQDRE+M++EKA+R 
Sbjct  140  WKVYFYVSPYKRAVDTLKGLGKAFERSRIAGMREEPRLREQDFGNFQDREKMRVEKAIRM  199

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            RYGRFFYRFPNGESAADVYDRITG
Sbjct  200  RYGRFFYRFPNGESAADVYDRITG  223


 Score =   210 bits (535),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETL++DID+GRF+PPG+++PN+NL++VSHGLTLRVFLMRWYKWTVEQFE L+N  
Sbjct  221   ITGFRETLKSDIDVGRFQPPGQRNPNINLVIVSHGLTLRVFLMRWYKWTVEQFERLNNFS  280

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NGSMVVMERGYGGRYSL +HH +EEL +FGL+D+ML DQEWQK AKPGELNYDC     S
Sbjct  281   NGSMVVMERGYGGRYSLSVHHREEELREFGLSDEMLTDQEWQKYAKPGELNYDCPTIN-S  339

Query  1110  YFTHFDDDN  1136
             +FTHF +D+
Sbjct  340   FFTHFGEDD  348



>ref|XP_009800802.1| PREDICTED: uncharacterized protein LOC104246640 isoform X2 [Nicotiana 
sylvestris]
Length=312

 Score =   295 bits (754),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 8/211 (4%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTS-VRCCDDDATARVNIKPPDYNG----FPEK-ILK  228
            M+ LFS + P S   V  +KP+  +S +RCC+D+ + +V  K  + NG    FPEK ++ 
Sbjct  1    MSNLFSKIYPTSFG-VNHQKPHPKSSAIRCCNDEYS-KVQHKSTELNGWVSSFPEKNLVL  58

Query  229  HNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI  408
              P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADPKVG+TE+GV EAEECGR++RE+I
Sbjct  59   SYPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPKVGLTEKGVEEAEECGRKMREII  118

Query  409  EKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
            EK+  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMK
Sbjct  119  EKNGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMK  178

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            IEKAVR RYGRFFYRFPNGESAADVYDRITG
Sbjct  179  IEKAVRARYGRFFYRFPNGESAADVYDRITG  209


 Score =   172 bits (437),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 93/130 (72%), Gaps = 29/130 (22%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PP                             VEQFEGLHN+ 
Sbjct  207   ITGFRETLRSDIDIGRFQPP-----------------------------VEQFEGLHNMS  237

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQK AKPGELNYDCLITGPS
Sbjct  238   NGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKTAKPGELNYDCLITGPS  297

Query  1110  YFTHFDDDNK  1139
             YFTHFDD+ +
Sbjct  298   YFTHFDDEEE  307



>ref|XP_009363412.1| PREDICTED: uncharacterized protein LOC103953403 [Pyrus x bretschneideri]
Length=367

 Score =   240 bits (613),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFY  447
            IILVRHGQS+GNVDES YTR++DPK+G+TE+G+ EAE+CGRRIREMIE D+A +WKVYFY
Sbjct  91   IILVRHGQSEGNVDESAYTRISDPKIGLTEKGLTEAEDCGRRIREMIEGDKAHNWKVYFY  150

Query  448  VSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFF  627
            VSPYRR +ETL+ L +AFERSRIAG+R EPRLREQDFGNFQDRE+M++EKA+R  YGRFF
Sbjct  151  VSPYRRTVETLKGLGRAFERSRIAGMRVEPRLREQDFGNFQDREKMRVEKAIRMLYGRFF  210

Query  628  YRFPNGESAADVYDRITG  681
            YRFPNGESAADVYDRITG
Sbjct  211  YRFPNGESAADVYDRITG  228


 Score =   219 bits (558),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 4/131 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPGE++PN+NL++VSHGLTLRVFLMRWYKWTVEQFE L+N G
Sbjct  226   ITGFRETLRSDIDIGRFQPPGERNPNINLVLVSHGLTLRVFLMRWYKWTVEQFERLNNFG  285

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG MVVMERGYGGRYSLLMHHT+EEL +FG+TD+ML+DQEWQK AKPGELNYDC +   S
Sbjct  286   NGGMVVMERGYGGRYSLLMHHTEEELRQFGMTDEMLVDQEWQKYAKPGELNYDCPMLN-S  344

Query  1110  YFTHF---DDD  1133
             +FTHF   DDD
Sbjct  345   FFTHFANGDDD  355



>ref|XP_004300810.1| PREDICTED: LOW QUALITY PROTEIN: broad-range acid phosphatase 
DET1-like [Fragaria vesca subsp. vesca]
Length=312

 Score =   248 bits (634),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  250  PPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED  429
            PPRPRRIILVRHGQS+GNVDESVYTRV+DPK+ +TE+G+A+AEECG+RIRE IEKD  ED
Sbjct  43   PPRPRRIILVRHGQSEGNVDESVYTRVSDPKIRLTEKGIADAEECGKRIRETIEKDXVED  102

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVY YVSPYRR +ETL+ L KAFERSRIAG+REEPRLREQDFGNFQDRE+M++EKA+R 
Sbjct  103  WKVYIYVSPYRRTVETLKGLGKAFERSRIAGMREEPRLREQDFGNFQDRERMRVEKAMRM  162

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
             YGRFF+ FPNGESAADVYDRITG
Sbjct  163  LYGRFFFWFPNGESAADVYDRITG  186


 Score =   209 bits (532),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETL++DID+GRF+PPGE++ N+NL++VSHGLTLRVFLMRWYKWTVEQFEG++N G
Sbjct  184   ITGFRETLKSDIDVGRFQPPGERNTNINLVIVSHGLTLRVFLMRWYKWTVEQFEGINNFG  243

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NGSMVVME+GYGGRYSL MHH+ EEL +FG +++M++DQEWQK A+PGELNYDC  T  S
Sbjct  244   NGSMVVMEKGYGGRYSLCMHHSXEELREFGFSNEMIVDQEWQKYARPGELNYDCP-TLNS  302

Query  1110  YFTHFDDDNK  1139
             +FTHF +D++
Sbjct  303   FFTHFGEDDR  312



>gb|KHN25687.1| Putative phosphoglycerate mutase DET1 [Glycine soja]
Length=371

 Score =   256 bits (655),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 155/193 (80%), Gaps = 13/193 (7%)
 Frame = +1

Query  124  KPYSPTS----VRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVKPPRPRRIILVR  282
            KP S T+    ++CC +        +P + NG   FPEK    NPA   PPRPRRIILVR
Sbjct  27   KPNSNTNTCSLIQCCHNQT------EPIELNGQARFPEKNPHINPAAAVPPRPRRIILVR  80

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYR  462
            HG+S+GNVDESVYTR+ DPK+ +TE+G  +AEECG+RI++MIE D  + W+VYFYVSPYR
Sbjct  81   HGESEGNVDESVYTRIPDPKISLTEKGKVQAEECGKRIKQMIENDHDQHWQVYFYVSPYR  140

Query  463  RGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPN  642
            R L+TL++LA+ F+RSRIAG REEPR+REQDFGNFQ+RE+M++EKA+R+RYGRFFYRFP+
Sbjct  141  RTLQTLQHLARPFQRSRIAGFREEPRIREQDFGNFQNREKMRVEKALRQRYGRFFYRFPD  200

Query  643  GESAADVYDRITG  681
            GESAADVYDRITG
Sbjct  201  GESAADVYDRITG  213


 Score =   199 bits (507),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+  +MNL++VSHGLTLRVFLMRWYKWTV+QFE L+N+G
Sbjct  211   ITGFRETLRTDINIGRYQPPGEKKTDMNLVIVSHGLTLRVFLMRWYKWTVQQFESLNNMG  270

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG+M+VME+G+GGRYSLLMHH +EEL +FGLTD+MLIDQEW K AKP +LNYDC +   S
Sbjct  271   NGNMLVMEKGFGGRYSLLMHHGEEELRRFGLTDEMLIDQEWHKFAKPADLNYDCPMVN-S  329

Query  1110  YFTHFDDD  1133
             +F H  ++
Sbjct  330   FFPHLSEE  337



>ref|XP_003517475.1| PREDICTED: broad-range acid phosphatase DET1-like [Glycine max]
Length=342

 Score =   256 bits (653),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 155/193 (80%), Gaps = 13/193 (7%)
 Frame = +1

Query  124  KPYSPTS----VRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVKPPRPRRIILVR  282
            KP S T+    ++CC +        +P + NG   FPEK    NPA   PPRPRRIILVR
Sbjct  27   KPNSNTNTCSLIQCCHNQT------EPIELNGQARFPEKNPHINPAAAVPPRPRRIILVR  80

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYR  462
            HG+S+GNVDESVYTR+ DPK+ +TE+G  +AEECG+RI++MIE D  + W+VYFYVSPYR
Sbjct  81   HGESEGNVDESVYTRIPDPKISLTEKGKVQAEECGKRIKQMIENDHDQHWQVYFYVSPYR  140

Query  463  RGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPN  642
            R L+TL++LA+ F+RSRIAG REEPR+REQDFGNFQ+RE+M++EKA+R+RYGRFFYRFP+
Sbjct  141  RTLQTLQHLARPFQRSRIAGFREEPRIREQDFGNFQNREKMRVEKALRQRYGRFFYRFPD  200

Query  643  GESAADVYDRITG  681
            GESAADVYDRITG
Sbjct  201  GESAADVYDRITG  213


 Score =   199 bits (507),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+  +MNL++VSHGLTLRVFLMRWYKWTV+QFE L+N+G
Sbjct  211   ITGFRETLRTDINIGRYQPPGEKKTDMNLVIVSHGLTLRVFLMRWYKWTVQQFESLNNMG  270

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG+M+VME+G+GGRYSLLMHH +EEL +FGLTD+MLIDQEW K AKP +LNYDC +   S
Sbjct  271   NGNMLVMEKGFGGRYSLLMHHGEEELRRFGLTDEMLIDQEWHKFAKPADLNYDCPMVN-S  329

Query  1110  YFTHFDDD  1133
             +F H  ++
Sbjct  330   FFPHLSEE  337



>gb|KGN50072.1| hypothetical protein Csa_5G152870 [Cucumis sativus]
Length=311

 Score =   244 bits (623),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
            V+PPRPRRIILVRHG+S+GNVDES YTR+ADP++G+TE+G+ EAEECGR I+EMI+ D  
Sbjct  38   VRPPRPRRIILVRHGESEGNVDESAYTRIADPRIGLTEKGMKEAEECGRNIKEMIDGDGV  97

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
            EDW VYFYVSPY+R  +TL++LA +F R RIAG+REEPRLREQDFGNFQDRE+M++EKAV
Sbjct  98   EDWSVYFYVSPYKRTRQTLQHLATSFHRRRIAGMREEPRLREQDFGNFQDREKMRVEKAV  157

Query  604  RERYGRFFYRFPNGESAADVYDRITG  681
            R  YGRFFYRFPNGESAADVYDRITG
Sbjct  158  RMLYGRFFYRFPNGESAADVYDRITG  183


 Score =   211 bits (537),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETL++DID+GRF+PPG+++PNMNL++VSHGLTLRVFLMRWYKWTVEQ+E L+N+G
Sbjct  181   ITGFRETLKSDIDVGRFQPPGQRNPNMNLVLVSHGLTLRVFLMRWYKWTVEQYERLNNLG  240

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+G+GGRY+LL+HHT++EL +FGLTD+MLIDQEWQK AK GELNYDC +   S
Sbjct  241   NGKMIVMEKGFGGRYTLLLHHTEKELRQFGLTDEMLIDQEWQKHAKIGELNYDCAMMN-S  299

Query  1110  YFTHFDDD  1133
             +FTHFDD+
Sbjct  300   FFTHFDDE  307



>ref|XP_008796901.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X1 
[Phoenix dactylifera]
Length=310

 Score =   249 bits (635),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 145/185 (78%), Gaps = 7/185 (4%)
 Frame = +1

Query  127  PYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNV  306
            P S +  RCC+D  ++   + PP    FPE+      A    PRPRRIILVRHG+S+GNV
Sbjct  11   PSSSSRFRCCEDSLSSG-RVAPPSR--FPERA----AAAGTVPRPRRIILVRHGESEGNV  63

Query  307  DESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRN  486
            DESVYTRV DP++G+T +G  EAE CG RIRE++  D A+DWKVYFYVSPYRR LETLR 
Sbjct  64   DESVYTRVPDPRIGLTARGWQEAEACGVRIRELVSGDGADDWKVYFYVSPYRRTLETLRG  123

Query  487  LAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVY  666
            +  AF+ SRIAGVREEPRLREQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVY
Sbjct  124  IGLAFKPSRIAGVREEPRLREQDFGNFQDREKMRIEKDIRLRYGRFFYRFPNGESAADVY  183

Query  667  DRITG  681
            DRITG
Sbjct  184  DRITG  188


 Score =   205 bits (522),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGEQSPNMN+++VSHGLTLRVFLMRWYKWTVEQ+EGLHNI 
Sbjct  186   ITGFRETLRADIDIGRFQPPGEQSPNMNIVIVSHGLTLRVFLMRWYKWTVEQYEGLHNID  245

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VM+ G GGRYSLL+HH+ EEL  FGL++ ML DQ WQK AKPGELNY+ L  GP+
Sbjct  246   NGGMLVMQTGGGGRYSLLVHHSVEELQAFGLSEPMLNDQMWQKTAKPGELNYNFLTNGPA  305

Query  1110  YFTHF  1124
             +F HF
Sbjct  306   FFGHF  310



>ref|XP_011073114.1| PREDICTED: phosphoglycerate mutase-like protein AT74H isoform 
X3 [Sesamum indicum]
Length=290

 Score =   268 bits (686),  Expect(2) = 9e-118, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 162/207 (78%), Gaps = 16/207 (8%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPD--YNGFPEKILKHNPA  240
            M  LFST      SP V R+  SP S +CC +  +      P D    GFPEK    N  
Sbjct  1    MATLFST------SPAVLRR--SPCSTKCCLNHNS------PVDGGLAGFPEKRFASNRP  46

Query  241  TVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE  420
              KPPRPRRIILVRHGQSQGNVDE VYTRVADPKV +TEQGVAEAEECG  IR MIEKD 
Sbjct  47   RAKPPRPRRIILVRHGQSQGNVDECVYTRVADPKVALTEQGVAEAEECGGEIRRMIEKDG  106

Query  421  AEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
             ++WKVYFYVSPYRR LETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD+EQMKI+KA
Sbjct  107  GDEWKVYFYVSPYRRSLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDQEQMKIQKA  166

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             R+RYGRFFYRFPNGESAADVYDRITG
Sbjct  167  ARKRYGRFFYRFPNGESAADVYDRITG  193


 Score =   184 bits (468),  Expect(2) = 9e-118, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DI+IGRF+PPGEQSP+MNL++VSHGLTLRVFLMRWYKWTV+QFE LHNIG
Sbjct  191   ITGFRETLRSDIEIGRFQPPGEQSPDMNLVIVSHGLTLRVFLMRWYKWTVQQFEALHNIG  250

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             NG MVVMERG+GGRYSLL+HHT+EEL +FGLTD ML DQE
Sbjct  251   NGKMVVMERGHGGRYSLLVHHTREELKEFGLTDAMLTDQE  290



>ref|XP_008437314.1| PREDICTED: uncharacterized protein LOC103482772 [Cucumis melo]
Length=310

 Score =   243 bits (619),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
            V+PPRPRRIILVRHG+S+GNVDES YTR+ADP++G+TE+G+ EAEECGR I++MI+ D  
Sbjct  37   VRPPRPRRIILVRHGESEGNVDESAYTRIADPRIGLTEKGMKEAEECGRNIKKMIDGDGV  96

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
            EDW VYFYVSPY+R  +TL++LA +F R RIAG+REEPRLREQDFGNFQDRE+M++EKAV
Sbjct  97   EDWSVYFYVSPYKRTRQTLQHLATSFHRRRIAGMREEPRLREQDFGNFQDREKMRVEKAV  156

Query  604  RERYGRFFYRFPNGESAADVYDRITG  681
            R  YGRFFYRFPNGESAADVYDRITG
Sbjct  157  RMLYGRFFYRFPNGESAADVYDRITG  182


 Score =   209 bits (533),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETL++DID+GRF+PPG+++PNMNL++VSHGLTLRVFLMRWYKWTV+Q+E L+N+G
Sbjct  180   ITGFRETLKSDIDVGRFQPPGQRNPNMNLVLVSHGLTLRVFLMRWYKWTVDQYERLNNLG  239

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+G+GGRY+LL+HHT++EL +FGLTD+MLIDQEWQK AK GELNYDC +   S
Sbjct  240   NGKMIVMEKGFGGRYTLLLHHTEKELRQFGLTDEMLIDQEWQKHAKIGELNYDCAMMN-S  298

Query  1110  YFTHFDDD  1133
             +FTHFDD+
Sbjct  299   FFTHFDDE  306



>ref|XP_009385740.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=314

 Score =   249 bits (637),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +1

Query  133  SPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDE  312
            +P   RCC+D    R +  PP     PE            PRPRRIILVRHGQS+GNVDE
Sbjct  11   APPRFRCCEDTHGRRRHRPPPPLA--PEAQFPERSMAAPCPRPRRIILVRHGQSEGNVDE  68

Query  313  SVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLA  492
            SVYTRV DPK+G+T +G  +AEECG RIR+++  D A+DWKVYFYVSPYRR LETLR L 
Sbjct  69   SVYTRVPDPKIGLTPKGWRDAEECGLRIRDLVAGDGADDWKVYFYVSPYRRTLETLRGLG  128

Query  493  KAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDR  672
            KAFERSRIAGVREEPR+REQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVYDR
Sbjct  129  KAFERSRIAGVREEPRVREQDFGNFQDREKMRIEKEIRHRYGRFFYRFPNGESAADVYDR  188

Query  673  ITG  681
            ITG
Sbjct  189  ITG  191


 Score =   200 bits (509),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE+SPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N  
Sbjct  189   ITGFRETLRADIDIGRFQPPGERSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFD  248

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VM+ G GGRYSLL+HHT EEL  FGLT+ ML DQ WQ  AKPGELNYD +  G S
Sbjct  249   NGGMLVMQTGSGGRYSLLVHHTVEELRAFGLTEAMLNDQMWQMTAKPGELNYDFVTDGSS  308

Query  1110  YFTHF  1124
             +FTH 
Sbjct  309   FFTHL  313



>ref|XP_010089066.1| hypothetical protein L484_024239 [Morus notabilis]
 gb|EXB37313.1| hypothetical protein L484_024239 [Morus notabilis]
Length=355

 Score =   232 bits (591),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 148/207 (71%), Gaps = 33/207 (16%)
 Frame = +1

Query  133  SPTSVRCCDDDATARVNIKPPDYNG-----FPEKILKHNPAT---VKPPRPRRIILVRHG  288
            S T ++CC   ++++ N      NG     FPEK    + +    V PPRP RIILVRHG
Sbjct  23   SATKIQCC---SSSQAN------NGYASSTFPEKQRLASSSVAGKVPPPRPHRIILVRHG  73

Query  289  QSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRG  468
            +S+GNVDESVYTR ADPK+ +TE+G A+A ECG+ IREMI+KD  E WKVYFYVSPYRR 
Sbjct  74   ESEGNVDESVYTRTADPKISLTEKGKAQARECGKAIREMIKKDGIESWKVYFYVSPYRRT  133

Query  469  LETLRNLAKAFERSRIAGVREEPRLREQDF----------------GNFQDREQMKIEKA  600
             ETLR + +AFERSRIAGVREEPRLREQDF                GNFQDRE+M++EK 
Sbjct  134  RETLRFVGRAFERSRIAGVREEPRLREQDFGIELFGTNLQFSRGKKGNFQDREKMRVEKK  193

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
            +R  YGRFF+RFP+GESAADVYDRITG
Sbjct  194  LRNLYGRFFFRFPDGESAADVYDRITG  220


 Score =   218 bits (555),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPG+++P MNL++VSHGLTLRVFLMRWYKWTVEQF GL+N G
Sbjct  218   ITGFRETLRSDIDIGRFQPPGDRNPGMNLVIVSHGLTLRVFLMRWYKWTVEQFHGLNNFG  277

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+GYGGRYSL MHHT++EL KFGLTD ML DQEWQK AKPGELNYDC +   S
Sbjct  278   NGRMMVMEKGYGGRYSLAMHHTEDELRKFGLTDDMLADQEWQKFAKPGELNYDCPMLT-S  336

Query  1110  YFTHFDDDNKN*DC  1151
             +FTHFDD+    D 
Sbjct  337   FFTHFDDERSTSDS  350



>ref|XP_010934931.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Elaeis 
guineensis]
Length=312

 Score =   247 bits (630),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = +1

Query  127  PYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNV  306
            P S    RCC+D +       PP +  FPE+     P TV  PRPRRIILVRHG+S+GNV
Sbjct  11   PSSSPRFRCCED-SLRHGRAAPPGW--FPERAPVAVPGTV--PRPRRIILVRHGESEGNV  65

Query  307  DESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRN  486
            DESVYTRV DP++G+T +G  EA+ CG RIR+++  D A+DWKVYFYVSPYRR LETLR 
Sbjct  66   DESVYTRVPDPRIGLTARGWQEAKACGVRIRDLVSGDGADDWKVYFYVSPYRRTLETLRG  125

Query  487  LAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVY  666
            +  AF+ SRIAGVREEPRLREQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVY
Sbjct  126  IGLAFKPSRIAGVREEPRLREQDFGNFQDREKMRIEKDIRLRYGRFFYRFPNGESAADVY  185

Query  667  DRITG  681
            DRITG
Sbjct  186  DRITG  190


 Score =   202 bits (514),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGEQSPNMN+++VSHGLTLRVFLMRWYKWTVEQ+EGLHN+ 
Sbjct  188   ITGFRETLRADIDIGRFQPPGEQSPNMNIVIVSHGLTLRVFLMRWYKWTVEQYEGLHNLD  247

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VM+ G GGRYSLL+HH+ EEL  FGL + ML DQ WQK AKPGELNY+  I GP 
Sbjct  248   NGGMLVMQTGSGGRYSLLVHHSVEELRAFGLMEAMLDDQMWQKTAKPGELNYNLWINGPP  307

Query  1110  YFTHF  1124
             +F HF
Sbjct  308   FFGHF  312



>ref|XP_006829094.1| hypothetical protein AMTR_s00001p00262580 [Amborella trichopoda]
 gb|ERM96510.1| hypothetical protein AMTR_s00001p00262580 [Amborella trichopoda]
Length=342

 Score =   238 bits (606),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 144/190 (76%), Gaps = 4/190 (2%)
 Frame = +1

Query  118  CRKPYSPTSVRCCDDD-ATARVNIKPPDYNGFPEKILKHNPATVKP-PRPRRIILVRHGQ  291
            C K   P  ++CC+D     RV  +      FPE  + +   +  P PRPRRIILVRHGQ
Sbjct  31   CFKTQVPFRIKCCEDTLGRTRVKGRSEMEMRFPE--MNNALGSSCPCPRPRRIILVRHGQ  88

Query  292  SQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGL  471
            S+GNVDES YTR+ DPK+ +TE+G  +AEE G++IREMI  D A+DWKVYFYVSPYRR L
Sbjct  89   SEGNVDESAYTRIPDPKICLTEKGWRDAEEVGKQIREMILSDGADDWKVYFYVSPYRRTL  148

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            +TL  L +AFE  RIAGVREEPRLREQDFGNFQDRE+M++ KA R RYGRFFYRFP+GES
Sbjct  149  QTLEGLGRAFELHRIAGVREEPRLREQDFGNFQDREKMRVGKADRLRYGRFFYRFPDGES  208

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  209  AADVYDRITG  218


 Score =   210 bits (535),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR+DIDIGRF+PPGE++PNMNLI+VSHGLTLRVFLMRWYKWTVEQFEGL+N G
Sbjct  216   ITGFRETLRSDIDIGRFQPPGERTPNMNLIIVSHGLTLRVFLMRWYKWTVEQFEGLNNFG  275

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VM+ G+GGRYSLLMH + EEL +FGLT++MLIDQEWQ IAKPGELNY+ + +GPS
Sbjct  276   NGGMLVMQTGFGGRYSLLMHQSPEELQEFGLTEEMLIDQEWQMIAKPGELNYNWMTSGPS  335

Query  1110  YFTHF  1124
             +F+  
Sbjct  336   FFSRL  340



>ref|XP_010055680.1| PREDICTED: uncharacterized protein LOC104443835 [Eucalyptus grandis]
 gb|KCW72194.1| hypothetical protein EUGRSUZ_E00644 [Eucalyptus grandis]
Length=334

 Score =   251 bits (640),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +1

Query  208  FPEK--ILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEE  381
            FPEK  +L H       PRPRRIILVRHGQS+GN+DESVYTRVADPK+ +T++G AEAE 
Sbjct  54   FPEKDPLLHHATLASAAPRPRRIILVRHGQSEGNLDESVYTRVADPKISLTDKGKAEAEA  113

Query  382  CGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFG  561
             G +IREMIEKD A+DWKVYFYVSPYRR LETL++L +AFERSRIAG+REEPRLREQDFG
Sbjct  114  VGWKIREMIEKDGADDWKVYFYVSPYRRTLETLKSLGRAFERSRIAGMREEPRLREQDFG  173

Query  562  NFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            NFQDRE+M++EK +R  YGRFFYRFP+GESAADVYDRITG
Sbjct  174  NFQDREKMRVEKQMRLLYGRFFYRFPDGESAADVYDRITG  213


 Score =   193 bits (491),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 106/128 (83%), Gaps = 11/128 (9%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE           HGLTLRVFLMRWYKWT +QFEGL+N+G
Sbjct  211   ITGFRETLRADIDIGRFQPPGE----------PHGLTLRVFLMRWYKWTSDQFEGLNNLG  260

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG M+VME+GYGGRYSLLMHHT+EEL +FGLTD ML+DQEWQK AKPGELNYDC +   S
Sbjct  261   NGGMIVMEKGYGGRYSLLMHHTEEELREFGLTDDMLVDQEWQKYAKPGELNYDCPMLN-S  319

Query  1110  YFTHFDDD  1133
             +FTHF+++
Sbjct  320   FFTHFENE  327



>ref|XP_003611071.1| 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase [Medicago 
truncatula]
 gb|AES94029.1| phosphoglycerate mutase family protein [Medicago truncatula]
Length=354

 Score =   246 bits (627),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 10/187 (5%)
 Frame = +1

Query  145  VRCCDDDATARVNIKPPDYNG---FPEKILKHNPATVK-----PPRPRRIILVRHGQSQG  300
            ++CC        ++   + NG   FPEK    NP         PPRPRRIILVRHG+S+G
Sbjct  38   IQCCHSQTDPIDSLT--NNNGHTRFPEKNPLINPLLASKVGAVPPRPRRIILVRHGESEG  95

Query  301  NVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETL  480
            NVDESVYTRV DPK+G+T +G  +AEECG+RI+ MIEKD  E+W++YFYVSPYRR LETL
Sbjct  96   NVDESVYTRVPDPKIGLTNRGRVQAEECGQRIKNMIEKDSDENWQLYFYVSPYRRTLETL  155

Query  481  RNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAAD  660
            ++LA+ FERSRIAG REEPR+REQDFGNFQ+RE MK+EKA R  YGRFFYRFPNGESAAD
Sbjct  156  QSLARPFERSRIAGFREEPRIREQDFGNFQNRELMKVEKAQRHLYGRFFYRFPNGESAAD  215

Query  661  VYDRITG  681
            VYDRITG
Sbjct  216  VYDRITG  222


 Score =   194 bits (492),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE++ ++NL++VSHGLTLRVFLMRWYKWTVEQFEGL+N G
Sbjct  220   ITGFRETLRADINIGRYQPPGEKNFDVNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFG  279

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  +VME+GYGGRYSL MHH ++EL +FGLTD+MLIDQEW K AKP +LNYDC +   S
Sbjct  280   NGGELVMEKGYGGRYSLSMHHDEQELRQFGLTDEMLIDQEWHKFAKPADLNYDCPMVN-S  338

Query  1110  YFTHFDDD  1133
             +F H  ++
Sbjct  339   FFPHLHEE  346



>ref|XP_007158518.1| hypothetical protein PHAVU_002G158900g [Phaseolus vulgaris]
 gb|ESW30512.1| hypothetical protein PHAVU_002G158900g [Phaseolus vulgaris]
Length=341

 Score =   236 bits (602),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 151/196 (77%), Gaps = 17/196 (9%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDATARVNIKPPDYNG---FPEKIL-KHNPATVK-----PPRPRRII  273
            +  +SP  ++CC          +P   NG     EK+L + NP+        PPRPRRII
Sbjct  28   KSTFSP--IQCCHSQT------EPFQLNGQGRVSEKLLPQSNPSVAASSVAVPPRPRRII  79

Query  274  LVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVS  453
            LVRHG+S+GNVDESVYTR+ DPK+ +T +G  +AE CG RI++MIEK++ + W+VYFYVS
Sbjct  80   LVRHGESEGNVDESVYTRIPDPKISLTRKGRDQAEACGNRIKQMIEKEQGQHWQVYFYVS  139

Query  454  PYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYR  633
            PY+R L+TL++LA+ F+RSRIAG REEPR+REQDFGNFQ+RE+M++EKA+R+ YGRFFYR
Sbjct  140  PYQRTLQTLQHLARPFQRSRIAGFREEPRIREQDFGNFQNREKMRVEKALRQLYGRFFYR  199

Query  634  FPNGESAADVYDRITG  681
            FP+GESAADVYDRITG
Sbjct  200  FPDGESAADVYDRITG  215


 Score =   203 bits (516),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+   MNL++VSHGLTLRVFLMRWYKWTV+QFEGL+N+G
Sbjct  213   ITGFRETLRTDINIGRYQPPGEKKTEMNLVIVSHGLTLRVFLMRWYKWTVQQFEGLNNMG  272

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG+M+VME+GYGGRYSLLMHH +EEL  FGLTD+MLIDQEW KIA+P +LNYDC +   S
Sbjct  273   NGNMLVMEKGYGGRYSLLMHHDEEELRGFGLTDEMLIDQEWHKIARPADLNYDCPMVN-S  331

Query  1110  YFTHFDDD  1133
             +F H  ++
Sbjct  332   FFPHLSEE  339



>gb|AFK43634.1| unknown [Lotus japonicus]
Length=348

 Score =   241 bits (615),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 150/180 (83%), Gaps = 7/180 (4%)
 Frame = +1

Query  145  VRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYT  324
            ++CC +  T  + +     + FPEK    NP  + PPRPRRIILVRHG+S+GNVDE+VYT
Sbjct  26   IQCCHNQ-TDPIRLTNNGASRFPEK----NP-LLNPPRPRRIILVRHGESEGNVDETVYT  79

Query  325  RVADPKVGITEQGVAEAEECGRRIREMIEKD-EAEDWKVYFYVSPYRRGLETLRNLAKAF  501
            RV DPK+G+T++G A+AEECG RI++MIE+D E  +W++YFYVSPYRR LETL++LA+ F
Sbjct  80   RVPDPKIGLTDRGKAQAEECGYRIKKMIEEDAEDHNWQLYFYVSPYRRALETLKSLARPF  139

Query  502  ERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            +RSRIAG REEPR+REQDFGNFQ+RE+M++EKA R+ YGRFFYRFP+GESAADVYDRITG
Sbjct  140  DRSRIAGFREEPRIREQDFGNFQNREKMRVEKAARQLYGRFFYRFPDGESAADVYDRITG  199


 Score =   195 bits (495),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+  ++NL++VSHGLTLRVFLMRWYKWTVEQFEGLHN+ 
Sbjct  197   ITGFRETLRADINIGRYQPPGEEKMDINLVIVSHGLTLRVFLMRWYKWTVEQFEGLHNLR  256

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  M+VME+GYGGRYSLLMHH ++EL +FGLTD+MLI+QEW K A+P +LNYDC +   S
Sbjct  257   NAEMLVMEKGYGGRYSLLMHHDEQELRRFGLTDEMLIEQEWHKHARPADLNYDCPMVN-S  315

Query  1110  YFTHFDDD  1133
             +F H +++
Sbjct  316   FFPHLNEE  323



>ref|XP_006476517.1| PREDICTED: uncharacterized protein LOC102620270 [Citrus sinensis]
Length=347

 Score =   229 bits (584),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 6/190 (3%)
 Frame = +1

Query  130  YSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVD  309
            Y+    +CC   A      +     GF EK  +       PPRPRRIILVRHG+S+GNVD
Sbjct  30   YNTFKFKCCHKTAETIHLHQGNGKAGFSEKGHQDLHKDPPPPRPRRIILVRHGESEGNVD  89

Query  310  ESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE------DWKVYFYVSPYRRGL  471
            ES YTRVADPK+ +TE+G A++EECGRRIR+MIE+++ +      DW+VYFYVSPY R L
Sbjct  90   ESAYTRVADPKIALTEKGKAQSEECGRRIRQMIEQNDGDGAELDDDWQVYFYVSPYTRTL  149

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            +TL+ L +AFERSRIAG+ +EPRLREQDFGNFQDRE+M++EKAVR  YGRFFYRFPNGES
Sbjct  150  QTLQFLGRAFERSRIAGMTKEPRLREQDFGNFQDRERMRVEKAVRLLYGRFFYRFPNGES  209

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  210  AADVYDRITG  219


 Score =   200 bits (509),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DID GRF+PPG +S NMN+++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  217   ITGFRETLRADIDHGRFQPPGHRSQNMNIVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  276

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG ++VME+GYGGRYSLL+HHT+EEL +FGLT++MLIDQEWQK ++  ++NYDC +   S
Sbjct  277   NGGIIVMEKGYGGRYSLLVHHTEEELREFGLTNEMLIDQEWQKYSRLEDINYDCPLLN-S  335

Query  1110  YFTHFDD  1130
             +FTH DD
Sbjct  336   FFTHLDD  342



>ref|XP_003538692.2| PREDICTED: broad-range acid phosphatase DET1-like isoform X1 
[Glycine max]
 gb|KHN35034.1| Putative phosphoglycerate mutase DET1 [Glycine soja]
Length=351

 Score =   227 bits (578),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 23/199 (12%)
 Frame = +1

Query  124  KPYSPTS----VRCCDDDATARVNIKPPDYNG---FPEKILKHNPATV------KPPRPR  264
            KP S T+    + CC          +P + NG   F EK    NPAT        PPRPR
Sbjct  27   KPNSKTNTCSLIHCCHSQT------EPIELNGQARFREK----NPATAVASPVVVPPRPR  76

Query  265  RIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYF  444
            RIILVRHG+S+GNVDESVYTR+ DPK+ +TE+G  +AEECG RI++MIE D  + W+VYF
Sbjct  77   RIILVRHGESEGNVDESVYTRIPDPKISLTEKGKVQAEECGNRIKQMIENDHDQHWQVYF  136

Query  445  YVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRF  624
            YVSPYRR L+TL++LA+ F+RSRIAG REEPR+REQDFGNFQ+RE+M++EK +R+RYGRF
Sbjct  137  YVSPYRRTLQTLQHLARPFQRSRIAGFREEPRIREQDFGNFQNREKMRMEKELRQRYGRF  196

Query  625  FYRFPNGESAADVYDRITG  681
            FYRFP+GESAADVYDRITG
Sbjct  197  FYRFPDGESAADVYDRITG  215


 Score =   201 bits (512),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+  +MNL++VSHGLTLRVFLMRWYKWTV+QFEGL+N+G
Sbjct  213   ITGFRETLRTDINIGRYQPPGEKKTDMNLVIVSHGLTLRVFLMRWYKWTVQQFEGLNNMG  272

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG+M+VME+G+GGRYSLLMHH +EEL +FG TD+MLIDQEW K AKP +LNYDC +   S
Sbjct  273   NGNMLVMEKGFGGRYSLLMHHGEEELRRFGFTDEMLIDQEWHKFAKPADLNYDCPMVN-S  331

Query  1110  YFTHFDDDNKN*DCMFE  1160
             +F H  D  +   C ++
Sbjct  332   FFPHLSDSEET--CRYD  346



>gb|KDO76300.1| hypothetical protein CISIN_1g019037mg [Citrus sinensis]
Length=347

 Score =   228 bits (580),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 6/190 (3%)
 Frame = +1

Query  130  YSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVD  309
            Y+    +CC   A      +     GF EK  +       PPRPRRIILVRHG+S+GNVD
Sbjct  30   YNAFKFKCCHKTAETIHLHQGNGKVGFSEKGHQDIHRDPPPPRPRRIILVRHGESEGNVD  89

Query  310  ESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE------DWKVYFYVSPYRRGL  471
            ES YTRVADPK+ +TE+G A++EECGRRIR+MIE+++ +      DW+VYFYVSPY R L
Sbjct  90   ESAYTRVADPKIALTEKGKAQSEECGRRIRQMIEQNDGDGAELDDDWQVYFYVSPYTRTL  149

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            +TL+ L +AFERSRIAG+ +EPRLREQDFGNFQDRE+M++EKAVR  YGRFFYRFPNGES
Sbjct  150  QTLQFLGRAFERSRIAGMTKEPRLREQDFGNFQDRERMRVEKAVRLLYGRFFYRFPNGES  209

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  210  AADVYDRITG  219


 Score =   199 bits (507),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DID GRF+PPG +S NMN+++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  217   ITGFRETLRADIDHGRFQPPGHRSQNMNIVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  276

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG ++VME+GYGGRYSLL+HHT+EEL +FGLT +MLIDQEWQK A+  ++NYDC +   S
Sbjct  277   NGGIIVMEKGYGGRYSLLVHHTEEELREFGLTYEMLIDQEWQKYARLEDINYDCPLLN-S  335

Query  1110  YFTHFDD  1130
             +FTH DD
Sbjct  336   FFTHLDD  342



>ref|XP_002509842.1| phosphoglycerate mutase, putative [Ricinus communis]
 gb|EEF51229.1| phosphoglycerate mutase, putative [Ricinus communis]
Length=303

 Score =   239 bits (610),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDATARVNIKPPDYNGFPEK--ILKHNPATVKPPRPRRIILVRHGQS  294
            +K  S +S++CC +   +   +       FPE+  +L H+   + PPRPRRIILVRHG+S
Sbjct  19   QKLASFSSIQCCKNPKES-TEVYTNGQVSFPERNPLLLHS-TRIPPPRPRRIILVRHGES  76

Query  295  QGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLE  474
            +GNVDESVYTRVADPK+G+TE+G A+AEECG+RIREMIEKD   DW+VYFYVSPY+R L+
Sbjct  77   EGNVDESVYTRVADPKIGLTEKGKAQAEECGKRIREMIEKDGVIDWQVYFYVSPYKRTLQ  136

Query  475  TLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESA  654
            TL+NL +AFER RIAG+REEPRLREQDFGNFQDRE+M++EKA+R  YGRFFYRFP+GESA
Sbjct  137  TLQNLGRAFERPRIAGMREEPRLREQDFGNFQDREKMRVEKALRMLYGRFFYRFPDGESA  196

Query  655  ADVYDRITG  681
            ADVYDRITG
Sbjct  197  ADVYDRITG  205


 Score =   187 bits (475),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE+SPNMNL++VSHGLTLRVFLMRWYKWTVEQ+E LHN G
Sbjct  203   ITGFRETLRADIDIGRFQPPGERSPNMNLVIVSHGLTLRVFLMRWYKWTVEQYEALHNFG  262

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEW  1052
             NG M+VME+GYGGRY+L MHHT+EEL KFGLTD+MLIDQEW
Sbjct  263   NGGMMVMEKGYGGRYTLSMHHTEEELRKFGLTDEMLIDQEW  303



>ref|XP_006439496.1| hypothetical protein CICLE_v10020727mg [Citrus clementina]
 gb|ESR52736.1| hypothetical protein CICLE_v10020727mg [Citrus clementina]
Length=366

 Score =   223 bits (568),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 129/149 (87%), Gaps = 6/149 (4%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE---  426
            RPRRIILVRHG+S+GNVDES YTRVADPK+ +TE+G A++EECGRRIR+MIE+++ +   
Sbjct  77   RPRRIILVRHGESEGNVDESAYTRVADPKIALTEKGKAQSEECGRRIRQMIEQNDGDGAE  136

Query  427  ---DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEK  597
               DW+VYFYVSPY R L+TL+ L +AFERSRIAG+ +EPRLREQDFGNFQDRE+M++EK
Sbjct  137  LDDDWQVYFYVSPYTRTLQTLQFLGRAFERSRIAGMTKEPRLREQDFGNFQDRERMRVEK  196

Query  598  AVRERYGRFFYRFPNGESAADVYDRITGS  684
            AVR  YGRFFYRFP G+ AAD YD+ITG+
Sbjct  197  AVRLLYGRFFYRFPKGKFAADFYDKITGT  225


 Score =   199 bits (505),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +3

Query  720   LCMFVLRLN*IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTV  899
             +    L++    GFRETLR DID GRF+PPG +S NMN+++VSHGLTLRVFLMRWYKWTV
Sbjct  226   VTKLTLKIENATGFRETLRADIDHGRFQPPGHRSQNMNIVIVSHGLTLRVFLMRWYKWTV  285

Query  900   EQFEGLHNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGEL  1079
             EQFEGL+N+GNG ++VME+GYGGRYSLL+HHT+EEL +FGLT +MLIDQEWQK A+  ++
Sbjct  286   EQFEGLNNLGNGGIIVMEKGYGGRYSLLVHHTEEELREFGLTYEMLIDQEWQKYARLEDI  345

Query  1080  NYDCLITGPSYFTHFDD  1130
             NYDC +   S+FTH DD
Sbjct  346   NYDCPLLN-SFFTHLDD  361



>ref|XP_008796902.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X2 
[Phoenix dactylifera]
Length=296

 Score =   248 bits (634),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 146/185 (79%), Gaps = 7/185 (4%)
 Frame = +1

Query  127  PYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNV  306
            P S +  RCC+D  ++   + PP  + FPE+      A    PRPRRIILVRHG+S+GNV
Sbjct  11   PSSSSRFRCCEDSLSSG-RVAPP--SRFPER----AAAAGTVPRPRRIILVRHGESEGNV  63

Query  307  DESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRN  486
            DESVYTRV DP++G+T +G  EAE CG RIRE++  D A+DWKVYFYVSPYRR LETLR 
Sbjct  64   DESVYTRVPDPRIGLTARGWQEAEACGVRIRELVSGDGADDWKVYFYVSPYRRTLETLRG  123

Query  487  LAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVY  666
            +  AF+ SRIAGVREEPRLREQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVY
Sbjct  124  IGLAFKPSRIAGVREEPRLREQDFGNFQDREKMRIEKDIRLRYGRFFYRFPNGESAADVY  183

Query  667  DRITG  681
            DRITG
Sbjct  184  DRITG  188


 Score =   172 bits (436),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGEQSPNMN+++VSHGLTLRVFLMRWYKWTVEQ+EGLHNI 
Sbjct  186   ITGFRETLRADIDIGRFQPPGEQSPNMNIVIVSHGLTLRVFLMRWYKWTVEQYEGLHNID  245

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
             NG M+VM+ G GGRYSLL+HH+ EEL  FGL++ ML DQ W  +AK
Sbjct  246   NGGMLVMQTGGGGRYSLLVHHSVEELQAFGLSEPMLNDQMWYWMAK  291



>ref|XP_009385739.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=316

 Score =   249 bits (637),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +1

Query  133  SPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDE  312
            +P   RCC+D    R +  PP     PE            PRPRRIILVRHGQS+GNVDE
Sbjct  11   APPRFRCCEDTHGRRRHRPPPPLA--PEAQFPERSMAAPCPRPRRIILVRHGQSEGNVDE  68

Query  313  SVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLA  492
            SVYTRV DPK+G+T +G  +AEECG RIR+++  D A+DWKVYFYVSPYRR LETLR L 
Sbjct  69   SVYTRVPDPKIGLTPKGWRDAEECGLRIRDLVAGDGADDWKVYFYVSPYRRTLETLRGLG  128

Query  493  KAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDR  672
            KAFERSRIAGVREEPR+REQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVYDR
Sbjct  129  KAFERSRIAGVREEPRVREQDFGNFQDREKMRIEKEIRHRYGRFFYRFPNGESAADVYDR  188

Query  673  ITG  681
            ITG
Sbjct  189  ITG  191


 Score =   170 bits (430),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE+SPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N  
Sbjct  189   ITGFRETLRADIDIGRFQPPGERSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFD  248

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNY  1085
             NG M+VM+ G GGRYSLL+HHT EEL  FGLT+ ML DQ W +       N+
Sbjct  249   NGGMLVMQTGSGGRYSLLVHHTVEELRAFGLTEAMLNDQMWYRTVALDRENF  300



>ref|XP_004964301.1| PREDICTED: broad-range acid phosphatase DET1-like [Setaria italica]
Length=386

 Score =   225 bits (574),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFY  447
            I+LVRHG+S+GNVDES YTRV DP++G+T +G  +AE+CGRR+R++   D  +DWKVYFY
Sbjct  118  IVLVRHGESEGNVDESAYTRVPDPRIGLTAKGRRDAEDCGRRLRDLFSSDADDDWKVYFY  177

Query  448  VSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFF  627
            VSPYRR LETLR +  AFER RIAGVREEPRLREQDFGNFQDREQM++EK +R RYGRFF
Sbjct  178  VSPYRRTLETLRGIGHAFERHRIAGVREEPRLREQDFGNFQDREQMRVEKELRLRYGRFF  237

Query  628  YRFPNGESAADVYDRITG  681
            YRFPNGESAADVYDRITG
Sbjct  238  YRFPNGESAADVYDRITG  255


 Score =   192 bits (487),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPG ++PNMN+++VSHGLTLRVFLMRWYKWTV QFEGL+N+G
Sbjct  253   ITGFRETLRADIDIGRFQPPGRRTPNMNIVLVSHGLTLRVFLMRWYKWTVRQFEGLNNLG  312

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  +VM+ G GGRYSLL+HH+ +EL +FGLTD+ML DQ WQ+ AKPG+LNY  +  G  
Sbjct  313   NGGTIVMQTGRGGRYSLLVHHSADELREFGLTDEMLQDQMWQETAKPGDLNYRFMTNGQY  372

Query  1110  YFTHFD  1127
             +F  FD
Sbjct  373   FFDRFD  378



>ref|XP_009385742.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=314

 Score =   250 bits (638),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +1

Query  133  SPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDE  312
            +P   RCC+D    R +  PP     PE            PRPRRIILVRHGQS+GNVDE
Sbjct  11   APPRFRCCEDTHGRRRHRPPPPLA--PEAQFPERSMAAPCPRPRRIILVRHGQSEGNVDE  68

Query  313  SVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLA  492
            SVYTRV DPK+G+T +G  +AEECG RIR+++  D A+DWKVYFYVSPYRR LETLR L 
Sbjct  69   SVYTRVPDPKIGLTPKGWRDAEECGLRIRDLVAGDGADDWKVYFYVSPYRRTLETLRGLG  128

Query  493  KAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDR  672
            KAFERSRIAGVREEPR+REQDFGNFQDRE+M+IEK +R RYGRFFYRFPNGESAADVYDR
Sbjct  129  KAFERSRIAGVREEPRVREQDFGNFQDREKMRIEKEIRHRYGRFFYRFPNGESAADVYDR  188

Query  673  ITG  681
            ITG
Sbjct  189  ITG  191


 Score =   160 bits (405),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE+SPNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N  
Sbjct  189   ITGFRETLRADIDIGRFQPPGERSPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFD  248

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNY  1085
             NG M+VM+ G GG  SLL+HHT EEL  FGLT+ ML DQ W +       N+
Sbjct  249   NGGMLVMQTGSGG--SLLVHHTVEELRAFGLTEAMLNDQMWYRTVALDRENF  298



>ref|XP_001754608.1| predicted protein [Physcomitrella patens]
 gb|EDQ80578.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   232 bits (591),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  250  PPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED  429
            PPRPRRIILVRHG+S GNVDE+ YT++ D K+ +TE+G  +A +CG  IRE+IE D ++D
Sbjct  2    PPRPRRIILVRHGESLGNVDETAYTQIPDSKICLTEKGWKQALKCGHDIRELIEGDHSDD  61

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVYFYVSPY R L+TLR +  AF+R RIAGVREEPRLREQDFGNFQDRE+M++EKA+R 
Sbjct  62   WKVYFYVSPYNRTLQTLRGIGIAFDRERIAGVREEPRLREQDFGNFQDRERMRVEKAIRL  121

Query  610  RYGRFFYRFPNGESAADVYDRITGSS  687
            RYGRFFYRFPNGESAADVYDRITG+S
Sbjct  122  RYGRFFYRFPNGESAADVYDRITGNS  147


 Score =   177 bits (450),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +3

Query  762   RETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSM  941
             +ETLR DID+GRF+ P  +S NMNL++VSHGLTLRVFLMRWYKWTV+QFEGL+N GN  M
Sbjct  152   QETLRADIDVGRFQRPESRSKNMNLVLVSHGLTLRVFLMRWYKWTVQQFEGLYNFGNTEM  211

Query  942   VVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPSYFTH  1121
             +VME G GGRYSL MHH+ +EL  FG+TD M+ DQEWQKIA+PGELN +   T PS+F H
Sbjct  212   LVMELGPGGRYSLTMHHSADELRAFGMTDDMIEDQEWQKIARPGELN-NNWDTNPSFFHH  270

Query  1122  FDDDNKN*D  1148
             FD   K  D
Sbjct  271   FDAAAKGLD  279



>gb|KDO76301.1| hypothetical protein CISIN_1g019037mg [Citrus sinensis]
Length=317

 Score =   228 bits (581),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 6/190 (3%)
 Frame = +1

Query  130  YSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVD  309
            Y+    +CC   A      +     GF EK  +       PPRPRRIILVRHG+S+GNVD
Sbjct  30   YNAFKFKCCHKTAETIHLHQGNGKVGFSEKGHQDIHRDPPPPRPRRIILVRHGESEGNVD  89

Query  310  ESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE------DWKVYFYVSPYRRGL  471
            ES YTRVADPK+ +TE+G A++EECGRRIR+MIE+++ +      DW+VYFYVSPY R L
Sbjct  90   ESAYTRVADPKIALTEKGKAQSEECGRRIRQMIEQNDGDGAELDDDWQVYFYVSPYTRTL  149

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            +TL+ L +AFERSRIAG+ +EPRLREQDFGNFQDRE+M++EKAVR  YGRFFYRFPNGES
Sbjct  150  QTLQFLGRAFERSRIAGMTKEPRLREQDFGNFQDRERMRVEKAVRLLYGRFFYRFPNGES  209

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  210  AADVYDRITG  219


 Score =   175 bits (443),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DID GRF+PPG +S NMN+++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  217   ITGFRETLRADIDHGRFQPPGHRSQNMNIVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  276

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEW  1052
             NG ++VME+GYGGRYSLL+HHT+EEL +FGLT +MLIDQEW
Sbjct  277   NGGIIVMEKGYGGRYSLLVHHTEEELREFGLTYEMLIDQEW  317



>ref|XP_006590506.1| PREDICTED: broad-range acid phosphatase DET1-like isoform X2 
[Glycine max]
Length=320

 Score =   227 bits (579),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 23/199 (12%)
 Frame = +1

Query  124  KPYSPTS----VRCCDDDATARVNIKPPDYNG---FPEKILKHNPATV------KPPRPR  264
            KP S T+    + CC          +P + NG   F EK    NPAT        PPRPR
Sbjct  27   KPNSKTNTCSLIHCCHSQT------EPIELNGQARFREK----NPATAVASPVVVPPRPR  76

Query  265  RIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYF  444
            RIILVRHG+S+GNVDESVYTR+ DPK+ +TE+G  +AEECG RI++MIE D  + W+VYF
Sbjct  77   RIILVRHGESEGNVDESVYTRIPDPKISLTEKGKVQAEECGNRIKQMIENDHDQHWQVYF  136

Query  445  YVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRF  624
            YVSPYRR L+TL++LA+ F+RSRIAG REEPR+REQDFGNFQ+RE+M++EK +R+RYGRF
Sbjct  137  YVSPYRRTLQTLQHLARPFQRSRIAGFREEPRIREQDFGNFQNREKMRMEKELRQRYGRF  196

Query  625  FYRFPNGESAADVYDRITG  681
            FYRFP+GESAADVYDRITG
Sbjct  197  FYRFPDGESAADVYDRITG  215


 Score =   175 bits (443),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DI+IGR++PPGE+  +MNL++VSHGLTLRVFLMRWYKWTV+QFEGL+N+G
Sbjct  213   ITGFRETLRTDINIGRYQPPGEKKTDMNLVIVSHGLTLRVFLMRWYKWTVQQFEGLNNMG  272

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEW  1052
             NG+M+VME+G+GGRYSLLMHH +EEL +FG TD+MLIDQEW
Sbjct  273   NGNMLVMEKGFGGRYSLLMHHGEEELRRFGFTDEMLIDQEW  313



>ref|NP_001056573.2| Os06g0109000 [Oryza sativa Japonica Group]
 gb|EEC79850.1| hypothetical protein OsI_21329 [Oryza sativa Indica Group]
 dbj|BAF18487.2| Os06g0109000 [Oryza sativa Japonica Group]
Length=363

 Score =   201 bits (512),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 14/193 (7%)
 Frame = +1

Query  145  VRCCDDDATARVNIKP------PDYNGFPEKILKHNPATVKPPRPR--------RIILVR  282
            VRCC+D      + +P           FPE +  +  A+  P + R        RI+LVR
Sbjct  25   VRCCEDTLGVPRSRRPTHDTELAQSQRFPELVTPYGAASYLPHQQRYPPPPRPRRIVLVR  84

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYR  462
            HG+S+GNVDE+ YTRV DP++G+T QG  +AE+CGRR+R ++     +DWKVYFYVSPYR
Sbjct  85   HGESEGNVDEAAYTRVPDPRIGLTPQGWRDAEDCGRRLRHLLSTGGGDDWKVYFYVSPYR  144

Query  463  RGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPN  642
            R LETLR L +AFE  RIAGVREEPRLREQDFGNFQDR++M++EK +R RYGRFFYRFPN
Sbjct  145  RTLETLRGLGRAFEARRIAGVREEPRLREQDFGNFQDRDKMRVEKEIRRRYGRFFYRFPN  204

Query  643  GESAADVYDRITG  681
            GESAADVYDRITG
Sbjct  205  GESAADVYDRITG  217


 Score =   187 bits (475),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++P+MN+++VSHGLTLRVFLMRWYKWTV QFEGL N+ 
Sbjct  215   ITGFRETLRADIDIGRFQPPGERNPDMNVVLVSHGLTLRVFLMRWYKWTVSQFEGLANLS  274

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  +VM+ G GGRYSLL+HH+ +EL +FGLTD M+ DQ+WQ  A+PGELNY+ +  GPS
Sbjct  275   NGGALVMQTGAGGRYSLLVHHSVDELREFGLTDDMIEDQKWQMTARPGELNYNFITNGPS  334



>dbj|BAD67688.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD67891.1| hypothetical protein [Oryza sativa Japonica Group]
Length=375

 Score =   201 bits (512),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 14/193 (7%)
 Frame = +1

Query  145  VRCCDDDATARVNIKP------PDYNGFPEKILKHNPATVKPPRPR--------RIILVR  282
            VRCC+D      + +P           FPE +  +  A+  P + R        RI+LVR
Sbjct  37   VRCCEDTLGVPRSRRPTHDTELAQSQRFPELVTPYGAASYLPHQQRYPPPPRPRRIVLVR  96

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYR  462
            HG+S+GNVDE+ YTRV DP++G+T QG  +AE+CGRR+R ++     +DWKVYFYVSPYR
Sbjct  97   HGESEGNVDEAAYTRVPDPRIGLTPQGWRDAEDCGRRLRHLLSTGGGDDWKVYFYVSPYR  156

Query  463  RGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPN  642
            R LETLR L +AFE  RIAGVREEPRLREQDFGNFQDR++M++EK +R RYGRFFYRFPN
Sbjct  157  RTLETLRGLGRAFEARRIAGVREEPRLREQDFGNFQDRDKMRVEKEIRRRYGRFFYRFPN  216

Query  643  GESAADVYDRITG  681
            GESAADVYDRITG
Sbjct  217  GESAADVYDRITG  229


 Score =   187 bits (476),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++P+MN+++VSHGLTLRVFLMRWYKWTV QFEGL N+ 
Sbjct  227   ITGFRETLRADIDIGRFQPPGERNPDMNVVLVSHGLTLRVFLMRWYKWTVSQFEGLANLS  286

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  +VM+ G GGRYSLL+HH+ +EL +FGLTD M+ DQ+WQ  A+PGELNY+ +  GPS
Sbjct  287   NGGALVMQTGAGGRYSLLVHHSVDELREFGLTDDMIEDQKWQMTARPGELNYNFITNGPS  346



>gb|EEE64959.1| hypothetical protein OsJ_19850 [Oryza sativa Japonica Group]
Length=363

 Score =   199 bits (507),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 141/193 (73%), Gaps = 14/193 (7%)
 Frame = +1

Query  145  VRCCDDDATARVNIKP------PDYNGFPEKILKHNPATVKPPR--------PRRIILVR  282
            VRCC+D      + +P           FPE +  +  A+  P +        PRRI+LVR
Sbjct  25   VRCCEDTLGVPRSRRPTHDTELAQSQRFPELVTPYGAASYLPHQQRYPPPPGPRRIVLVR  84

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPYR  462
            HG+S+GNVDE+ YTRV DP++G+T QG  +AE+CGRR+R ++     +DWKVYFYVSPYR
Sbjct  85   HGESEGNVDEAAYTRVPDPRIGLTPQGWRDAEDCGRRLRHLLSTGGGDDWKVYFYVSPYR  144

Query  463  RGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPN  642
            R LETLR L +AFE  RIAGVREEPRLREQDFGNFQDR++M++EK +R RYGRFFYRFPN
Sbjct  145  RTLETLRGLGRAFEARRIAGVREEPRLREQDFGNFQDRDKMRVEKEIRRRYGRFFYRFPN  204

Query  643  GESAADVYDRITG  681
            GESAADVYDRITG
Sbjct  205  GESAADVYDRITG  217


 Score =   187 bits (476),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++P+MN+++VSHGLTLRVFLMRWYKWTV QFEGL N+ 
Sbjct  215   ITGFRETLRADIDIGRFQPPGERNPDMNVVLVSHGLTLRVFLMRWYKWTVSQFEGLANLS  274

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  +VM+ G GGRYSLL+HH+ +EL +FGLTD M+ DQ+WQ  A+PGELNY+ +  GPS
Sbjct  275   NGGALVMQTGAGGRYSLLVHHSVDELREFGLTDDMIEDQKWQMTARPGELNYNFITNGPS  334



>ref|XP_002968785.1| hypothetical protein SELMODRAFT_66964, partial [Selaginella moellendorffii]
 ref|XP_002992880.1| hypothetical protein SELMODRAFT_46930, partial [Selaginella moellendorffii]
 gb|EFJ06071.1| hypothetical protein SELMODRAFT_46930, partial [Selaginella moellendorffii]
 gb|EFJ29901.1| hypothetical protein SELMODRAFT_66964, partial [Selaginella moellendorffii]
Length=239

 Score =   224 bits (571),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            PRRIILVRHGQS+GN+DE  YTR+ D K+ +TE G  +A ECG+RIR ++E D A DWKV
Sbjct  1    PRRIILVRHGQSEGNIDEGAYTRIPDSKISLTEAGWRQAIECGKRIRTLVESDGAPDWKV  60

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPYRR L+TL+ +  AFER RIAGVREEPRLREQDFGNFQD+E+M++EK +R RYG
Sbjct  61   YFYVSPYRRSLQTLKAIGMAFERERIAGVREEPRLREQDFGNFQDQERMRVEKEIRLRYG  120

Query  619  RFFYRFPNGESAADVYDRITG  681
            RFFYRFPNGESAADVYDRITG
Sbjct  121  RFFYRFPNGESAADVYDRITG  141


 Score =   155 bits (393),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+ P ++S N+NL++VSHGLTLRVFLMRWYKWTVEQFEGL N G
Sbjct  139   ITGFRETLRADIDIGRFQRPEDRSKNVNLVLVSHGLTLRVFLMRWYKWTVEQFEGLWNFG  198

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEW  1052
             N   +VME G GGRYSLL+HHT+EEL  FG+T+ M+ DQEW
Sbjct  199   NTGTMVMETGPGGRYSLLVHHTREELKAFGMTECMIDDQEW  239



>ref|XP_007209559.1| hypothetical protein PRUPE_ppa010955mg [Prunus persica]
 gb|EMJ10758.1| hypothetical protein PRUPE_ppa010955mg [Prunus persica]
Length=229

 Score =   211 bits (538),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 118/135 (87%), Gaps = 5/135 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++PN+NL++VSHGLTLRVFLMRWYKWTVEQFE L+N G
Sbjct  91    ITGFRETLRADIDIGRFQPPGERNPNINLVIVSHGLTLRVFLMRWYKWTVEQFERLNNFG  150

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG +VVMERGYGGRYSLL+HHT+EEL +FGLTD+ML DQEWQK AKPGELNYDC  T  S
Sbjct  151   NGGVVVMERGYGGRYSLLVHHTEEELREFGLTDEMLSDQEWQKYAKPGELNYDC-PTLNS  209

Query  1110  YFTHFD----DDNKN  1142
             +F+HF     D+N+N
Sbjct  210   FFSHFANNCGDENEN  224


 Score =   167 bits (423),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  MIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQ  582
            MIEKD+  +WKVYFYVSPYRRG+ETL+ L +AFERSRIAG+REEPRLREQDFGNFQDRE+
Sbjct  1    MIEKDKVHNWKVYFYVSPYRRGVETLKGLGRAFERSRIAGMREEPRLREQDFGNFQDREK  60

Query  583  MKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            M++EKA+R  YGRFFYRFPNGESAADVYDRITG
Sbjct  61   MRVEKAIRMLYGRFFYRFPNGESAADVYDRITG  93



>gb|KDO76302.1| hypothetical protein CISIN_1g019037mg [Citrus sinensis]
Length=297

 Score =   227 bits (579),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 6/190 (3%)
 Frame = +1

Query  130  YSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVD  309
            Y+    +CC   A      +     GF EK  +       PPRPRRIILVRHG+S+GNVD
Sbjct  30   YNAFKFKCCHKTAETIHLHQGNGKVGFSEKGHQDIHRDPPPPRPRRIILVRHGESEGNVD  89

Query  310  ESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE------DWKVYFYVSPYRRGL  471
            ES YTRVADPK+ +TE+G A++EECGRRIR+MIE+++ +      DW+VYFYVSPY R L
Sbjct  90   ESAYTRVADPKIALTEKGKAQSEECGRRIRQMIEQNDGDGAELDDDWQVYFYVSPYTRTL  149

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            +TL+ L +AFERSRIAG+ +EPRLREQDFGNFQDRE+M++EKAVR  YGRFFYRFPNGES
Sbjct  150  QTLQFLGRAFERSRIAGMTKEPRLREQDFGNFQDRERMRVEKAVRLLYGRFFYRFPNGES  209

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  210  AADVYDRITG  219


 Score =   140 bits (354),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            I GFRETLR DID GRF+PPG +S NMN+++VSHGLTLRVFLMRWYKWTVEQFEGL+N+G
Sbjct  217  ITGFRETLRADIDHGRFQPPGHRSQNMNIVIVSHGLTLRVFLMRWYKWTVEQFEGLNNLG  276

Query  930  NGSMVVMERGYGGRYSLLMH  989
            NG ++VME+GYGGRYS+ +H
Sbjct  277  NGGIIVMEKGYGGRYSIFIH  296



>dbj|BAJ86007.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   190 bits (482),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPP----GEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGL  917
             I GFRETLR DIDIGRF+PP    G  +P MNL++VSHGLTLRVFLMRWYKWTV QFEGL
Sbjct  214   ITGFRETLRADIDIGRFQPPSPPGGPTAPEMNLVLVSHGLTLRVFLMRWYKWTVRQFEGL  273

Query  918   HNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLI  1097
              N+ NG  +VM+ G GGRYSLL+HHT +EL +FGLTD+M+ DQ WQ+ A+PGELNY+ + 
Sbjct  274   ANLDNGGTLVMQTGEGGRYSLLVHHTVDELREFGLTDEMIDDQMWQRTARPGELNYNFIT  333

Query  1098  TGPSYFTHF  1124
              GPS+FTHF
Sbjct  334   NGPSFFTHF  342


 Score =   175 bits (444),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 6/144 (4%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED------  429
            I+LVRHGQS+GNVDE  YTRV DP +G+T +G  +AE+CGRR+  ++     +D      
Sbjct  73   IVLVRHGQSEGNVDEGAYTRVPDPLIGLTTKGHRQAEDCGRRLHRLLSSGHDDDDDDYDD  132

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVYFYVSPYRR LETLR + +AF+  RIAGVREEPR+REQDFGNFQDRE+M++EK  R 
Sbjct  133  WKVYFYVSPYRRTLETLRGVGRAFDARRIAGVREEPRIREQDFGNFQDREKMRVEKEARR  192

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            RYGRFFYRFP+GESAADVYDRITG
Sbjct  193  RYGRFFYRFPDGESAADVYDRITG  216



>dbj|BAJ90090.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   190 bits (482),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPP----GEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGL  917
             I GFRETLR DIDIGRF+PP    G  +P MNL++VSHGLTLRVFLMRWYKWTV QFEGL
Sbjct  214   ITGFRETLRADIDIGRFQPPSPPGGPTAPEMNLVLVSHGLTLRVFLMRWYKWTVRQFEGL  273

Query  918   HNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLI  1097
              N+ NG  +VM+ G GGRYSLL+HHT +EL +FGLTD+M+ DQ WQ+ A+PGELNY+ + 
Sbjct  274   ANLDNGGTLVMQTGEGGRYSLLVHHTVDELREFGLTDEMIDDQMWQRTARPGELNYNFIT  333

Query  1098  TGPSYFTHF  1124
              GPS+FTHF
Sbjct  334   NGPSFFTHF  342


 Score =   175 bits (444),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 6/144 (4%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED------  429
            I+LVRHGQS+GNVDE  YTRV DP +G+T +G  +AE+CGRR+  ++     +D      
Sbjct  73   IVLVRHGQSEGNVDEGAYTRVPDPLIGLTTKGHRQAEDCGRRLHRLLSSGHDDDDDDYDD  132

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKVYFYVSPYRR LETLR + +AF+  RIAGVREEPR+REQDFGNFQDRE+M++EK  R 
Sbjct  133  WKVYFYVSPYRRTLETLRGVGRAFDARRIAGVREEPRIREQDFGNFQDREKMRVEKEARR  192

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            RYGRFFYRFP+GESAADVYDRITG
Sbjct  193  RYGRFFYRFPDGESAADVYDRITG  216



>ref|XP_009800803.1| PREDICTED: uncharacterized protein LOC104246640 isoform X3 [Nicotiana 
sylvestris]
Length=294

 Score =   293 bits (750),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 177/210 (84%), Gaps = 8/210 (4%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTS-VRCCDDDATARVNIKPPDYNG----FPEK-ILK  228
            M+ LFS + P S   V  +KP+  +S +RCC+D+ + +V  K  + NG    FPEK ++ 
Sbjct  1    MSNLFSKIYPTSFG-VNHQKPHPKSSAIRCCNDEYS-KVQHKSTELNGWVSSFPEKNLVL  58

Query  229  HNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI  408
              P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADPKVG+TE+GV EAEECGR++RE+I
Sbjct  59   SYPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPKVGLTEKGVEEAEECGRKMREII  118

Query  409  EKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
            EK+  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMK
Sbjct  119  EKNGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMK  178

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            IEKAVR RYGRFFYRFPNGESAADVYDRIT
Sbjct  179  IEKAVRARYGRFFYRFPNGESAADVYDRIT  208


 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  888   KWTVEQFEGLHNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
             + TVEQFEGLHN+ NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQK AK
Sbjct  206   RITVEQFEGLHNMSNGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKTAK  265

Query  1068  PGELNYDCLITGPSYFTHFDDDNK  1139
             PGELNYDCLITGPSYFTHFDD+ +
Sbjct  266   PGELNYDCLITGPSYFTHFDDEEE  289



>ref|XP_009628163.1| PREDICTED: uncharacterized protein LOC104118593 isoform X3 [Nicotiana 
tomentosiformis]
Length=294

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 172/209 (82%), Gaps = 6/209 (3%)
 Frame = +1

Query  67   MTGLFSTLLppssspVVCRKPYSPTSVRCCDDDATARVNIKPPDYNG----FPEK-ILKH  231
            M+ LFS + P S      +   + +++RCC+D+ +  V  K  + NG    FPEK ++  
Sbjct  1    MSNLFSKIYPTSFGVNHQKLHPNSSTIRCCNDEYSG-VQHKSTELNGWVSSFPEKNLVLS  59

Query  232  NPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE  411
             P  VKPPRP+RIILVRHGQS+GNVDESVYTRVADP VG+TE+GV EAEECGR++REMIE
Sbjct  60   YPGIVKPPRPKRIILVRHGQSEGNVDESVYTRVADPNVGLTEKGVEEAEECGRKMREMIE  119

Query  412  KDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKI  591
            KD  +DWKVYFYVSPY+RG+ETLRNLAK+FERSRIAGVREEPRLREQDFGNFQD+EQMKI
Sbjct  120  KDGGDDWKVYFYVSPYKRGIETLRNLAKSFERSRIAGVREEPRLREQDFGNFQDKEQMKI  179

Query  592  EKAVRERYGRFFYRFPNGESAADVYDRIT  678
            EKAVR RYGRFFYRFPNGESAADVYDRIT
Sbjct  180  EKAVRARYGRFFYRFPNGESAADVYDRIT  208


 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  888   KWTVEQFEGLHNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
             + TVEQFEGLHN+ NG M+VMERGYGGRY L +HHT+EEL KFG+TD+MLIDQEWQKIAK
Sbjct  206   RITVEQFEGLHNMSNGGMIVMERGYGGRYCLSVHHTREELQKFGMTDEMLIDQEWQKIAK  265

Query  1068  PGELNYDCLITGPSYFTHFDDD  1133
             PGELNYDCLITGPSYFTHFDDD
Sbjct  266   PGELNYDCLITGPSYFTHFDDD  287



>gb|EMT11962.1| hypothetical protein F775_08310 [Aegilops tauschii]
Length=266

 Score =   189 bits (480),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPP----GEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGL  917
             I GFRETLR DIDIGRF+PP    G  +P MNL++VSHGLTLRVFLMRWYKWTV QFEGL
Sbjct  137   ITGFRETLRADIDIGRFQPPSPPGGPTAPEMNLVLVSHGLTLRVFLMRWYKWTVRQFEGL  196

Query  918   HNIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLI  1097
              N+ NG  +VM+ G GGRYSLL+HHT +EL +FGLTD+M+ DQ WQ+ A+PGELNY+ + 
Sbjct  197   ANLDNGGTLVMQTGEGGRYSLLVHHTVDELREFGLTDEMIDDQMWQRTARPGELNYNFIT  256

Query  1098  TGPSYFTHF  1124
              GPS+FTHF
Sbjct  257   NGPSFFTHF  265


 Score =   160 bits (405),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 8/139 (6%)
 Frame = +1

Query  289  QSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED--------WKVYF  444
             S+GNVDE  YTRV DP +G+T +G  +AE+CGRR+  ++     +D        WKVYF
Sbjct  1    MSEGNVDEGAYTRVPDPLIGLTPKGHRQAEDCGRRLHRLLSSGHGDDEEEDSDDDWKVYF  60

Query  445  YVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRF  624
            YVSPYRR LETLR + +AF+  RIAGVREEPR+REQDFGNFQDRE+M++EK +R RYGRF
Sbjct  61   YVSPYRRTLETLRGVGRAFDARRIAGVREEPRIREQDFGNFQDREKMRVEKEIRRRYGRF  120

Query  625  FYRFPNGESAADVYDRITG  681
            FYRFP+GESAADVYDRITG
Sbjct  121  FYRFPDGESAADVYDRITG  139



>ref|XP_003561228.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Brachypodium 
distachyon]
Length=343

 Score =   174 bits (441),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 133/190 (70%), Gaps = 14/190 (7%)
 Frame = +1

Query  148  RCCDDDATARVNIKPPDYNG-----FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDE  312
            RCC+D        + P         FPE  L+ +     PPRPRRI+LVRHGQS+GNVDE
Sbjct  30   RCCEDSLGVPRRRRAPGAESQQQMYFPE--LRPSHPPSPPPRPRRIVLVRHGQSEGNVDE  87

Query  313  SVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA-------EDWKVYFYVSPYRRGL  471
            S Y RV DP +G+T +G ++AE+ GRR+  +             ++WKVYFYVSPYRR L
Sbjct  88   SAYGRVPDPLIGLTPKGRSQAEDSGRRLHRLFSGSGESEDESSEQNWKVYFYVSPYRRTL  147

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            ETLR L +AF   RIAGVREEPRLREQDFGNFQDRE+M++EK  R RYGRFFYRFP+GES
Sbjct  148  ETLRGLGRAFSAPRIAGVREEPRLREQDFGNFQDREKMRVEKETRRRYGRFFYRFPDGES  207

Query  652  AADVYDRITG  681
            AADVYDRITG
Sbjct  208  AADVYDRITG  217


 Score =   173 bits (438),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 100/128 (78%), Gaps = 3/128 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSP---NMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLH  920
             I GFRETLR DIDIGRF+PP         MNL++VSHGLTLRVFLMRWYKWTV QFEGL 
Sbjct  215   ITGFRETLRADIDIGRFQPPTPSPATAPEMNLVLVSHGLTLRVFLMRWYKWTVSQFEGLA  274

Query  921   NIGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLIT  1100
             N+ NG  VVM+ G GGRYSLL+HH+ EEL + GLT++M+ DQ WQ  A+PGELNY+ +  
Sbjct  275   NLDNGGAVVMQTGEGGRYSLLVHHSVEELREMGLTEEMIEDQVWQSTARPGELNYEFITN  334

Query  1101  GPSYFTHF  1124
             GPS+FTHF
Sbjct  335   GPSFFTHF  342



>ref|XP_002966946.1| hypothetical protein SELMODRAFT_86459 [Selaginella moellendorffii]
 gb|EFJ31545.1| hypothetical protein SELMODRAFT_86459 [Selaginella moellendorffii]
Length=315

 Score =   195 bits (496),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP RIILVRHGQS+GNVDES Y+ VAD K+ +TE G  +A  CG+ +R +IE+D  +DWK
Sbjct  9    RPTRIILVRHGQSEGNVDESKYSSVADYKIHLTEGGFQQAIACGQEVRRIIERDVRDDWK  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY+R   TLR + +AFE+ RI GVREEPR+REQDFGNFQ  E MK+ K  R+R+
Sbjct  69   VYFYVSPYKRTRCTLRGIGRAFEKERILGVREEPRIREQDFGNFQCMEVMKVVKETRDRF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR+T
Sbjct  129  GRFFYRFPEGESAADVFDRVT  149


 Score =   129 bits (325),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R      +S ++NLI+VSHGLT+RVFLMRW+KWT EQFE L+N  
Sbjct  148   VTSFLESLWRDIDMNRLNRS--KSSDLNLIIVSHGLTMRVFLMRWFKWTTEQFELLNNPQ  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VM+ G GG YSL +HH+++EL  +GLT +M+ DQEW+  A  G+ N D   +G +
Sbjct  206   NCDIRVMQLGSGGEYSLAVHHSRQELENWGLTPEMIADQEWRATAMRGQWNDDWPWSGRA  265

Query  1110  YFTHFDDD  1133
             +F HF+D+
Sbjct  266   FFDHFEDE  273



>ref|XP_002961061.1| hypothetical protein SELMODRAFT_73590 [Selaginella moellendorffii]
 gb|EFJ38600.1| hypothetical protein SELMODRAFT_73590 [Selaginella moellendorffii]
Length=315

 Score =   195 bits (496),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP RIILVRHGQS+GNVDES Y+ VAD K+ +TE G  +A  CG+ +R +IE+D  +DWK
Sbjct  9    RPTRIILVRHGQSEGNVDESKYSSVADYKIHLTEGGFQQAIACGQEVRRIIERDVRDDWK  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY+R   TLR + +AFE+ RI GVREEPR+REQDFGNFQ  E MK+ K  R+R+
Sbjct  69   VYFYVSPYKRTRCTLRGIGRAFEKERILGVREEPRIREQDFGNFQCMEVMKVVKETRDRF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR+T
Sbjct  129  GRFFYRFPEGESAADVFDRVT  149


 Score =   129 bits (325),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R      +S ++NLI+VSHGLT+RVFLMRW+KWT EQFE L+N  
Sbjct  148   VTSFLESLWRDIDMNRLNRS--KSSDLNLIIVSHGLTMRVFLMRWFKWTTEQFELLNNPQ  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VM+ G GG YSL +HH+++EL  +GLT +M+ DQEW+  A  G+ N D   +G +
Sbjct  206   NCEIRVMQLGSGGEYSLAVHHSRQELENWGLTPEMIADQEWRATAMRGKWNDDWPWSGRA  265

Query  1110  YFTHFDDD  1133
             +F HF+D+
Sbjct  266   FFDHFEDE  273



>ref|XP_006382636.1| hypothetical protein POPTR_0005s04020g [Populus trichocarpa]
 gb|ERP60433.1| hypothetical protein POPTR_0005s04020g [Populus trichocarpa]
Length=298

 Score =   180 bits (456),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+SQGN+D + YT   D K+ +T  G+A+A + G  +  +I  DE ++W+V
Sbjct  19   PKRIILVRHGESQGNLDTAAYTTTPDNKIQLTPSGLAQARQAGNHLYNIISNDENKNWRV  78

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F++ RI GVREE R+REQDFGNFQ +E+MK+ K  RER+G
Sbjct  79   YFYVSPYDRTRSTLREIGRSFKKERIIGVREECRVREQDFGNFQVKERMKVVKESRERFG  138

Query  619  RFFYRFPNGESAADVYDRITG  681
            RFFYRFP GESAADV+DR++G
Sbjct  139  RFFYRFPEGESAADVFDRVSG  159


 Score =   124 bits (311),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF E+L  DID+ RF    + S ++NLI+VSHGLT RVFLM+W+KWTV+QFE L+N G
Sbjct  157   VSGFLESLWRDIDMKRFH--RDPSHDLNLIIVSHGLTCRVFLMKWFKWTVQQFEHLNNPG  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    +M+ G GG YSL +HHT EE++++GL+ +M+ DQ+W+  A  G+ N  C      
Sbjct  215   NCEFRIMQLGPGGEYSLAIHHTDEEMLEWGLSPEMIDDQKWRMRANKGDWNEKCPWYLDE  274

Query  1110  YFTHFDDDNKN*D  1148
             +F H  D ++  D
Sbjct  275   FFDHVADSDRESD  287



>ref|XP_002512328.1| phosphoglycerate mutase, putative [Ricinus communis]
 gb|EEF49780.1| phosphoglycerate mutase, putative [Ricinus communis]
Length=319

 Score =   180 bits (457),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 119/169 (70%), Gaps = 13/169 (8%)
 Frame = +1

Query  181  NIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQ  360
            N+   D++  P K L           P+RIILVRHG+S+GN+D + YT   D K+ +T  
Sbjct  22   NMINNDHSHHPYKFL-----------PKRIILVRHGESEGNLDTAAYTTTPDNKIPLTPS  70

Query  361  GVAEAEECGRRIREMIEK--DEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREE  534
            G+++AE  G  +  +I +  + A++W+VYFYVSPY+R L TLR + ++FER RI GVREE
Sbjct  71   GLSQAETAGIHLHNLISESNNHAQNWRVYFYVSPYQRTLSTLRGIGRSFERERIIGVREE  130

Query  535  PRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
             R+REQDFGNFQ +E+MK+ K  RER+GRFFYRFP GESAADV+DR++ 
Sbjct  131  CRIREQDFGNFQVKERMKVIKETRERFGRFFYRFPEGESAADVFDRVSS  179


 Score =   123 bits (309),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 8/140 (6%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R +   + S ++NLI++SHGLT RVFLM+W+KWTV+QFE L+N G
Sbjct  177   VSSFLESLWRDIDMNRLQK--DPSSDLNLIIISHGLTCRVFLMKWFKWTVDQFERLNNPG  234

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G GG YSL +HHT EE+ ++GL+ +M+ DQ+W+  A  G+ N  C     S
Sbjct  235   NCEYRVMELGDGGEYSLAIHHTDEEMQEWGLSPEMIADQKWRVHAHRGDWNESCSWYFDS  294

Query  1110  YFTHF------DDDNKN*DC  1151
             +F H       + D+K  DC
Sbjct  295   FFDHLKLDSNKESDDKADDC  314



>gb|KFK37920.1| hypothetical protein AALP_AA3G047500 [Arabis alpina]
Length=314

 Score =   176 bits (446),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +TE G+ +A+E G R+ ++I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTESGLIQAQEAGARLHDLISSNSSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   126 bits (317),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KW+VEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWSVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL K+GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELEKWGLSPEMIADQKWRVNAHKGEWKDDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D +K
Sbjct  266   FFDHLTDSDK  275



>ref|XP_010550965.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Tarenaya 
hassleriana]
Length=311

 Score =   169 bits (427),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YTR  D K+ +TE G  +A E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTRTPDNKIPLTECGRVQAREAGARLHALISSNASSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            ++FYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K  RER+
Sbjct  69   LFFYVSPYERTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVQERMRATKMARERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   132 bits (331),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 89/132 (67%), Gaps = 6/132 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R   +P  E    +NL++VSHGLT RVFLM+W+KWTVEQFEGL+N
Sbjct  148   VSSFLESLWRDIDMNRLHIDPTHE----LNLVIVSHGLTSRVFLMKWFKWTVEQFEGLNN  203

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN  + VME GYGG YSL +HH++EEL  +GL+ +M+ DQ+W+  A  GE N   L   
Sbjct  204   PGNSEIRVMESGYGGEYSLAIHHSEEELQAWGLSPEMIADQKWRVHAHKGEWNEHSLWNF  263

Query  1104  PSYFTHFDDDNK  1139
               +F HF D +K
Sbjct  264   GQFFDHFTDSDK  275



>ref|XP_006408105.1| hypothetical protein EUTSA_v10021179mg [Eutrema salsugineum]
 gb|ESQ49558.1| hypothetical protein EUTSA_v10021179mg [Eutrema salsugineum]
Length=312

 Score =   174 bits (441),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            PRRIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PRRIILVRHGESEGNLDTAAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   125 bits (313),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEALNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HH++EEL K+GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHSEEELEKWGLSPEMIADQKWRVHAHKGEWKEDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D +K
Sbjct  266   FFDHLADSDK  275



>dbj|BAF01531.1| hypothetical protein [Arabidopsis thaliana]
Length=284

 Score =   173 bits (438),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   126 bits (316),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KW+VEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWSVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELATWGLSPEMIADQKWRANAHKGEWKEDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D +K
Sbjct  266   FFDHMADSDK  275



>ref|XP_010464036.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Camelina 
sativa]
Length=318

 Score =   174 bits (442),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +TE G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTESGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   124 bits (312),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELTAWGLSPEMIADQKWRVNAHKGEWKDDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D ++
Sbjct  266   FFDHMTDSDQ  275



>ref|NP_187168.1| phosphoglycerate mutase family protein [Arabidopsis thaliana]
 sp|Q9MAA2.1|AT74_ARATH RecName: Full=Phosphoglycerate mutase-like protein AT74; Short=At-74 
[Arabidopsis thaliana]
 gb|AAF27023.1|AC009177_13 unknown protein [Arabidopsis thaliana]
 gb|AEE74200.1| phosphoglycerate mutase family protein [Arabidopsis thaliana]
Length=316

 Score =   173 bits (438),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   126 bits (316),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KW+VEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWSVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELATWGLSPEMIADQKWRANAHKGEWKEDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D +K
Sbjct  266   FFDHMADSDK  275



>ref|XP_002262723.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Vitis vinifera]
Length=298

 Score =   172 bits (435),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = +1

Query  253  PRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDW  432
            P P+RIILVRHG+S GN+D + YT   D ++ +T QG+ +A++ G RIR+++    + DW
Sbjct  13   PLPKRIILVRHGESAGNLDGTAYTTTPDHQIPLTPQGLVQAKQAGERIRQIV-SGLSRDW  71

Query  433  KVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            KVYFYVSPY R   TL  + ++F + R+ GVREE R+REQDFGNFQ  E+MK+ K  R R
Sbjct  72   KVYFYVSPYERTRSTLSEIGRSFSKKRVIGVREECRIREQDFGNFQVEERMKVVKETRLR  131

Query  613  YGRFFYRFPNGESAADVYDRIT  678
            +GRFFYRFP GESAADVYDR++
Sbjct  132  FGRFFYRFPEGESAADVYDRVS  153


 Score =   127 bits (318),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     E S ++N I+V+HGLT RVFLM+W+KWTVEQFEGL+N+G
Sbjct  152   VSSFLESLWRDIDMNRLH--NEPSSDLNFIIVTHGLTSRVFLMKWFKWTVEQFEGLNNLG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++K+GL+ +M+ DQ+W+  A  G+ N  C     S
Sbjct  210   NCEFQVMQLGNGGEYSLAIHHTEEEMIKWGLSHEMIADQKWRAHAHRGDWNEKCSWYLDS  269

Query  1110  YFTHFDDDNKN  1142
             +F +  + + +
Sbjct  270   FFENLQESDSS  280



>ref|XP_002882400.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58659.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=320

 Score =   173 bits (438),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTTAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   125 bits (314),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELATWGLSPEMIADQKWRVNAHKGEWKEDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D ++
Sbjct  266   FFDHMADSDR  275



>ref|XP_010424476.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Camelina 
sativa]
Length=314

 Score =   173 bits (438),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   124 bits (312),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFEGL+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEGLNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NSEIRVMELGQGGDYSLAIHHTEEELTAWGLSPEMIADQKWRVNAHKGEWKDDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F H  D ++
Sbjct  266   FFDHMTDSDQ  275



>ref|XP_006361882.1| PREDICTED: broad-range acid phosphatase DET1-like [Solanum tuberosum]
Length=301

 Score =   174 bits (442),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +1

Query  241  TVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE-KD  417
            T K   P+RIILVRHG+SQGN D++ Y+   D K+ +T QG+ +A++ G RI +++    
Sbjct  13   TQKYHLPKRIILVRHGESQGNKDDAAYSVTPDYKIPLTAQGIEQAKQAGSRILDVVSGHG  72

Query  418  EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEK  597
             +E+WKVYFYVSPY R   TLR + +AF ++R+ GVREE R+REQDFGNFQ  E+MK+ K
Sbjct  73   SSENWKVYFYVSPYARTRSTLREIGRAFPKNRMLGVREECRVREQDFGNFQVAERMKVIK  132

Query  598  AVRERYGRFFYRFPNGESAADVYDRIT  678
              RER+GRFFYRFP GESAADVYDR++
Sbjct  133  ETRERFGRFFYRFPEGESAADVYDRVS  159


 Score =   123 bits (308),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPN--MNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F ETL  D+D+ R       +PN  +NL++VSHGL  RVFLM+W+KWTVEQFE L+N
Sbjct  158   VSHFLETLWRDVDMNRHH----HNPNEELNLVIVSHGLASRVFLMKWFKWTVEQFEYLNN  213

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VME G GG YSL +HHT EE++++G++ +M+ DQ+W+  A  G LN  C    
Sbjct  214   LGNCEFRVMELGAGGEYSLAVHHTDEEMLEWGMSPEMIADQKWRANANRGTLNDHCPWYL  273

Query  1104  PSYFTHFDDDN  1136
              ++F H  D N
Sbjct  274   DAFFDHLADSN  284



>ref|XP_007030786.1| Phosphoglycerate mutase family protein isoform 1 [Theobroma cacao]
 gb|EOY11288.1| Phosphoglycerate mutase family protein isoform 1 [Theobroma cacao]
Length=297

 Score =   177 bits (449),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE-KDEAEDWK  435
            P+RIILVRHG+S GN+D S Y+   D K+ +TEQG A+A + G  +R++I       DW+
Sbjct  15   PKRIILVRHGESDGNLDTSAYSTTPDHKISLTEQGRAQARQAGSHLRDLISGHGSCSDWR  74

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R L TLR + K+F + R+ GVREE R+REQDFGNFQ   +MK+ K  RE++
Sbjct  75   VYFYVSPYERTLSTLREIGKSFSKKRVIGVREECRIREQDFGNFQVEGRMKVIKETREKF  134

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  135  GRFFYRFPEGESAADVFDRVS  155


 Score =   119 bits (299),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++NLI++SHGL  RVFLM+W+KWTV+QFE L+N+G
Sbjct  154   VSSFLESLWRDIDLNRLH--NDPSHDLNLIIISHGLAARVFLMKWFKWTVKQFELLNNLG  211

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G+GG YSL +HHT EEL+++GL+ +M+ DQ+W+  +     N  C     S
Sbjct  212   NCEIRVMELGHGGEYSLAIHHTDEELLEWGLSPEMIEDQKWRIHSDKASWNDHCSYYLNS  271

Query  1110  YFTHFDDDNKN  1142
             +F H  D +++
Sbjct  272   FFDHQLDSDED  282



>ref|XP_006298173.1| hypothetical protein CARUB_v10014223mg [Capsella rubella]
 gb|EOA31071.1| hypothetical protein CARUB_v10014223mg [Capsella rubella]
Length=313

 Score =   172 bits (436),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   D K+ +T+ G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDHKIQLTDSGLLQAQEAGTRLHALISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F   R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSHRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   125 bits (313),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R    P  E    +N ++VSHGLT RVFLM+W+KWTVEQFEGL+N
Sbjct  148   VSSFLESLWRDIDMNRLHINPTHE----LNFVIVSHGLTSRVFLMKWFKWTVEQFEGLNN  203

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN  + VME G GG YSL +HHT+EEL  +GL+ +M+ DQ+W+  A  GE   DC    
Sbjct  204   PGNSEIRVMELGQGGDYSLAIHHTEEELAAWGLSPEMIADQKWRVNAHKGEWKEDCKWYF  263

Query  1104  PSYFTHFDDDNK  1139
               +F H  D ++
Sbjct  264   GDFFDHLTDSDQ  275



>ref|XP_009147267.1| PREDICTED: uncharacterized protein LOC103870846 [Brassica rapa]
Length=314

 Score =   173 bits (439),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   DPK+ +TE G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDPKIQLTESGLLQAQEAGARLHSLISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ  E+M+  K  RER+
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVEERMRETKVDRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   121 bits (304),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  148   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEALNNPG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  206   NTEIRVMELGQGGDYSLAIHHTEEELERWGLSPEMIADQKWRVNAHKGEWKEDCKWYFGD  265

Query  1110  YFTHFDDDNK  1139
             +F    D +K
Sbjct  266   FFHDLADSDK  275



>ref|XP_009757980.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=294

 Score =   173 bits (438),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EK  414
            + VK   P+RIILVRHG+SQGN D++ Y+   D K+ +T +G+ +A + G RI +++ + 
Sbjct  9    SDVKYHLPKRIILVRHGESQGNKDDNAYSVTPDYKIPLTTRGIEQANQAGSRILDVVSDH  68

Query  415  DEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
              +++WKVYFYVSPY R   TLR + +AF R R+ GVREE R+REQDFGNFQ  E+MK+ 
Sbjct  69   GSSDNWKVYFYVSPYVRTRSTLREIGRAFPRDRVLGVREECRVREQDFGNFQVAERMKVI  128

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  129  KETRERFGRFFYRFPEGESAADVYDRVS  156


 Score =   121 bits (303),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPN--MNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  D+D+ R        PN  +NL+++SHGL  RVFLM+W+KWTVEQFE L+N
Sbjct  155   VSHFLESLWRDVDMNRHH----HDPNDELNLVIISHGLASRVFLMKWFKWTVEQFEYLNN  210

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VME G GG YSL +HH+ EE++++GL+ +M+ DQ+W+  A  G LN  C    
Sbjct  211   LGNCEFRVMELGAGGEYSLAVHHSDEEMLEWGLSPEMIADQKWRANASRGSLNDHCPRYL  270

Query  1104  PSYFTHFDDDN  1136
              ++F H  D N
Sbjct  271   DAFFDHLTDSN  281



>ref|XP_003554670.1| PREDICTED: uncharacterized protein LOC100785272 [Glycine max]
Length=291

 Score =   176 bits (447),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+SQGN+  + Y  + DPK+ +T +G+A+A   G RIR +I  + + +W+V
Sbjct  10   PKRIILVRHGESQGNLQPTAYDTIPDPKIQLTPEGIAQARHAGHRIRHVIAGEGSTNWRV  69

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M + K  R+R+G
Sbjct  70   YFYVSPYARTRSTLREIGRSFSRKRVIGVREECRIREQDFGNFQVQERMNVIKETRQRFG  129

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFP GESAADV+DR++
Sbjct  130  RFFYRFPEGESAADVFDRVS  149


 Score =   117 bits (292),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R     + S ++NLI+VSHGL  RVFLM+W+KWTVEQFE L+N  
Sbjct  148   VSSFLESLWRDVDMNRLN--HDPSDDLNLIIVSHGLASRVFLMKWFKWTVEQFELLNNFE  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG   V++ G GG YSL +HHT EEL+++GL+  M+ DQ+ +  A  G+ N  C     +
Sbjct  206   NGEFRVIQLGSGGEYSLAVHHTDEELLEWGLSPDMVADQKRRASASKGDWNDPCSWYLDA  265

Query  1110  YFTHF---DDDN  1136
             +F H    DDDN
Sbjct  266   FFDHLPDSDDDN  277



>ref|XP_004230163.2| PREDICTED: phosphoglycerate mutase-like protein AT74H [Solanum 
lycopersicum]
Length=327

 Score =   171 bits (433),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +1

Query  241  TVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE  420
            T K   P+RIILVRHG+SQGN D++ Y    D K+ +T QG+ +A++ G RI +++    
Sbjct  39   TQKYHLPKRIILVRHGESQGNKDDAAYGVTPDYKIPLTAQGIEQAKQAGSRILDVVSGHG  98

Query  421  AED-WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEK  597
            + D WKVYFYVSPY R   TLR + +AF ++R+ GVREE R+REQDFGNFQ  E+MK+ K
Sbjct  99   SSDNWKVYFYVSPYVRTRSTLREIGRAFPKNRMLGVREECRVREQDFGNFQVAERMKVIK  158

Query  598  AVRERYGRFFYRFPNGESAADVYDRIT  678
              RE++GRFFYRFP GESAADVYDR++
Sbjct  159  ETREKFGRFFYRFPEGESAADVYDRVS  185


 Score =   122 bits (305),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 86/130 (66%), Gaps = 4/130 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFE-PPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNI  926
             +  F ETL  D+D+ R    P E+   +NL++VSHGL  RVFLM+W+KWTVEQFE L+N+
Sbjct  184   VSHFLETLWRDVDMNRHHHNPNEE---LNLVIVSHGLASRVFLMKWFKWTVEQFEYLNNL  240

Query  927   GNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGP  1106
             GN    VME G GG YSL +HHT EE++++G++ +M+ DQ+W+  A  G LN  C     
Sbjct  241   GNCEFRVMELGAGGEYSLAVHHTDEEMLEWGMSPEMIADQKWRANANRGTLNDHCPWYLD  300

Query  1107  SYFTHFDDDN  1136
             ++F H  D N
Sbjct  301   AFFDHLVDSN  310



>ref|XP_004135635.1| PREDICTED: uncharacterized protein LOC101211877 [Cucumis sativus]
 ref|XP_004157262.1| PREDICTED: uncharacterized LOC101211877 [Cucumis sativus]
 gb|KGN66109.1| hypothetical protein Csa_1G571810 [Cucumis sativus]
Length=313

 Score =   173 bits (438),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = +1

Query  217  KILKHNPATVKPP---RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
             I  H   T + P    P+RIILVRHG+SQGN++ + YT   D KV +TE+G+ +A   G
Sbjct  4    NIETHQNHTHRKPISILPKRIILVRHGESQGNLNSATYTTTPDNKVPLTEEGLIQARIAG  63

Query  388  RRIREMIEKDEAE-DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGN  564
              +R ++  D     W+VYFYVSPY R   TLR + +AF + RI GVREE R+REQDFGN
Sbjct  64   TELRRLLSNDGTNPHWRVYFYVSPYERTRSTLREIGRAFSKKRIIGVREECRIREQDFGN  123

Query  565  FQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            FQ  E+MK+ K  RER+GRFFYRFP GESAADVYDR++ 
Sbjct  124  FQVEERMKVVKETRERFGRFFYRFPEGESAADVYDRVSS  162


 Score =   119 bits (299),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S ++NLI++SHGLT RVFLM+W+KWTVEQFE L+N  
Sbjct  160   VSSFLESLWRDIDMNRLR--HNPSQDLNLIIISHGLTSRVFLMKWFKWTVEQFEYLNNPE  217

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A  G+ N  C    P 
Sbjct  218   NCECRVMQLGEGGEYSLAIHHTEEEMLEWGLSHEMIADQKWRASAHKGQWNERC----PW  273

Query  1110  YFTHFDDDNKN*DC  1151
             Y   F D+  + DC
Sbjct  274   YLHAFFDNLADTDC  287



>ref|XP_004495754.1| PREDICTED: broad-range acid phosphatase DET1-like [Cicer arietinum]
Length=289

 Score =   172 bits (437),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIIL+RHG+SQGN+D S YT   D  + +T QG+A+A   G  +R ++       DW+
Sbjct  5    PKRIILMRHGESQGNLDTSAYTTTPDHSIQLTPQGIAQARHAGAELRRVVAGQGCSPDWR  64

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +YFYVSPY R   TLR + ++F + R+ GVREE R+REQDFGNFQ +E+MKI K  RER+
Sbjct  65   LYFYVSPYARARSTLREVGRSFSKKRLIGVREESRVREQDFGNFQVQERMKIIKETRERF  124

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DRI+G
Sbjct  125  GRFFYRFPEGESAADVFDRISG  146


 Score =   120 bits (300),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 84/125 (67%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GF E+L  DID+ R     + S ++NL++VSHGLT R+F+M+W+KWTVEQFE L+N G
Sbjct  144   ISGFFESLWRDIDLNRLH--NDPSNDLNLVIVSHGLTSRIFMMKWFKWTVEQFEHLNNFG  201

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    V+++G GG YSL ++HT+EE++++GL+  M+ DQ+W+  A  G  N  C      
Sbjct  202   NCEFRVIQQGSGGEYSLAVYHTEEEMLEWGLSPDMIADQKWRATAPKGAWNDQCPWYLDG  261

Query  1110  YFTHF  1124
             +F  F
Sbjct  262   FFDSF  266



>ref|XP_010111865.1| hypothetical protein L484_020658 [Morus notabilis]
 gb|EXC31830.1| hypothetical protein L484_020658 [Morus notabilis]
Length=298

 Score =   169 bits (427),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE-A  423
            K   P+RIIL+RHG+SQGN+D + YT   D ++ +T+ G+A+A   G R+R+++     A
Sbjct  10   KAGLPKRIILMRHGESQGNLDGAAYTTTPDYRIPLTDNGLAQASSAGARLRDVVSGGGCA  69

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
            + W+VYFYVSPY R   TLR + K+F + R+ GVREE R+REQDFGNFQ  + MK  K  
Sbjct  70   KSWRVYFYVSPYERTRSTLREVGKSFSKRRVIGVREECRIREQDFGNFQVEDTMKATKQT  129

Query  604  RERYGRFFYRFPNGESAADVYDRIT  678
            RER+GRFFYRFP GESAAD++DR++
Sbjct  130  RERFGRFFYRFPEGESAADIFDRVS  154


 Score =   124 bits (310),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R   +P  E    +NLI++SHGLTLRVFLM+W+KWTVEQFE L+N
Sbjct  153   VSSFLESLWRDIDMNRLHRDPTDE----LNLIIISHGLTLRVFLMKWFKWTVEQFEQLNN  208

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VM+ G GG YSL +HHT+EEL+++GL+ +M+ +Q+W+  A   + N  C    
Sbjct  209   LGNCKFRVMQLGSGGEYSLAIHHTEEELLEWGLSPEMIAEQKWRAGANRSDWNEKCPWYL  268

Query  1104  PSYFTHFDDDN  1136
              S+F  F D +
Sbjct  269   DSFFDQFADSD  279



>gb|KHG03047.1| Putative phosphoglycerate mutase DET1 [Gossypium arboreum]
Length=307

 Score =   174 bits (440),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EAEDWK  435
            P+ IILVRHG+S+GN D S Y+ + D K+ +TE G A+A   G R+R++I     ++DW+
Sbjct  19   PKHIILVRHGESEGNKDTSAYSTIPDHKISLTEHGRAQARLAGSRLRDLISSHGSSQDWR  78

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + K+F + R+ GVREE R+REQDFGNFQ  E+MK  K  RE++
Sbjct  79   VYFYVSPYERTRSTLREIGKSFSKKRVIGVREECRIREQDFGNFQVEERMKATKETREKF  138

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DR++ 
Sbjct  139  GRFFYRFPEGESAADVFDRVSS  160


 Score =   118 bits (296),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++NLI++SHGL  RVFLM+W+KWTVEQFE L+N G
Sbjct  158   VSSFLESLWRDIDLNRLN--NDPSQDLNLIIISHGLASRVFLMKWFKWTVEQFERLYNPG  215

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT EEL ++GL+ +M+ DQ+W+  A   +LN  C     S
Sbjct  216   NCEIRVMELGRGGEYSLAIHHTDEELREWGLSPEMIEDQKWRINANKTDLNDHCKWYLNS  275

Query  1110  YF  1115
             +F
Sbjct  276   FF  277



>ref|XP_004248821.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Solanum 
lycopersicum]
Length=321

 Score =   179 bits (453),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +1

Query  226  KHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREM  405
            +H P  V    P+RIILVRHG+S+GN D+++YT   D ++ +T +G+ +A+E G RI ++
Sbjct  32   QHKPVAVPKCLPKRIILVRHGESEGNKDDAMYTITPDYRIPLTPKGIDQAKEAGSRIFDI  91

Query  406  IEKDEAED-WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQ  582
            +  + +ED WKVYFYVSPY R   TLR + +AF R R+ GVREE R+REQDFGNFQ  ++
Sbjct  92   VSDNGSEDNWKVYFYVSPYVRARSTLREIGRAFSRRRVLGVREECRIREQDFGNFQVADR  151

Query  583  MKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            MK+ K  RER+GRFFYRFP GESAADVYDR++ 
Sbjct  152  MKVIKETRERFGRFFYRFPEGESAADVYDRVSS  184


 Score =   113 bits (283),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + + ++NL+++SHGL  RVFLM+W+KWTVEQFE L+N+G
Sbjct  182   VSSFLESLWRDIDMNRLH--HDPNDDLNLVIISHGLASRVFLMKWFKWTVEQFEYLNNLG  239

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    V++ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A        C     +
Sbjct  240   NCGFRVLQLGLGGEYSLAVHHTEEEMLEWGLSPEMISDQKWRAHASRSSWKDKCSWYLDA  299

Query  1110  YFTHFDDDNKN  1142
             +F H  + +++
Sbjct  300   FFDHLTNSDED  310



>emb|CDP17973.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   172 bits (436),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDEAEDWK  435
            P+RIILVRHG+SQGN D+S Y    D K+ +T  G+++A + G  IR+++ ++  +++W+
Sbjct  29   PKRIILVRHGESQGNKDDSAYVATPDYKIPLTSTGISQARQAGLGIRQVVSDQGSSQNWR  88

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +YFYVSPY R   TLR + +AF R R+ GVREE R+REQDFGNFQ  E+MKI K  RE++
Sbjct  89   IYFYVSPYERTRSTLREIGRAFSRRRLIGVREECRIREQDFGNFQVAERMKIIKQTREKF  148

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADVYDR++
Sbjct  149  GRFFYRFPEGESAADVYDRVS  169


 Score =   119 bits (298),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R +     + ++NL++VSHGL +RVFLM+W+KWTVEQFE L+N+G
Sbjct  168   VSSFLESLWRDIDMNRLQQNA--ADDLNLVIVSHGLAIRVFLMKWFKWTVEQFEYLNNLG  225

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL ++H+ EE+  +GL+  M+ DQ W+  AK G+ N  C    P 
Sbjct  226   NCEFRVMQLGIGGEYSLAVNHSDEEMQAWGLSSDMIADQRWRAHAKKGDWNEKC----PW  281

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  282   YLDAFFD  288



>ref|XP_003591056.1| hypothetical protein MTR_1g082360 [Medicago truncatula]
 gb|AES61307.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Medicago 
truncatula]
Length=292

 Score =   170 bits (431),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIIL+RHG+SQGN+D S YT   D  + +T  G+A+A   G  +  ++       DW+
Sbjct  5    PKRIILMRHGESQGNLDTSAYTTTPDHSIQLTPSGIAQARHAGANLHRLVSGQGCSPDWR  64

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +YFYVSPY R   TLR + ++F + R+ GVREE R+REQDFGNFQ +E+MKI K  RER+
Sbjct  65   LYFYVSPYARTRSTLREVGRSFSKKRVIGVREESRVREQDFGNFQVQERMKIVKETRERF  124

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DRI+G
Sbjct  125  GRFFYRFPEGESAADVFDRISG  146


 Score =   121 bits (303),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GF E+L  DID+ R     + + ++NL++VSHGLT R+FLM+W+KWTVEQFE L+N G
Sbjct  144   ISGFFESLWRDIDLNRLH--HDPTNDLNLVIVSHGLTSRIFLMKWFKWTVEQFEHLNNFG  201

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME+G GG YSL ++HT+EE++++G++  M+ DQ+W+  A  G  N  C      
Sbjct  202   NCEFRVMEQGSGGEYSLAINHTEEEMLEWGMSPDMIADQKWRADAPRGAWNDQCPWYLDG  261

Query  1110  YFTHFDDDNKN*DC  1151
             +F  FD    + D 
Sbjct  262   FFDRFDASESDDDT  275



>ref|XP_009124067.1| PREDICTED: uncharacterized protein LOC103848992 [Brassica rapa]
Length=306

 Score =   169 bits (427),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D S YT   D K+ +TE G+ +A+E G R+R ++  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTSAYTTTPDHKIQLTESGLLQAQEAGARLRSLLSSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VCFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   122 bits (307),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R    P  E    +N ++VSHGLT RVFLM+W+KWTVEQFE L+N
Sbjct  148   VSSFLESLWRDIDMNRLHMNPTHE----LNFVIVSHGLTSRVFLMKWFKWTVEQFEALNN  203

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN  + VME G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  GE   DC    
Sbjct  204   PGNSEIRVMELGQGGDYSLAIHHTEEELERWGLSPEMIADQKWRVNAHKGEWKEDCKWYF  263

Query  1104  PSYFTHFDDDN  1136
               +F H  D +
Sbjct  264   GDFFDHMADSD  274



>emb|CDY53231.1| BnaCnng24640D [Brassica napus]
Length=302

 Score =   168 bits (425),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D S YT   D K+ +TE G+ +A E G R+R ++  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTSAYTTTPDHKIQLTESGLLQAREAGARLRSLLSSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +++M++ K VRER+
Sbjct  69   VCFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKDRMRVTKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DR++ 
Sbjct  129  GRFFYRFPEGESAADVFDRVSS  150


 Score =   123 bits (309),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R    P  E    +N ++VSHGLT RVFLM+W+KWTVEQFE L+N
Sbjct  148   VSSFLESLWRDIDMNRLHMNPTHE----LNFVIVSHGLTSRVFLMKWFKWTVEQFEALNN  203

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN  + VME G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  GE   DC    
Sbjct  204   PGNSEIRVMELGQGGDYSLAIHHTEEELERWGLSPEMIADQKWRVNAHKGEWKEDCKWYF  263

Query  1104  PSYFTHFDDDNK  1139
               +F H  D ++
Sbjct  264   GDFFDHMADSDQ  275



>ref|XP_001778688.1| predicted protein [Physcomitrella patens]
 gb|EDQ56481.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   180 bits (457),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE-KDEAEDWK  435
            PRRIILVRHG+S+GNVD   Y  +ADPK+ +TE G  +A+ECG +IR+MI+ + E ++W 
Sbjct  1    PRRIILVRHGESEGNVDSKKYCDIADPKIRLTEAGANQAKECGEKIRDMIKTQSEDDEWL  60

Query  436  VYFYVSPYRRGLETLRNLAKAFE--RSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            VYFYVSPY R L TL+ + +AFE  +  I GVREEPR+REQDFGNFQ+  ++   K  R+
Sbjct  61   VYFYVSPYTRTLCTLKEIGRAFESDKKHIVGVREEPRIREQDFGNFQETHKITAVKKERQ  120

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            R+GRFFYRFP GESAADV+DR+T 
Sbjct  121  RFGRFFYRFPEGESAADVFDRVTS  144


 Score =   110 bits (276),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF-EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNI  926
             +  F E+L  DID+ R  +P   ++  +NL++VSHG+T+RVFLMRW+KWTVEQFE L+N 
Sbjct  142   VTSFLESLWRDIDMNRLHKPSSTKTLEVNLVIVSHGVTMRVFLMRWFKWTVEQFEKLNNP  201

Query  927   GNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
              N  + VME G G  YSLL+HHT+EEL ++GL   M+ DQE +K  K
Sbjct  202   KNCEVRVMELGEGEEYSLLVHHTQEELEEWGLDVDMIKDQEQRKHGK  248



>emb|CDY18784.1| BnaAnng02490D [Brassica napus]
Length=308

 Score =   168 bits (426),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D S YT   D K+ +TE G+ +A+E G R+R ++  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTSAYTTTPDHKIQLTESGLLQAQEAGARLRSLLSSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M+  K VRER+
Sbjct  69   VCFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  129  GRFFYRFPEGESAADVFDRVS  149


 Score =   122 bits (307),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  DID+ R    P  E    +N ++VSHGLT RVFLM+W+KWTVEQFE L+N
Sbjct  148   VSSFLESLWRDIDMNRLHMNPTHE----LNFVIVSHGLTSRVFLMKWFKWTVEQFEALNN  203

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN  + VME G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  GE   DC    
Sbjct  204   PGNSEIRVMELGQGGDYSLAIHHTEEELERWGLSPEMIADQKWRVNAHKGEWKEDCKWYF  263

Query  1104  PSYFTHFDDDN  1136
               +F H  D +
Sbjct  264   GDFFDHMADSD  274



>emb|CDY41943.1| BnaC05g46610D [Brassica napus]
Length=316

 Score =   167 bits (424),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE---D  429
            P+RIILVRHG+S+GN+D + YT   DPK+ +TE G+ +A+E G R+  +I  + +     
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDPKIQLTESGLLQAQEAGARLHSLISSNPSSPEWR  68

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            W+V FYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ  E+M+  K  RE
Sbjct  69   WRVCFYVSPYDRTRSTLREIGRSFSRRRVIGVREECRIREQDFGNFQVEERMRETKVDRE  128

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            R+GRFFYRFP GESAADV+DR++ 
Sbjct  129  RFGRFFYRFPEGESAADVFDRVSS  152


 Score =   123 bits (308),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  150   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEALNNPG  207

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL K+GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  208   NSEIRVMELGQGGDYSLAIHHTEEELEKWGLSPEMIADQKWRVNAHKGEWKEDCKWYFGD  267

Query  1110  YFTHFDDDNK  1139
             +F    D +K
Sbjct  268   FFHDLADSDK  277



>ref|XP_003556497.1| PREDICTED: broad-range acid phosphatase DET1-like [Glycine max]
Length=286

 Score =   166 bits (421),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIIL+RHG+SQGN++ + YT   D  + +T QG+ +A   G ++R ++  D    DW+
Sbjct  6    PKRIILMRHGESQGNLNTAAYTTTPDHSIQLTAQGMTQARHAGEQLRRVMGGDGCSPDWR  65

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR L + F R RI GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  66   VQFYVSPYGRTRSTLRELGRHFSRKRIIGVREESRVREQDFGNFQVEERMKVIKETRERF  125

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  126  GRFFYRFPEGESAADVFDRVS  146


 Score =   124 bits (311),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 87/129 (67%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++N ++VSHGLT R+FLM+W+KWTVEQFE L+N G
Sbjct  145   VSSFFESLWRDIDMNRLR--HDPSNDLNFVIVSHGLTSRIFLMKWFKWTVEQFEHLNNFG  202

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A  G+ N  C     +
Sbjct  203   NCEFRVMQLGSGGEYSLAVHHTEEEMLEWGLSPEMIADQKWRATAIRGDWNDQCPWYLDA  262

Query  1110  YFTHFDDDN  1136
             +F H  DD+
Sbjct  263   FFDHLPDDD  271



>gb|KHG00939.1| Putative phosphoglycerate mutase DET1 [Gossypium arboreum]
Length=290

 Score =   172 bits (437),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +1

Query  226  KHNPATVKP-PRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIRE  402
            K+N  + K    P+RIILVRHG+S+GN+D S Y+   D K+ +TE+G A+A   G  +R+
Sbjct  7    KNNHQSCKTRLLPKRIILVRHGESEGNLDTSAYSTTPDYKISLTEEGRAQACLAGSHLRD  66

Query  403  MIEKD-EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDRE  579
            ++       DW+VYFYVSPY R   TLR + K+F + R+ GVREE R+REQDFGNFQ  E
Sbjct  67   LVSSHGHCPDWRVYFYVSPYERTRSTLREIGKSFSKKRVIGVREECRIREQDFGNFQVEE  126

Query  580  QMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            +MKI K  RER+GRFFYRFP GESAADV+DR++ 
Sbjct  127  RMKIIKETRERFGRFFYRFPEGESAADVFDRVSS  160


 Score =   117 bits (294),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++NLI++SHGL  RVFLM+W+KWTVEQFE L+N+G
Sbjct  158   VSSFLESLWRDIDLNRLH--SDSSQDLNLIIISHGLASRVFLMKWFKWTVEQFERLNNLG  215

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G+GG YSL ++H+ EEL+++GL+ +M+ DQ+W+      + N  C     S
Sbjct  216   NCEIRVMELGHGGEYSLAINHSDEELLEWGLSPEMIKDQKWRIDGNKADWNDHCTWYLRS  275

Query  1110  YFTHFDD  1130
             +F +  D
Sbjct  276   FFDYESD  282



>emb|CDY27789.1| BnaA05g31980D [Brassica napus]
Length=317

 Score =   168 bits (425),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S+GN+D + YT   DPK+ +TE G+ +A+E G R+  +I  + +  +W+
Sbjct  9    PKRIILVRHGESEGNLDTAAYTTTPDPKIQLTESGLLQAQEAGARLHSLISSNPSSPEWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEP---RLREQDFGNFQDREQMKIEKAVR  606
            VYFYVSPY R   TLR + ++F R R+ GVREE    R+REQDFGNFQ  E+M+  K  R
Sbjct  69   VYFYVSPYDRTRSTLREIGRSFSRRRVIGVREEWAQCRIREQDFGNFQVEERMRETKVDR  128

Query  607  ERYGRFFYRFPNGESAADVYDRIT  678
            ER+GRFFYRFP GESAADV+DR++
Sbjct  129  ERFGRFFYRFPEGESAADVFDRVS  152


 Score =   121 bits (304),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S  +N ++VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  151   VSSFLESLWRDIDMNRLHI--NPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEALNNPG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VME G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  GE   DC      
Sbjct  209   NTEIRVMELGQGGDYSLAIHHTEEELERWGLSPEMIADQKWRVNAHKGEWKEDCKWYFGD  268

Query  1110  YFTHFDDDNK  1139
             +F    D +K
Sbjct  269   FFHDLADSDK  278



>ref|XP_009613887.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   174 bits (440),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 114/156 (73%), Gaps = 4/156 (3%)
 Frame = +1

Query  226  KHNPATVKP-PR--PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRI  396
             HN    KP P+  P+RIILVRHG+S+GN D+++YT   D ++ +T +G+ +A+E G RI
Sbjct  28   SHNNNPQKPIPKCLPKRIILVRHGESEGNRDDAMYTVTPDYRIPLTPKGIGQAKEAGSRI  87

Query  397  REMIEKDEAED-WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD  573
             ++I  +   D WKVYFYVSPY R   TLR + +AF R R+ GVREE R+REQDFGNFQ 
Sbjct  88   FDVISDNGTSDNWKVYFYVSPYVRTRSTLREMGRAFSRRRVLGVREECRIREQDFGNFQV  147

Query  574  REQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
             E+MK+ K  RER+GRFFYRFP GESAADVYDR++ 
Sbjct  148  AERMKVIKETRERFGRFFYRFPEGESAADVYDRVSS  183


 Score =   115 bits (289),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + + ++NL+++SHGL  RVFLM+W+KWTVEQFE L+N+G
Sbjct  181   VSSFLESLWRDIDMNRLH--HDPNDDLNLVIISHGLASRVFLMKWFKWTVEQFEYLNNLG  238

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    V++ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A     N  C     +
Sbjct  239   NCEFRVIQLGLGGEYSLAVHHTEEEMLEWGLSPEMISDQKWRAHANRSSWNDKCPWYLDA  298

Query  1110  YFTHF---DDDN  1136
             +F H    DDD+
Sbjct  299   FFDHLANSDDDD  310



>ref|XP_008450693.1| PREDICTED: broad-range acid phosphatase DET1 [Cucumis melo]
 ref|XP_008450694.1| PREDICTED: broad-range acid phosphatase DET1 [Cucumis melo]
 ref|XP_008450695.1| PREDICTED: broad-range acid phosphatase DET1 [Cucumis melo]
Length=313

 Score =   172 bits (435),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+SQGN++ + YT   D KV +TE+G+ +A   G  +R ++  D     W+
Sbjct  21   PKRIILVRHGESQGNLNSATYTTTPDYKVPLTEEGLIQARIAGTELRRLLSNDGTNPHWR  80

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF + RI GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  81   VYFYVSPYERTRSTLREIGRAFSKKRIIGVREECRIREQDFGNFQVEERMKVVKETRERF  140

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADVYDR++ 
Sbjct  141  GRFFYRFPEGESAADVYDRVSS  162


 Score =   117 bits (293),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S ++NLI++SHGLT RVFL +W+KWTVEQFE L+N  
Sbjct  160   VSSFLESLWRDIDMNRLR--HNPSQDLNLIIISHGLTSRVFLTKWFKWTVEQFEYLNNPE  217

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A  G+ N  C    P 
Sbjct  218   NCECRVMQLGEGGEYSLAIHHTEEEMLEWGLSGEMIADQKWRASAHKGQWNERC----PW  273

Query  1110  YFTHFDDDNKN*DC  1151
             Y   F D+  + DC
Sbjct  274   YLHAFFDNLADTDC  287



>ref|XP_009772304.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=323

 Score =   173 bits (439),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED-WK  435
            P+RIILVRHG+S+GN D+++YT   D ++ +T +G+ +A+E G RI ++I  +   D WK
Sbjct  45   PKRIILVRHGESEGNRDDAMYTVTPDYRIPLTPKGIGQAKEAGSRIFDVISDNGTSDNWK  104

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF R R+ GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  105  VYFYVSPYMRTRSTLREMGRAFSRRRVLGVREECRIREQDFGNFQVAERMKVIKETRERF  164

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADVYDR++ 
Sbjct  165  GRFFYRFPEGESAADVYDRVSS  186


 Score =   115 bits (289),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + + ++NL+++SHGL  RVFLM+W+KWTVEQFE L+N+G
Sbjct  184   VSSFLESLWRDIDMNRLH--HDPNDDLNLVIISHGLASRVFLMKWFKWTVEQFEYLNNLG  241

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    V++ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A     N  C     +
Sbjct  242   NCEFRVIQLGLGGEYSLAVHHTEEEMLEWGLSPEMISDQKWRAHANRSSWNDKCPWYLDA  301

Query  1110  YFTHF---DDDN  1136
             +F H    DDD+
Sbjct  302   FFDHLANSDDDD  313



>gb|KHN20196.1| Putative phosphoglycerate mutase DET1 [Glycine soja]
Length=286

 Score =   164 bits (416),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RII++RHG+SQGN++ + YT   D  + +T QG+ +A   G  +R ++  D    DW+
Sbjct  6    PKRIIVMRHGESQGNLNTAAYTTTPDHSIQLTAQGMTQALHAGEHLRRVMGGDGCSPDWR  65

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR L + F R RI GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  66   VQFYVSPYGRTRSTLRELGRHFSRKRIIGVREESRVREQDFGNFQVEERMKVIKETRERF  125

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  126  GRFFYRFPEGESAADVFDRVS  146


 Score =   124 bits (310),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 87/129 (67%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++N ++VSHGLT R+FLM+W+KWTVEQFE L+N G
Sbjct  145   VSSFFESLWRDIDMNRLR--HDPSNDLNFVIVSHGLTSRIFLMKWFKWTVEQFEHLNNFG  202

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++++GL+ +M+ DQ+W+  A  G+ N  C     +
Sbjct  203   NCEFRVMQLGSGGEYSLAVHHTEEEMLEWGLSPEMIADQKWRATAIRGDWNDQCPWYLDA  262

Query  1110  YFTHFDDDN  1136
             +F H  DD+
Sbjct  263   FFDHLPDDD  271



>ref|XP_007147082.1| hypothetical protein PHAVU_006G094900g [Phaseolus vulgaris]
 gb|ESW19076.1| hypothetical protein PHAVU_006G094900g [Phaseolus vulgaris]
Length=294

 Score =   171 bits (433),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+SQGN D + Y    DPK+ +T QG+A+A   G R+R  +    + +W+V
Sbjct  13   PKRIILVRHGESQGNNDPATYDTTPDPKIQLTTQGIAQARLAGTRMRHAVAGGGSTNWRV  72

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F + R+ GVREE R+REQDFGNFQ +++M + K  R+R+G
Sbjct  73   YFYVSPYARTRSTLREIGRSFSKKRVIGVREECRIREQDFGNFQVQDRMNVIKEARQRFG  132

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFP GESAADV+DR++
Sbjct  133  RFFYRFPEGESAADVFDRVS  152


 Score =   117 bits (293),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R     + S ++NLI+VSHGL  RVF+M+W+KWTVEQFE L N+ 
Sbjct  151   VSSFLESLWRDVDMNRLNH--DPSDDLNLIIVSHGLASRVFMMKWFKWTVEQFELLRNLE  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG   V++ G GG YSL +HH  EEL+++GL+  M+ DQ+ +  A  GE N  C     S
Sbjct  209   NGEFRVIQLGSGGEYSLAVHHDDEELLEWGLSPDMVADQKSRACASKGEWNDRCSWYIDS  268

Query  1110  YFTHF---DDDN  1136
             +F H    DDDN
Sbjct  269   FFDHLPDSDDDN  280



>ref|XP_006433195.1| hypothetical protein CICLE_v10001975mg [Citrus clementina]
 ref|XP_006471876.1| PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 
4-like [Citrus sinensis]
 gb|ESR46435.1| hypothetical protein CICLE_v10001975mg [Citrus clementina]
Length=302

 Score =   163 bits (413),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P RIILVRHG+S+GN++   Y    D K+ +T  G+ +   CG R+R ++    A D++V
Sbjct  18   PNRIILVRHGESEGNLNTGAYATTPDNKIPLTPGGIHQGRSCGARLRSLL-SGSANDYRV  76

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F R RI GVREE R+REQDFGNFQ  E+MK+ K  RE++G
Sbjct  77   YFYVSPYERTRSTLREIGRSFSRKRIIGVREECRIREQDFGNFQVSERMKVIKETREKFG  136

Query  619  RFFYRFPNGESAADVYDRIT  678
            RF+YRFP GESAADV+DR++
Sbjct  137  RFYYRFPEGESAADVFDRVS  156


 Score =   124 bits (311),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 6/140 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R +    Q   +NLI+VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  155   VSNFLESLWRDIDLNRLQHDASQE--LNLIIVSHGLTSRVFLMKWFKWTVEQFEHLNNPG  212

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT +E++++GL+ +M+ DQ+W+  A  GE N +C      
Sbjct  213   NCETRVMQLGEGGEYSLAIHHTDQEMLEWGLSPEMIADQKWRAHATRGEWNENCPWYLDE  272

Query  1110  YFTHF----DDDNKN*DCMF  1157
             +F H     +DD K  D  +
Sbjct  273   FFDHLMIDSEDDEKENDAEY  292



>dbj|BAO45876.1| phosphoglycerate mutase [Acacia mangium]
Length=285

 Score =   171 bits (434),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EA  423
            K   P+RIILVRHG+SQGN+D++ Y+   D  + +T+QG+A+A   G ++R+++  D   
Sbjct  6    KTILPQRIILVRHGESQGNLDDAAYSTTPDHDIQLTQQGIAQARLAGAKLRQIVSGDGSG  65

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
             +W++YFYVSPY R   TLR + ++F + R+ GVREE R+REQDFGNFQ +E+MK+ K  
Sbjct  66   PNWRLYFYVSPYHRTRTTLREIGRSFSKKRVLGVREECRVREQDFGNFQVQERMKVIKET  125

Query  604  RERYGRFFYRFPNGESAADVYDRIT  678
            RER+GRF+YRFP GESAADV+DR++
Sbjct  126  RERFGRFYYRFPEGESAADVFDRVS  150


 Score =   116 bits (290),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 83/129 (64%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NL++VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  149   VSNFLESLWRDIDMKRLHMDDKH--DLNLVIVSHGLTSRVFLMKWFKWTVEQFEHLNNPG  206

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VM+ G GG YSL +HH+ E+L+++GL+  M+ DQ+W+  A  G  N  C      
Sbjct  207   NCEIRVMQLGSGGEYSLAVHHSDEQLLEWGLSPDMIADQKWRAAADRGAWNDHCPWYLDE  266

Query  1110  YFTHFDDDN  1136
             +F    DD+
Sbjct  267   FFDRLVDDS  275



>ref|XP_006850858.1| hypothetical protein AMTR_s00025p00142320 [Amborella trichopoda]
 gb|ERN12439.1| hypothetical protein AMTR_s00025p00142320 [Amborella trichopoda]
Length=295

 Score =   153 bits (387),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S GNVD S Y    D ++ +T QG+     CGR IREMIE+D A DW+V
Sbjct  15   PKRIILVRHGESHGNVDYSAYVTTPDHQIPLTPQGLLHGRACGREIREMIERDSAGDWRV  74

Query  439  YFYVSPYRRGLETLRNLAKAF-ERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            YFYVSPY R   TLR + K   ER R+ GVREE R+REQDFGNFQ  E+M+  K  RER+
Sbjct  75   YFYVSPYERTRATLREIGKEIGERKRVIGVREECRIREQDFGNFQVEERMRAVKETRERF  134

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFP GESAADVYDR+T
Sbjct  135  GRFFFRFPEGESAADVYDRVT  155


 Score =   133 bits (334),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R    G    ++NL++VSHGLT R+FLMRW+KWTVEQFE L+N G
Sbjct  154   VTSFLESLWRDIDMNRLNREG--VSDLNLVIVSHGLTSRIFLMRWFKWTVEQFERLNNPG  211

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  AK GE N DC      
Sbjct  212   NCEVRVMQIGSGGEYSLAVHHTEEELERWGLSPEMIADQKWRATAKKGEWNDDCPWYNDD  271

Query  1110  YFTHF  1124
             YF H 
Sbjct  272   YFDHL  276



>ref|XP_006654027.1| PREDICTED: uncharacterized protein LOC102711804 [Oryza brachyantha]
Length=301

 Score =   157 bits (397),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 8/159 (5%)
 Frame = +1

Query  226  KHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREM  405
            +H P  V+   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   GR I ++
Sbjct  4    QHQPQCVRRL-PKRIILVRHGESQGNLDMSAYTTTPDYRIPLTPLGVDQARAAGRAILDV  62

Query  406  IEK-------DEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGN  564
            +             +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGN
Sbjct  63   VSSCSGAGGGGGGANWKVYFYVSPYERTRATLREIGAAFPRHRVIGAREECRVREQDFGN  122

Query  565  FQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            FQ  E+M+  K  RE +GRFF+RFP GESAADV+DR+  
Sbjct  123  FQVEERMRAIKETRELFGRFFFRFPEGESAADVFDRVAS  161


 Score =   129 bits (323),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR E   + S   NL++VSHGLT RVFLM+W+KWTV+QFE L+N  
Sbjct  159   VASFLESLWRDIDMGRLEQ--DASCETNLVIVSHGLTSRVFLMKWFKWTVDQFEHLNNFD  216

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    +M+ G  G YSLL+HHTKEEL ++GL+ +M+ DQ+W+  A  G    +C     +
Sbjct  217   NCEFRIMQLGPAGEYSLLVHHTKEELQRWGLSPEMIADQQWRASANRGSWADECSSFLST  276

Query  1110  YFTHFDDDNKN*D  1148
             +F H++DD ++ D
Sbjct  277   FFDHWNDDEEDND  289



>ref|XP_010674997.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   167 bits (422),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDE-----A  423
            P+RIILVRHG+SQGN+D S Y+   D K+ +T  G+++A   G  IR +++K       A
Sbjct  16   PKRIILVRHGESQGNIDMSAYSITPDHKIQLTSDGISQANIAGNSIRRLLDKSSFSVGAA  75

Query  424  EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
              W+VYFYVSPY R   TLR + ++F + R+ GVREE R+REQDFGNFQ  E+M   K  
Sbjct  76   AAWRVYFYVSPYERTRSTLRQIGRSFPKRRVIGVREECRIREQDFGNFQVEERMSAIKQT  135

Query  604  RERYGRFFYRFPNGESAADVYDRIT  678
            RE++GRFFYRFP GESAADVYDR++
Sbjct  136  REKFGRFFYRFPEGESAADVYDRVS  160


 Score =   119 bits (298),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 88/133 (66%), Gaps = 6/133 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E++  DID+ R   +P  E    +NLI+V+HGL  RVFLM+W+KWTVEQFE L+N
Sbjct  159   VSSFMESMWRDIDMNRLHHDPDHE----LNLIIVTHGLLSRVFLMKWFKWTVEQFELLNN  214

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
              GN    VME G GG YSL ++H+ EEL+++GL+ +M+ DQ+W+  A+ GE N  C    
Sbjct  215   PGNCEYRVMELGEGGDYSLAINHSDEELLEWGLSPEMVADQKWRAHARKGEWNEKCSWYL  274

Query  1104  PSYFTHFDDDNKN  1142
              S+F   +D ++N
Sbjct  275   DSFFDQLEDSDQN  287



>ref|XP_001757629.1| predicted protein [Physcomitrella patens]
 gb|EDQ77686.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   160 bits (406),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = +1

Query  283  HGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED-WKVYFYVSPY  459
            HG+S+GNVD   Y  +ADP++ +TE G  +A++CG +I++MI K+   D W VYFYVSPY
Sbjct  18   HGESEGNVDSKKYCDIADPRIRLTEAGAQQAKQCGEKIQDMIRKESINDEWLVYFYVSPY  77

Query  460  RRGLETLRNLAKAFE--RSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYR  633
             R L TL+ + +AFE  +  I GVREEPR+REQDFGNFQ+  ++   K  R+R+GRFFYR
Sbjct  78   NRTLCTLKEIGRAFENEKKHIIGVREEPRIREQDFGNFQEMHKITAVKKERQRFGRFFYR  137

Query  634  FPNGESAADVYDRIT  678
            FP GESAADV+DR+T
Sbjct  138  FPEGESAADVFDRVT  152


 Score =   125 bits (314),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 86/128 (67%), Gaps = 2/128 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R    G +   +NL++VSHG+T+RVFLMRW+KWTVEQFE L N  
Sbjct  151   VTSFLESLWRDIDMNRLNTSGTKQQEVNLVIVSHGVTMRVFLMRWFKWTVEQFENLRNPK  210

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGE-LNYDCLITGP  1106
             N  + VM++G GG YSLL+HHT+EEL ++GL D M+ DQE +K  K    +N +C+   P
Sbjct  211   NCEIRVMQQGEGGEYSLLVHHTREELEEWGLNDDMIKDQERRKYGKRERWINDECVDHWP  270

Query  1107  -SYFTHFD  1127
              S F  FD
Sbjct  271   WSGFQFFD  278



>ref|XP_011078746.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Sesamum 
indicum]
Length=298

 Score =   168 bits (425),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S GN+D + YT   D K+ +T QG+ +A+  G RI  ++    A  +WK
Sbjct  19   PKRIILVRHGESAGNIDGTAYTTTPDNKIPLTPQGIDQAKRAGSRICHVVSDGGASSNWK  78

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF ++R+ G REE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  79   VYFYVSPYLRTRTTLREIGRAFPKNRVIGAREECRIREQDFGNFQVAERMKVIKETRERF  138

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADVYDR++
Sbjct  139  GRFFYRFPEGESAADVYDRVS  159


 Score =   118 bits (295),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 87/139 (63%), Gaps = 7/139 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S  +NLI+VSHGL +RVFL +W+KWTVEQFE L+N+G
Sbjct  158   VSSFLESLWRDIDMNRLH--QDPSDELNLIIVSHGLAIRVFLTKWFKWTVEQFEYLNNLG  215

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT EE+ ++GL+  M+ DQ W+  A  G+ N  C     +
Sbjct  216   NSEFRVMQLGIGGDYSLAVHHTDEEMQQWGLSPDMIADQRWRAHAARGDWNEKCPWYLDT  275

Query  1110  YFTHF----DDDN-KN*DC  1151
             +F  F    D DN ++ DC
Sbjct  276   FFDQFAESEDGDNVESCDC  294



>ref|XP_009335642.1| PREDICTED: uncharacterized protein LOC103928334 [Pyrus x bretschneideri]
Length=304

 Score =   167 bits (423),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
            ++P  P+RIIL+RHG+SQGN+D + YT   D K+ +T++G+A+A+  G  I  ++     
Sbjct  10   LQPVLPKRIILMRHGESQGNLDTAAYTTTPDNKIPLTQEGLAQAQLAGAEIHRVVSDATG  69

Query  424  ED---WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
             D   W+V FYVSPY R   TL  + ++F R R+ GVREE R+REQDFGNFQ +E+MK  
Sbjct  70   ADSPNWRVCFYVSPYERTRSTLSQIGRSFSRKRVIGVREECRIREQDFGNFQVQERMKAI  129

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  130  KETRERFGRFFYRFPEGESAADVYDRVS  157


 Score =   118 bits (296),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  156   VSSFLESLWRDIDMNRHR--HDPCHDLNLIIISHGLTSRVFLMKWFKWTVEQFEHLNNLG  213

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  G+ N  C    P 
Sbjct  214   NCEFRVMQLGKGGEYSLAIHHTEEELQEWGLSPEMIADQKWRGHANRGDWNERC----PW  269

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  270   YLDAFFD  276



>ref|XP_007144765.1| hypothetical protein PHAVU_007G182800g [Phaseolus vulgaris]
 gb|ESW16759.1| hypothetical protein PHAVU_007G182800g [Phaseolus vulgaris]
Length=294

 Score =   167 bits (423),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            PRRIIL+RHG+SQGN+D + YT   D  + +TEQG+ +A + G R+R  I       DW+
Sbjct  15   PRRIILMRHGESQGNLDTAAYTTTPDHGIHLTEQGLEQARDAGVRLRRAIGASGCSPDWR  74

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V FYVSPY R   TLR + + F + RI GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  75   VQFYVSPYDRTRSTLREVGRCFSKKRIIGVREESRIREQDFGNFQVEERMKVIKETRERF  134

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  135  GRFFYRFPEGESAADVFDRVS  155


 Score =   118 bits (295),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + S ++N ++VSHGLT R+FLM+W+KWTV+QFE L+N G
Sbjct  154   VSSFFESLWRDIDMNRLRH--DPSNDLNFVIVSHGLTSRIFLMKWFKWTVDQFEHLNNFG  211

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EE++++GL+  M+ DQ+W+  A  GE N  C      
Sbjct  212   NCEFRVMQLGSGGEYSLAVHHTEEEMLEWGLSPDMIADQKWRATASRGEWNDQCPWYLGD  271

Query  1110  YFTHF  1124
             +F H 
Sbjct  272   FFDHL  276



>ref|XP_007205634.1| hypothetical protein PRUPE_ppa009217mg [Prunus persica]
 gb|EMJ06833.1| hypothetical protein PRUPE_ppa009217mg [Prunus persica]
Length=301

 Score =   165 bits (417),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE  426
            +P  P+RIIL+RHG+SQGN+D + YT   D K+ +T+ G+A+A   G  +  +I   +  
Sbjct  11   QPVLPKRIILMRHGESQGNLDTAAYTTTPDNKIPLTDVGLAQAHLAGAHLHRVISDIDTN  70

Query  427  D--WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
            +  W+VYFYVSPY R   TL  + ++F R+R+ GVREE R+REQDFGNFQ +++MK  K 
Sbjct  71   NPNWRVYFYVSPYERTRSTLCQIGRSFSRTRVIGVREECRIREQDFGNFQVQDRMKAIKE  130

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             RE++GRFFYRFP GESAADVYDR++ 
Sbjct  131  TREKFGRFFYRFPEGESAADVYDRVSS  157


 Score =   119 bits (297),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  155   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIISHGLTSRVFLMKWFKWTVEQFEHLNNLG  212

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HH++EEL+++GL+ +M+ DQ+W+  A  G+ N  C    P 
Sbjct  213   NCEFRVMQLGKGGEYSLAIHHSEEELVEWGLSPEMIADQKWRAHANRGDWNERC----PW  268

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  269   YLDTFFD  275



>ref|XP_003626327.1| hypothetical protein MTR_7g113920 [Medicago truncatula]
 gb|ABN09016.1| Phosphoglycerate/bisphosphoglycerate mutase [Medicago truncatula]
 gb|AES82545.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Medicago 
truncatula]
Length=321

 Score =   171 bits (434),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RII+VRHG+SQGN+D   YT   D K+ +T QG+++A   G RIR +I    +  DW+
Sbjct  37   PKRIIVVRHGESQGNLDPGAYTVTPDHKIPLTPQGISQALSTGSRIRHVISSSSSSPDWR  96

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR LAK+F + R+ GVREE R+REQDFGNFQ +E+M   K  R+R+
Sbjct  97   VYFYVSPYTRTRSTLRELAKSFSKKRVIGVREECRIREQDFGNFQVQERMDAIKETRQRF  156

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DR++ 
Sbjct  157  GRFFYRFPEGESAADVFDRVSS  178


 Score =   112 bits (279),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  DID+ R       S ++NLI+VSHGL  RVFLMRW++WTVEQFE L+N G
Sbjct  176   VSSFLESMWRDIDMNRLN--HNPSNDLNLIIVSHGLASRVFLMRWFRWTVEQFELLNNFG  233

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQ---KIAKPGELNYDCLIT  1100
             N    VM+ G GG YSL +HHT EEL+++GL+  M+ DQ+W+     A   + +  CL  
Sbjct  234   NCEFRVMQLGSGGEYSLAVHHTDEELLEWGLSPDMVADQKWRAHGSKAPSNDQSPRCLEA  293

Query  1101  GPSYFTHFDDDN  1136
                  T  DD++
Sbjct  294   FFDLITDSDDES  305



>gb|KDP23559.1| hypothetical protein JCGZ_23392 [Jatropha curcas]
Length=312

 Score =   162 bits (411),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD--EAEDW  432
            P+RIILVRHG+S+GN+D   Y    D K+ +T  G+ +A   G  +  +I  +     +W
Sbjct  30   PKRIILVRHGESEGNIDTDAYATTPDNKIPLTPLGLEQARTAGDHLYNLISDNGNSKSNW  89

Query  433  KVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            +VYFYVSPY R   TLR + + F+R RI GVREE R+REQDFGNFQ +E+M++ K  RER
Sbjct  90   RVYFYVSPYLRTRSTLREIGRPFQRERIIGVREECRIREQDFGNFQVKERMQVIKETRER  149

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            +GRFFYRFP GESAADVYDR++ 
Sbjct  150  FGRFFYRFPEGESAADVYDRVSS  172


 Score =   120 bits (302),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFE-PPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNI  926
             +  F E+L  DID+ R    P ++   +NLI+V+HGLT RVFLM+W+KWTVEQFE L+N 
Sbjct  170   VSSFFESLWRDIDMHRLHHAPTDE---LNLIIVTHGLTCRVFLMKWFKWTVEQFEQLNNP  226

Query  927   GNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGP  1106
              N    VME+G+GG YSL +HHT EE+ ++GL+ +M+ DQ+W+  A+ G+ N +C     
Sbjct  227   DNCECRVMEQGHGGEYSLAVHHTDEEMEEWGLSPEMIADQKWRIRAQRGDWNDNCPWYLD  286

Query  1107  SYFTHFDDD  1133
             S+F H   D
Sbjct  287   SFFNHLKTD  295



>ref|XP_010025142.1| PREDICTED: uncharacterized protein LOC104415518 [Eucalyptus grandis]
Length=339

 Score =   159 bits (403),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIIL+RHG+S+GN+  S Y    D K+ +T  G A+A   G R+R ++     E W+V
Sbjct  66   PKRIILLRHGESEGNLSPSAYATTPDHKIPLTPVGAAQARAAGDRLRALVAGGGGE-WRV  124

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFY SPY R   TLR + ++F R R+ G REE R+REQDFGNFQ  E+MK+ K  RER+G
Sbjct  125  YFYASPYERTRSTLREIGRSFGRGRVIGAREECRIREQDFGNFQVVERMKVVKETRERFG  184

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFP GESAADV+DR++
Sbjct  185  RFFYRFPEGESAADVFDRVS  204


 Score =   123 bits (309),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S ++NLI+VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  203   VSSFMESLWRDIDMNRLHT--NPSHDLNLIIVSHGLTSRVFLMKWFKWTVEQFEQLNNPG  260

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A+  E N  C     +
Sbjct  261   NCEFRVMQLGEGGEYSLAIHHTEEELREWGLSSEMIEDQKWRAHARKSEWNERCPWYLDA  320

Query  1110  YFTHFDDDNKN  1142
             +F  F D + N
Sbjct  321   FFDGFADSDDN  331



>gb|EYU21001.1| hypothetical protein MIMGU_mgv1a011084mg [Erythranthe guttata]
Length=293

 Score =   160 bits (405),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+S GN+D + Y+   D K+ +T  G+ +A+  G  I +++ +  A  +WK
Sbjct  18   PKRIILVRHGESAGNIDGAAYSTTPDNKIPLTPLGIDQAKRAGSGICDVVSRGGASSNWK  77

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + ++F R+R+ G REE R+REQDFGNFQ  E+MK  K  RER+
Sbjct  78   VYFYVSPYLRTRSTLREIGRSFPRNRVIGAREECRVREQDFGNFQVAERMKAIKETRERF  137

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADVYDR++
Sbjct  138  GRFFYRFPEGESAADVYDRVS  158


 Score =   122 bits (307),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R +   + +  +NL++VSHGL +RVFLM+W+KWTVEQFE L+N+G
Sbjct  157   VSSFLESLWRDIDMNRLQQ--DSTDELNLVIVSHGLAIRVFLMKWFKWTVEQFEYLNNLG  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HH+ EE+ ++GL+  M+ DQ W+  A  G+ N        +
Sbjct  215   NCEFRVMQLGIGGEYSLAIHHSDEEMQEWGLSADMIADQRWRAHANKGDFNEKSPWYLDT  274

Query  1110  YFTHFDDDN  1136
             +F HF D N
Sbjct  275   FFDHFADSN  283



>gb|AFK43154.1| unknown [Medicago truncatula]
Length=314

 Score =   171 bits (432),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RII+VRHG+SQGN+D   YT   D K+ +T QG+++A   G RIR +I    +  DW+
Sbjct  37   PKRIIVVRHGESQGNLDPGAYTVTPDHKIPLTPQGISQALSTGPRIRHVISSSSSSPDWR  96

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR LAK+F + R+ GVREE R+REQDFGNFQ +E+M   K  R+R+
Sbjct  97   VYFYVSPYTRTRSTLRELAKSFSKKRVIGVREECRIREQDFGNFQVQERMDAIKETRQRF  156

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DR++ 
Sbjct  157  GRFFYRFPEGESAADVFDRVSS  178


 Score =   112 bits (279),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  DID+ R       S ++NLI+VSHGL  RVFLMRW++WTVEQFE L+N G
Sbjct  176   VSSFLESMWRDIDMNRLN--HNPSNDLNLIIVSHGLASRVFLMRWFRWTVEQFELLNNFG  233

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQ---KIAKPGELNYDCLIT  1100
             N    VM+ G GG YSL +HHT EEL+++GL+  M+ DQ+W+     A   + +  CL  
Sbjct  234   NCEFRVMQLGSGGEYSLAVHHTDEELLEWGLSPDMVADQKWRAHGSKAPSNDQSPRCLEA  293

Query  1101  GPSYFTHFDDDN  1136
                  T  DD++
Sbjct  294   FFDLITDSDDES  305



>gb|KCW61746.1| hypothetical protein EUGRSUZ_H04451 [Eucalyptus grandis]
Length=285

 Score =   159 bits (402),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIIL+RHG+S+GN+  S Y    D K+ +T  G A+A   G R+R ++     E W+V
Sbjct  12   PKRIILLRHGESEGNLSPSAYATTPDHKIPLTPVGAAQARAAGDRLRALVAGGGGE-WRV  70

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFY SPY R   TLR + ++F R R+ G REE R+REQDFGNFQ  E+MK+ K  RER+G
Sbjct  71   YFYASPYERTRSTLREIGRSFGRGRVIGAREECRIREQDFGNFQVVERMKVVKETRERFG  130

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFP GESAADV+DR++
Sbjct  131  RFFYRFPEGESAADVFDRVS  150


 Score =   123 bits (308),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S ++NLI+VSHGLT RVFLM+W+KWTVEQFE L+N G
Sbjct  149   VSSFMESLWRDIDMNRLHT--NPSHDLNLIIVSHGLTSRVFLMKWFKWTVEQFEQLNNPG  206

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A+  E N  C     +
Sbjct  207   NCEFRVMQLGEGGEYSLAIHHTEEELREWGLSSEMIEDQKWRAHARKSEWNERCPWYLDA  266

Query  1110  YFTHFDDDNKN  1142
             +F  F D + N
Sbjct  267   FFDGFADSDDN  277



>ref|XP_008246529.1| PREDICTED: uncharacterized protein LOC103344690 [Prunus mume]
Length=301

 Score =   166 bits (419),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE  426
            +P  P+RIIL+RHG+SQGN+D + YT   D K+ +T+ G+A+A   G  +  +I   +  
Sbjct  11   QPVLPKRIILMRHGESQGNLDTAAYTTTPDNKIPLTDVGLAQAHLAGAHLLRVISDIDTN  70

Query  427  --DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
              +W+VYFYVSPY R   TL  + ++F R+R+ GVREE RLREQDFGNFQ +++MK  K 
Sbjct  71   SPNWRVYFYVSPYERTRSTLCQIGRSFSRTRVIGVREECRLREQDFGNFQVQDRMKAIKE  130

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             RE++GRFFYRFP GESAADVYDR++ 
Sbjct  131  TREKFGRFFYRFPEGESAADVYDRVSS  157


 Score =   116 bits (290),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 84/127 (66%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  155   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIISHGLTSRVFLMKWFKWTVEQFEHLNNLG  212

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HH++EEL+++GL+ +M+ DQ+W+  A   + N  C     +
Sbjct  213   NCEFRVMQLGKGGEYSLAIHHSEEELVEWGLSPEMIADQKWRAHANRVDWNERCPWYLDA  272

Query  1110  YFTHFDD  1130
             +F    D
Sbjct  273   FFDRLAD  279



>ref|XP_008368646.1| PREDICTED: uncharacterized protein LOC103432243 [Malus domestica]
Length=306

 Score =   163 bits (413),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED---  429
            P+RIIL+RHG+SQGN+D + YT   D K+ +T++G+A+A+  G  I  ++      D   
Sbjct  15   PKRIILMRHGESQGNLDTAAYTITPDNKIPLTQEGLAQAQLAGAEIHRVVSDAAGADSPN  74

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            W V FYVSPY R   TL  + ++F R R+ GVREE R+REQDFGNFQ +E+MK  K  RE
Sbjct  75   WSVCFYVSPYERTRSTLSQIGRSFSRKRVIGVREECRIREQDFGNFQVQERMKAIKETRE  134

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            R+GRFFYRFP GESAADVYDR++ 
Sbjct  135  RFGRFFYRFPEGESAADVYDRVSS  158


 Score =   118 bits (296),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NL ++SHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  156   VSSFLESLWRDIDMNRLR--HDPCHDLNLXIISHGLTSRVFLMKWFKWTVEQFEHLNNLG  213

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  G+ N  C    P 
Sbjct  214   NCEFRVMQLGKGGEYSLAIHHTEEELQEWGLSPEMIADQKWRAQANRGDWNERC----PW  269

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  270   YLDAFFD  276



>ref|XP_009373960.1| PREDICTED: uncharacterized protein LOC103962903 [Pyrus x bretschneideri]
Length=303

 Score =   169 bits (428),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
            ++P  P+RIIL+RHG+S+GN+D + YT   D K+ +T++G+A+A   G  +  ++     
Sbjct  10   LQPVLPKRIILMRHGESEGNLDHAAYTTTPDNKIPLTQEGLAQARLAGAELHRVVSDTTG  69

Query  424  ED---WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
             D   W+VYFYVSPY R   TL  + ++F R+RI GVREE R+REQDFGNFQ +E+MK  
Sbjct  70   ADSPNWRVYFYVSPYERTRSTLCQIGRSFSRTRIIGVREECRIREQDFGNFQVQERMKAT  129

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  130  KETRERFGRFFYRFPEGESAADVYDRVS  157


 Score =   110 bits (276),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGL  RVFLM+W+KWTVEQFE L N+G
Sbjct  156   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIISHGLASRVFLMKWFKWTVEQFELLINLG  213

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A   +    C    P 
Sbjct  214   NCEFRVMQLGKGGEYSLAIHHTEEELQEWGLSPEMIADQKWRARANRVDWTEHC----PW  269

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  270   YLDAFFD  276



>ref|XP_007030787.1| Phosphoglycerate mutase family protein isoform 2 [Theobroma cacao]
 gb|EOY11289.1| Phosphoglycerate mutase family protein isoform 2 [Theobroma cacao]
Length=285

 Score =   159 bits (402),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE-KDEAEDWK  435
            P+RIILVRHG+S GN+D S Y+   D K+ +TEQG A+A + G  +R++I       DW+
Sbjct  15   PKRIILVRHGESDGNLDTSAYSTTPDHKISLTEQGRAQARQAGSHLRDLISGHGSCSDWR  74

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R L TLR + K+F + R+ GVREE R+REQDFGNFQ   +MK+ K  RE++
Sbjct  75   VYFYVSPYERTLSTLREIGKSFSKKRVIGVREECRIREQDFGNFQVEGRMKVIKETREKF  134

Query  616  GRFFYRFPNG  645
            GRFFYRFP G
Sbjct  135  GRFFYRFPEG  144


 Score =   120 bits (301),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = +3

Query  756   GFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNG  935
             GF E+L  DID+ R     + S ++NLI++SHGL  RVFLM+W+KWTV+QFE L+N+GN 
Sbjct  144   GFLESLWRDIDLNRLH--NDPSHDLNLIIISHGLAARVFLMKWFKWTVKQFELLNNLGNC  201

Query  936   SMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPSYF  1115
              + VME G+GG YSL +HHT EEL+++GL+ +M+ DQ+W+  +     N  C     S+F
Sbjct  202   EIRVMELGHGGEYSLAIHHTDEELLEWGLSPEMIEDQKWRIHSDKASWNDHCSYYLNSFF  261

Query  1116  THFDDDNKN  1142
              H  D +++
Sbjct  262   DHQLDSDED  270



>ref|XP_004302463.1| PREDICTED: uncharacterized protein LOC101306246 [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   168 bits (426),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE  426
            +P  P+RIIL+RH +SQGN+D + YT   D K+ +TEQG+A+AE  G ++R +I  D   
Sbjct  27   QPCLPKRIILMRHAESQGNLDTAAYTTTPDNKIPLTEQGLAQAELAGAQLRRVISADNDS  86

Query  427  D---WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEK  597
            +   W+V FYVSPY R   TL  + ++F R R+ GVREE R+REQDFGNFQ +E+M   K
Sbjct  87   NHPEWRVCFYVSPYERTRSTLSQIGRSFSRKRVIGVREECRIREQDFGNFQVQERMTAIK  146

Query  598  AVRERYGRFFYRFPNGESAADVYDRITG  681
              RE++GRFFYRFP GESAADVYDR++ 
Sbjct  147  QTREKFGRFFYRFPEGESAADVYDRVSS  174


 Score =   110 bits (276),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R         ++NL++VSHGLT RVFLM+W+KW+VEQFE L+N G
Sbjct  172   VSSFLESLWRDIDMNRLR--HNPCHDLNLVIVSHGLTSRVFLMKWFKWSVEQFEHLNNFG  229

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPG  1073
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  +  G
Sbjct  230   NCEFRVMQLGAGGEYSLAVHHTEEELTEWGLSPEMIADQKWRARSGKG  277



>ref|XP_004494645.1| PREDICTED: uncharacterized protein LOC101512622 [Cicer arietinum]
Length=293

 Score =   167 bits (422),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RII++RHG+SQGN+D   Y    D K+ +T QG+A+A   G RIR +I    +  DW+
Sbjct  11   PKRIIVLRHGESQGNLDPGAYAVTPDHKISLTPQGIAQARLTGSRIRHVISSSSSSPDWR  70

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +YFYVSPY R   TLR +A++F + R+ GVREE R+REQDFGNFQ +E+M   K  R+R+
Sbjct  71   LYFYVSPYTRTRSTLREIARSFSKKRVIGVREECRIREQDFGNFQVQERMNAIKETRQRF  130

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP GESAADV+DR++
Sbjct  131  GRFFYRFPEGESAADVFDRVS  151


 Score =   112 bits (280),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 6/127 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R       S ++NLI+VSHGL  RVFLMRW++WTVEQFE L+N G
Sbjct  150   VSSFLESLWRDIDMNRLN--HNPSNDLNLIIVSHGLASRVFLMRWFRWTVEQFEHLNNFG  207

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT +EL+++GL+  M+ DQ+W+     G  N       P 
Sbjct  208   NSEFRVMQLGSGGEYSLAVHHTDKELLEWGLSPDMIADQKWRAHGCKGASNDQS----PR  263

Query  1110  YFTHFDD  1130
             Y   F D
Sbjct  264   YLEAFFD  270



>emb|CDX95020.1| BnaC05g06510D [Brassica napus]
Length=280

 Score =   174 bits (442),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T K   P+RIIL+RHG+S GN+D+  Y    D K+ +TE+G A+A E GR++R +I   
Sbjct  2    GTDKKMLPKRIILMRHGESAGNIDQGAYATTPDHKIPLTEEGRAQAREAGRKMRALISAQ  61

Query  418  EA----EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
                  E+W+VYFYVSPY R   TLR + KAF R R+ GVREE R+REQDFGNFQ  E+M
Sbjct  62   SGGACGENWRVYFYVSPYERTRTTLREVGKAFSRRRVIGVREECRIREQDFGNFQVEERM  121

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            ++ K  RER+GRFFYRFP GESA+DVYDR++
Sbjct  122  RVVKETRERFGRFFYRFPEGESASDVYDRVS  152


 Score =   104 bits (259),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R +   + S  +NL++VSHGLT RVFLM+W+KWTVE+FE L+N+G
Sbjct  151   VSSFLESLWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLMKWFKWTVEEFERLNNLG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G GG Y+  +HHT+EE++ +G++  M+ DQ  +       LN  C +    
Sbjct  209   NCEFRVMELGAGGEYTFGIHHTEEEMLAWGMSKGMIDDQMVRVNGSRETLNDCCTLQLDE  268

Query  1110  YFTHFD  1127
             Y    D
Sbjct  269   YLDLLD  274



>emb|CDX93526.1| BnaA06g05220D [Brassica napus]
Length=280

 Score =   173 bits (439),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T K   P+RIIL+RHG+S GN+D+  Y    D K+ +TE+G A+A E GR++R +I   
Sbjct  2    GTDKKILPKRIILMRHGESAGNIDQGAYATTPDHKIPLTEEGRAQAREAGRKMRALISAQ  61

Query  418  EA----EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
                  E+W+VYFYVSPY R   TLR + KAF R R+ GVREE R+REQDFGNFQ  ++M
Sbjct  62   SGGTCGENWRVYFYVSPYERTRTTLREVGKAFSRRRVIGVREECRIREQDFGNFQVEDRM  121

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            ++ K  RER+GRFFYRFP GESA+DVYDR++
Sbjct  122  RVVKETRERFGRFFYRFPEGESASDVYDRVS  152


 Score =   104 bits (259),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGR--FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  D+D+ R   +P  E    +NL++VSHGLT RVFLM+W+KWTVE+FE L+N
Sbjct  151   VSSFLESLWRDVDMNRHQVDPLSE----LNLVIVSHGLTSRVFLMKWFKWTVEEFERLNN  206

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VME G GG Y+  +HHT+EE++ +G++  M+ DQ  +       LN  C +  
Sbjct  207   LGNCEFRVMELGAGGEYTFGIHHTEEEMLAWGMSKDMIDDQMVRVNGSRETLNDCCTLQL  266

Query  1104  PSYFTHFD  1127
               YF   D
Sbjct  267   DEYFDLLD  274



>ref|XP_008388602.1| PREDICTED: uncharacterized protein LOC103450968 [Malus domestica]
Length=303

 Score =   166 bits (420),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = +1

Query  244  VKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA  423
            ++P  P+RIIL+RHG+S+GN+D + YT   D K+ +T++G+A+A   G  +  ++     
Sbjct  10   LQPVLPKRIILMRHGESEGNLDHAAYTTTPDNKIPLTQEGLAQARLAGAELHRVVSDTTG  69

Query  424  ED---WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
             D   W+ YFYVSPY R   TL  + ++F R+RI GVREE R+REQDFGNFQ++++MK  
Sbjct  70   ADSPNWRXYFYVSPYERTRSTLCQIGRSFSRTRIIGVREECRIREQDFGNFQEQDRMKAT  129

Query  595  KAVRERYGRFFYRFPNGESAADVYDRITG  681
            K  RE++GRFFYRFP GESAADVYDR++ 
Sbjct  130  KETREQFGRFFYRFPEGESAADVYDRVSS  158


 Score =   111 bits (277),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGL  RVFLM+W+KWTVEQFE L N+G
Sbjct  156   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIISHGLASRVFLMKWFKWTVEQFELLINLG  213

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A   +    C     S
Sbjct  214   NCEFRVMQLGKGGEYSLAIHHTEEELQEWGLSPEMIADQKWRARANRVDWTERCPWYLDS  273

Query  1110  YFTHFDDDNKN  1142
             +F    +  ++
Sbjct  274   FFDQLAESEED  284



>gb|KHN43259.1| Putative phosphoglycerate mutase DET1 [Glycine soja]
Length=279

 Score =   159 bits (403),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 101/141 (72%), Gaps = 12/141 (9%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+SQGN+  + Y  + DPK+ +T +G+A+A E             + +W+V
Sbjct  10   PKRIILVRHGESQGNLQPTAYDTIPDPKIQLTPEGIAQAREG------------STNWRV  57

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F R R+ GVREE R+REQDFGNFQ +E+M + K  R+R+G
Sbjct  58   YFYVSPYARTRSTLREIGRSFSRKRVIGVREECRIREQDFGNFQVQERMNVIKETRQRFG  117

Query  619  RFFYRFPNGESAADVYDRITG  681
            RFFYRFP GESAADV+DR++ 
Sbjct  118  RFFYRFPEGESAADVFDRVSS  138


 Score =   117 bits (293),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R     + S ++NLI+VSHGL  RVFLM+W+KWTVEQFE L+N  
Sbjct  136   VSSFLESLWRDVDMNRLN--HDPSDDLNLIIVSHGLASRVFLMKWFKWTVEQFELLNNFE  193

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG   V++ G GG YSL +HHT EEL+++GL+  M+ DQ+ +  A  G+ N  C     +
Sbjct  194   NGEFRVIQLGSGGEYSLAVHHTDEELLEWGLSPDMVADQKRRASASKGDWNDPCSWYLDA  253

Query  1110  YFTHF---DDDN  1136
             +F H    DDDN
Sbjct  254   FFDHLPDSDDDN  265



>gb|KFK43199.1| hypothetical protein AALP_AA1G093200 [Arabis alpina]
Length=280

 Score =   177 bits (449),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
            A  K   P+RIIL+RHG+S GN+D+  Y   AD K+ +TE+G A+A E G+++R +I   
Sbjct  2    ANDKKMLPKRIILMRHGESAGNIDQGAYATTADHKIPLTEEGRAQAREAGKKMRALISTH  61

Query  418  EA----EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
             +    E+W+VYFYVSPY R   TLR + K F R R+AGVREE R+REQDFGNFQ  E+M
Sbjct  62   SSGACGENWRVYFYVSPYERTRTTLREVGKGFSRRRVAGVREECRIREQDFGNFQVEERM  121

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            ++ K  RER+GRFFYRFP GESA+DVYDR++
Sbjct  122  RVVKETRERFGRFFYRFPEGESASDVYDRVS  152


 Score = 99.4 bits (246),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R     + S  +NL++VSHGLT RVFLM+W+KWTVE+FE L+N G
Sbjct  151   VSSFLESLWRDVDMNRHRV--DPSSEINLVIVSHGLTSRVFLMKWFKWTVEEFERLNNFG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLI  1097
             N    VME G    Y+  +HHT+EE++ +G++ K +ID +  ++    E   DC  
Sbjct  209   NCEFRVMELGANEEYTFGIHHTEEEMLAWGMS-KSMIDDQMSRVDGSRETTNDCCT  263



>gb|EPS66293.1| hypothetical protein M569_08481 [Genlisea aurea]
Length=345

 Score =   166 bits (420),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = +1

Query  184  IKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQG  363
            I+  D +G+  +    +P+      P+RI+LVRHG+S GN+D + Y  + D ++ +T  G
Sbjct  45   IEGEDMSGYSSE----SPSQRARSLPKRIVLVRHGESAGNIDGAAYCTIPDNRIPLTPVG  100

Query  364  VAEAEECGRRIREMIEKDEA--EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEP  537
            + +A+E GRRI  +I         WKVYFYVSPY R   TLR + +AF + R+ G REE 
Sbjct  101  IDQAKEAGRRISHVISDGGGARSRWKVYFYVSPYERTRSTLREIGRAFSKKRVIGAREEC  160

Query  538  RLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            R+REQDFGNFQ  E+MKI K  RER+GRFFYRFP GESAADVYDR++
Sbjct  161  RIREQDFGNFQVSERMKIIKETRERFGRFFYRFPEGESAADVYDRVS  207


 Score =   109 bits (273),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFE-PPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNI  926
             +  F E+L  DID+ R    PG     +NL+++SHGL +RVFLM+W+KWTVEQFE L+N+
Sbjct  206   VSSFLESLWRDIDMNRLRHDPGPPPEELNLVIISHGLAIRVFLMKWFKWTVEQFERLNNL  265

Query  927   GNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQ-KIAKPGELNYDCLITG  1103
             GN    VM+ G GG YSL +HH+  E+  +GL   M+ DQ+W+ +   P   + D     
Sbjct  266   GNCEFRVMQLGEGGEYSLAVHHSDGEMEGWGLAPDMIADQKWRARRGAPSRESDDWNDRC  325

Query  1104  PSYFTHFDD  1130
             P Y   F D
Sbjct  326   PPYLDTFFD  334



>ref|XP_010550016.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Tarenaya 
hassleriana]
Length=281

 Score =   165 bits (417),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EAEDWK  435
            P+RIIL+RHG+S GN+D + Y+   D K+ +TE+G  +A E G+++RE+I      E W+
Sbjct  9    PKRIILMRHGESAGNIDAAAYSTTPDHKIPLTEEGRVQAREAGKKMRELISSACGGERWR  68

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V+FYVSPY R   TLR + + F R R+ GVREE R+REQDFGNFQ  E+M++ K  RER+
Sbjct  69   VFFYVSPYERTRTTLREVGRGFSRRRVIGVREECRIREQDFGNFQVEERMRVVKETRERF  128

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRF++RFP GESAADVYDR++
Sbjct  129  GRFYFRFPEGESAADVYDRVS  149


 Score =   109 bits (273),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 7/136 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R     + S  +NL++V+HGLT RVF+M+W+KWTV+QFE L+N G
Sbjct  148   VSSFLESLWRDVDMNRLHV--DPSTELNLVIVTHGLTSRVFMMKWFKWTVQQFEHLNNFG  205

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    V+E G GG YSL +HH++EE+ ++G+++ M+ DQ+W+     G+ N  C      
Sbjct  206   NCEFRVLELGSGGEYSLAIHHSEEEMSEWGMSEDMIRDQKWRVDGSRGKFNDFCPWHLDE  265

Query  1110  YF-----THFDDDNKN  1142
             YF     T  D++++N
Sbjct  266   YFDCSGVTDEDEEDEN  281



>ref|XP_009148152.1| PREDICTED: uncharacterized protein LOC103871633 [Brassica rapa]
Length=280

 Score =   168 bits (426),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T K   P+RIIL+RHG+S GN+D+  Y    D K+ +TE+G A+A E GR++R +I   
Sbjct  2    GTDKKILPKRIILMRHGESAGNIDQGAYATTPDHKIPLTEEGRAQAREAGRKMRALISAQ  61

Query  418  EA----EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
                  E+W+VYFYVSPY R   TLR   KAF R  + GVREE R+REQDFGNFQ  ++M
Sbjct  62   SGGTCGENWRVYFYVSPYERTRTTLREEGKAFSRRCVIGVREECRIREQDFGNFQVEDRM  121

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            ++ K  RER+GRFFYRFP GESA+DVYDR++
Sbjct  122  RVVKETRERFGRFFYRFPEGESASDVYDRVS  152


 Score =   104 bits (260),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGR--FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  F E+L  D+D+ R   +P  E    +NL++VSHGLT RVFLM+W+KWTVE+FE L+N
Sbjct  151   VSSFLESLWRDVDMNRHQVDPLSE----LNLVIVSHGLTSRVFLMKWFKWTVEEFERLNN  206

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VME G GG Y+  +HHT+EE++ +G++  M+ DQ  +       LN  C +  
Sbjct  207   LGNCEFRVMELGAGGEYTFGIHHTEEEMLAWGMSKDMIDDQMVRVNGSRETLNDCCTLQL  266

Query  1104  PSYFTHFD  1127
               YF   D
Sbjct  267   DEYFDLLD  274



>ref|XP_007206718.1| hypothetical protein PRUPE_ppa024546mg [Prunus persica]
 gb|EMJ07917.1| hypothetical protein PRUPE_ppa024546mg [Prunus persica]
Length=301

 Score =   151 bits (382),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE  426
            +P  P+RIIL+RHG+SQ N+D + Y+     K+ +TE G+A+A   G  +  +I   +  
Sbjct  11   QPVLPKRIILMRHGESQANIDLATYSTTPHNKIPLTEVGLAQAHLAGAHLHRVISDIDTN  70

Query  427  --DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
              +W+VYFYVSPY R   TL  + ++F R+R+ GVREE RLREQDFGNF+ + ++K  K 
Sbjct  71   SPNWRVYFYVSPYERTRSTLCQIGRSFSRTRVIGVREECRLREQDFGNFRSQVRIKAIKE  130

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             +E++GRFF+R P GESAADVYDR++ 
Sbjct  131  TKEKFGRFFFRNPEGESAADVYDRVSS  157


 Score =   120 bits (301),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI++SHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  155   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIISHGLTARVFLMKWFKWTVEQFEHLNNLG  212

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HH++EEL+++GL+ +M+ DQ+W+  A  G+ N  C     +
Sbjct  213   NCEFQVMQLGKGGEYSLAIHHSEEELVEWGLSPEMIADQKWRAHANRGDWNERCPWYLDT  272

Query  1110  YFTHFDD  1130
             +F    D
Sbjct  273   FFNRLAD  279



>ref|XP_008218207.1| PREDICTED: uncharacterized protein LOC103318582 [Prunus mume]
Length=301

 Score =   152 bits (385),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE  426
            +P  P+RIIL+RHG+SQ N+D + Y+     K+ +T+ G+A+A   G  +  +I   +  
Sbjct  11   QPVLPKRIILMRHGESQANIDIATYSTTPHNKIPLTDVGLAQAHLAGAHLHRVISDIDTN  70

Query  427  D--WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
            +  W+VYFYVSPY R   TL  + ++F R+R+ GVREE RLREQDFGNFQ +++ K  K 
Sbjct  71   NPNWRVYFYVSPYERTRSTLCQIGRSFSRTRVIGVREECRLREQDFGNFQAQDRFKAIKE  130

Query  601  VRERYGRFFYRFPNGESAADVYDRIT  678
             +E++GRFF+R P GESAADVYDR++
Sbjct  131  TKEKFGRFFFRNPEGESAADVYDRVS  156


 Score =   119 bits (297),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     +   ++NLI+VSHGLT RVFLM+W+KWTVEQFE L+N+G
Sbjct  155   VSSFLESLWRDIDMNRLR--HDPCHDLNLIIVSHGLTSRVFLMKWFKWTVEQFEHLNNLG  212

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HH++E+L+++GL+ +M+ DQ+W+  A  G+ N  C     +
Sbjct  213   NCEFQVMQLGKGGEYSLAIHHSEEQLVEWGLSPEMIADQKWRAHANGGDWNERCPWYLDT  272

Query  1110  YFTHFDD  1130
             +F    D
Sbjct  273   FFNRLAD  279



>ref|XP_010458160.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Camelina 
sativa]
Length=281

 Score =   172 bits (437),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA----E  426
            P+RIIL+RHG+S GN+D   Y    D K+ +TE+G A+A E G+R+R +I         E
Sbjct  10   PKRIILMRHGESAGNIDAGAYATTPDHKIPLTEEGRAQAREAGKRMRALISTQSGGTCGE  69

Query  427  DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVR  606
            +W+VYFYVSPY R   TLR + K F R R+ GVREE R+REQDFGNFQ  E+M++ K  R
Sbjct  70   NWRVYFYVSPYERTRTTLREVGKGFSRKRVIGVREECRIREQDFGNFQVEERMRVVKETR  129

Query  607  ERYGRFFYRFPNGESAADVYDRIT  678
            ER+GRFFYRFP GESAADVYDR++
Sbjct  130  ERFGRFFYRFPEGESAADVYDRVS  153


 Score = 97.1 bits (240),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + S  +NL++VSHGLT RVFL +W+KWTVE+FE L+N G
Sbjct  152   VSSFLESMWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLTKWFKWTVEEFERLNNFG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G  G Y+  +HHT+EE++ +G++ +M+ DQ  +        N  C +    
Sbjct  210   NCEFRVMELGASGEYTFGIHHTEEEMLGWGMSKEMIDDQMDRVDGCRVTSNDSCSLHLNE  269

Query  1110  YFTHFD  1127
             YF   D
Sbjct  270   YFDLLD  275



>ref|XP_006417629.1| hypothetical protein EUTSA_v10008391mg [Eutrema salsugineum]
 gb|ESQ35982.1| hypothetical protein EUTSA_v10008391mg [Eutrema salsugineum]
Length=287

 Score =   171 bits (434),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA-  423
            K   P+RIIL+RHG+S GN+D+  Y    D K+ +TE+G A+A E GR++R +I    + 
Sbjct  5    KKMLPKRIILMRHGESAGNIDQGAYATTPDHKIPLTEEGRAQAREAGRKMRALISAHSSG  64

Query  424  ------EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
                  E+W+VYFYVSPY R   TLR + K F R R+ GVREE R+REQDFGNFQ  E+M
Sbjct  65   GDGACGENWRVYFYVSPYERTRTTLREVGKGFSRRRVIGVREECRIREQDFGNFQVEERM  124

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            ++ K  RER+GRFFYRFP GESA+DVYDR++
Sbjct  125  RVVKETRERFGRFFYRFPEGESASDVYDRVS  155


 Score = 98.2 bits (243),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  D+D+ R +   + S  +NL++VSHGLT RVFLM+W+KWTVE+FE L+N G
Sbjct  154   VSSFLESLWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLMKWFKWTVEEFERLNNFG  211

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCL  1094
             N    VME G  G Y+  ++H++EE++ +G++  M ID +  ++    E + DC 
Sbjct  212   NCEFRVMELGASGEYTFGIYHSEEEMLSWGMSQDM-IDDQMGRVDGSRETSNDCC  265



>ref|XP_002889724.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65983.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=281

 Score =   170 bits (430),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 4/148 (3%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA-  423
            K   P+RIIL+RHG+S GN+D   Y    D K+ +TE+G A+A E G+++R +I      
Sbjct  5    KKILPKRIILMRHGESAGNIDAGAYETTPDHKIPLTEEGRAQAREAGKKMRALISTHSGS  64

Query  424  ---EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
               E+W+VYFYVSPY R   TLR + K F R R+ GVREE R+REQDFGNFQ  E+M+  
Sbjct  65   ACGENWRVYFYVSPYERTRTTLREVGKGFSRKRVIGVREECRIREQDFGNFQVEERMRAV  124

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  125  KETRERFGRFFYRFPEGESAADVYDRVS  152


 Score = 99.4 bits (246),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + S  +NL++VSHGLT RVFL +W+KWTVE+FE L+N G
Sbjct  151   VSSFLESMWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLTKWFKWTVEEFERLNNFG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G  G Y+  +HHT+EE++ +G++  M+ DQ+ +        N  C +    
Sbjct  209   NCEFRVMELGASGDYTFAIHHTEEEMLDWGMSKDMIDDQKERVDGCRVTSNDSCSLHLHE  268

Query  1110  YFTHFD--DDNK  1139
             YF   D  DD++
Sbjct  269   YFDLLDVTDDDE  280



>ref|XP_010475712.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Camelina 
sativa]
Length=281

 Score =   171 bits (434),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA----E  426
            P+RIIL+RHG+S GNVD   Y    D K+ +TE+G A+A E G+++R +I         E
Sbjct  10   PKRIILMRHGESAGNVDAGAYATTPDHKIPLTEEGRAQAREAGKKMRALISTQSGGACGE  69

Query  427  DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVR  606
            +W+VYFYVSPY R   TLR + K F + R+ GVREE R+REQDFGNFQ  E+M+I K  R
Sbjct  70   NWRVYFYVSPYERTRTTLREVGKGFSKKRVIGVREECRIREQDFGNFQVEERMRIVKETR  129

Query  607  ERYGRFFYRFPNGESAADVYDRIT  678
            ER+GRFFYRFP GESAADVYDR++
Sbjct  130  ERFGRFFYRFPEGESAADVYDRVS  153


 Score = 97.1 bits (240),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + S  +NL++VSHGLT RVFL +W+KWTVE+FE L+N G
Sbjct  152   VSSFLESMWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLTKWFKWTVEEFERLNNFG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQ  1046
             N    VME G  G Y+  +HHT+EE++ +G++ +M+ DQ
Sbjct  210   NCEFRVMELGASGEYTFGIHHTEEEMLGWGMSKEMIDDQ  248



>ref|XP_006303260.1| hypothetical protein CARUB_v10009965mg [Capsella rubella]
 gb|EOA36158.1| hypothetical protein CARUB_v10009965mg [Capsella rubella]
Length=279

 Score =   169 bits (429),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = +1

Query  265  RIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIE-KDEAEDWKVY  441
            RIIL+RHG+S GN+D   Y    D K+ +TE+G A+A E G+++R +I  K   E+W+VY
Sbjct  13   RIILMRHGESAGNIDAGAYATTPDHKIPLTEEGRAQAREAGKKMRALISTKSGGENWRVY  72

Query  442  FYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGR  621
            FYVSPY R   TLR + K F + R+ GVREE R+REQDFGNFQ  E+M++ K  RER+GR
Sbjct  73   FYVSPYERTRTTLREVGKGFSKKRVIGVREECRIREQDFGNFQVEERMRVVKETRERFGR  132

Query  622  FFYRFPNGESAADVYDRIT  678
            FFYRFP GESAADVYDR++
Sbjct  133  FFYRFPEGESAADVYDRVS  151


 Score = 99.0 bits (245),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + +  +NL++VSHGLT RVFL +W+KWTVE+FE L+N G
Sbjct  150   VSSFLESMWRDVDMNRHQV--DPTSELNLVIVSHGLTSRVFLTKWFKWTVEEFERLNNFG  207

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G  G Y+  +HHT+EE++ +G++  M+ DQ  +        N  C +    
Sbjct  208   NCEFRVMELGASGEYTFAIHHTEEEMLSWGMSKDMIDDQMDRVDGCRATSNDHCSLHLHE  267

Query  1110  YFTHFD  1127
             YF   D
Sbjct  268   YFDLLD  273



>ref|XP_010489549.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Camelina 
sativa]
Length=282

 Score =   171 bits (434),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA----E  426
            P+RIIL+RHG+S GN+D   Y    D K+ +TE+G A+A E G+R+R +I         E
Sbjct  10   PKRIILMRHGESAGNIDAGAYATTPDHKIPLTEEGRAQAREAGKRMRALISTQSGGACGE  69

Query  427  DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVR  606
            +W+VYFYVSPY R   TLR + K F + R+ GVREE R+REQDFGNFQ  E+M++ K  R
Sbjct  70   NWRVYFYVSPYERTRTTLREVGKGFSKKRVIGVREECRIREQDFGNFQVEERMRVVKETR  129

Query  607  ERYGRFFYRFPNGESAADVYDRIT  678
            ER+GRFFYRFP GESAADVYDR++
Sbjct  130  ERFGRFFYRFPEGESAADVYDRVS  153


 Score = 97.1 bits (240),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + S  +NL++VSHGLT RVFL +W+KWTVE+FE L+N G
Sbjct  152   VSSFLESMWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLTKWFKWTVEEFERLNNFG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQ  1046
             N    VME G  G Y+  +HHT+EE++ +G++ +M+ DQ
Sbjct  210   NCEFRVMELGASGEYTFGIHHTEEEMLGWGMSKEMIDDQ  248



>ref|NP_172369.1| phosphoglycerate mutase-like protein [Arabidopsis thaliana]
 sp|O04035.2|AT74H_ARATH RecName: Full=Phosphoglycerate mutase-like protein AT74H; AltName: 
Full=Protein At-74 homolog; Short=At-74H [Arabidopsis 
thaliana]
 gb|AAB70412.1| Similar to Saccharomyces hypothetical protein YDR051c (gb|Z49209). 
ESTs gb|T44436,gb|42252 come from this gene [Arabidopsis 
thaliana]
 gb|AEE28372.1| phosphoglycerate mutase-like protein [Arabidopsis thaliana]
Length=281

 Score =   172 bits (437),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 4/148 (3%)
 Frame = +1

Query  247  KPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEA-  423
            K   P+RIIL+RHG+S GN+D   Y    D K+ +TE+G A+A E G+++R +I      
Sbjct  5    KKMLPKRIILMRHGESAGNIDAGAYATTPDHKIPLTEEGRAQAREAGKKMRALISTQSGG  64

Query  424  ---EDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
               E+W+VYFYVSPY R   TLR + K F R R+ GVREE R+REQDFGNFQ  E+M++ 
Sbjct  65   ACGENWRVYFYVSPYERTRTTLREVGKGFSRKRVIGVREECRIREQDFGNFQVEERMRVV  124

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  125  KETRERFGRFFYRFPEGESAADVYDRVS  152


 Score = 95.5 bits (236),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E++  D+D+ R +   + S  +NL++VSHGLT RVFL +W+KWTV +FE L+N G
Sbjct  151   VSSFLESMWRDVDMNRHQV--DPSSELNLVIVSHGLTSRVFLTKWFKWTVAEFERLNNFG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             N    VME G  G Y+  +HH++EE++ +G++  M+ DQ+
Sbjct  209   NCEFRVMELGASGEYTFAIHHSEEEMLDWGMSKDMIDDQK  248



>ref|XP_010941733.1| PREDICTED: phosphoglycerate mutase-like protein AT74 isoform 
X2 [Elaeis guineensis]
Length=287

 Score =   145 bits (366),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDEAEDWK  435
            P+RIILVRHG+SQGN+D + YT   D ++ +T  GV +A   GRRIR ++ +  +A +WK
Sbjct  13   PKRIILVRHGESQGNLDMAAYTTTPDYRIPLTRLGVEQARAAGRRIRHVVSDGGQAANWK  72

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF + RI GVREE R+REQDFGNFQ  ++MK+ K  R+R+
Sbjct  73   VYFYVSPYERTRLTLREIGRAFSKKRIIGVREECRVREQDFGNFQVEDRMKVIKETRDRF  132

Query  616  GRFFYRFPNGESAADVYDRI  675
            GRFF+RFP GESAADVYDR+
Sbjct  133  GRFFFRFPEGESAADVYDRV  152


 Score =   122 bits (306),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ RF        + NLI++SHGL  RVFLM+W+KW+V+QFE L+N+G
Sbjct  152   VANFMESLWRDIDMKRFGQVDH--SDTNLIIISHGLASRVFLMKWFKWSVDQFERLNNLG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  G  N DC    P 
Sbjct  210   NCEFRVMQLGPGGEYSLAIHHTREELEQWGLSSEMITDQQWRATANRGSWNEDC----PW  265

Query  1110  YFTHFDDDNKN  1142
             Y   F D+ K+
Sbjct  266   YLNSFFDNLKD  276



>ref|XP_010255255.1| PREDICTED: phosphoglycerate mutase-like protein AT74 isoform 
X2 [Nelumbo nucifera]
Length=327

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  756   GFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNG  935
             GFRETLR DIDIGRF+PPG+++PNMNL++VSHGLTLRVFLMRWYKWTVEQFEGL+N  NG
Sbjct  198   GFRETLRADIDIGRFQPPGQRNPNMNLVIVSHGLTLRVFLMRWYKWTVEQFEGLNNFSNG  257

Query  936   SMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPSYF  1115
              M+VM+ GYGGRYSLL+HHT EEL +FGLTD+ML DQEWQK A+PGELNYD L TG S+F
Sbjct  258   GMIVMQTGYGGRYSLLVHHTPEELREFGLTDEMLTDQEWQKFARPGELNYDILTTGQSFF  317

Query  1116  THFDDDN  1136
             THFD  N
Sbjct  318   THFDTGN  324


 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 113/154 (73%), Gaps = 11/154 (7%)
 Frame = +1

Query  121  RKPYSPTSVRCCDDDA-------TARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILV  279
            RK +  + + CC+D          A +N       GFPEK     P +  PPRPRRIILV
Sbjct  49   RKLFHSSHIHCCEDTVGRPRKPQLASLN----GLAGFPEKNALLTPTSALPPRPRRIILV  104

Query  280  RHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKVYFYVSPY  459
            RHGQS+GNVDES YTRV DPK+G+T++G+ EAE+CG RIREMIEKD A DWKVYFYVSPY
Sbjct  105  RHGQSEGNVDESAYTRVPDPKIGLTKKGMQEAEDCGIRIREMIEKDGAPDWKVYFYVSPY  164

Query  460  RRGLETLRNLAKAFERSRIAGVREEPRLREQDFG  561
            +R LETL+ L KAFE SRIAGVREEPRLREQDFG
Sbjct  165  KRTLETLQGLGKAFEPSRIAGVREEPRLREQDFG  198



>ref|XP_008809146.1| PREDICTED: uncharacterized protein LOC103720944 [Phoenix dactylifera]
 ref|XP_008809147.1| PREDICTED: uncharacterized protein LOC103720944 [Phoenix dactylifera]
Length=286

 Score =   143 bits (361),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDEAEDWK  435
            P+RIILVRHG+SQGN+D + Y    D ++ +T  GV +A   GRRIR+++ +  +A +WK
Sbjct  12   PKRIILVRHGESQGNLDMAAYATTPDYRIPLTRLGVEQARAAGRRIRDVVSDGGQAANWK  71

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF + RI GVREE R+REQDFGNFQ  E+MK  K  RER+
Sbjct  72   VYFYVSPYERTRLTLREIGRAFSKKRIVGVREECRVREQDFGNFQVEERMKAIKETRERF  131

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFP GESAADVYDR+ 
Sbjct  132  GRFFFRFPEGESAADVYDRVA  152


 Score =   123 bits (309),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ RF      + N NLI++SHGL  RVFLM+W+KW+V+QFE L+N+G
Sbjct  151   VANFMESLWRDIDMKRFGQVN--NSNTNLIIISHGLASRVFLMKWFKWSVDQFERLNNLG  208

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT+EEL ++GL+ +M+ DQ+W+  A  G  N DC     S
Sbjct  209   NCEFRVMQVGPGGDYSLAIHHTREELEQWGLSPEMIADQQWRATANRGSWNEDCAWYLNS  268

Query  1110  YFTHFDDDN  1136
             +F    D +
Sbjct  269   FFDDLKDSS  277



>ref|NP_001150740.1| glycerolphosphate mutase [Zea mays]
 gb|ACG40168.1| glycerolphosphate mutase [Zea mays]
Length=338

 Score =   218 bits (556),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD--EAEDWKVY  441
            I+LVRHG+S+GNVDE+ YTRV DP++G+T +G  EA++CGRR+R++      + +DWKVY
Sbjct  71   IVLVRHGESEGNVDEAAYTRVPDPRIGLTAKGWREADDCGRRLRDLFSSGSRDQDDWKVY  130

Query  442  FYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGR  621
            FY SPYRR LETLR +  AFE  RIAGVREEPRLREQDFGNFQDREQM++EK +R+RYGR
Sbjct  131  FYASPYRRSLETLRGIGHAFEPHRIAGVREEPRLREQDFGNFQDREQMRVEKEIRQRYGR  190

Query  622  FFYRFPNGESAADVYDRITGSSGANVVDLKLS  717
            FFYRFPNGESAADVYDRITG     + D+ L 
Sbjct  191  FFYRFPNGESAADVYDRITGFRETLLSDIVLG  222


 Score =   172 bits (436),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSP--NMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I GFRETL +DI +GRF+PPG +S   +MN+++VSHGLTLRVFLMRWYKWTV QFEGL N
Sbjct  208   ITGFRETLLSDIVLGRFQPPGHRSTSGDMNIVLVSHGLTLRVFLMRWYKWTVRQFEGLEN  267

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             + NG  +VM+ G GGRYSLL+HHT +EL  FGLTD+ML DQ WQK A+PGELN+  +  G
Sbjct  268   LANGGELVMQTGEGGRYSLLVHHTPDELRAFGLTDEMLQDQMWQKTARPGELNHRFMTNG  327

Query  1104  PSYFTHF  1124
              S+F  F
Sbjct  328   QSFFDPF  334



>gb|AFW86181.1| glycerolphosphate mutase [Zea mays]
Length=338

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = +1

Query  268  IILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD--EAEDWKVY  441
            I+LVRHG+S+GNVDE+ YTRV DP++G+T +G  EA++CGRR+R++      + +DWKVY
Sbjct  71   IVLVRHGESEGNVDEAAYTRVPDPRIGLTAKGWREADDCGRRLRDLFSSGSRDQDDWKVY  130

Query  442  FYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGR  621
            FY SPYRR LETLR +  AFE  RIAGVREEPRLREQDFGNFQDREQM++EK +R+RYGR
Sbjct  131  FYASPYRRSLETLRGIGHAFEPHRIAGVREEPRLREQDFGNFQDREQMRVEKEIRQRYGR  190

Query  622  FFYRFPNGESAADVYDRITGSSGANVVDLKLS  717
            FFYRFPNGESAADVYDRITG     + D+ L 
Sbjct  191  FFYRFPNGESAADVYDRITGFRETLLSDIVLG  222


 Score =   172 bits (437),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSP--NMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I GFRETL +DI +GRF+PPG +S   +MN+++VSHGLTLRVFLMRWYKWTV QFEGL N
Sbjct  208   ITGFRETLLSDIVLGRFQPPGHRSTSGDMNIVLVSHGLTLRVFLMRWYKWTVRQFEGLEN  267

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             + NG  +VM+ G GGRYSLL+HHT +EL  FGLTD+ML DQ WQK A+PGELN+  +  G
Sbjct  268   LANGGELVMQTGEGGRYSLLVHHTPDELRAFGLTDEMLQDQMWQKTARPGELNHRFMTNG  327

Query  1104  PSYFTHF  1124
              S+F  F
Sbjct  328   QSFFDPF  334



>ref|XP_010242541.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Nelumbo 
nucifera]
Length=291

 Score =   141 bits (356),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EAEDWK  435
            P+RIILVRHG+SQGN+D S YT   D K+ +T QG+ +A   G +IR +I  D ++++WK
Sbjct  10   PKRIILVRHGESQGNLDGSAYTTTPDNKIPLTPQGLNQARAAGEKIRRVISDDGQSQNWK  69

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY+R   TL  + ++  + RI GVREE R+REQDFGNFQ  E+MK  K  RER+
Sbjct  70   VYFYVSPYQRTRSTLCEIGRSIPKKRIIGVREECRIREQDFGNFQVEERMKAIKETRERF  129

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFP GESAADV+DR++
Sbjct  130  GRFFFRFPEGESAADVFDRVS  150


 Score =   122 bits (306),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R     + +  +NL+++SHGL LRVFLM+W+KWTVEQFE L+N+G
Sbjct  149   VSSFLESLWRDIDMNRLH--RDSNDEVNLVIISHGLALRVFLMKWFKWTVEQFEYLNNLG  206

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VME G GG YSL +HH++EEL ++GL+ +++ DQ+W+  A  G+ N  C     +
Sbjct  207   NCEFRVMELGQGGEYSLAIHHSEEELQEWGLSPEVISDQKWRASANRGDWNEKCPWYLDA  266

Query  1110  YFTHFDDDNKN*DC  1151
             +F H  D ++  D 
Sbjct  267   FFDHLPDSDEEEDA  280



>ref|XP_006656552.1| PREDICTED: broad-range acid phosphatase DET1-like [Oryza brachyantha]
Length=206

 Score =   203 bits (516),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I GFRETLR DIDIGRF+PPGE++P MN+++VSHGLTLRVFLMRWYKWTV QFEGL+N+ 
Sbjct  63    ITGFRETLRADIDIGRFQPPGERNPEMNVVLVSHGLTLRVFLMRWYKWTVRQFEGLNNLA  122

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             NG  VVM+ G GGRYSLL+HH+ EEL +FGLTD M+ DQ WQK A+PGELNY+ +  GPS
Sbjct  123   NGGAVVMQTGSGGRYSLLVHHSVEELREFGLTDDMIEDQMWQKTARPGELNYNFITNGPS  182

Query  1110  YFTHFDD  1130
             +FTHF+D
Sbjct  183   FFTHFND  189


 Score = 57.8 bits (138),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  508  SRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            +RI G R   R    DFGNFQDRE+M++EK +R RYGRFFYRFPNGESAADVYDRITG
Sbjct  10   NRIGGYRR--RACPVDFGNFQDREKMRVEKEIRRRYGRFFYRFPNGESAADVYDRITG  65



>gb|EAY96505.1| hypothetical protein OsI_18407 [Oryza sativa Indica Group]
Length=326

 Score =   137 bits (346),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   G
Sbjct  29   FCEMTRQHHPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTPLGVDQARAAG  87

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
            + I +++    A +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNF
Sbjct  88   KGILDVVSS--AANWKVYFYVSPYERTRATLREIGAAFPRHRVIGAREECRVREQDFGNF  145

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRI  675
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+
Sbjct  146  QVEERMRAVKETRDRFGRFFFRFPEGESAADVFDRV  181


 Score =   121 bits (303),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR E   + S   NL++VSHGLT RVFLM+W+KWTV+QFE L+N  
Sbjct  181   VASFLESLWRDIDMGRLEQ--DASCETNLVIVSHGLTSRVFLMKWFKWTVDQFERLNNFD  238

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G  G YSLL+HHTKEEL ++GL+ +M+ DQ+W+  A       +C     +
Sbjct  239   NCEFRVMQLGPAGEYSLLIHHTKEELQRWGLSPEMIADQQWRASANRRSWADECSSFLAT  298

Query  1110  YFTHF  1124
             +F H+
Sbjct  299   FFDHW  303



>gb|EEE62282.1| hypothetical protein OsJ_17070 [Oryza sativa Japonica Group]
Length=324

 Score =   137 bits (346),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   G
Sbjct  27   FCEMTRQHHPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTPLGVDQARAAG  85

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
            + I +++    A +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNF
Sbjct  86   KGILDVVSS--AANWKVYFYVSPYERTRATLREIGAAFPRHRVIGAREECRVREQDFGNF  143

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRI  675
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+
Sbjct  144  QVEERMRAVKETRDRFGRFFFRFPEGESAADVFDRV  179


 Score =   121 bits (303),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR E   + S   NL++VSHGLT RVFLM+W+KWTV+QFE L+N  
Sbjct  179   VASFLESLWRDIDMGRLEQ--DASCETNLVIVSHGLTSRVFLMKWFKWTVDQFERLNNFD  236

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G  G YSLL+HHTKEEL ++GL+ +M+ DQ+W+  A       +C     +
Sbjct  237   NCEFRVMQLGPAGEYSLLIHHTKEELQRWGLSPEMIADQQWRASANRRSWADECSSFLAT  296

Query  1110  YFTHF  1124
             +F H+
Sbjct  297   FFDHW  301



>ref|XP_010231735.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Brachypodium 
distachyon]
Length=340

 Score =   137 bits (344),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 110/165 (67%), Gaps = 6/165 (4%)
 Frame = +1

Query  199  YNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAE  378
            Y GF E + K + A      P+RIILVRHG+SQGN+D S Y+   D ++ +T +GV +A 
Sbjct  27   YCGFCE-MTKQHAAGCARRLPKRIILVRHGESQGNLDMSAYSTTPDYRIPLTPRGVEQAR  85

Query  379  ECGRRIREMIEKDEAE-----DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRL  543
              G+ I +++    AE     +WKVYFYVSPY R   TLR +  AF + R+ G REE R+
Sbjct  86   AAGKGILDVVSTSAAEASPDPNWKVYFYVSPYERTRATLREIGAAFPKDRVIGAREECRV  145

Query  544  REQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            REQDFGNFQ  E+M+  K  RER+GRFF+RFP GESAADV+DR+ 
Sbjct  146  REQDFGNFQVEERMRAVKETRERFGRFFFRFPEGESAADVFDRVA  190


 Score =   121 bits (304),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID GR +        +NL++VSHGLT RVF+M+W+KWTVEQFE L+N  
Sbjct  189   VASFMESLWRDIDNGRLD--QSTGCEINLVIVSHGLTSRVFMMKWFKWTVEQFERLNNFE  246

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSLLMHHTKEEL ++GL+ +M+ DQ+W+  A       +C     +
Sbjct  247   NCEFRVMQLGPGGEYSLLMHHTKEELERWGLSPEMITDQQWRAAANRRSWAEECGSFIAT  306

Query  1110  YFTHFDD  1130
             +F ++DD
Sbjct  307   FFDNWDD  313



>ref|XP_002500018.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61276.1| predicted protein [Micromonas sp. RCC299]
Length=353

 Score =   138 bits (348),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 111/163 (68%), Gaps = 14/163 (9%)
 Frame = +1

Query  193  PDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAE  372
            P+Y G P K            RP+RI+L+RH +S+GNVDE++Y R  D ++ +TE+G  +
Sbjct  40   PEYCGVPIKT---------TGRPKRIVLIRHAESEGNVDETMYQRKPDHRIELTERGKEQ  90

Query  373  AEECGRRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQ  552
            A + G  ++E+++ DE    +VY YVSPY R ++TL  L +     R++GVREEPR+REQ
Sbjct  91   ARQAGLALKELLDPDE----QVYVYVSPYMRTMQTLYELGQTLGPERVSGVREEPRMREQ  146

Query  553  DFGNFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            DFGNFQD    +++K  R  +GRFF+RFPNGESA+DVYDR+T 
Sbjct  147  DFGNFQDHTMQELKKE-RHGFGRFFFRFPNGESASDVYDRVTS  188


 Score =   119 bits (298),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 8/129 (6%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  FRETLRND++ GR+      + N  +++++HGLTLRVFLMRWYKWT + F+ L N G
Sbjct  186   VTSFRETLRNDMNFGRY------TENCTVLIITHGLTLRVFLMRWYKWTCDMFDKLRNPG  239

Query  930   NGSMVVMERGYGGRYSLLMHHTKEE-LMKFGLTDKMLIDQEWQKIAKPGELNYD-CLITG  1103
             N  +VVMERG  GRYS+L     EE L K G T+ M+ DQ W + A   +LN       G
Sbjct  240   NAELVVMERGERGRYSMLSESQGEEFLQKMGFTEDMIEDQRWARTASMSDLNSSWATSKG  299

Query  1104  PSYFTHFDD  1130
               +F  F D
Sbjct  300   TIFFESFPD  308



>ref|XP_006361884.1| PREDICTED: uncharacterized protein LOC102590720 isoform X2 [Solanum 
tuberosum]
Length=293

 Score =   136 bits (342),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S GN D +V       K  +TE+G+ +A++ G RI+++I +++  +WKV
Sbjct  13   PKRIILVRHGESSGNADRNVRGTTPTHKFELTEKGIEQAKQTGIRIKKLISEND-NNWKV  71

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM-KIEKAVRERY  615
            +FYVSP  R  +TLR +  +F   R+ GV+EEPRLR+ +FGN+ D   + KI+K  R  Y
Sbjct  72   FFYVSPLERTRKTLREIGGSFPTRRVMGVKEEPRLRDLNFGNYHDPASIGKIQKE-RFTY  130

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRF+YR P GE+ A+VYDRI+
Sbjct  131  GRFYYRVPGGETGAEVYDRIS  151


 Score =   121 bits (304),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPN--MNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I  F ETL  D+D+ R       +PN  +NL++VSHGL  +VFLM+W+KWTVEQFE L+N
Sbjct  150   ISDFLETLWRDVDMNRHH----HNPNKELNLVIVSHGLASQVFLMKWFKWTVEQFEYLNN  205

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITG  1103
             +GN    VME G GG YSL +HHT EE++++G++ +M+ DQ+W+  A  G LN  C    
Sbjct  206   LGNCEFRVMELGAGGEYSLAVHHTDEEMLEWGMSPEMIADQKWRANANRGTLNDHCPWYL  265

Query  1104  PSYFTHFDDDN  1136
              ++F H  D N
Sbjct  266   DAFFDHLADSN  276



>ref|XP_009412070.1| PREDICTED: broad-range acid phosphatase DET1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412071.1| PREDICTED: broad-range acid phosphatase DET1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412072.1| PREDICTED: broad-range acid phosphatase DET1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412073.1| PREDICTED: broad-range acid phosphatase DET1-like [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   140 bits (353),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDEAEDWK  435
            P+RIILVRHG+SQGN+D + YT   D ++ +T  GV +A + G RI +++ E   A  WK
Sbjct  13   PKRIILVRHGESQGNLDMAAYTTTPDYRIPLTVLGVEQARDAGERICQVVSEGGRAAAWK  72

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF R RI G REE R+REQDFGNFQ  E+MK  K  RER+
Sbjct  73   VYFYVSPYERTRSTLREMGRAFPRKRIIGAREECRIREQDFGNFQVEERMKAIKETRERF  132

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFP GESAADV+DR+T
Sbjct  133  GRFFFRFPEGESAADVFDRVT  153


 Score =   117 bits (292),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R E   E + N+NL++VSHGLT RVFLM+W+KWTV++FE L+N G
Sbjct  152   VTSFMESLWRDIDMRRLEQ--EDNANVNLVIVSHGLTSRVFLMKWFKWTVDEFERLNNPG  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + VM+ G GG YSL +HH  EEL ++GL+ +M+ DQ+W+  A  G     C     +
Sbjct  210   NCEIRVMQLGPGGDYSLAIHHQPEELQRWGLSPEMIADQQWRATAVRGRWYDSCPWHLDN  269

Query  1110  YFTHF  1124
             +F H 
Sbjct  270   FFHHL  274



>dbj|BAJ85350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   134 bits (337),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  217  KILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRI  396
            ++ K + A      P+RIILVRHG+SQGN+D S Y+   D ++ +T +GV +A   GR I
Sbjct  25   EMSKQHAAGCARRLPKRIILVRHGESQGNLDMSAYSTTPDYRIPLTPRGVEQARAAGRGI  84

Query  397  REMIEKDEAE-DWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD  573
             +++     + +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNFQ 
Sbjct  85   LDVVSSGAPDANWKVYFYVSPYERTRATLRGIGAAFPRHRVIGAREECRVREQDFGNFQV  144

Query  574  REQMKIEKAVRERYGRFFYRFPNGESAADVYDRI  675
             E+M+  K  RER+GRFF+RFP GESAADV+DR+
Sbjct  145  EERMRAIKETRERFGRFFFRFPEGESAADVFDRV  178


 Score =   123 bits (309),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID GR +P    +   NL++VSHGLT RVF+M+W+KWTVEQFE L+N  
Sbjct  178   VASFLESLWRDIDNGRLDP--STTCETNLVIVSHGLTSRVFMMKWFKWTVEQFERLNNFE  235

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSLLMHHTKEEL  +GL+ +M+ DQ+W+  A     + +C     +
Sbjct  236   NCEFRVMQLGPGGEYSLLMHHTKEELEAWGLSPEMITDQQWRASANRRSWSEECSSFIAT  295

Query  1110  YFTHFDD  1130
             +F +++D
Sbjct  296   FFDNWND  302



>ref|NP_001054606.1| Os05g0141700 [Oryza sativa Japonica Group]
 gb|AAS90644.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAS98428.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16520.1| Os05g0141700 [Oryza sativa Japonica Group]
Length=295

 Score =   135 bits (341),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = +1

Query  226  KHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREM  405
            +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   G+ I ++
Sbjct  4    QHHPQCARRL-PKRIILVRHGESQGNLDMSAYTTTPDYRIPLTPLGVDQARAAGKGILDV  62

Query  406  IEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
            +    A +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNFQ  E+M
Sbjct  63   VSS--AANWKVYFYVSPYERTRATLREIGAAFPRHRVIGAREECRVREQDFGNFQVEERM  120

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            +  K  R+R+GRFF+RFP GESAADV+DR+  
Sbjct  121  RAVKETRDRFGRFFFRFPEGESAADVFDRVAS  152


 Score =   121 bits (303),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR E   + S   NL++VSHGLT RVFLM+W+KWTV+QFE L+N  
Sbjct  150   VASFLESLWRDIDMGRLEQ--DASCETNLVIVSHGLTSRVFLMKWFKWTVDQFERLNNFD  207

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G  G YSLL+HHTKEEL ++GL+ +M+ DQ+W+  A       +C     +
Sbjct  208   NCEFRVMQLGPAGEYSLLIHHTKEELQRWGLSPEMIADQQWRASANRRSWADECSSFLAT  267

Query  1110  YFTHF  1124
             +F H+
Sbjct  268   FFDHW  272



>ref|NP_001146798.1| hypothetical protein [Zea mays]
 ref|XP_008661854.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008661855.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008661856.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACL54777.1| unknown [Zea mays]
 gb|ACN26788.1| unknown [Zea mays]
 gb|AFW57565.1| hypothetical protein ZEAMMB73_364027 [Zea mays]
 gb|AFW57566.1| hypothetical protein ZEAMMB73_364027 [Zea mays]
 gb|AFW57567.1| hypothetical protein ZEAMMB73_364027 [Zea mays]
Length=336

 Score =   140 bits (353),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   G
Sbjct  39   FCEMTRQHHPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGVEQARAAG  97

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
             RIR+++      +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFGNF
Sbjct  98   HRIRDVVAAGGG-NWKVYFYVSPYARTRATLREVGRAFPRDRVIGAREECRVREQDFGNF  156

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRITG  681
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+  
Sbjct  157  QVEERMRAVKETRQRFGRFFFRFPEGESAADVFDRVAS  194


 Score =   116 bits (290),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QF+ L+N  
Sbjct  192   VASFLESLWRDIDMGRLD--QDPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFDRLNNFD  249

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
             N    VM+ G GG YSLL+HHTKEEL ++G++ +M+ DQ+W+  A 
Sbjct  250   NCEFRVMQLGPGGEYSLLVHHTKEELQQWGMSPEMIADQQWRATAS  295



>gb|ACL52890.1| unknown [Zea mays]
Length=336

 Score =   140 bits (353),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   G
Sbjct  39   FCEMTRQHHPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGVEQARAAG  97

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
             RIR+++      +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFGNF
Sbjct  98   HRIRDVVAAGGG-NWKVYFYVSPYARTRATLREVGRAFPRDRVIGAREECRVREQDFGNF  156

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRI  675
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+
Sbjct  157  QVEERMRAVKETRQRFGRFFFRFPEGESAADVFDRV  192


 Score =   115 bits (287),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QF+ L+N  
Sbjct  192   VASFLESLWRDIDMGRLD--QDPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFDRLNNFD  249

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAK  1067
             N    VM+ G GG YSLL+HHTKEEL ++G++  M+ DQ+W+  A 
Sbjct  250   NCEFRVMQLGPGGEYSLLVHHTKEELQQWGMSPGMIADQQWRATAS  295



>ref|XP_004960443.1| PREDICTED: uncharacterized protein LOC101777668 isoform X1 [Setaria 
italica]
 ref|XP_004960444.1| PREDICTED: uncharacterized protein LOC101777668 isoform X2 [Setaria 
italica]
 ref|XP_004960445.1| PREDICTED: uncharacterized protein LOC101777668 isoform X3 [Setaria 
italica]
 ref|XP_004960446.1| PREDICTED: uncharacterized protein LOC101777668 isoform X4 [Setaria 
italica]
 ref|XP_004960447.1| PREDICTED: uncharacterized protein LOC101777668 isoform X5 [Setaria 
italica]
 ref|XP_004960448.1| PREDICTED: uncharacterized protein LOC101777668 isoform X6 [Setaria 
italica]
 ref|XP_004960449.1| PREDICTED: uncharacterized protein LOC101777668 isoform X7 [Setaria 
italica]
Length=338

 Score =   138 bits (347),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 107/157 (68%), Gaps = 2/157 (1%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  G  +A   G
Sbjct  40   FCEMTRQHHPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGAEQARAAG  98

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
            R IR+++      +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFGNF
Sbjct  99   RGIRDVVASGGG-NWKVYFYVSPYARTRATLREIGRAFPRDRVIGAREECRVREQDFGNF  157

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+ 
Sbjct  158  QVEERMRAVKETRQRFGRFFFRFPEGESAADVFDRVA  194


 Score =   117 bits (292),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 80/122 (66%), Gaps = 2/122 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QFE L+N  
Sbjct  193   VASFLESLWRDIDMGRLD--QDPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFERLNNFD  250

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSLL+HHTKEEL ++G++ +M+ DQ+W+  A       +C     S
Sbjct  251   NCEFRVMQLGPGGEYSLLVHHTKEELEQWGMSPEMIADQQWRASANRRSWAEECSSFIDS  310

Query  1110  YF  1115
             +F
Sbjct  311   FF  312



>gb|AFW82672.1| hypothetical protein ZEAMMB73_958380 [Zea mays]
Length=348

 Score =   139 bits (349),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  G  +A   G
Sbjct  47   FCEMTRQHQPQCARR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGAEQARAAG  105

Query  388  RRIREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNF  567
            +RIR+++    + +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFGNF
Sbjct  106  QRIRDVVAG--SGNWKVYFYVSPYARTRATLREIGRAFPRDRVIGAREECRVREQDFGNF  163

Query  568  QDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            Q  E+M+  K  R+R+GRFF+RFP GESAADV+DR+ 
Sbjct  164  QVEERMRAVKETRQRFGRFFFRFPEGESAADVFDRVA  200


 Score =   115 bits (287),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QFE L+N  
Sbjct  199   VASFLESLWRDIDMGRLD--QDPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFERLNNFD  256

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIA  1064
             N    VM+ G GG YSLL+HHT+EEL ++G++ +M+ DQ+W+  A
Sbjct  257   NCEFRVMQLGPGGEYSLLVHHTQEELQQWGMSPEMIADQQWRASA  301



>ref|XP_006654026.1| PREDICTED: uncharacterized protein LOC102711346 [Oryza brachyantha]
Length=299

 Score =   132 bits (332),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 99/148 (67%), Gaps = 7/148 (5%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEK-------D  417
            P+RIILVRHG+SQGN+D S YT   D ++ +T  GV +A   GR I +++          
Sbjct  7    PKRIILVRHGESQGNLDMSAYTTTPDYRIPLTPLGVDQARAAGRAILDVVSSCSGAGGGG  66

Query  418  EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEK  597
               +WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNFQ  E+M+  K
Sbjct  67   GGANWKVYFYVSPYERTRATLREMGAAFPRHRVIGAREECRVREQDFGNFQVEERMRAVK  126

Query  598  AVRERYGRFFYRFPNGESAADVYDRITG  681
              R+R+GRFF+RFP GESAADV+DR+  
Sbjct  127  ETRDRFGRFFFRFPEGESAADVFDRVAS  154


 Score =   118 bits (296),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR E   + S   NL++VSHGLT RVFLM+W+KWTV+QFE L N  
Sbjct  152   VASFLESLWRDIDMGRLE--QDASCETNLVIVSHGLTSRVFLMKWFKWTVDQFERLSNFD  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G  G YSLL+HHT+EEL ++GL+ +M+ DQ+W+  A       DC     +
Sbjct  210   NCEFRVMQLGPAGEYSLLVHHTREELQRWGLSPEMIADQQWRASANRRSWADDCSSFLAT  269

Query  1110  YF  1115
             +F
Sbjct  270   FF  271



>gb|ACF78655.1| unknown [Zea mays]
Length=299

 Score =   137 bits (344),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = +1

Query  226  KHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREM  405
            +H P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  G  +A   G+RIR++
Sbjct  4    QHQPQCARRL-PKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGAEQARAAGQRIRDV  62

Query  406  IEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQM  585
            +    + +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFGNFQ  E+M
Sbjct  63   VAG--SGNWKVYFYVSPYARTRATLREIGRAFPRDRVIGAREECRVREQDFGNFQVEERM  120

Query  586  KIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            +  K  R+R+GRFF+RFP GESAADV+DR+ 
Sbjct  121  RAVKETRQRFGRFFFRFPEGESAADVFDRVA  151


 Score =   114 bits (285),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QFE L+N  
Sbjct  150   VASFLESLWRDIDMGRLDQ--DPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFERLNNFD  207

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIA  1064
             N    VM+ G GG YSLL+HHT+EEL ++G++ +M+ DQ+W+  A
Sbjct  208   NCEFRVMQLGPGGEYSLLVHHTQEELQQWGMSPEMIADQQWRASA  252



>ref|XP_009393256.1| PREDICTED: uncharacterized protein LOC103978992 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   142 bits (359),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDEAEDWK  435
            P+RIILVRHG+SQGN+D + YT   D ++ +T  GV +A   G RI++++ E   A  WK
Sbjct  13   PKRIILVRHGESQGNLDMAAYTTTPDCRIPLTPLGVVQARTAGERIQQVVSEGGRAARWK  72

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR + +AF R RI GVREE R+REQDFGNFQ  E+MK+ K  RER+
Sbjct  73   VYFYVSPYERTRATLREIGRAFPRKRIIGVREECRIREQDFGNFQVEERMKVIKETRERF  132

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFP GESAADV+DR+ 
Sbjct  133  GRFFFRFPEGESAADVFDRVA  153


 Score =   108 bits (269),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+ R E   + + ++NL++VSHGLT RVFLM+W+KWTV+QFE L+N  
Sbjct  152   VASFMESLWRDIDMRRLE--QDDNLDVNLVIVSHGLTSRVFLMKWFKWTVDQFELLNNPD  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSL +HHT  EL  +GL+ +M+ DQ+W+     G    +C     +
Sbjct  210   NCEFRVMQLGPGGEYSLAIHHTPAELQLWGLSPEMIADQQWRATTVRGSWYENCPWHLDN  269

Query  1110  YFTHF  1124
             +F H 
Sbjct  270   FFHHL  274



>ref|XP_002439257.1| hypothetical protein SORBIDRAFT_09g003230 [Sorghum bicolor]
 gb|EES17687.1| hypothetical protein SORBIDRAFT_09g003230 [Sorghum bicolor]
Length=345

 Score =   132 bits (333),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 3/159 (2%)
 Frame = +1

Query  208  FPEKILKHNPATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECG  387
            F E   +H+P   +   P+RIILVRHG+SQGN+D S YT   D ++ +T  G  +A   G
Sbjct  41   FCEMTRQHHPQCSRR-LPKRIILVRHGESQGNLDMSAYTTTPDYRIPLTALGAEQARAAG  99

Query  388  RRIREMIEKDE--AEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFG  561
             RI +++        +WKVYFYVSPY R   TLR + +AF R R+ G REE R+REQDFG
Sbjct  100  LRIHDVVSSSSSPGGNWKVYFYVSPYARTRATLREIGRAFPRDRVIGAREECRVREQDFG  159

Query  562  NFQDREQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
            NFQ  E+M+  K  R+R+GRFF+RFP GESAADV+DR+ 
Sbjct  160  NFQVEERMRAVKETRQRFGRFFFRFPEGESAADVFDRVA  198


 Score =   116 bits (290),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID+GR +   + S   NL++VSHGLT RVFLM+W+KWTV QFE L+N  
Sbjct  197   VASFLESLWRDIDMGRLD--QDPSCETNLVIVSHGLTSRVFLMKWFKWTVAQFERLNNFD  254

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDC  1091
             N    VM+ G GG YSLL+HHTKEEL ++G++ +M+ DQ+W+  A       +C
Sbjct  255   NCEFRVMQLGPGGEYSLLVHHTKEELQQWGMSPEMIADQQWRASANRRSWAEEC  308



>gb|EMT21664.1| Putative phosphoglycerate mutase DET1 [Aegilops tauschii]
Length=304

 Score =   127 bits (318),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RIILVRHG+SQGN+D S Y+   D ++ +T +GV +A   GR I +++     + +WK
Sbjct  14   PKRIILVRHGESQGNLDMSAYSTTPDYRIPLTPRGVEQARAAGRGILDVVSSGGPDANWK  73

Query  436  ----VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAV  603
                VYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNFQ  E+M+  K  
Sbjct  74   GAFYVYFYVSPYERTRATLRGIGAAFPRDRVIGAREECRVREQDFGNFQVEERMRAIKET  133

Query  604  RERYGRFFYRFPNGESAADVYDRIT  678
            RER+GRFF+RFP GESAADV+DR+ 
Sbjct  134  RERFGRFFFRFPEGESAADVFDRVA  158


 Score =   120 bits (302),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 2/127 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DID GR +P    +   NL++VSHGLT RVF+M+W+KWTVEQFE L+N  
Sbjct  157   VASFLESLWRDIDNGRLDP--STNCETNLVIVSHGLTSRVFMMKWFKWTVEQFERLNNFE  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N    VM+ G GG YSLLMHHTKEEL ++GL+ +M+ DQ+W+  A     + +C     +
Sbjct  215   NCEFRVMQLGPGGEYSLLMHHTKEELEEWGLSPEMITDQQWRASANRRSWSEECSSFIAT  274

Query  1110  YFTHFDD  1130
             +F ++ D
Sbjct  275   FFDNWVD  281



>ref|XP_009771138.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=288

 Score =   155 bits (391),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  247  KPPR-PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EKDE  420
            KP R P+RIILVRHG+S+GNVD+++Y    D KV +TE+G  ++++ G  IR ++ +   
Sbjct  13   KPSRLPKRIILVRHGESEGNVDKNIYAITPDHKVQLTEKGKEQSKKAGEMIRGLVCDSRN  72

Query  421  AEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKA  600
            +   KVYFYVSP+ R  ETL+ +  AF  S I GVREE R+RE D+  F + E+M   K 
Sbjct  73   SGKEKVYFYVSPFLRTRETLKEIGAAFSSSEIIGVREESRVREMDYAKFHNTEKMDEYKK  132

Query  601  VRERYGRFFYRFPNGESAADVYDRITG  681
             RERYG+FFYRFP GESAADVYDR++G
Sbjct  133  ERERYGKFFYRFPGGESAADVYDRVSG  159


 Score = 91.3 bits (225),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF E+L  DID+         + ++NLI++SHGLT+RV LMR ++WT EQ + L +  
Sbjct  157   VSGFIESLWRDIDMDMISYGA--NDDINLIIISHGLTIRVLLMRLFRWTAEQVDNLTSPK  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + +ME G+ G YSL +HH  + L K+GL+ +M+ +Q+ +  A P +++ D  +   +
Sbjct  215   NAEVRIMELGHEGEYSLALHHDDQTLEKWGLSPEMIANQKLR--AYPPKVDLDKRVFSSN  272

Query  1110  YFTHF  1124
             YF H 
Sbjct  273   YFDHL  277



>ref|XP_006341338.1| PREDICTED: broad-range acid phosphatase DET1-like [Solanum tuberosum]
Length=249

 Score =   157 bits (398),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 5/141 (4%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S+GN D++VYT V D KV +TE+G  EA+  G  IR ++      + KV
Sbjct  16   PKRIILVRHGESEGNEDKNVYTAVPDHKVQLTEKGKEEAKNAGEVIRSVVG-----NCKV  70

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSP+ R  ETL+ ++++F  + I GVREE RLRE D+  FQ+ E+M+  K  RERYG
Sbjct  71   YFYVSPFLRTRETLKEISESFSSNEIIGVREECRLREMDYAKFQNTEKMEEYKKERERYG  130

Query  619  RFFYRFPNGESAADVYDRITG  681
            +FFYRFP+GESAADVYDR++G
Sbjct  131  KFFYRFPHGESAADVYDRVSG  151


 Score = 88.2 bits (217),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF E+L  DI++      G  S N+N++++SHGLT+R+ LMR +KWT E+ E L +  
Sbjct  149   VSGFMESLWRDIEMEEICETG--SDNLNIVIISHGLTIRIILMRLFKWTAEEVESLISPK  206

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             NG + ++E G+ G+YSL +HH  +   K+GL+ +M++DQ+
Sbjct  207   NGEIRILELGHEGKYSLALHHDDKTFEKWGLSPQMILDQK  246



>ref|XP_003057908.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57859.1| predicted protein [Micromonas pusilla CCMP1545]
Length=308

 Score =   127 bits (320),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RIIL+RH +S+GNVDE+VY R  D ++ +TE+G  +A + G +++ ++  +E+    
Sbjct  21   RPKRIILIRHAESEGNVDETVYQRKPDHRIELTEKGKQQARDAGEKLKAILGPNES----  76

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VY YVSPY R  +TL  + +A    R+ GVREEPR+REQDFGNFQD    ++ K  R+R+
Sbjct  77   VYAYVSPYMRTEQTLYEIGQAIGTHRVLGVREEPRMREQDFGNFQDVGMAEL-KRERQRF  135

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFF+RFPNGESAADVYDR+T
Sbjct  136  GRFFFRFPNGESAADVYDRVT  156


 Score =   116 bits (291),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 84/131 (64%), Gaps = 6/131 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             +  FRETLRND+  GRF  +  G ++ +  +++V+HGLTLRVFLMRWYKW+VE FE   N
Sbjct  155   VTSFRETLRNDMHFGRFNCDVTGCRTEDCTVVIVTHGLTLRVFLMRWYKWSVEMFERCRN  214

Query  924   IGNGSMVVMERGYGGRYSLLMHHT---KEELMKFGLTDKMLIDQEWQKIAKPGELNYDCL  1094
               NG +VVMERG GGRY++L       +E L KFG  ++M+ DQ W K A    LN +  
Sbjct  215   ARNGELVVMERGKGGRYTMLNEQNGQDEEWLAKFGFNEEMIADQVWAKDAPVDGLNSEWP  274

Query  1095  IT-GPSYFTHF  1124
              + G  +F +F
Sbjct  275   TSKGQMFFDNF  285



>ref|XP_004248834.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Solanum 
lycopersicum]
Length=249

 Score =   154 bits (388),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 5/141 (4%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S+GN D+ VYT V D KV +TE+G  +A+  G  IR ++      + KV
Sbjct  16   PKRIILVRHGESEGNEDKHVYTVVPDHKVQLTEKGKEQAKNAGELIRSVVG-----NCKV  70

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSP+ R  ETL  ++ +F  + I GVREE RLRE D+  FQ+ E+M+  K  RERYG
Sbjct  71   YFYVSPFLRTRETLNEISASFSGNEIIGVREECRLREMDYAKFQNTEKMEEYKKERERYG  130

Query  619  RFFYRFPNGESAADVYDRITG  681
            +FFYRFP+GESAADVYDR++G
Sbjct  131  KFFYRFPHGESAADVYDRVSG  151


 Score = 87.8 bits (216),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF E++  DI++   E     S N+N++++SHGLT+R+ LMR +KWT EQ E L +  
Sbjct  149   VSGFIESMWRDIEME--EICESDSDNLNIVIISHGLTIRILLMRLFKWTAEQVESLISPE  206

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             NG + ++E G+ G+YSL +HH  + L K+GL+ +M+ DQ+
Sbjct  207   NGEIRILEFGHQGKYSLALHHDDKTLEKWGLSPQMIFDQK  246



>gb|ACJ84275.1| unknown [Medicago truncatula]
Length=256

 Score =   170 bits (430),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE-DWK  435
            P+RII+VRHG+SQGN+D   YT   D K+ +T QG+++A   G RIR +I    +  DW+
Sbjct  37   PKRIIVVRHGESQGNLDPGAYTVTPDHKIPLTPQGISQALSTGPRIRHVISSSSSSPDWR  96

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            VYFYVSPY R   TLR LAK+F + R+ GVREE R+REQDFGNFQ +E+M   K  R+R+
Sbjct  97   VYFYVSPYTRTRSTLRELAKSFSKKRVIGVREECRIREQDFGNFQVQERMDAIKETRQRF  156

Query  616  GRFFYRFPNGESAADVYDRITG  681
            GRFFYRFP GESAADV+DR++ 
Sbjct  157  GRFFYRFPEGESAADVFDRVSS  178


 Score = 71.6 bits (174),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            +  F E++  DID+ R       S ++NLI+VSHGL  RVFLMRW++WTVEQFE L+N G
Sbjct  176  VSSFLESMWRDIDMNRLN--HNPSNDLNLIIVSHGLASRVFLMRWFRWTVEQFELLNNFG  233

Query  930  NGSMVVMERG  959
            N    VM+ G
Sbjct  234  NCEFRVMQLG  243



>ref|XP_002499391.1| phosphoglycerate mutase family protein [Micromonas sp. RCC299]
 gb|ACO60650.1| phosphoglycerate mutase family protein [Micromonas sp. RCC299]
Length=388

 Score =   174 bits (442),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RI+LVRHG+S GN+DES YTR  D ++ +T+ G  +A + G  +R++ + ++  D+K 
Sbjct  103  PKRIVLVRHGESTGNLDESEYTRTPDSQIPLTQNGHVQATQTGAMLRDLFDANDDPDYKC  162

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FY+SPYRR  +T   +A+AFE+  I+GVREEP+LREQDFGNFQD +Q K EK  R+ +G
Sbjct  163  FFYISPYRRSKQTALGIAQAFEKRHISGVREEPQLREQDFGNFQDLKQKKAEKRERQYFG  222

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFPNGES ADV+DRIT
Sbjct  223  RFFYRFPNGESGADVFDRIT  242


 Score = 66.6 bits (161),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I  F + +  DID GRF      + + N+I+ +HGLTLR+FLMRW+ WTV ++E + N  
Sbjct  241   ITIFEDHMVRDIDAGRF------NKDTNMILCTHGLTLRLFLMRWFHWTVAEYERVANPA  294

Query  930   NGSMVVMERGYGGRYSLLMHHTKE  1001
             N + +++ER           HTKE
Sbjct  295   NSTPIILERIDDPTVDHGRFHTKE  318



>ref|XP_003078295.1| unnamed protein product [Ostreococcus tauri]
Length=305

 Score =   180 bits (457),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            PRRI+LVRHG+S GNVDES YTR  D +V +T  G  +AE  GRR+R+M++ +  ED+K+
Sbjct  28   PRRIVLVRHGESFGNVDESEYTRTPDSQVRLTATGHNQAETTGRRLRDMMD-ETGEDYKL  86

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FY+SPYRR  ET   +AKAF+  RI GVREEP+LREQDFGNFQD E  + EK  R R+G
Sbjct  87   FFYLSPYRRSKETAIGIAKAFDGRRILGVREEPQLREQDFGNFQDYEAKQAEKRERHRFG  146

Query  619  RFFYRFPNGESAADVYDRITGSSGANV  699
            RFFYRFPNGES ADVYDRIT  S   V
Sbjct  147  RFFYRFPNGESGADVYDRITMFSDHMV  173


 Score = 59.3 bits (142),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = +3

Query  786  DIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMER  956
            D GRF        + N+I+ +HGLTLR+FLMRW+ WTV ++E + N  N   +++ER
Sbjct  182  DAGRF------PEDTNMILCTHGLTLRLFLMRWFHWTVAEYERIANPSNSQPIILER  232



>ref|XP_003565626.1| PREDICTED: phosphoglycerate mutase-like protein AT74H [Brachypodium 
distachyon]
Length=315

 Score =   135 bits (339),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 8/147 (5%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAED---  429
            P+RIILVRHGQS GN+D S Y   AD ++ +T+ GV +A   GRRI +++    A+    
Sbjct  14   PKRIILVRHGQSLGNLDTSAYATTADSRIPLTDLGVEQARAAGRRILDVVSGTSADGDGD  73

Query  430  -----WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
                 WKVYFYVSPY R   TLR +  AF R R+ G REE R+REQDFGNFQ  ++M+  
Sbjct  74   ADPDDWKVYFYVSPYERTRATLRGIGAAFPRRRVVGAREECRVREQDFGNFQVEDRMRAL  133

Query  595  KAVRERYGRFFYRFPNGESAADVYDRI  675
            K  R+R+GRFF+RFP GESAADV+DR+
Sbjct  134  KETRDRFGRFFFRFPQGESAADVFDRV  160


 Score =   104 bits (259),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E+L  DI+ GR       +  +NL++VSHG+T R+F+M+W+KWTVEQFE L N+ 
Sbjct  160   VASFMESLWRDINHGRLV--QSTTSEINLVIVSHGITTRIFMMKWFKWTVEQFERLRNME  217

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIA-KPGELNYDCLITGP  1106
             N    VM+ G GG YSLL HHT+EEL  +GL+ +M+ DQ+ +  A +P E    C     
Sbjct  218   NCEFRVMQLGPGGEYSLLGHHTEEELEAWGLSPEMIADQQRRASADRPSE----CSSFTA  273

Query  1107  SYFTHFDD  1130
             ++F  + D
Sbjct  274   TFFDDWTD  281



>ref|XP_003055812.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61064.1| predicted protein [Micromonas pusilla CCMP1545]
Length=280

 Score =   170 bits (430),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EAEDWK  435
            P+RI+LVRHG+S GNVDES YTR  D ++ +T  G A+A E G+++R++ ++D     ++
Sbjct  29   PKRIVLVRHGESYGNVDESEYTRTPDSQIRLTTNGHAQATETGKQLRKLFDEDFSLHPYR  88

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V+FY+SPYRR  ET   +A+AF+   I+GVREEP+LREQDFGNFQD  + K+EK  R+ +
Sbjct  89   VFFYISPYRRSKETALGIARAFDDDAISGVREEPQLREQDFGNFQDASRKKLEKRERQYF  148

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFP+GES ADV+DRIT
Sbjct  149  GRFFYRFPDGESGADVFDRIT  169


 Score = 68.6 bits (166),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I  F + +  DID GRF+       N N+++ +HGLTLR+FLMRW+ WTV ++E + N  
Sbjct  168   ITIFEDHMVRDIDAGRFDE------NTNMVLCTHGLTLRLFLMRWFHWTVAEYERIANPA  221

Query  930   NGSMVVMERGYGGRYSLLMHHTKE  1001
             N + +++ER      +    HTKE
Sbjct  222   NSTPIILERIDDPTVNKGTFHTKE  245



>ref|XP_009604162.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   151 bits (381),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S+GN+D++VY    D +V +TE+G  + ++ G  IR +I        KV
Sbjct  19   PKRIILVRHGESEGNLDKNVYAITPDHRVQLTEKGKEQGKKAGEIIRGVICDKGNCSSKV  78

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSP+ R  ETL+ +  AF  S I GVREE RLRE D+  FQ+ E+M+  K  RE+YG
Sbjct  79   YFYVSPFLRTRETLKEIGAAFCSSEIVGVREECRLREMDYAKFQNTEKMEEYKMEREKYG  138

Query  619  RFFYRFPNGESAADVYDRITG  681
            +FFYRFP GESAADVYDR++G
Sbjct  139  KFFYRFPGGESAADVYDRVSG  159


 Score = 85.1 bits (209),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF ++L  DID+     P     ++N++++SHGLT+RV LMR ++WT EQ + L +  
Sbjct  157   VSGFIDSLWRDIDMDMI--PYGAKEDLNVVVISHGLTIRVLLMRIFRWTPEQIDNLVSPK  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELNYDCLITGPS  1109
             N  + +ME G  G YSL +HH  + L K+GL+ +M++DQ+ +      +L+  C    P 
Sbjct  215   NAEVRIMELGNEGEYSLALHHDDQTLGKWGLSAEMIVDQKLRAYGPTVDLD-KCFF--PR  271

Query  1110  YFTHFDD  1130
             YF    D
Sbjct  272   YFDRLAD  278



>ref|XP_009798734.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=279

 Score =   148 bits (374),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+R+ILVRHG+S+GN+D++VY    D +V +T++G  +A++ G  IR ++        KV
Sbjct  19   PKRLILVRHGESEGNLDKNVYAITPDHRVQLTQKGKEQAKKSGEIIRGVVCDKGNCSSKV  78

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSP+ R  ETL+ +  AF  S I GVREE RLRE D+  F++ E+M+  K  RE+YG
Sbjct  79   YFYVSPFLRTRETLKEIGAAFCSSEIVGVREECRLREMDYAKFKNTEKMEEYKKEREKYG  138

Query  619  RFFYRFPNGESAADVYDRITG  681
            +FFYRFP GESAADVYDR++G
Sbjct  139  KFFYRFPGGESAADVYDRVSG  159


 Score = 87.8 bits (216),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 77/122 (63%), Gaps = 9/122 (7%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             + GF ++L +DID+     P   + ++N++++SHGLT+RV LMR ++WT EQ + L +  
Sbjct  157   VSGFIDSLWSDIDMDMI--PYGANEDLNVVVISHGLTIRVLLMRIFRWTPEQVDNLISPK  214

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPGELN-------YD  1088
             N  + +ME G+ G YSL +HH  E L+K+GL+ +M++DQ+ +      +L+       +D
Sbjct  215   NAEVRIMELGHEGEYSLALHHDDETLVKWGLSAEMIVDQKLRAYGPMVDLDKCFFSRYFD  274

Query  1089  CL  1094
             CL
Sbjct  275   CL  276



>ref|XP_007511089.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66649.1| predicted protein [Bathycoccus prasinos]
Length=395

 Score =   171 bits (432),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 126/189 (67%), Gaps = 6/189 (3%)
 Frame = +1

Query  124  KPYSPTSVRCCDDDATARVNIKPPDYNGFPEKILKHNPATVKPPRPRRIILVRHGQSQGN  303
            +P S  +     ++    V+ +  DY   P   +  N +T K   P+RIIL+RHG+SQGN
Sbjct  55   EPTSRVNTTNTKNNIQLSVDERSLDYRA-PGFTVGENVSTSKRVLPKRIILIRHGESQGN  113

Query  304  VDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAE----DWKVYFYVSPYRRGL  471
            +DE+ Y    D ++ +TE+G  +AE+ G+ +REM+E+D+ E    D KV+FY+SPYRR  
Sbjct  114  IDETAYQNTPDWQIRLTEKGREQAEQTGKMLREMLERDKIEEPEKDPKVFFYISPYRRSK  173

Query  472  ETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYGRFFYRFPNGES  651
            ET   +A++ +   I GVREEP+LREQDFGNFQD + +K  K  R+ +GRFFYRFP+GES
Sbjct  174  ETAAGIAQSLDPEMIIGVREEPQLREQDFGNFQDGQMIKT-KNERQAFGRFFYRFPDGES  232

Query  652  AADVYDRIT  678
             ADVYDR+T
Sbjct  233  GADVYDRMT  241


 Score = 64.3 bits (155),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +3

Query  759  FRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGS  938
            F + +  DID GRF      S + N+++ +HGLTLR+FLMRW+ WTV ++E + N  N  
Sbjct  243  FEDHMVRDIDNGRF------SGSTNMVLCTHGLTLRIFLMRWFHWTVAEYERITNPANSV  296

Query  939  MVVMER  956
             +++ER
Sbjct  297  PIILER  302



>ref|XP_006361885.1| PREDICTED: uncharacterized protein LOC102591300 [Solanum tuberosum]
Length=313

 Score =   139 bits (351),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S GN D +V       K  +TE+G+ +A++ G RI+++I +++  +WKV
Sbjct  43   PKRIILVRHGESSGNADRNVRGTTPTHKFELTEKGIEQAKQTGIRIKKLISEND-NNWKV  101

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FYVSP  R  +TLR +  +F   R+ GV+EEPRLR+ +FGN+ D   +   K  R  YG
Sbjct  102  FFYVSPLERTRKTLREIGGSFPTRRVMGVKEEPRLRDLNFGNYHDPASIGKIKKERVTYG  161

Query  619  RFFYRFPNGESAADVYDRITG  681
            RF+YR P GE+ A+VYDRI+G
Sbjct  162  RFYYRVPGGETGAEVYDRISG  182


 Score = 90.1 bits (222),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I G+ E LR DI++ +F    P +++   N+I+V+HGL+ R+FLM+W+ WT+EQFE L+ 
Sbjct  180   ISGYIECLRRDIEMKKFVCHDPCQET---NIIIVTHGLSSRIFLMKWFDWTIEQFEDLNR  236

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPG  1073
             +      V++ G+GG YSL  HH  ++L ++GL+  M+ DQ+ +     G
Sbjct  237   MKPSEFQVLQLGHGGEYSLAFHHDDKKLHEWGLSPDMIEDQKCKAYGPTG  286



>ref|XP_006361883.1| PREDICTED: uncharacterized protein LOC102590720 isoform X1 [Solanum 
tuberosum]
Length=285

 Score =   137 bits (345),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+S GN D +V       K  +TE+G+ +A++ G RI+++I +++  +WKV
Sbjct  13   PKRIILVRHGESSGNADRNVRGTTPTHKFELTEKGIEQAKQTGIRIKKLISEND-NNWKV  71

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FYVSP  R  +TLR +  +F   R+ GV+EEPRLR+ +FGN+ D   +   +  R  YG
Sbjct  72   FFYVSPLERTRKTLREIGGSFPTRRVMGVKEEPRLRDLNFGNYHDPASIGKIQKERFTYG  131

Query  619  RFFYRFPNGESAADVYDRITG  681
            RF+YR P GE+ A+VYDRI+G
Sbjct  132  RFYYRVPGGETGAEVYDRISG  152


 Score = 91.7 bits (226),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 72/110 (65%), Gaps = 5/110 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I G+ E LR DI++ +F    P +++   N+I+++HGL+ R+FLM+W+ WTVEQFE L+ 
Sbjct  150   ISGYIECLRRDIEMKKFVCHDPCQET---NIIIITHGLSSRIFLMKWFDWTVEQFEVLNR  206

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPG  1073
             +  G   V++ G+GG YSL  HH  ++L ++GL+  M+ DQ+ +     G
Sbjct  207   MRTGEFQVLQLGHGGEYSLAFHHDDKKLREWGLSPDMIEDQKCKAYGPTG  256



>ref|XP_001417008.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95301.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=202

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            PRRI+LVRHG+S+GNVDES YTR  D +V +T +G  +AE  GR +R+M++ D  +D+K+
Sbjct  4    PRRIVLVRHGESEGNVDESEYTRTPDSQVRLTARGHEQAESTGRELRDMMDAD-GDDYKL  62

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FY+SPYRR  ET   +AKAF   +I GVREEP+LREQDFGNFQD E+ + EK  R R+G
Sbjct  63   FFYISPYRRSKETAIGIAKAFSGRQILGVREEPQLREQDFGNFQDYERKQAEKLERHRFG  122

Query  619  RFFYRFPNGESAADVYDRITGSSGANVVDL  708
            RFFYRFPNGES ADVYDRIT  S   V D+
Sbjct  123  RFFYRFPNGESGADVYDRITMFSDHMVRDI  152


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            I  F + +  DID GRF        + N+I+ +HGLTLR+FLMRW+ WTV ++E + N  
Sbjct  141  ITMFSDHMVRDIDAGRF------PEDANMILCTHGLTLRLFLMRWFHWTVAEYERIANPS  194

Query  930  NGSMVVME  953
            N   +++E
Sbjct  195  NSQPIILE  202



>ref|XP_002946902.1| hypothetical protein VOLCADRAFT_86965 [Volvox carteri f. nagariensis]
 gb|EFJ52128.1| hypothetical protein VOLCADRAFT_86965 [Volvox carteri f. nagariensis]
Length=384

 Score =   158 bits (400),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD--EAEDW  432
            P RIILVRH +S+GNVD   YT + D +V +T +G  +A E G++I+ ++E D   A D+
Sbjct  129  PDRIILVRHAESEGNVDNKAYTYIPDSQVPLTARGHMQAREAGKQIKGLMEADPERARDY  188

Query  433  KVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQ--DFGNFQDREQMKIEKAVR  606
            K+YFY+SPY+R L+T   ++  F    + GV+EE +LREQ  DFGNFQD +  + EKA R
Sbjct  189  KLYFYISPYKRSLQTYEGISSQFPTHHLLGVQEEVQLREQQQDFGNFQDEQGKQHEKAER  248

Query  607  ERYGRFFYRFPNGESAADVYDRIT  678
             R+GRFFYRFPNGES ADVYDRIT
Sbjct  249  LRFGRFFYRFPNGESGADVYDRIT  272


 Score = 69.3 bits (168),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            I  F + +  DI+ GRF      + N  L++VSHGL LR+FLMRW+ WTV++F  ++N G
Sbjct  271  ITIFEDHMVRDINAGRF------ADNTALVLVSHGLALRIFLMRWFHWTVDEFLLVYNPG  324

Query  930  NGSMVVMERGYGGRYSLLMH  989
            N   +V+ER     YS   H
Sbjct  325  NAEPLVLERCPSTEYSSWRH  344



>emb|CEF97227.1| Phosphoglycerate/bisphosphoglycerate mutase, active site [Ostreococcus 
tauri]
Length=300

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            PRRI+LVRHG+S GNVDES YTR  D +V +T  G  +AE  GRR+R+M++ +  ED+K+
Sbjct  28   PRRIVLVRHGESFGNVDESEYTRTPDSQVRLTATGHNQAETTGRRLRDMMD-ETGEDYKL  86

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FY+SPYRR  ET   +AKAF+  RI GVREEP+LREQDFGNFQD E  + EK  R R+G
Sbjct  87   FFYLSPYRRSKETAIGIAKAFDGRRILGVREEPQLREQDFGNFQDYEAKQAEKRERHRFG  146

Query  619  RFFYRFPNGESAADVYDRITGSSGANVVDL  708
            RFFYRFPNGES ADVYDRIT  S   V D+
Sbjct  147  RFFYRFPNGESGADVYDRITMFSDHMVRDI  176


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            I  F + +  DID GRF        + N+I+ +HGLTLR+FLMRW+ WTV ++E + N  
Sbjct  165  ITMFSDHMVRDIDAGRF------PEDTNMILCTHGLTLRLFLMRWFHWTVAEYERIANPS  218

Query  930  NGSMVVMER  956
            N   +++ER
Sbjct  219  NSQPIILER  227



>ref|XP_011102210.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Sesamum 
indicum]
Length=270

 Score =   139 bits (350),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG++Q N DE+V   V + K+ ++++G  +A + G +IRE++   E  DWKV
Sbjct  24   PKRIILVRHGETQVNEDETVLEYVPNYKIKLSKKGRHQAHKTGSKIREIV-SHENSDWKV  82

Query  439  YFYVSPYRRGLETLRNL---AKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            +FYVSP  R  ET+  +    + F + ++ GVREE RLREQ FGNFQ+ E  K  K +R 
Sbjct  83   FFYVSPSSRTRETMEEIMGGGETFPKEKVVGVREECRLREQHFGNFQEMETRKKIKRMRN  142

Query  610  RYGRFFYRFPNGESAADVYDRIT  678
             YG+FFYR P+GES+ADV+DR++
Sbjct  143  GYGKFFYRVPDGESSADVHDRVS  165


 Score = 84.7 bits (208),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E L  D++  RF      S  +NLI+VSHGLT+ +FLM+ + W+++QFEGL N G
Sbjct  164   VSAFLEGLWRDMETNRF--GNGPSNELNLIVVSHGLTILLFLMKCFNWSIDQFEGLTNPG  221

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             N    V+E G  G YSL +HH  EEL ++GL+ +M+ +Q+
Sbjct  222   NCEYRVIEVGCNGEYSLSVHHQDEELREWGLSQEMIEEQK  261



>ref|XP_005647575.1| phosphoglycerate mutase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23031.1| phosphoglycerate mutase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   167 bits (423),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRH +S+GN D   Y+ + DP++ +T +G  +A + GR+IR +IE D  + +K+
Sbjct  191  PKRIILVRHAESEGNTDHFAYSHIPDPQICLTHRGHEQAIDAGRKIRSIIEAD-GQPYKL  249

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFY+SPYRR  +T+  +A  FE  +IAG +EE +LREQDFGNFQD E  + EKA R R+G
Sbjct  250  YFYMSPYRRSSQTVEGIASCFEEDQIAGFQEEVQLREQDFGNFQDTEGKEREKAERIRFG  309

Query  619  RFFYRFPNGESAADVYDRIT  678
            RFFYRFPNGES ADVYDR+T
Sbjct  310  RFFYRFPNGESGADVYDRMT  329


 Score = 56.2 bits (134),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 15/87 (17%)
 Frame = +3

Query  759  FRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGS  938
            F + +  DI+ GRF      + N +L++V+HGL  R+FLMRW+ W+V +   + N  N  
Sbjct  331  FEDHMIRDINAGRF------AKNTSLVLVTHGLAARIFLMRWFHWSVAELLMVFNPPNAE  384

Query  939  MVVMER-------GYGGRYSLLMHHTK  998
             +V++R         GGR S +  HTK
Sbjct  385  PIVLDRIPKDEAAKAGGRASWI--HTK  409



>ref|XP_004230164.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Solanum 
lycopersicum]
Length=284

 Score =   136 bits (342),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+   N D +VY    + K+ +TE+G+ +A++ G RI+++I +++ ++WKV
Sbjct  18   PKRIILVRHGECSANADINVYGTTPNHKIELTEKGIEQAKQTGTRIKKLISEND-KNWKV  76

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            +FYVSP  R   TLR +  +F + R+ GV+EE RLRE +FGN+ D   +   K  R  YG
Sbjct  77   FFYVSPAERTRRTLREMGGSFPKRRVMGVKEEYRLRELNFGNYHDPASIGKIKKERVTYG  136

Query  619  RFFYRFPNGESAADVYDRIT  678
            RF+YR P GE+ A+VYDRI+
Sbjct  137  RFYYRVPGGETGAEVYDRIS  156


 Score = 87.0 bits (214),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 66/108 (61%), Gaps = 5/108 (5%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I  + E LR DI++ +F          N+I+V+HGL+ R+FLM+W+ WT+EQFE L+ + 
Sbjct  155   ISSYIECLRRDIEMKKF-----CDEETNIIIVTHGLSSRIFLMKWFDWTIEQFEDLNRMK  209

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQEWQKIAKPG  1073
                  V++ G+GG YSL  HH  ++L ++GL+  M+ DQ+ +     G
Sbjct  210   TSEFQVLQLGHGGEYSLAFHHDDKKLGEWGLSPDMIEDQKCKAYGPNG  257



>ref|XP_011101658.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Sesamum 
indicum]
Length=269

 Score =   136 bits (342),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG++Q N DE+V   V + K+ ++++G  +A + G +IRE I+  +  DWKV
Sbjct  23   PKRIILVRHGETQVNEDETVLEYVPNYKIKLSKKGRHQAHKTGSKIRE-IKLFQNSDWKV  81

Query  439  YFYVSPYRRGLETLRNL---AKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            +FYVSP  R  ET+  +    + F + ++ GVREE RLREQ FGNFQ+ E  K  K +R 
Sbjct  82   FFYVSPSSRTRETMEEIMGGGETFPKEKVVGVREECRLREQHFGNFQEMETRKKIKRMRN  141

Query  610  RYGRFFYRFPNGESAADVYDRIT  678
             YG+FFYR P+GES+ADV+DR++
Sbjct  142  GYGKFFYRVPDGESSADVHDRVS  164


 Score = 84.7 bits (208),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             +  F E L  D++  RF      S  +NLI+VSHGLT+ +FLM+ + W+++QFEGL N G
Sbjct  163   VSAFLEGLWRDMETNRF--GNGPSNELNLIVVSHGLTILLFLMKCFNWSIDQFEGLTNPG  220

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             N    V+E G  G YSL +HH  EEL ++GL+ +M+ +Q+
Sbjct  221   NCEYRVIEVGCNGEYSLSVHHQDEELREWGLSQEMIEEQK  260



>ref|XP_009792382.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=294

 Score =   130 bits (328),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 99/168 (59%), Gaps = 15/168 (9%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T     P+RIILVRHG+   N D +VY    + K+ +T++G+ +A++ G  I+++I  +
Sbjct  14   TTCSNHLPKRIILVRHGECLANTDINVYGTTPNHKIELTQKGIEQAKQTGSLIKKLITSE  73

Query  418  ---EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
               E+ +WKV+FYVSP  R   TLR + ++F + ++ GV+EE RLRE  FGN+ D   + 
Sbjct  74   NAVESNNWKVFFYVSPAERTRRTLREIGQSFPKRKVMGVKEEYRLRELSFGNYHDPASIA  133

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCACL  732
              K  R  YGRF+YR   GE+ A+VYDRI+            SF  CL
Sbjct  134  KVKEERVTYGRFYYRVTGGETGAEVYDRIS------------SFVECL  169


 Score = 90.1 bits (222),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF-EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNI  926
             I  F E LR DI++ +F E P +++   N+I+V+HGL+ R+FLM+W++WT+EQFE L+ +
Sbjct  162   ISSFVECLRRDIEMKKFCEDPSQET---NIIIVTHGLSSRIFLMKWFEWTIEQFEDLNRM  218

Query  927   GNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
                   V++ G GG YSL  HH  ++L ++GL+  M+ DQ+
Sbjct  219   RTCEFQVLQLGQGGEYSLAFHHDDKKLKEWGLSLDMIEDQK  259



>ref|XP_009592808.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   132 bits (333),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 96/144 (67%), Gaps = 3/144 (2%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD---EAED  429
            P+RIILVRHG+   N D +VY    + K+ +T++G+ +A++ G  I+++I  +   E+ +
Sbjct  50   PKRIILVRHGECLANADINVYGTTPNHKIELTQKGIEQAKQTGSLIKKLITSENAVESNN  109

Query  430  WKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRE  609
            WKV+FYVSP  R   TLR + ++F + ++ GV+EE RLRE  FGN+ +   +   K  R 
Sbjct  110  WKVFFYVSPAERTRRTLREMGQSFPKRKLMGVKEEYRLRELSFGNYHNPASIAKVKEERV  169

Query  610  RYGRFFYRFPNGESAADVYDRITG  681
            +YGRF+YR P GE+ A+VYDRI+ 
Sbjct  170  KYGRFYYRVPGGETGAEVYDRISS  193


 Score = 87.8 bits (216),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I  F E LR DI++ +F    + S + N+I+V+HGL+ R+FLM+W++WT+EQFE L+ + 
Sbjct  191   ISSFVECLRRDIEMKKF--CDDTSQDTNIIIVTHGLSSRIFLMKWFEWTIEQFEDLNRMK  248

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
                  V++ G  G YSL  HH  ++L ++GL+  M+ DQ+
Sbjct  249   TCEFQVLQLGQRGEYSLAFHHNDKKLREWGLSLDMIEDQK  288



>ref|XP_011036746.1| PREDICTED: phosphoglycerate mutase-like protein AT74 [Populus 
euphratica]
Length=164

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWKV  438
            P+RIILVRHG+SQGN+D + YT   D K+ +T  G+A+A + G  +  +I  DE ++W+V
Sbjct  16   PQRIILVRHGESQGNLDTAAYTTTPDNKIPLTPLGLAQARQAGDHLYNIISNDENKNWRV  75

Query  439  YFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERYG  618
            YFYVSPY R   TLR + ++F++ RI GVREE R+REQDFGNFQ +E+MK+ K   ER+G
Sbjct  76   YFYVSPYDRTRSTLREIGRSFKKERIIGVREECRVREQDFGNFQVKERMKVIKESIERFG  135

Query  619  RFFYRFPNGESAADVYDRITG  681
            RFFYRFP GESAADV+DR++G
Sbjct  136  RFFYRFPEGESAADVFDRVSG  156



>gb|KFM25028.1| Broad-range acid phosphatase DET1 [Auxenochlorella protothecoides]
Length=719

 Score =   149 bits (376),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = +1

Query  229  HNPATVKPPR-----PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRR  393
            H+ ++   PR     P RI+L+RH +S+GNVD   YT + D +V +T  G  +A   G R
Sbjct  459  HSTSSGATPRDFRTLPIRIVLIRHAESEGNVDNIAYTYLPDSRVPLTTYGWQQALTAGER  518

Query  394  IREMIEKDEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQD  573
            +RE +   +A   +++FY SPY R  +T   +A AF+  +I G +EE +LREQDFGNFQD
Sbjct  519  VRE-VSSGDAHPPRLFFYTSPYLRSKQTFEGVAAAFDPGQIMGAQEEVQLREQDFGNFQD  577

Query  574  REQMKIEKAVRERYGRFFYRFPNGESAADVYDRIT  678
             E  + EKA R R+GRFFYRFPNGES ADVYDR+T
Sbjct  578  AEGKQREKAERLRFGRFFYRFPNGESGADVYDRMT  612


 Score = 68.6 bits (166),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +3

Query  759  FRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGS  938
            F + L  DI+ GRF       P+  L++V+HGL LR+FLMRW+ WTVE+F G+ N  N  
Sbjct  614  FEDHLVRDINAGRF------GPDATLVLVTHGLALRIFLMRWFHWTVEEFMGVFNPPNAE  667

Query  939  MVVMER  956
             +V+ER
Sbjct  668  PLVLER  673



>ref|XP_009792383.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
sylvestris]
Length=293

 Score =   127 bits (319),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 99/168 (59%), Gaps = 15/168 (9%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T     P+RIILVRHG+   N D +VY    + K+ +T++G+ +A++ G  ++++I  +
Sbjct  14   TTCSNHLPKRIILVRHGECLANTDINVYGTTPNHKIELTQKGIEQAKQTGSLLKKLITSE  73

Query  418  ---EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
               E+ +WKV+FYVSP  R   TLR + ++F + ++ GV+EE RLRE  FGN+ D   + 
Sbjct  74   NAVESNNWKVFFYVSPAERTRRTLREIGQSFPKRKVMGVKEEYRLRELSFGNYHDPASIA  133

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCACL  732
              K  R  +GRF+YR   G++ A+VYDRI+            SF  CL
Sbjct  134  KVKEERVTFGRFYYRVSGGQTIAEVYDRIS------------SFVECL  169


 Score = 89.0 bits (219),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
             I  F E LR DI++ +F    + S   N+I+V+HGL+ R+FLM+W++WT EQFE L+ + 
Sbjct  162   ISSFVECLRRDIEMKKF--CDDPSRETNIIIVTHGLSSRIFLMKWFEWTAEQFEDLNRMK  219

Query  930   NGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
                  V++ G GG YSL  HH  ++L ++GL+  M+ DQ+
Sbjct  220   TCEFQVLQLGNGGEYSLAFHHDDKKLKEWGLSRDMIEDQK  259



>ref|XP_009606097.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
tomentosiformis]
Length=200

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMI-EK  414
            + VK   P+RIILVRHG+SQGN D++ Y+   D K+ +T +G+ +A + G RI +++ + 
Sbjct  9    SDVKYHLPKRIILVRHGESQGNKDDNAYSITPDYKIPLTTRGIEQANQVGSRILDVVSDH  68

Query  415  DEAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIE  594
              +++WKVYFYVSPY R   TLR + +AF R+R+ GVREE R+REQDFGNFQ  E+MK+ 
Sbjct  69   GSSDNWKVYFYVSPYVRTRSTLREIGRAFPRNRVLGVREECRVREQDFGNFQVAERMKVI  128

Query  595  KAVRERYGRFFYRFPNGESAADVYDRIT  678
            K  RER+GRFFYRFP GESAADVYDR++
Sbjct  129  KETRERFGRFFYRFPEGESAADVYDRVS  156



>ref|XP_009592804.1| PREDICTED: broad-range acid phosphatase DET1-like [Nicotiana 
tomentosiformis]
Length=293

 Score =   125 bits (315),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 15/168 (9%)
 Frame = +1

Query  238  ATVKPPRPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD  417
             T     P+RIILVRHG+   N D +VY    + K+ +T++G+ +A++ G  I+++I  +
Sbjct  14   TTSNNHLPKRIILVRHGECLANADINVYGTTPNHKIELTQKGIEQAKQTGSLIKKLIISE  73

Query  418  ---EAEDWKVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMK  588
               E+ +WKV+FYVSP  R   TLR + ++F + ++ GV+EE RLRE  FGN+ D   + 
Sbjct  74   NAVESNNWKVFFYVSPAERTRRTLREIGQSFPKRKVMGVKEEYRLRELSFGNYHDPASIA  133

Query  589  IEKAVRERYGRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCACL  732
              K  R  YGRF+YR   G + A+VYDRI+            SF  CL
Sbjct  134  KVKEERVTYGRFYYRVLGGGTIAEVYDRIS------------SFVECL  169


 Score = 89.0 bits (219),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 67/102 (66%), Gaps = 6/102 (6%)
 Frame = +3

Query  750   IVGFRETLRNDIDIGRF--EPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHN  923
             I  F E L  DI++ +F  +PP E     N+I+V+HGL+ R+FLM+W++WTVEQFE L+ 
Sbjct  162   ISSFVECLSRDIEMKKFCDDPPQE----TNIIIVTHGLSSRIFLMKWFEWTVEQFEDLNR  217

Query  924   IGNGSMVVMERGYGGRYSLLMHHTKEELMKFGLTDKMLIDQE  1049
             +      V++ G GG YSL  HH  ++L ++GL+  M+ DQ+
Sbjct  218   MKTCEFQVLQLGNGGEYSLAFHHDDKKLREWGLSLDMIEDQK  259



>ref|WP_030421247.1| phosphoglycerate mutase [Streptomyces sp. NRRL F-5065]
Length=219

 Score =   154 bits (388),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY RV D  + +TE+G A+AEE GRR+ E+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYERVPDHALALTERGWAQAEETGRRLHEVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  +TLR    AF+   R+  VREEPRLREQD+GN Q+RE++ ++K+ R+ 
Sbjct  58   VSVYVSPYRRTHQTLR----AFDLDPRLIRVREEPRLREQDWGNLQNREEVLVQKSYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 60.8 bits (146),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEEP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGEDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|XP_005847519.1| hypothetical protein CHLNCDRAFT_134554 [Chlorella variabilis]
 gb|EFN55417.1| hypothetical protein CHLNCDRAFT_134554 [Chlorella variabilis]
Length=485

 Score =   150 bits (378),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIR-EMIEKDEAEDWK  435
            P+RI LVRH +S+GNVD   YT + DP+V +T +G  +A   G R++ +M      + +K
Sbjct  242  PKRIFLVRHAESEGNVDNIAYTYLPDPRVPLTARGWQQAMLAGDRLKAQMDAAHGGKPYK  301

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            ++FY SPY R  +T   LA+ F   ++ GV+EE +LREQDFGNFQD E  K EKA R R+
Sbjct  302  LFFYTSPYLRSRQTYEGLAQVFMPEQVQGVQEEVQLREQDFGNFQDAEGKKREKAERLRF  361

Query  616  GRFFYRFPNGESAADVYDRIT  678
            GRFFYRFPNGES ADVYDR+T
Sbjct  362  GRFFYRFPNGESGADVYDRMT  382


 Score = 64.7 bits (156),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 12/93 (13%)
 Frame = +3

Query  759   FRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGS  938
             F + L  DI+ GRF      + + +L++V+HGL LRVFLMRW+ WTV+QF  + N  N  
Sbjct  384   FEDHLVRDINAGRF------ADSTSLVLVTHGLALRVFLMRWFHWTVDQFMCVFNPPNAE  437

Query  939   MVVMERGYGGRYSLLMHHTKEELMKFGLTDKML  1037
              +V+ER     Y L    +  E++K G T+ M 
Sbjct  438   PLVLERAL---YRL--SDSSREVIK-GCTEDMC  464



>ref|WP_030342899.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-1022]
Length=219

 Score =   152 bits (384),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWRQAEETGKRLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FF+RFP GES ADVYDR+ G
Sbjct  115  GHFFFRFPQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M V+  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLANPGNAEMRVLVLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_029393377.1| MULTISPECIES: phosphoglycerate mutase [Streptomyces]
Length=219

 Score =   151 bits (381),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G+A+AEE G+ +RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGLAQAEETGKALREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 62.8 bits (151),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE PG      N+++V+HGL +R+F MRW+ WTV +FE L N GNG M ++  G  G+Y 
Sbjct  145  FEDPGHPP---NVLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNGEMRMLVLGEDGKYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030750765.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-31]
Length=219

 Score =   153 bits (387),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G+ +AEE G+R+RE+  +++     
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGLRQAEETGKRLRELFGREQ-----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDPGLIRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FF+RFP GES ADVYDR+ G
Sbjct  114  YGHFFFRFPQGESGADVYDRVGG  136


 Score = 58.9 bits (141),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G   RY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGEDDRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_003956106.1| phosphoglycerate mutase [Streptomyces clavuligerus]
 gb|EDY50554.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 
27064]
 gb|EFG09759.1| phosphoglycerate mutase family protein, putative [Streptomyces 
clavuligerus ATCC 27064]
Length=219

 Score =   147 bits (372),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 12/155 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GN D++VY R  D  + +T +G+++AEE G R+RE+  ++      
Sbjct  3    RPRRIVLVRHGESEGNADDTVYEREPDHALRLTGRGLSQAEETGARLRELFGRE-----S  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  +T R       R R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHQTFRAFGLDPARVR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSF  720
            G FFYRF  GES ADVYDR+    GA +  L  SF
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSF  145


 Score = 65.1 bits (157),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +3

Query  816  QSPN--MNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYSL  980
            +SP+   N+++V+HGLT+R+F MRW+ WTV +FE L N GNG   V+  G  GRY+L
Sbjct  146  ESPDHPPNVLLVTHGLTMRLFCMRWFHWTVAEFESLSNPGNGETRVLTLGDDGRYTL  202



>ref|WP_030947189.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-646]
Length=219

 Score =   151 bits (381),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGWQQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   S   N+++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAPDHPS---NVLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030609003.1| phosphoglycerate mutase [Streptomyces achromogenes]
Length=219

 Score =   152 bits (385),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GN+D+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNIDDSVYEREPDHALALTERGWRQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FF+RFP GES ADVYDR+ G
Sbjct  115  GHFFFRFPQGESGADVYDRVGG  136


 Score = 59.7 bits (143),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_037710795.1| phosphoglycerate mutase [Streptomyces mirabilis]
Length=219

 Score =   152 bits (383),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G  +AEE G+R+RE++ ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGWQQAEETGKRLREVLGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 60.5 bits (145),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = +3

Query  798   FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
             FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145   FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978   LLMHHTK-EELMKFGLTD  1028
             L     +  E   +G+TD
Sbjct  202   LDRPFGRWREPEPYGITD  219



>gb|AJE81830.1| hypothetical protein SLNWT_1454 [Streptomyces albus]
Length=231

 Score =   145 bits (367),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RI+LVRHG+SQGN+D+SVY R  D  + +TE G  +A   G R+R +  ++     +
Sbjct  3    RPQRIVLVRHGESQGNIDDSVYEREPDHALALTEAGHEQAVRTGARLRRLFGEE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR  A    R RI   REEPRLREQD+GN+QD E ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFALDPARVRI---REEPRLREQDWGNWQDHEDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    G+ +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GSFLESLHRSFEA  147


 Score = 65.9 bits (159),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +3

Query  831   NLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYSLLMHHTK-EEL  1007
             N+++V+HGLT+R+  MRW+ W+V +FE L N GN  M V+ERG  G+Y+L     +  E 
Sbjct  153   NVLLVTHGLTMRLLCMRWFHWSVAEFESLSNPGNAEMRVLERGPDGKYTLDQPFERWCEP  212

Query  1008  MKFGLT  1025
               +GLT
Sbjct  213   EPYGLT  218



>ref|WP_030826137.1| phosphoglycerate mutase [Streptomyces sp. NRRL F-2305]
Length=219

 Score =   150 bits (379),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 100/142 (70%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +T QG  +AEE G R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTAQGRQQAEETGERLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  +TL       ER R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHQTLSAFRLDPERIR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M V+  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRVLVLGENGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|XP_001702950.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96803.1| predicted protein [Chlamydomonas reinhardtii]
Length=213

 Score =   152 bits (383),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +1

Query  259  PRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKD-EAED-W  432
            P RIILVRH +S+GNVD   Y+ + D +V +T +G  +A E G+ I+++++ D EA D +
Sbjct  8    PERIILVRHAESEGNVDNKAYSYIPDSQVPLTARGHMQAREAGQMIKQVMKSDPEARDNF  67

Query  433  KVYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            +++FY+SPY+R L+T   +   F    + GV+EE +LREQDFGNFQD    + EKA R R
Sbjct  68   RLFFYISPYKRSLQTYEGICSQFPSHHLLGVQEEVQLREQDFGNFQDHVGKQREKAERLR  127

Query  613  YGRFFYRFPNGESAADVYDRIT  678
            +GRFFYRFPNGES ADVYDRIT
Sbjct  128  FGRFFYRFPNGESGADVYDRIT  149


 Score = 59.3 bits (142),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 6/64 (9%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            I  F + +  DI+ GRF      +   +L++V+HGL LRVFLMRW+ WTV++F  ++N G
Sbjct  148  ITIFEDHMIRDINAGRF------ADKTSLVLVTHGLALRVFLMRWFHWTVDEFLSVYNPG  201

Query  930  NGSM  941
            N  +
Sbjct  202  NAEV  205



>ref|WP_030796603.1| phosphoglycerate mutase [Streptomyces sp. NRRL F-5008]
Length=219

 Score =   151 bits (381),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +T++G  +AEE GRR+RE++ ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTDRGRQQAEETGRRLREVLGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFER-SRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF   S +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDSDLIRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 59.7 bits (143),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_040256397.1| phosphoglycerate mutase, partial [Streptomyces albus]
Length=219

 Score =   145 bits (366),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RI+LVRHG+SQGN+D+SVY R  D  + +TE G  +A   G R+R +  ++     +
Sbjct  3    RPQRIVLVRHGESQGNIDDSVYEREPDHALALTEAGHEQAVRTGARLRRLFGEE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR  A    R RI   REEPRLREQD+GN+QD E ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFALDPARVRI---REEPRLREQDWGNWQDHEDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    G+ +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GSFLESLHRSFEA  147


 Score = 65.9 bits (159),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  831  NLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYSL  980
            N+++V+HGLT+R+  MRW+ W+V +FE L N GN  M V+ERG  G+Y+L
Sbjct  153  NVLLVTHGLTMRLLCMRWFHWSVAEFESLSNPGNAEMRVLERGPDGKYTL  202



>ref|WP_030647607.1| MULTISPECIES: phosphoglycerate mutase [Streptomyces]
Length=219

 Score =   153 bits (386),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWQQAEETGKRLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDPDLIRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FF+RFP GES ADVYDR+ G
Sbjct  114  YGHFFFRFPQGESGADVYDRVGG  136


 Score = 57.8 bits (138),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L        FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VGGFLESL-----FRSFEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLANPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            N  M ++  G   +Y+L
Sbjct  186  NAEMRMLVLGEDDKYTL  202



>gb|AIS00945.1| alpha-ribazole phosphatase [Streptomyces glaucescens]
Length=219

 Score =   151 bits (382),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G+ +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGLRQAEETGKRLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETL+      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLQAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 59.3 bits (142),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N  NG M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLRNPENGDMRMLVLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_033286209.1| phosphoglycerate mutase [Streptomyces sp. NRRL F-525]
Length=219

 Score =   149 bits (376),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +T+QG  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHSLALTDQGWLQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            +  YVSPYRR  ET R    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   ISVYVSPYRRTHETFR----AFHLDPDLVRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGRYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030902585.1| phosphoglycerate mutase [Streptomyces sp. NRRL F-5126]
Length=215

 Score =   150 bits (380),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 12/155 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRIILVRHG+S+GN D+SVY RV D  + +TE+GV +AE  G+R+R     DE  D +
Sbjct  3    RPRRIILVRHGESEGNADDSVYERVPDHALSLTERGVRQAEATGKRLR-----DELGDGR  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPY R  +TLR  A A +R  +  VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSAYVSPYLRTHQTLR--AFALDRC-LVRVREEPRLREQDWGNWQDRDDVRLQKAHRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSF  720
            G FFYRF  GES ADVYDR+    GA +  L   F
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRGF  145


 Score = 60.1 bits (144),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   SP  N+++V+HGLT+R+F MRW+ WTV +FE L N GNG    +  G  G Y+
Sbjct  145  FEQP--DSPP-NVLIVTHGLTMRLFCMRWFHWTVAEFEALSNPGNGETRSLLLGEDGTYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>gb|EDY61370.1| alpha-ribazole phosphatase [Streptomyces sviceus ATCC 29083]
Length=219

 Score =   150 bits (378),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G  +AEE G+R+RE++ +++     
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGWRQAEETGKRLREVLGREQ-----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 60.5 bits (145),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = +3

Query  798   FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
             FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145   FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978   LLMHHTK-EELMKFGLTD  1028
             L     +  E   +G+TD
Sbjct  202   LDRPFGRWREPEPYGITD  219



>ref|WP_030870582.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-37]
Length=225

 Score =   150 bits (379),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGRLQAEETGERLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  +TL       ER R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHQTLSAFRLDPERIR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 60.1 bits (144),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = +3

Query  798   FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
             FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145   FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGENGKYT  201

Query  978   LLMHHTK-EELMKFGLTD  1028
             L     +  +   +G+TD
Sbjct  202   LDRPFERWRDPEPYGITD  219



>ref|WP_030974094.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-1824]
Length=219

 Score =   149 bits (375),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 106/155 (68%), Gaps = 12/155 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RI+LVRHG+S+GN D++VY R  D  + +T  G+ +A E G R+R++ + +     +
Sbjct  3    RPQRIVLVRHGESEGNADDTVYEREPDHALRLTATGLRQARETGARLRDLFDGE-----Q  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET R+L    ER R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETFRSLGLDLERVR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSF  720
            G FFYRF  GES ADVYDR+    GA +  L  SF
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSF  145


 Score = 61.6 bits (148),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ W+V +FE L N GNG   ++  G  GRY+
Sbjct  145  FEDP-DHPPN--VLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGETRMLMLGEDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_019061000.1| phosphoglycerate mutase [Streptomyces prunicolor]
Length=219

 Score =   149 bits (375),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +T+QG  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHSLALTDQGWRQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            +  YVSPYRR  ET R    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   ISVYVSPYRRTHETFR----AFHLDPDLVRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGRYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_020942656.1| hypothetical protein [Streptomyces collinus]
 ref|YP_008389055.1| hypothetical protein B446_27180 [Streptomyces collinus Tu 365]
 gb|AGS72244.1| hypothetical protein B446_27180 [Streptomyces collinus Tu 365]
Length=219

 Score =   148 bits (374),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+ +RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGRRQAEETGKTLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FF+RFP GES ADVYDR+ G
Sbjct  115  GHFFFRFPQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGEDGRYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_023538202.1| phosphoglycerate mutase [Streptomyces niveus]
 gb|EST30432.1| phosphoglycerate mutase [Streptomyces niveus NCIMB 11891]
Length=219

 Score =   149 bits (375),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GN D++VY R  D  +G+TE G  +AEE G R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESEGNADDTVYEREPDHALGLTETGWRQAEETGARLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET R  A   E  R    REEPRLREQD+GN+QD E ++++K  R+ Y
Sbjct  58   VSVYVSPYRRTHETFRAFALDPELVR---AREEPRLREQDWGNWQDHEDVRLQKTYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSFEA  147


 Score = 60.8 bits (146),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   +   N+++++HGLT+R+F MRW+ W+V +FE L N GNG    +  G  GRY+
Sbjct  145  FEAPDHPA---NVLLITHGLTMRLFCMRWFHWSVAEFESLSNPGNGDSRTLLLGEDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030670372.1| phosphoglycerate mutase [Streptomyces cellulosae]
Length=219

 Score =   149 bits (377),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWQQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   ISVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRI  675
            G FFYRF  GES ADVYDR+
Sbjct  115  GHFFYRFAQGESGADVYDRV  134


 Score = 60.1 bits (144),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   +   N+++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAPDHPT---NVLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030785422.1| phosphoglycerate mutase [Streptomyces lavenduligriseus]
Length=219

 Score =   150 bits (378),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGRRQAEETGERLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDPGLIRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FF+RFP GES ADVYDR+ G
Sbjct  114  YGHFFFRFPQGESGADVYDRVGG  136


 Score = 59.7 bits (143),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLANPGNAEMRMLVLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030931697.1| phosphoglycerate mutase [Streptomyces violaceoruber]
Length=219

 Score =   149 bits (377),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWQQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            +  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   ISVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRI  675
            G FFYRF  GES ADVYDR+
Sbjct  115  GHFFYRFAQGESGADVYDRV  134


 Score = 60.1 bits (144),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   +   N+++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAPDHPT---NVLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_037701328.1| phosphoglycerate mutase [Streptomyces atratus]
Length=219

 Score =   148 bits (374),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RI+LVRHG+S+GN D++VY R  D  + +T  G+ +A E G ++RE+  ++     +
Sbjct  3    RPQRIVLVRHGESEGNADDTVYEREPDHALRLTATGLRQARETGAQLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET R+     ER R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETFRSFGLDLERVR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSFEA  147


 Score = 61.2 bits (147),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ W+V +FE L N GNG    +  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGEKRTLILGEDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_026179190.1| phosphoglycerate mutase [Streptomyces sp. R1-NS-10]
Length=219

 Score =   148 bits (374),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +T+QG  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTDQGWRQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            +  YVSPYRR  ET R    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   ISVYVSPYRRTHETFR----AFHLDPDLVRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGRYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_024885646.1| phosphoglycerate mutase [Streptomyces sp. CNH189]
Length=222

 Score =   152 bits (383),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 104/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GNVD++VY R  D  +G+TE+G  +AE  G R+R++  ++     +
Sbjct  3    RPRRIVLVRHGESRGNVDDTVYEREPDHALGLTERGRKQAEATGERLRDVFGQE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR LETL +     +R R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTLETLGSFGLDPDRIR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 57.8 bits (138),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  + ++  G  G+Y+
Sbjct  145  FEDP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEVRMLVLGEDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030220830.1| phosphoglycerate mutase [Streptomyces bikiniensis]
Length=219

 Score =   150 bits (380),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GN D++VY R  D  + +TE G  +AEE G R+RE+   DEA    
Sbjct  3    RPRRIVLVRHGESEGNADDTVYEREPDHALRLTETGWRQAEETGERLRELF-GDEA----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E+ R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLPPEQVR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 58.9 bits (141),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ WTV  FE L N GN    V+     GRY 
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRVLLLDEDGRYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030778611.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-920]
Length=219

 Score =   147 bits (370),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRIILVRHG+S GN D++VY R  D  + +TE G A+A + G R+RE++ ++     +
Sbjct  3    RPRRIILVRHGESAGNADDTVYEREPDHALALTETGWAQATDVGERLREVLGQE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETL+      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLQAFRLDPELVR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 62.4 bits (150),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ W+V +FE L N GNG M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGEMRMLVLGEDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_039652538.1| phosphoglycerate mutase [Streptomyces sp. MUSC 125]
 gb|KHK86858.1| phosphoglycerate mutase [Streptomyces pluripotens]
 gb|KIE26627.1| phosphoglycerate mutase [Streptomyces sp. MUSC 125]
 gb|KIE39671.1| phosphoglycerate mutase [Streptomyces pluripotens]
Length=219

 Score =   149 bits (375),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G ++RE+ +++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWRQAEETGGKLRELFDRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF     +  VREEPRLREQD+GN+QDR+ ++++K  R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFRLDPGLIRVREEPRLREQDWGNWQDRDDVRLQKTYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FF+RFP GES ADVYDR+ G
Sbjct  114  YGHFFFRFPQGESGADVYDRVGG  136


 Score = 60.8 bits (146),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV  FE L N GN  M V+  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVADFESLANPGNAEMRVLVLGENGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_028424398.1| phosphoglycerate mutase [Streptomyces sp. GXT6]
Length=219

 Score =   148 bits (373),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+ +RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWRQAEETGKELRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L        FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VGGFLESL-----FRSFEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFECLSNPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            NG M ++  G  G+Y+L
Sbjct  186  NGEMRMLVLGDDGKYTL  202



>ref|WP_023546149.1| phosphoglycerate mutase [Streptomyces roseochromogenus]
 gb|EST34249.1| phosphoglycerate mutase [Streptomyces roseochromogenes subsp. 
oscitans DS 12.976]
Length=219

 Score =   147 bits (372),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE G+ IRE+  ++      
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGRRQAEETGKEIREIFGRE-----C  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FF+RFP GES ADVYDR+ G
Sbjct  115  GHFFFRFPQGESGADVYDRVGG  136


 Score = 61.2 bits (147),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGEDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030235303.1| MULTISPECIES: phosphoglycerate mutase [Streptomyces]
Length=219

 Score =   149 bits (377),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY RV D  + +TE+G  +AE  G R+RE+   +     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYERVPDHALALTERGRRQAEATGERLRELFGGE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFER-SRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF   + +  VREEPRLREQD+GN+QDR++++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDTGLIRVREEPRLREQDWGNWQDRDEVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 59.3 bits (142),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GNG + ++  G  G+Y+
Sbjct  145  FEDP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNGEVRMLVLGDDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_005311052.1| phosphoglycerate mutase [Streptomyces pristinaespiralis]
 gb|EDY63271.1| conserved hypothetical protein [Streptomyces pristinaespiralis 
ATCC 25486]
Length=219

 Score =   147 bits (370),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GN D++VY R  D  + +T  G+A+A E G  +R++  ++     +
Sbjct  3    RPRRIVLVRHGESVGNADDTVYEREPDHALQLTAAGLAQAAETGAHLRDLFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET +  A   E  R   VREEPRLREQD+GN+QDRE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETFQAFALDPELVR---VREEPRLREQDWGNWQDREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSFAA  147


 Score = 62.0 bits (149),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  831  NLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYSL  980
            N+++V+HGLT+R+F MRW+ W+V +FE L N GNG    ++ G  GRY L
Sbjct  153  NVLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGETRTLQLGDDGRYHL  202



>gb|KFG73310.1| phosphoglycerate mutase [Streptomyces mutabilis]
Length=219

 Score =   148 bits (374),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TEQG A+AEE G+ +RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTEQGRAQAEETGKALREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETL    +AF     +  +REEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETL----QAFHLDPGLIRIREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 60.5 bits (145),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GNG M ++  G  G+Y 
Sbjct  145  FEDP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNGEMRMLVLGEDGKYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030038944.1| phosphoglycerate mutase [Streptomyces resistomycificus]
Length=219

 Score =   149 bits (375),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +T++G+ +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTDRGLQQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRI  675
            G FFYRF  GES ADVYDR+
Sbjct  115  GHFFYRFAQGESGADVYDRV  134


 Score = 59.7 bits (143),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P   S   N+++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y 
Sbjct  145  FEAPDHPS---NVLLVTHGLAMRLFCMRWFHWTVAEFESLANPGNAEMRMLVLGDDGKYV  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_028809895.1| phosphoglycerate mutase [Streptomyces sp. 351MFTsu5.1]
Length=219

 Score =   151 bits (381),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TEQG  +AEE G+R+R++  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTEQGWRQAEETGKRLRDVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 57.8 bits (138),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y 
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYV  201

Query  978  L  980
            +
Sbjct  202  M  202



>ref|WP_009191060.1| phosphoglycerate mutase [Streptomyces sp. e14]
 gb|EFF93518.1| phosphoglycerate mutase [Streptomyces sp. e14]
Length=228

 Score =   147 bits (370),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GN+D+SVY R  D  + +TE+G  +AEE G+ +R++  ++     +
Sbjct  3    RPRRIVLVRHGESEGNLDDSVYEREPDHALALTERGRLQAEETGKELRDLFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETLR    AF     +  VREEPRLREQD+GN+QDR+ ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETLR----AFHLDPDLIRVREEPRLREQDWGNWQDRDDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 62.0 bits (149),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L        FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VGGFLESL-----FRSFEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            NG M ++  G  GRY L
Sbjct  186  NGEMRMLVLGDDGRYVL  202



>ref|WP_041131610.1| phosphoglycerate mutase [Streptomyces vietnamensis]
 gb|AJF67676.1| phosphoglycerate mutase [Streptomyces vietnamensis]
Length=219

 Score =   149 bits (377),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GNVD++VY R  D  + +TE G  +AEE G R+RE+  ++      
Sbjct  3    RPRRIVLVRHGESEGNVDDTVYEREPDHALRLTETGWRQAEETGERLRELFGEE-----P  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E+ R   VREEPRLREQD+GN+Q+RE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLPAEQVR---VREEPRLREQDWGNWQEREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 58.9 bits (141),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ WTV  FE L N GN    ++  G  GRY 
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRMLLLGEDGRYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_006382567.1| phosphoglycerate mutase family protein [Streptomyces turgidiscabies]
 gb|ELP62517.1| phosphoglycerate mutase family protein [Streptomyces turgidiscabies 
Car8]
Length=219

 Score =   147 bits (370),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GN D++VY R  D  + +TE+G  +AEE G+R+RE+  +++     
Sbjct  3    RPRRIVLVRHGESMGNADDTVYEREPDHALALTERGRRQAEETGKRLREVFGQEQ-----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLNPDHIR---VREEPRLREQDWGNWQDRDDVQLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 61.6 bits (148),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGSDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030362796.1| MULTISPECIES: phosphoglycerate mutase [Streptomyces]
Length=219

 Score =   148 bits (374),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GN D++VY R  D  + +TE G  +AEE G+ +RE+  ++      
Sbjct  3    RPRRIVLVRHGESAGNADDTVYEREPDHALALTETGWRQAEETGKHLRELFGQEH-----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET R L    +R R   VREEPRLREQD+GN+QDR+ +K++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETFRALRLDPDRVR---VREEPRLREQDWGNWQDRDDVKLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    G+ +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GSFLESLYRSFEA  147


 Score = 60.1 bits (144),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ W+V +FE L N GNG    +  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGETRTLLLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_014675460.1| phosphoglycerate mutase [Streptomyces hygroscopicus]
 ref|YP_006248046.1| hypothetical protein SHJG_6906 [Streptomyces hygroscopicus subsp. 
jinggangensis 5008]
 ref|YP_007695662.1| hypothetical protein SHJGH_6666 [Streptomyces hygroscopicus subsp. 
jinggangensis TL01]
 gb|AEY92173.1| hypothetical protein SHJG_6906 [Streptomyces hygroscopicus subsp. 
jinggangensis 5008]
 gb|AGF66328.1| hypothetical protein SHJGH_6666 [Streptomyces hygroscopicus subsp. 
jinggangensis TL01]
Length=219

 Score =   150 bits (378),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GN D+SVY R  D  + +TE+G  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNADDSVYEREPDHALALTERGWRQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDLIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FF+RFP GES ADVYDR+ G
Sbjct  115  GHFFFRFPQGESGADVYDRVGG  136


 Score = 58.2 bits (139),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  + ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEVRMLVLGEDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_004982581.1| phosphoglycerate mutase [Streptomyces ghanaensis]
 gb|EFE66696.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 
14672]
Length=219

 Score =   149 bits (377),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE GRR+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWRQAEETGRRLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  +TLR      E  R   VREEPRLREQD+GN+QD E ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHQTLRAFDLDPELIR---VREEPRLREQDWGNWQDCEDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVDG  136


 Score = 58.9 bits (141),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L    D     P        N+++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VDGFLESLFRSFDAPDHPP--------NVLIVTHGLAMRLFCMRWFHWTVAEFESLSNPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            N    ++  G  G+Y+L
Sbjct  186  NAETRMLVLGENGKYTL  202



>ref|WP_016432232.1| hypothetical protein [Streptomyces sp. HGB0020]
 gb|EPD65706.1| hypothetical protein HMPREF1211_02261 [Streptomyces sp. HGB0020]
Length=219

 Score =   150 bits (380),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G  +AEE G+R+RE+   +      
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGWQQAEETGKRLREVFGSE-----P  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      +R RI   REEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPDRIRI---REEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 57.8 bits (138),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L        FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VGGFLESL-----FRSFEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            N  M ++  G   +Y+L
Sbjct  186  NAEMRMLVLGEDDKYTL  202



>ref|WP_024489020.1| phosphoglycerate mutase [Streptomyces sp. AW19M42]
Length=219

 Score =   145 bits (367),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 105/157 (67%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RP+RI+LVRHG+S+GN D++VY R  D  + +T  G+ +A E G R+RE+ + ++     
Sbjct  3    RPQRIVLVRHGESEGNADDTVYEREPDHALRLTSTGLRQARETGVRLRELFDGEQ-----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ET R+     ER R   VREEPRLREQD+GN+Q+R  ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETFRSFGLDLERVR---VREEPRLREQDWGNWQERGDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLHRSFEA  147


 Score = 62.8 bits (151),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ W+V +FE L N GNG +  +  G  GRY+
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWSVAEFESLSNPGNGELRTLVLGKDGRYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_028960141.1| phosphoglycerate mutase [Streptomyces sp. UNC401CLCol]
Length=219

 Score =   149 bits (377),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  +G+TE+G  +AE  G R+R++  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALGLTERGRKQAEATGERLRDLFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR LETL     AF     +  VREEPRLREQD+GN+QDRE ++++KA R+ 
Sbjct  58   VSVYVSPYRRTLETL----NAFHLDPDLIRVREEPRLREQDWGNWQDREDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 58.5 bits (140),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  + ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEVRMLVLGENGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_024754940.1| phosphoglycerate mutase [Streptomyces exfoliatus]
Length=219

 Score =   148 bits (374),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GN D++VY R  D  + +TE G  +AEE G R+RE+   +     +
Sbjct  3    RPRRIVLVRHGESEGNADDTVYEREPDHALRLTETGWRQAEETGERLRELFGDE-----Q  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E+ R   VREEPRLREQD+GN+Q+RE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLPREQMR---VREEPRLREQDWGNWQEREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 59.7 bits (143),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ WTV  FE L N GN     +  G  GRY 
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRTLLLGEDGRYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030605426.1| phosphoglycerate mutase [Streptomyces fulvoviolaceus]
Length=219

 Score =   148 bits (373),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TE+G  +AEE G+ +RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTERGWQQAEETGKPLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 59.7 bits (143),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYA  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_016824385.1| phosphoglycerate mutase [Streptomyces viridosporus]
Length=219

 Score =   149 bits (375),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY R  D  + +TE+G  +AEE GRR+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYEREPDHALALTERGWRQAEETGRRLRELFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  +TLR    AF+    +  VREEPRLREQD+GN+QD E ++++KA R+ 
Sbjct  58   VSVYVSPYRRTHQTLR----AFDLDPDLIRVREEPRLREQDWGNWQDCEDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVDG  136


 Score = 58.9 bits (141),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +3

Query  750  IVGFRETLRNDIDIGRFEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIG  929
            + GF E+L    D     P        N+++V+HGL +R+F MRW+ WTV +FE L N G
Sbjct  134  VDGFLESLFRSFDAPDHPP--------NVLIVTHGLAMRLFCMRWFHWTVAEFESLSNPG  185

Query  930  NGSMVVMERGYGGRYSL  980
            N    ++  G  G+Y+L
Sbjct  186  NAETRMLVLGENGKYTL  202



>ref|WP_027738606.1| phosphoglycerate mutase [Streptomyces sp. CNT360]
Length=221

 Score =   145 bits (365),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 105/155 (68%), Gaps = 12/155 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+L+RHG+S+GN D+S+Y RV D  + +TE+G+ +AE  G+R+RE+   +     +
Sbjct  3    RPRRIVLLRHGESEGNSDDSIYERVPDHALPLTERGLQQAEHAGKRLRELFGGE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETL  L     + R   VREEPRLREQD+GN+QDR+ ++ +K  R+ Y
Sbjct  58   VSAYVSPYRRTRETLAALGMGPAQMR---VREEPRLREQDWGNWQDRQDVRQQKKYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSF  720
            G FFYRF  GES ADVYDR    +GA +  L  SF
Sbjct  115  GHFFYRFAQGESGADVYDR----AGAFLESLWRSF  145


 Score = 62.4 bits (150),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +3

Query  816  QSPN--MNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYSL  980
            +SP+   N+++V+HGLT+R+F MRW+ WTVE+FE L N  NG M  +  G  GRY L
Sbjct  146  ESPDNPPNVLLVTHGLTMRLFCMRWFHWTVEEFECLSNPRNGEMRTLLLGPDGRYHL  202



>ref|WP_030326754.1| phosphoglycerate mutase [Streptomyces sp. NRRL B-3229]
Length=219

 Score =   152 bits (384),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  + +TEQG  +AEE G+R+RE+  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALALTEQGWRQAEETGKRLREVFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 55.5 bits (132),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRY  974
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G   +Y
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDDKY  200



>ref|WP_030895065.1| phosphoglycerate mutase [Streptomyces sp. NRRL S-474]
Length=219

 Score =   148 bits (374),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD+SVY RV D  + +TE+G  +AE  G R+RE+   +     +
Sbjct  3    RPRRIVLVRHGESTGNVDDSVYERVPDHALALTERGRRQAEATGERLRELFGGE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFER-SRIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR  ETL     AF   + +  VREEPRLREQD+GN+QDR++++++KA R+ 
Sbjct  58   VSVYVSPYRRTHETL----HAFHLDTGLIRVREEPRLREQDWGNWQDRDEVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 59.3 bits (142),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GNG + ++  G  G+Y+
Sbjct  145  FEDP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNGEVRMLVLGDDGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_015657410.1| alpha-ribazole phosphatase [Streptomyces davawensis]
 ref|YP_007521145.1| alpha-ribazole phosphatase [Streptomyces davawensis JCM 4913]
 emb|CCK27018.1| alpha-ribazole phosphatase [Streptomyces davawensis JCM 4913]
Length=219

 Score =   149 bits (375),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRIILVRHG+S GNVD++VY R  D  + +T++G  +AEE G+R+RE+  ++      
Sbjct  3    RPRRIILVRHGESTGNVDDTVYEREPDHALALTDRGWEQAEETGKRLREVFGRE-----P  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E  R   VREEPRLREQD+GN+QDR+ ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFHLDPELIR---VREEPRLREQDWGNWQDRDDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITG  681
            G FFYRF  GES ADVYDR+ G
Sbjct  115  GHFFYRFAQGESGADVYDRVGG  136


 Score = 58.5 bits (140),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  M ++  G  G+Y 
Sbjct  145  FEAP-DHPPN--VLLVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEMRMLVLGDDGKYV  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_015036668.1| phosphoglycerate mutase [Streptomyces venezuelae]
 ref|YP_006881031.1| phosphoglycerate mutase [Streptomyces venezuelae ATCC 10712]
 emb|CCA58772.1| phosphoglycerate mutase [Streptomyces venezuelae ATCC 10712]
Length=219

 Score =   150 bits (379),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GNVD++VY R  D  + +TE G A+AE  G R+RE+   DEA    
Sbjct  3    RPRRIVLVRHGESEGNVDDTVYEREPDHALRLTETGWAQAERTGDRLRELF-GDEA----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR      E+ R   VREEPRLREQD+GN+Q+RE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLPPEQVR---VREEPRLREQDWGNWQEREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 57.0 bits (136),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ WTV  FE L N GN     +     GRY 
Sbjct  145  FEAP-DHPPN--VLIVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRTLLLDEDGRYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_030548201.1| phosphoglycerate mutase [Streptomyces exfoliatus]
Length=219

 Score =   146 bits (369),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S+GNVD++VY R  D  +G+T  G+ +A E G R+RE+   DE+    
Sbjct  3    RPRRIVLVRHGESEGNVDDTVYEREPDHALGLTATGLRQAGETGERLRELF-GDES----  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERSRIAGVREEPRLREQDFGNFQDREQMKIEKAVRERY  615
            V  YVSPYRR  ETLR       + R   VREEPRLREQD+GN+Q+RE ++++KA R+ Y
Sbjct  58   VSVYVSPYRRTHETLRAFRLPPGQVR---VREEPRLREQDWGNWQEREDVRLQKAYRDAY  114

Query  616  GRFFYRFPNGESAADVYDRITGSSGANVVDLKLSFCA  726
            G FFYRF  GES ADVYDR+    GA +  L  SF A
Sbjct  115  GHFFYRFAQGESGADVYDRV----GAFLESLYRSFEA  147


 Score = 60.8 bits (146),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGLT+R+F MRW+ WTV  FE L N GN    V+  G  GRY 
Sbjct  145  FEAP-DHPPN--VLLVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRVLLLGEDGRYR  201

Query  978  L  980
            L
Sbjct  202  L  202



>ref|WP_026244045.1| phosphoglycerate mutase [Streptomyces sp. FxanaD5]
Length=219

 Score =   149 bits (375),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +1

Query  256  RPRRIILVRHGQSQGNVDESVYTRVADPKVGITEQGVAEAEECGRRIREMIEKDEAEDWK  435
            RPRRI+LVRHG+S GNVD++VY R  D  +G+TE+G  +AE  G R+R++  ++     +
Sbjct  3    RPRRIVLVRHGESTGNVDDTVYEREPDHALGLTERGRKQAEVTGERLRDLFGRE-----R  57

Query  436  VYFYVSPYRRGLETLRNLAKAFERS-RIAGVREEPRLREQDFGNFQDREQMKIEKAVRER  612
            V  YVSPYRR LETL     AF     +  VREEPRLREQD+GN+QDRE ++++KA R+ 
Sbjct  58   VSVYVSPYRRTLETL----NAFHLDPDLIRVREEPRLREQDWGNWQDREDVRLQKAYRDA  113

Query  613  YGRFFYRFPNGESAADVYDRITG  681
            YG FFYRF  GES ADVYDR+ G
Sbjct  114  YGHFFYRFAQGESGADVYDRVGG  136


 Score = 58.5 bits (140),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  798  FEPPGEQSPNMNLIMVSHGLTLRVFLMRWYKWTVEQFEGLHNIGNGSMVVMERGYGGRYS  977
            FE P +  PN  +++V+HGL +R+F MRW+ WTV +FE L N GN  + ++  G  G+Y+
Sbjct  145  FEAP-DHPPN--VLIVTHGLAMRLFCMRWFHWTVAEFESLSNPGNAEVRMLVLGENGKYT  201

Query  978  L  980
            L
Sbjct  202  L  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4988340514278