BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21976_g1_i2 len=1399 path=[1637:0-737 2951:738-818 2375:819-819
292:820-938 2493:939-939 342:940-1398]

Length=1399
                                                                      Score     E

ref|XP_009617352.1|  PREDICTED: serine/threonine-protein kinase p...  92.8    1e-16   
ref|XP_009617353.1|  PREDICTED: serine/threonine-protein kinase p...  92.8    1e-16   
ref|XP_009770599.1|  PREDICTED: serine/threonine-protein kinase p...  89.7    1e-15   
ref|XP_009770600.1|  PREDICTED: serine/threonine-protein kinase p...  89.7    1e-15   
ref|XP_006362577.1|  PREDICTED: serine/threonine-protein kinase P...  71.2    1e-09   
ref|XP_004239418.1|  PREDICTED: serine/threonine-protein kinase p...  68.2    1e-08   
ref|XP_011077099.1|  PREDICTED: serine/threonine-protein kinase p...  52.8    6e-04   



>ref|XP_009617352.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X1 
[Nicotiana tomentosiformis]
Length=1031

 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 141/247 (57%), Gaps = 35/247 (14%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEAQ   P         +EK D+NS +SG ++ +RK R+ D+        RE  SS+ +
Sbjct  117  LHEAQRQGPA--------VEKVDQNSTASGRHDEQRKSRKADN-------SRERKSSDKH  161

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDF-NQKNSLTTEDAGKRHKAG  380
             ANG+ + E+HK D + +       +E RKQKSY  DE+   +Q+ SLT E +GKRH++ 
Sbjct  162  FANGSCIDEFHKLDSKPQKKDSYAGEEVRKQKSYDDDESHLQDQRKSLTPESSGKRHRSV  221

Query  379  DGASPHDGYYKKGRSRKESKSPN-LSG----PSELddkyykdwkyknDSDNERMTR----  227
              +S HD + ++    K SKSP+   G     S L++ +      + D   E+ +R    
Sbjct  222  GVSSSHDEHLEERHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEKESRYRSN  281

Query  226  -------RSRDYRHGSRDISRE-KGERSPSHGRYVSREERHHSRETIERYREASLEINRD  71
                    ++DYRHGSR+ SR+ + E + S+ R+ SR +R++S E+++RYRE+S+E  RD
Sbjct  282  LDDEKIGHNKDYRHGSRESSRDIEKEHNSSYSRH-SR-DRYYSTESVDRYRESSIENERD  339

Query  70   RVRDKDK  50
            RVR+KD+
Sbjct  340  RVREKDR  346



>ref|XP_009617353.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X2 
[Nicotiana tomentosiformis]
Length=996

 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 141/247 (57%), Gaps = 35/247 (14%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEAQ   P         +EK D+NS +SG ++ +RK R+ D+        RE  SS+ +
Sbjct  117  LHEAQRQGPA--------VEKVDQNSTASGRHDEQRKSRKADN-------SRERKSSDKH  161

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDF-NQKNSLTTEDAGKRHKAG  380
             ANG+ + E+HK D + +       +E RKQKSY  DE+   +Q+ SLT E +GKRH++ 
Sbjct  162  FANGSCIDEFHKLDSKPQKKDSYAGEEVRKQKSYDDDESHLQDQRKSLTPESSGKRHRSV  221

Query  379  DGASPHDGYYKKGRSRKESKSPN-LSG----PSELddkyykdwkyknDSDNERMTR----  227
              +S HD + ++    K SKSP+   G     S L++ +      + D   E+ +R    
Sbjct  222  GVSSSHDEHLEERHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEKESRYRSN  281

Query  226  -------RSRDYRHGSRDISRE-KGERSPSHGRYVSREERHHSRETIERYREASLEINRD  71
                    ++DYRHGSR+ SR+ + E + S+ R+ SR +R++S E+++RYRE+S+E  RD
Sbjct  282  LDDEKIGHNKDYRHGSRESSRDIEKEHNSSYSRH-SR-DRYYSTESVDRYRESSIENERD  339

Query  70   RVRDKDK  50
            RVR+KD+
Sbjct  340  RVREKDR  346



>ref|XP_009770599.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X1 
[Nicotiana sylvestris]
Length=1044

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 134/250 (54%), Gaps = 41/250 (16%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEAQ   P         +EK DRNS +SG ++ +RK ++ D+        RE  SS+ +
Sbjct  116  LHEAQRQGPA--------VEKVDRNSTASGRHDEQRKSKKADN-------SRERKSSDKH  160

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDF-NQKNSLTTEDAGKRHKAG  380
              NG+ + E+HK D + +       +E RKQKSY  DE+   +++ SLT E +GKRH++ 
Sbjct  161  FVNGSCIDEFHKLDSKPQKEDIYAGEEGRKQKSYDDDESHLQDERKSLTPESSGKRHRSV  220

Query  379  DGASPHDGYYKKGRSRKESKSPN-LSG----PSELddkyykdwkyknDSDNERMTR----  227
              +S HD + +     K SKSP+   G     S L++ +      + D   E+ +R    
Sbjct  221  GVSSSHDEHLEDRHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEKESRYRSN  280

Query  226  -------RSRDYRHG----SRDISREKGERSPSHGRYVSREERHHSRETIERYREASLEI  80
                   R++DYRHG    SRD+ +E       H R     +R++SR++++RYRE+S+E 
Sbjct  281  FDDEKNGRNKDYRHGSRESSRDVEKEHNSSCNRHSR-----DRYYSRDSVDRYRESSIEN  335

Query  79   NRDRVRDKDK  50
             RDR+R+KD+
Sbjct  336  ERDRLREKDR  345



>ref|XP_009770600.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X2 
[Nicotiana sylvestris]
Length=1009

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 134/250 (54%), Gaps = 41/250 (16%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEAQ   P         +EK DRNS +SG ++ +RK ++ D+        RE  SS+ +
Sbjct  116  LHEAQRQGPA--------VEKVDRNSTASGRHDEQRKSKKADN-------SRERKSSDKH  160

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDF-NQKNSLTTEDAGKRHKAG  380
              NG+ + E+HK D + +       +E RKQKSY  DE+   +++ SLT E +GKRH++ 
Sbjct  161  FVNGSCIDEFHKLDSKPQKEDIYAGEEGRKQKSYDDDESHLQDERKSLTPESSGKRHRSV  220

Query  379  DGASPHDGYYKKGRSRKESKSPN-LSG----PSELddkyykdwkyknDSDNERMTR----  227
              +S HD + +     K SKSP+   G     S L++ +      + D   E+ +R    
Sbjct  221  GVSSSHDEHLEDRHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEKESRYRSN  280

Query  226  -------RSRDYRHG----SRDISREKGERSPSHGRYVSREERHHSRETIERYREASLEI  80
                   R++DYRHG    SRD+ +E       H R     +R++SR++++RYRE+S+E 
Sbjct  281  FDDEKNGRNKDYRHGSRESSRDVEKEHNSSCNRHSR-----DRYYSRDSVDRYRESSIEN  335

Query  79   NRDRVRDKDK  50
             RDR+R+KD+
Sbjct  336  ERDRLREKDR  345



>ref|XP_006362577.1| PREDICTED: serine/threonine-protein kinase PRP4 homolog [Solanum 
tuberosum]
Length=984

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 137/248 (55%), Gaps = 35/248 (14%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEA+   P        N+EK DR+S  SG ++ +++ R+ D         RE  S   +
Sbjct  133  LHEAKGQGP------ADNVEKVDRDSTVSGRHDEQKQSRKADS-------SRERKSRVKH  179

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDFNQK--NSLTTEDAGKRHKA  383
             ANG+ + E+HK + + +       +E  +QKSY  DE+    +   SLT E+ GKRH++
Sbjct  180  SANGSYIYEFHKLESKPQKEDSIAGEESTEQKSYHEDESALQDQIIKSLTPENVGKRHRS  239

Query  382  GDGASPHDGYYKKGRSRKESKSPN-----------------LSGPSELddkyykdwkykn  254
               +S H  + ++    K SKSP+                 +    E+DD Y K+ +Y++
Sbjct  240  VRVSSSHYEHPEERHVTKSSKSPDRSRGRSRSKSVLEESFLVPKSREIDDTYEKESRYRS  299

Query  253  DSDNERMTRRSRDYRHGSRDISREKGERSPSHGRYVSREERHHSRETIERYREASLEINR  74
            + D+E++   +RDYRHGSR+ SR++ +   S     SR +R+++RE+++R+RE S+E +R
Sbjct  300  NFDDEKIGY-NRDYRHGSRESSRDREKEHNSCNSRSSR-DRYYNRESVDRFRE-SMENDR  356

Query  73   DRVRDKDK  50
            DRVR+KD+
Sbjct  357  DRVREKDR  364



>ref|XP_004239418.1| PREDICTED: serine/threonine-protein kinase prpf4B [Solanum lycopersicum]
Length=1005

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 131/242 (54%), Gaps = 34/242 (14%)
 Frame = -1

Query  736  LHEAQVDAPNPSLPSESNLEKSDRNSISSGGYNAKRKDREHDDDKIHKHVGREIMSSEGY  557
            LHEAQ   P        N+EK DR+   SG ++ + K R+ D         RE  SS+ +
Sbjct  133  LHEAQEQGP------ADNVEKVDRDYTVSGRHDEQSKSRKADR-------SRERKSSDKH  179

Query  556  HANGNSVGEYHKGDHRQRDGKRSPDKEDRKQKSYRGDENDFNQK--NSLTTEDAGKRHKA  383
             ANG+ + ++HK D   +       +E  KQKSY  DEN+   +   S T E+ GKRH++
Sbjct  180  CANGSYIDKFHKLDSEPQKEDSITAEEITKQKSYDEDENEVQDRIIRSSTPENVGKRHRS  239

Query  382  GDGASPHDGYYKKGRSRKESKSPN-----------------LSGPSELddkyykdwkykn  254
               +S H  + ++    K SKSP+                 +    E+DD Y K+ +YK 
Sbjct  240  VRVSSSHYEHPEERHVTKSSKSPDRSRGRSRSKSVLEESFLVPKSREIDDTYEKESRYKG  299

Query  253  DSDNERMTRRSRDYRHGSRDISREKGERSPSHGRYVSREERHHSRETIERYREASLEINR  74
            + D+E++   +RDYRHGSRD SR++ E+  + G   S  +R+++RE+++R+RE+SLE +R
Sbjct  300  NFDDEKIVY-NRDYRHGSRDSSRDR-EKEHNSGNSRSSRDRYYNRESVDRFRESSLENDR  357

Query  73   DR  68
            DR
Sbjct  358  DR  359



>ref|XP_011077099.1| PREDICTED: serine/threonine-protein kinase prpf4B [Sesamum indicum]
Length=1016

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -1

Query  250  SDNERMTRRSRDYRHGSRDISREKGERSPSHGRYVSREERHHSRETIERYREASLEINRD  71
            SD+ER+  R++ YRH SRD  REK ER  S  RY  R ERH+SRET + YRE S E + D
Sbjct  291  SDDERVNARAKSYRHSSRDDVREK-ERERSSSRYAERVERHYSRETRDSYREGSRERHWD  349

Query  70   R  68
            R
Sbjct  350  R  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042