BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21971_g2_i2 len=1363 path=[2345:0-692 4115:693-697 4120:698-702
824:703-1362]

Length=1363
                                                                      Score     E

ref|XP_006357296.1|  PREDICTED: transcription factor RF2b-like          171   3e-45   
ref|XP_004240847.1|  PREDICTED: transcription factor RF2b               170   1e-44   
ref|XP_009622931.1|  PREDICTED: transcription factor RF2b               169   2e-44   
ref|XP_009783051.1|  PREDICTED: transcription factor RF2b-like          169   2e-44   
ref|XP_004240865.1|  PREDICTED: transcription factor RF2b-like is...    167   1e-43   
ref|XP_010322129.1|  PREDICTED: transcription factor RF2b-like is...    167   2e-43   
ref|XP_006435914.1|  hypothetical protein CICLE_v10032076mg             166   3e-43   
gb|KDO42950.1|  hypothetical protein CISIN_1g020026mg                   166   4e-43   
gb|KDO42951.1|  hypothetical protein CISIN_1g020026mg                   166   4e-43   
ref|XP_011076587.1|  PREDICTED: transcription factor RF2b-like          164   3e-42   
ref|XP_002280180.1|  PREDICTED: transcription factor RF2b isoform X1    159   1e-40   Vitis vinifera
ref|XP_009606784.1|  PREDICTED: transcription factor RF2b-like          158   3e-40   
emb|CAN70347.1|  hypothetical protein VITISV_012579                     159   4e-40   Vitis vinifera
ref|XP_009769625.1|  PREDICTED: transcription factor RF2b-like          155   4e-39   
ref|XP_006358750.1|  PREDICTED: transcription factor RF2b-like          153   1e-38   
ref|XP_004307733.1|  PREDICTED: transcription factor RF2b-like          152   5e-38   
ref|XP_008233880.1|  PREDICTED: transcription factor RF2b               152   6e-38   
emb|CDP13910.1|  unnamed protein product                                151   8e-38   
ref|XP_008359822.1|  PREDICTED: transcription factor RF2b-like          151   1e-37   
ref|XP_011084822.1|  PREDICTED: transcription factor RF2b-like          151   1e-37   
ref|XP_008369370.1|  PREDICTED: transcription factor RF2b               150   2e-37   
ref|XP_009349073.1|  PREDICTED: transcription factor RF2b-like          150   2e-37   
ref|XP_007218181.1|  hypothetical protein PRUPE_ppa007645mg             149   5e-37   
ref|XP_009363876.1|  PREDICTED: transcription factor RF2b-like          149   1e-36   
ref|XP_007011316.1|  Basic-leucine zipper transcription factor fa...    147   3e-36   
gb|KDP21652.1|  hypothetical protein JCGZ_03323                         147   5e-36   
ref|XP_010067612.1|  PREDICTED: transcription factor RF2b-like is...    143   6e-35   
ref|XP_007011315.1|  Basic-leucine zipper transcription factor fa...    140   1e-33   
ref|XP_007017082.1|  Basic-leucine zipper transcription factor fa...    139   5e-33   
ref|XP_010253091.1|  PREDICTED: transcription factor RF2b isoform X2    135   1e-31   
ref|XP_010253090.1|  PREDICTED: transcription factor RF2b isoform X1    135   1e-31   
emb|CBI15815.3|  unnamed protein product                                128   1e-30   
emb|CBI25364.3|  unnamed protein product                                127   2e-30   
gb|EYU20095.1|  hypothetical protein MIMGU_mgv1a008953mg                130   2e-30   
ref|XP_010067613.1|  PREDICTED: transcription factor RF2b-like is...    130   2e-30   
ref|XP_010108472.1|  Transcription factor RF2b                          131   3e-30   
ref|XP_010103645.1|  Transcription factor RF2b                          129   5e-30   
ref|XP_010252066.1|  PREDICTED: transcription factor RF2b-like          129   7e-30   
gb|KHN01885.1|  Transcription factor RF2b                               124   2e-29   
gb|KHG09638.1|  Transcription factor RF2b                               127   3e-29   
ref|XP_007011317.1|  Basic-leucine zipper transcription factor fa...    125   3e-29   
ref|XP_002520865.1|  Transcription factor RF2b, putative                127   3e-29   Ricinus communis
ref|XP_002266792.1|  PREDICTED: transcription factor RF2b-like          127   4e-29   Vitis vinifera
emb|CAN65087.1|  hypothetical protein VITISV_035032                     126   5e-29   Vitis vinifera
ref|XP_002319876.1|  bZIP transcription factor family protein           125   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002319969.2|  hypothetical protein POPTR_0013s15280g             125   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008782655.1|  PREDICTED: transcription factor RF2b-like is...    125   1e-28   
gb|KDP45689.1|  hypothetical protein JCGZ_17296                         125   2e-28   
ref|XP_010921141.1|  PREDICTED: transcription factor RF2b-like          124   7e-28   
ref|XP_003544931.1|  PREDICTED: transcription factor RF2b               123   7e-28   
gb|EYU35211.1|  hypothetical protein MIMGU_mgv1a009267mg                122   2e-27   
gb|KHG07492.1|  Transcription factor RF2b                               121   2e-27   
ref|XP_008465307.1|  PREDICTED: transcription factor RF2b-like          122   3e-27   
ref|XP_011041787.1|  PREDICTED: transcription factor RF2b-like          121   3e-27   
ref|XP_002325642.2|  hypothetical protein POPTR_0019s15040g             121   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011006306.1|  PREDICTED: transcription factor RF2b-like is...    120   5e-27   
gb|KHN18663.1|  Transcription factor RF2b                               117   5e-27   
ref|XP_008241588.1|  PREDICTED: transcription factor RF2b               121   7e-27   
ref|XP_007142045.1|  hypothetical protein PHAVU_008G247800g             119   1e-26   
gb|KHN40989.1|  Transcription factor RF2b                               116   1e-26   
ref|XP_002518293.1|  Transcription factor RF2b, putative                119   2e-26   Ricinus communis
ref|XP_007205237.1|  hypothetical protein PRUPE_ppa006097mg             118   6e-26   
ref|XP_004140027.1|  PREDICTED: transcription factor RF2b-like          117   7e-26   
ref|XP_007137632.1|  hypothetical protein PHAVU_009G142900g             115   7e-26   
ref|XP_008358922.1|  PREDICTED: transcription factor RF2b-like          117   1e-25   
ref|XP_010031087.1|  PREDICTED: transcription factor RF2b               116   1e-25   
ref|XP_004500364.1|  PREDICTED: transcription factor RF2b-like          117   1e-25   
ref|XP_008384666.1|  PREDICTED: transcription factor RF2b-like          117   1e-25   
ref|XP_003552912.1|  PREDICTED: transcription factor RF2b-like          116   2e-25   
ref|XP_004502831.1|  PREDICTED: transcription factor RF2b-like is...    115   2e-25   
ref|XP_011021042.1|  PREDICTED: transcription factor RF2b-like is...    116   2e-25   
ref|XP_003537351.1|  PREDICTED: transcription factor RF2b-like          115   3e-25   
ref|XP_011021041.1|  PREDICTED: transcription factor RF2b-like is...    115   3e-25   
gb|KEH35548.1|  bZIP transcription factor                               114   4e-25   
ref|XP_003635981.1|  Transcription factor RF2b                          110   4e-25   
ref|XP_004166348.1|  PREDICTED: transcription factor RF2b-like          115   5e-25   
ref|XP_009374449.1|  PREDICTED: transcription factor RF2b-like          114   1e-24   
ref|XP_004296017.1|  PREDICTED: transcription factor RF2b-like          114   1e-24   
ref|XP_009354848.1|  PREDICTED: transcription factor RF2b-like          114   1e-24   
gb|KEH34480.1|  bZIP transcription factor                               113   2e-24   
ref|XP_008344762.1|  PREDICTED: transcription factor RF2b-like          114   2e-24   
ref|XP_006651350.1|  PREDICTED: transcription factor RF2b-like          109   7e-24   
ref|XP_007146883.1|  hypothetical protein PHAVU_006G078500g             111   1e-23   
ref|XP_010685977.1|  PREDICTED: transcription factor RF2b-like          110   3e-23   
ref|XP_010938010.1|  PREDICTED: transcription factor RF2b-like is...    108   9e-23   
ref|XP_004158959.1|  PREDICTED: transcription factor RF2b-like          103   1e-22   
gb|ADN33710.1|  b-zip DNA binding protein                               107   2e-22   
ref|XP_008456950.1|  PREDICTED: transcription factor RF2b               107   2e-22   
ref|XP_004146436.1|  PREDICTED: transcription factor RF2b-like          107   2e-22   
ref|XP_003616032.1|  Transcription factor RF2b                          105   7e-22   
gb|EAZ26838.1|  hypothetical protein OsJ_10754                          103   8e-22   Oryza sativa Japonica Group [Japonica rice]
sp|Q6S4P4.1|RF2B_ORYSJ  RecName: Full=Transcription factor RF2b         103   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050039.1|  Os03g0336200                                       103   3e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EMS51355.1|  hypothetical protein TRIUR3_04237                       101   3e-21   
gb|EMT28167.1|  Transcription factor RF2b                               100   4e-21   
ref|XP_010658179.1|  PREDICTED: transcription factor RF2b isoform X2    102   5e-21   
ref|XP_002463392.1|  hypothetical protein SORBIDRAFT_02g042990          103   5e-21   Sorghum bicolor [broomcorn]
ref|XP_006658967.1|  PREDICTED: transcription factor RF2b-like          102   6e-21   
ref|XP_004958698.1|  PREDICTED: transcription factor RF2b-like          103   7e-21   
gb|EMT03280.1|  Transcription factor RF2b                               102   8e-21   
dbj|BAC84100.1|  putative transcription activator RF2a                  101   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41100.1|  hypothetical protein OsJ_25592                          100   2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|AAV85851.1|  AT-rich element binding factor 1                        101   2e-20   Pisum sativum [garden pea]
ref|NP_001060641.1|  Os07g0679500                                       100   3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05151.1|  hypothetical protein OsI_27345                          100   3e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAK06096.1|  predicted protein                                      100   4e-20   
tpg|DAA64130.1|  TPA: putative bZIP transcription factor superfam...  96.3    4e-20   
ref|XP_010539313.1|  PREDICTED: transcription factor RF2b-like          100   5e-20   
dbj|BAK00487.1|  predicted protein                                      100   6e-20   
ref|XP_004984459.1|  PREDICTED: transcription factor RF2b-like        99.8    8e-20   
ref|XP_003557964.1|  PREDICTED: transcription factor RF2b             98.2    3e-19   
ref|NP_001266619.1|  transcription factor RF2b                        97.8    4e-19   
ref|XP_003523277.1|  PREDICTED: transcription factor RF2b             96.7    5e-19   
ref|NP_001141404.1|  putative bZIP transcription factor superfami...  97.4    6e-19   Zea mays [maize]
ref|XP_003562448.1|  PREDICTED: transcription factor RF2b-like        95.9    2e-18   
ref|XP_010505811.1|  PREDICTED: transcription factor RF2b-like        95.9    2e-18   
ref|XP_010554718.1|  PREDICTED: transcription factor RF2b-like is...  96.3    2e-18   
ref|NP_001183764.1|  uncharacterized protein LOC100502357             95.1    3e-18   
ref|XP_010554715.1|  PREDICTED: transcription factor RF2b-like is...  96.7    3e-18   
ref|XP_010554713.1|  PREDICTED: transcription factor RF2b-like is...  96.7    4e-18   
ref|XP_009406876.1|  PREDICTED: transcription factor RF2b-like is...  95.1    5e-18   
ref|XP_009386932.1|  PREDICTED: transcription factor RF2b-like        95.1    5e-18   
ref|XP_010554714.1|  PREDICTED: transcription factor RF2b-like is...  96.3    5e-18   
ref|XP_008808308.1|  PREDICTED: transcription factor RF2b-like        94.4    5e-18   
ref|XP_009406875.1|  PREDICTED: transcription factor RF2b-like is...  94.7    6e-18   
gb|EAY89914.1|  hypothetical protein OsI_11463                        93.6    6e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006417873.1|  hypothetical protein EUTSA_v10008146mg           93.2    1e-17   
ref|XP_010508829.1|  PREDICTED: transcription factor RF2b-like        93.6    1e-17   
ref|XP_010517502.1|  PREDICTED: transcription factor RF2b-like        94.0    2e-17   
ref|XP_010931507.1|  PREDICTED: transcription factor RF2b-like        93.2    2e-17   
ref|XP_008792225.1|  PREDICTED: transcription factor RF2b             90.1    4e-17   
ref|NP_001152693.1|  LOC100286334                                     91.3    7e-17   Zea mays [maize]
ref|XP_009387765.1|  PREDICTED: transcription factor RF2b             91.3    1e-16   
gb|ACN26156.1|  unknown                                               90.1    2e-16   Zea mays [maize]
ref|NP_001130089.1|  putative bZIP transcription factor superfami...  88.6    6e-16   Zea mays [maize]
gb|ABI34685.1|  bZIP transcription factor bZIP43                      86.7    7e-16   Glycine max [soybeans]
ref|XP_002467902.1|  hypothetical protein SORBIDRAFT_01g036120        84.3    8e-16   Sorghum bicolor [broomcorn]
ref|XP_006305297.1|  hypothetical protein CARUB_v10009673mg           87.8    1e-15   
ref|XP_011006307.1|  PREDICTED: transcription factor RF2b-like is...  86.7    1e-15   
gb|KFK36932.1|  hypothetical protein AALP_AA4G191400                  86.7    3e-15   
ref|XP_010457837.1|  PREDICTED: transcription factor RF2b-like        85.9    4e-15   
ref|XP_009142704.1|  PREDICTED: transcription factor RF2b-like        85.9    5e-15   
ref|XP_002881732.1|  bZIP transcription factor family protein         85.9    6e-15   
emb|CDX79976.1|  BnaA05g01800D                                        85.5    6e-15   
ref|XP_010486780.1|  PREDICTED: transcription factor RF2b-like        85.1    7e-15   
ref|XP_002889621.1|  predicted protein                                84.7    8e-15   
ref|NP_172170.1|  basic leucine-zipper 52                             85.1    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842469.1|  hypothetical protein AMTR_s00077p00070990        85.1    1e-14   
ref|XP_010525409.1|  PREDICTED: transcription factor RF2b-like        85.1    1e-14   
gb|AAF63137.1|AC011001_7  Similar to bZIP transcription factors       84.7    2e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAB06697.1|  b-Zip DNA binding protein                            83.2    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181594.1|  bZIP transcription factor                           82.8    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475437.1|  PREDICTED: transcription factor RF2b-like        81.6    1e-13   
gb|KFK42999.1|  hypothetical protein AALP_AA1G066300                  80.9    2e-13   
emb|CDY09952.1|  BnaC08g44990D                                        79.7    5e-13   
ref|XP_006411330.1|  hypothetical protein EUTSA_v10016819mg           79.3    1e-12   
ref|XP_009118474.1|  PREDICTED: transcription factor RF2b             78.2    1e-12   
ref|XP_006296036.1|  hypothetical protein CARUB_v10025182mg           78.6    2e-12   
gb|AHZ96958.1|  bZIP transcription factor 14                          72.8    2e-12   
emb|CDY23889.1|  BnaC04g01480D                                        77.8    3e-12   
emb|CDX86512.1|  BnaC08g01910D                                        77.0    4e-12   
emb|CDY06231.1|  BnaA09g49720D                                        77.0    4e-12   
ref|XP_009110972.1|  PREDICTED: transcription factor RF2b-like        75.9    8e-12   
emb|CDY15590.1|  BnaA08g28740D                                        75.9    9e-12   
ref|XP_006581713.1|  PREDICTED: transcription factor RF2b-like is...  70.9    3e-11   
ref|XP_006581714.1|  PREDICTED: transcription factor RF2b-like is...  70.9    3e-11   
emb|CDY06974.1|  BnaA04g23410D                                        73.2    8e-11   
gb|AFW88453.1|  putative bZIP transcription factor superfamily pr...  69.3    1e-10   
ref|XP_009141921.1|  PREDICTED: transcription factor RF2b-like        71.2    4e-10   
emb|CDX93167.1|  BnaC04g47290D                                        68.6    3e-09   
emb|CDY35020.1|  BnaC06g13660D                                        63.5    2e-08   
ref|XP_009384770.1|  PREDICTED: transcription factor RF2b-like        63.5    1e-07   
ref|XP_006371286.1|  hypothetical protein POPTR_0019s08590g           60.8    2e-07   
gb|EPS70738.1|  hypothetical protein M569_04023                       60.5    4e-07   
ref|XP_006423515.1|  hypothetical protein CICLE_v10028062mg           62.4    5e-07   
ref|XP_006471421.1|  PREDICTED: dentin sialophosphoprotein-like       62.0    5e-07   
gb|KDO42321.1|  hypothetical protein CISIN_1g007579mg                 62.0    5e-07   
ref|XP_001764874.1|  predicted protein                                61.2    6e-07   
ref|XP_010260915.1|  PREDICTED: transcription factor VIP1 isoform X1  61.2    6e-07   
ref|XP_010938012.1|  PREDICTED: transcription factor RF2b-like is...  61.2    7e-07   
emb|CDY24896.1|  BnaC03g22760D                                        60.5    1e-06   
gb|KDP27629.1|  hypothetical protein JCGZ_19634                       61.2    1e-06   
ref|XP_010938011.1|  PREDICTED: transcription factor RF2b-like is...  60.5    1e-06   
ref|XP_010911966.1|  PREDICTED: transcription factor VIP1-like        60.1    1e-06   
ref|XP_010670608.1|  PREDICTED: transcription factor RF2b-like        60.5    1e-06   
ref|XP_009402213.1|  PREDICTED: transcription factor RF2b-like        59.7    2e-06   
ref|XP_001755981.1|  predicted protein                                58.5    3e-06   
ref|XP_011042922.1|  PREDICTED: transcription factor VIP1-like        58.9    3e-06   
ref|XP_001785739.1|  predicted protein                                58.9    4e-06   
ref|XP_001755887.1|  predicted protein                                58.9    4e-06   
emb|CDY10231.1|  BnaC05g04740D                                        56.2    5e-06   
gb|AFO63283.1|  bZIP4                                                 58.5    5e-06   
ref|XP_010260917.1|  PREDICTED: transcription factor VIP1-like        58.2    7e-06   
ref|XP_008785820.1|  PREDICTED: transcription factor VIP1-like        57.8    8e-06   
ref|XP_010665860.1|  PREDICTED: uncharacterized protein LOC104883107  58.2    1e-05   
ref|XP_010680531.1|  PREDICTED: transcription factor VIP1             57.4    1e-05   
ref|XP_002962855.1|  hypothetical protein SELMODRAFT_77868            57.4    1e-05   
ref|XP_006854522.1|  hypothetical protein AMTR_s00030p00014690        57.0    1e-05   
ref|XP_002989437.1|  hypothetical protein SELMODRAFT_129846           57.0    1e-05   
ref|NP_001131398.1|  uncharacterized protein LOC100192726             54.3    1e-05   Zea mays [maize]
ref|XP_008803311.1|  PREDICTED: transcription factor RF2a-like        57.4    2e-05   
ref|XP_002300925.2|  hypothetical protein POPTR_0002s07020g           56.6    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002533020.1|  hypothetical protein RCOM_1170820                53.9    2e-05   Ricinus communis
ref|XP_008782656.1|  PREDICTED: transcription factor RF2b-like is...  56.6    2e-05   
ref|XP_009404907.1|  PREDICTED: transcription factor VIP1-like        56.2    2e-05   
ref|XP_011047123.1|  PREDICTED: transcription factor RF2a             56.6    3e-05   
ref|NP_001030982.1|  basic leucine-zipper 52                          55.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43006.1|  hypothetical protein JCGZ_25192                       55.8    3e-05   
gb|ABR16513.1|  unknown                                               56.2    3e-05   Picea sitchensis
gb|EMS56823.1|  Transcription factor RF2b                             53.9    3e-05   
ref|XP_003562153.2|  PREDICTED: transcription factor RF2b-like        55.8    4e-05   
ref|XP_010271435.1|  PREDICTED: probable transcription factor Pos...  56.2    4e-05   
emb|CBI37976.3|  unnamed protein product                              55.8    4e-05   
dbj|BAI66488.1|  basic leucine zipper transcription factor            55.5    4e-05   Hordeum vulgare [barley]
ref|XP_002313753.2|  hypothetical protein POPTR_0009s12830g           56.2    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004139652.1|  PREDICTED: transcription factor VIP1-like        55.5    5e-05   
ref|XP_008461512.1|  PREDICTED: transcription factor VIP1             55.5    5e-05   
ref|XP_004154456.1|  PREDICTED: transcription factor VIP1-like        55.5    5e-05   
ref|XP_011044198.1|  PREDICTED: transcription factor VIP1-like        55.5    5e-05   
gb|KCW69195.1|  hypothetical protein EUGRSUZ_F02715                   55.5    5e-05   
gb|EEE69091.1|  hypothetical protein OsJ_28152                        54.7    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006472967.1|  PREDICTED: transcription factor VIP1-like        55.1    6e-05   
ref|XP_010062128.1|  PREDICTED: transcription factor VIP1             55.5    6e-05   
ref|XP_006434439.1|  hypothetical protein CICLE_v10001715mg           55.1    6e-05   
ref|XP_002307491.2|  hypothetical protein POPTR_0005s21300g           55.1    6e-05   Populus trichocarpa [western balsam poplar]
gb|KDO83691.1|  hypothetical protein CISIN_1g019163mg                 55.1    6e-05   
ref|XP_009420592.1|  PREDICTED: transcription factor VIP1-like        55.1    6e-05   
emb|CBI18550.3|  unnamed protein product                              53.5    6e-05   
ref|XP_008781393.1|  PREDICTED: transcription factor VIP1             55.1    6e-05   
ref|XP_011037233.1|  PREDICTED: transcription factor RF2a-like        55.5    7e-05   
dbj|BAK05721.1|  predicted protein                                    55.5    7e-05   
ref|XP_009393798.1|  PREDICTED: transcription factor VIP1-like        55.1    7e-05   
gb|ADF83495.1|  bZiP-like trancription factor                         55.5    7e-05   
dbj|BAI66489.1|  basic leucine zipper proein                          55.5    7e-05   Hordeum vulgare [barley]
ref|XP_006660351.1|  PREDICTED: transcription factor RF2a-like        54.7    7e-05   
ref|XP_010647563.1|  PREDICTED: serine/threonine-protein kinase p...  55.5    7e-05   
ref|XP_010647562.1|  PREDICTED: serine/threonine-protein kinase p...  55.5    7e-05   
ref|XP_010647556.1|  PREDICTED: serine/threonine-protein kinase p...  55.5    7e-05   
gb|EAZ07859.1|  hypothetical protein OsI_30120                        54.3    9e-05   Oryza sativa Indica Group [Indian rice]
gb|EYU36846.1|  hypothetical protein MIMGU_mgv1a011393mg              54.3    9e-05   
ref|XP_006359608.1|  PREDICTED: transcription factor RF2a-like        55.1    9e-05   
ref|XP_004230901.1|  PREDICTED: probable transcription factor PosF21  55.1    9e-05   
ref|XP_002445762.1|  hypothetical protein SORBIDRAFT_07g025270        55.1    1e-04   Sorghum bicolor [broomcorn]
ref|XP_010933933.1|  PREDICTED: transcription factor RF2a-like        55.1    1e-04   
ref|XP_010919167.1|  PREDICTED: transcription factor RF2a-like is...  54.7    1e-04   
ref|XP_007131742.1|  hypothetical protein PHAVU_011G038200g           54.7    1e-04   
ref|XP_010500116.1|  PREDICTED: transcription factor VIP1-like        54.3    1e-04   
ref|XP_009627336.1|  PREDICTED: probable transcription factor PosF21  54.7    1e-04   
ref|XP_008784139.1|  PREDICTED: transcription factor VIP1-like        54.3    1e-04   
ref|XP_010479019.1|  PREDICTED: transcription factor VIP1-like is...  53.9    1e-04   
ref|NP_001062403.2|  Os08g0543900                                     54.3    1e-04   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA48354.1|  TPA: putative bZIP transcription factor superfam...  54.3    1e-04   
ref|NP_001147562.1|  LOC100281171                                     54.3    1e-04   Zea mays [maize]
ref|NP_001170295.1|  uncharacterized protein LOC100384258             54.3    1e-04   Zea mays [maize]
gb|AFW65008.1|  putative bZIP transcription factor superfamily pr...  54.3    1e-04   
ref|XP_009804619.1|  PREDICTED: probable transcription factor PosF21  54.3    2e-04   
ref|XP_002305468.2|  hypothetical protein POPTR_0004s17080g           54.3    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010530242.1|  PREDICTED: transcription factor VIP1             53.5    2e-04   
ref|XP_010519397.1|  PREDICTED: transcription factor VIP1-like        53.5    2e-04   
ref|XP_009391940.1|  PREDICTED: probable transcription factor PosF21  53.9    2e-04   
ref|XP_010461414.1|  PREDICTED: transcription factor VIP1-like        53.5    2e-04   
ref|XP_009393224.1|  PREDICTED: transcription factor RF2a-like        53.9    2e-04   
ref|XP_007042006.1|  Basic-leucine zipper transcription factor fa...  53.9    2e-04   
ref|XP_003574872.1|  PREDICTED: transcription factor VIP1-like        53.9    2e-04   
ref|XP_010665015.1|  PREDICTED: transcription factor VIP1 isoform X2  53.5    2e-04   
ref|XP_010095678.1|  putative transcription factor PosF21             53.9    2e-04   
ref|XP_010531490.1|  PREDICTED: probable transcription factor PosF21  53.9    2e-04   
ref|XP_008780305.1|  PREDICTED: transcription factor RF2a-like        53.9    2e-04   
ref|XP_010931001.1|  PREDICTED: transcription factor VIP1-like        53.1    3e-04   
ref|XP_010940929.1|  PREDICTED: transcription factor VIP1-like        53.5    3e-04   
tpg|DAA43095.1|  TPA: putative bZIP transcription factor superfam...  53.1    3e-04   
ref|XP_002974466.1|  hypothetical protein SELMODRAFT_34663            52.8    3e-04   
ref|NP_001151391.1|  transcription factor RF2b                        51.6    3e-04   Zea mays [maize]
ref|XP_010912402.1|  PREDICTED: transcription factor VIP1-like        52.8    3e-04   
ref|XP_008776338.1|  PREDICTED: probable transcription factor PosF21  52.8    4e-04   
ref|XP_006649313.1|  PREDICTED: transcription factor RF2a-like        51.2    4e-04   
ref|XP_009133444.1|  PREDICTED: transcription factor RF2b-like        52.4    4e-04   
gb|KHG15398.1|  Transcription factor RF2a                             52.8    4e-04   
emb|CDY07597.1|  BnaA03g19140D                                        52.4    4e-04   
ref|NP_001048832.1|  Os03g0127500                                     52.8    5e-04   
gb|EAY88362.1|  hypothetical protein OsI_09817                        52.8    5e-04   
ref|XP_011088545.1|  PREDICTED: uncharacterized protein LOC105169746  52.8    5e-04   
gb|EAZ25438.1|  hypothetical protein OsJ_09254                        52.4    5e-04   
ref|NP_001151643.1|  DNA binding protein precursor                    52.4    5e-04   
ref|XP_007019465.1|  VIRE2-interacting protein 1, putative            52.4    5e-04   
gb|AFO63287.1|  bZIP8                                                 52.8    5e-04   
ref|XP_010923730.1|  PREDICTED: probable transcription factor PosF21  52.8    5e-04   
ref|XP_004170444.1|  PREDICTED: transcription factor VIP1-like        50.1    5e-04   
ref|XP_006305300.1|  hypothetical protein CARUB_v10009675mg           52.0    6e-04   
ref|XP_004985885.1|  PREDICTED: probable transcription factor Pos...  52.4    6e-04   
ref|XP_004170187.1|  PREDICTED: uncharacterized protein LOC101227308  52.4    6e-04   
ref|XP_003578876.1|  PREDICTED: transcription factor VIP1-like        52.0    6e-04   
ref|XP_008668106.1|  PREDICTED: transcription factor RF2b isoform X1  52.0    6e-04   
ref|XP_004148549.1|  PREDICTED: uncharacterized protein LOC101216189  52.4    6e-04   
ref|XP_008448027.1|  PREDICTED: dentin sialophosphoprotein            52.4    6e-04   
ref|XP_004148547.1|  PREDICTED: uncharacterized protein LOC101215703  52.4    7e-04   
emb|CDX72732.1|  BnaC07g47540D                                        52.0    7e-04   
ref|XP_008448029.1|  PREDICTED: probable transcription factor PosF21  52.4    7e-04   
ref|XP_010028661.1|  PREDICTED: uncharacterized protein LOC104418889  52.4    7e-04   
ref|NP_001237238.1|  bZIP transcription factor bZIP28                 52.0    7e-04   
gb|EYU37915.1|  hypothetical protein MIMGU_mgv1a005205mg              52.0    8e-04   
ref|XP_002468594.1|  hypothetical protein SORBIDRAFT_01g048710        52.0    8e-04   
ref|XP_009145063.1|  PREDICTED: transcription factor VIP1-like        51.6    8e-04   
emb|CDO96979.1|  unnamed protein product                              52.0    8e-04   
emb|CDY30752.1|  BnaC05g51490D                                        51.6    8e-04   
ref|XP_010263926.1|  PREDICTED: probable serine/threonine-protein...  52.0    8e-04   
ref|XP_004494977.1|  PREDICTED: probable transcription factor Pos...  52.0    9e-04   
ref|XP_010530317.1|  PREDICTED: uncharacterized protein LOC104806...  52.0    0.001   



>ref|XP_006357296.1| PREDICTED: transcription factor RF2b-like [Solanum tuberosum]
Length=349

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAM QQAQLRDALNEALK EVERL++ATGE+++ SDAY+LGMQHIPYNQSAFFSHQP SG
Sbjct  216  QAMAQQAQLRDALNEALKQEVERLKMATGEMSS-SDAYNLGMQHIPYNQSAFFSHQPQSG  274

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+SQNIQ+ QFH+LQ S   PH  +LA       DT+QQDPLGRFQGLDI  RG H+VK
Sbjct  275  PSESQNIQMQQFHSLQDSLLNPHRRLLAGHGQVLQDTMQQDPLGRFQGLDIGGRGMHLVK  334



>ref|XP_004240847.1| PREDICTED: transcription factor RF2b [Solanum lycopersicum]
Length=349

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAM QQAQLRDALNEALK EVERL++ATGE+++ SDAY+LGMQHIPYNQSAFFSHQP SG
Sbjct  216  QAMAQQAQLRDALNEALKQEVERLKMATGEMSS-SDAYNLGMQHIPYNQSAFFSHQPQSG  274

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
             S+SQNIQ+ QFH+LQ S  TPH  +LA       DT+QQDPLGRFQGLDI  RG H+VK
Sbjct  275  ASESQNIQMQQFHSLQDSLLTPHRRLLAGHGQGLPDTMQQDPLGRFQGLDIGGRGLHLVK  334



>ref|XP_009622931.1| PREDICTED: transcription factor RF2b [Nicotiana tomentosiformis]
Length=343

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 98/120 (82%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAM QQAQLRDALNEALK EVERL++ATGE+++ SDAY+LGMQHIPYNQSAFFSHQ  SG
Sbjct  210  QAMAQQAQLRDALNEALKQEVERLKMATGEMSS-SDAYNLGMQHIPYNQSAFFSHQTQSG  268

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+SQNIQ+ QFH+LQ S  TPH  +LA       DT+QQDPLGRFQGLDI  RG H VK
Sbjct  269  PSESQNIQMQQFHSLQDSLLTPHRRLLAGHGQALPDTMQQDPLGRFQGLDIGGRGMHHVK  328



>ref|XP_009783051.1| PREDICTED: transcription factor RF2b-like [Nicotiana sylvestris]
Length=343

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 98/120 (82%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAM QQAQLRDALNEALK EVERL++ATGE+++ SDAY+LGMQHIPYNQSAFFSHQ  SG
Sbjct  210  QAMAQQAQLRDALNEALKQEVERLKMATGEMSS-SDAYNLGMQHIPYNQSAFFSHQTQSG  268

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+SQNIQ+ QFH+LQ S  TPH  +LA       DT+QQDPLGRFQGLDI  RG H VK
Sbjct  269  PSESQNIQMQQFHSLQDSLLTPHRRLLAGHGQALPDTMQQDPLGRFQGLDIGGRGMHHVK  328



>ref|XP_004240865.1| PREDICTED: transcription factor RF2b-like isoform X2 [Solanum 
lycopersicum]
Length=340

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATG+I+A SDAYS GMQ I YN+ AFF HQ   G
Sbjct  206  QAMEQQAQLRDALNEALKQEVERLKIATGQISASSDAYSSGMQQIQYNRPAFFPHQTQPG  265

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+S NIQ+ QFH LQ S S P HP+       LAD +QQDP+GRFQGLDISSRGSH+VK
Sbjct  266  PSESHNIQMSQFHHLQDSMSNPRHPLLSGNVQALADAMQQDPVGRFQGLDISSRGSHLVK  325



>ref|XP_010322129.1| PREDICTED: transcription factor RF2b-like isoform X1 [Solanum 
lycopersicum]
Length=367

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATG+I+A SDAYS GMQ I YN+ AFF HQ   G
Sbjct  233  QAMEQQAQLRDALNEALKQEVERLKIATGQISASSDAYSSGMQQIQYNRPAFFPHQTQPG  292

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+S NIQ+ QFH LQ S S P HP+       LAD +QQDP+GRFQGLDISSRGSH+VK
Sbjct  293  PSESHNIQMSQFHHLQDSMSNPRHPLLSGNVQALADAMQQDPVGRFQGLDISSRGSHLVK  352



>ref|XP_006435914.1| hypothetical protein CICLE_v10032076mg [Citrus clementina]
 ref|XP_006435915.1| hypothetical protein CICLE_v10032076mg [Citrus clementina]
 ref|XP_006486172.1| PREDICTED: transcription factor RF2b-like isoform X1 [Citrus 
sinensis]
 gb|ESR49154.1| hypothetical protein CICLE_v10032076mg [Citrus clementina]
 gb|ESR49155.1| hypothetical protein CICLE_v10032076mg [Citrus clementina]
Length=331

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+  P+D Y+LGMQ IPYNQS F+ H P +G
Sbjct  196  QAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTG  255

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
            P D+Q IQ+P+FH  QP+ STPH PMLA        + +QQDPLGR QGLDI+ R SH+V
Sbjct  256  PGDTQIIQLPEFHPFQPNMSTPHQPMLATANSHTFSEMLQQDPLGRLQGLDINGRNSHLV  315

Query  337  K  339
            K
Sbjct  316  K  316



>gb|KDO42950.1| hypothetical protein CISIN_1g020026mg [Citrus sinensis]
Length=332

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 94/121 (78%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+  P+D Y+LGMQ IPYNQS F+ H P +G
Sbjct  197  QAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTG  256

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
            P D+Q +Q+P+FH  QP+ STPH PMLA        + +QQDPLGR QGLDI+ R SH+V
Sbjct  257  PGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLV  316

Query  337  K  339
            K
Sbjct  317  K  317



>gb|KDO42951.1| hypothetical protein CISIN_1g020026mg [Citrus sinensis]
Length=331

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 94/121 (78%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+  P+D Y+LGMQ IPYNQS F+ H P +G
Sbjct  196  QAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTG  255

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
            P D+Q +Q+P+FH  QP+ STPH PMLA        + +QQDPLGR QGLDI+ R SH+V
Sbjct  256  PGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLV  315

Query  337  K  339
            K
Sbjct  316  K  316



>ref|XP_011076587.1| PREDICTED: transcription factor RF2b-like [Sesamum indicum]
Length=356

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERLRIATGEI+A +D ++L MQH+PYNQSAFFS QP  G
Sbjct  221  QAMEQQAQLRDALNEALKQEVERLRIATGEISATTDTFNLAMQHVPYNQSAFFSPQPQPG  280

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
            P+DSQN+Q+ QFH L    S+  HPM        L+D++ QDPLGRFQGL ISSR SH+V
Sbjct  281  PNDSQNVQMQQFHTLPAGMSSHQHPMLSATPLQGLSDSLHQDPLGRFQGLGISSRSSHLV  340

Query  337  K  339
            K
Sbjct  341  K  341



>ref|XP_002280180.1| PREDICTED: transcription factor RF2b isoform X1 [Vitis vinifera]
Length=359

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 92/121 (76%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI   SDAY+LGM H+PY QS+FFSHQ   G
Sbjct  224  QAMEQQAQLRDALNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPG  283

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
            PS+SQNIQ+PQFH    +  T H P+        L+D +QQDPLGR QGLDISSRG  +V
Sbjct  284  PSESQNIQMPQFHPFPSNMLTHHQPLLGAAHSNALSDMLQQDPLGRLQGLDISSRGPSLV  343

Query  337  K  339
            K
Sbjct  344  K  344



>ref|XP_009606784.1| PREDICTED: transcription factor RF2b-like [Nicotiana tomentosiformis]
Length=356

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 93/120 (78%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATG+I+A SDAY+ GMQ I YN+ AFF HQP  G
Sbjct  222  QAMEQQAQLRDALNEALKQEVERLKIATGQISASSDAYNSGMQQISYNRPAFFPHQPQPG  281

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+  NIQ+PQFH LQ S S+  HP+LA       D +QQDPL RFQGL I+SR SH+VK
Sbjct  282  PSEPPNIQMPQFHTLQESMSSSRHPLLAGHAQALTDAMQQDPLDRFQGLGINSRSSHLVK  341



>emb|CAN70347.1| hypothetical protein VITISV_012579 [Vitis vinifera]
Length=412

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 92/121 (76%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI   SDAY+LGM H+PY QS+FFSHQ   G
Sbjct  277  QAMEQQAQLRDALNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPG  336

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
            PS+SQNIQ+PQFH    +  T H P+        L+D +QQDPLGR QGLDISSRG  +V
Sbjct  337  PSESQNIQMPQFHPFPSNMLTHHQPLLGVAHSNALSDMLQQDPLGRLQGLDISSRGPSLV  396

Query  337  K  339
            K
Sbjct  397  K  397



>ref|XP_009769625.1| PREDICTED: transcription factor RF2b-like [Nicotiana sylvestris]
Length=362

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 91/120 (76%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDA NEALK EVERL+IATG+I+A SDAY+ GMQ I YN+ AFF HQP  G
Sbjct  228  QAMEQQAQLRDARNEALKQEVERLKIATGQISASSDAYNSGMQQISYNRPAFFPHQPQPG  287

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
            PS+  N  +PQFH LQ S S P H +LA       D +QQDPL RFQGLDI+SRGSH+VK
Sbjct  288  PSEPPNTLMPQFHTLQGSMSNPRHTLLAGHAQALTDAMQQDPLRRFQGLDINSRGSHLVK  347



>ref|XP_006358750.1| PREDICTED: transcription factor RF2b-like [Solanum tuberosum]
Length=324

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 90/120 (75%), Gaps = 16/120 (13%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATG+I+A SDAY+ GMQ I YN+ AFF H     
Sbjct  199  QAMEQQAQLRDALNEALKQEVERLKIATGQISASSDAYNPGMQQIQYNRPAFFPH-----  253

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                QNIQ+PQFH LQ S S P HP+       LAD +QQDPLGRFQGLDISSRGSH VK
Sbjct  254  ----QNIQMPQFHHLQGSMSNPRHPLLSGNAQALADAMQQDPLGRFQGLDISSRGSHRVK  309



>ref|XP_004307733.1| PREDICTED: transcription factor RF2b-like [Fragaria vesca subsp. 
vesca]
Length=364

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 10/123 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL+IATGE    +D+Y+LGM H PY+QS+FF  QP SG
Sbjct  227  QAMEQQAQLRDALNDALKKELERLKIATGEALTHTDSYNLGMHHFPYSQSSFFPGQPQSG  286

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPML---------ADTVQQDPLGRFQGLDISSR-GSH  330
            P DSQNIQ+PQ+H  Q +   PH PML         +D +QQD +GRFQGLDI++R GSH
Sbjct  287  PRDSQNIQLPQYHQFQSNMQAPHQPMLGASAQSHACSDMLQQDSIGRFQGLDINNRGGSH  346

Query  331  IVK  339
            +VK
Sbjct  347  LVK  349



>ref|XP_008233880.1| PREDICTED: transcription factor RF2b [Prunus mume]
Length=360

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL+IATGE+   +D+Y++GM  IPY+QS FF  Q  +G
Sbjct  225  QAMEQQAQLRDALNDALKKELERLKIATGEVLTHTDSYNMGMHQIPYSQSPFFPSQSQAG  284

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S PH PML        +D +QQD +GRFQGLDIS+RGSH+V
Sbjct  285  QRDSQNIHMPQFHPFQPNMSAPHQPMLSAAQSHACSDMLQQDSIGRFQGLDISNRGSHLV  344

Query  337  K  339
            +
Sbjct  345  R  345



>emb|CDP13910.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   151 bits (382),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 91/121 (75%), Gaps = 9/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERLRIATGEI+ PSDAY LGMQH+PY+QS FFSHQ   G
Sbjct  226  QAMEQQAQLRDALNEALKQEVERLRIATGEISGPSDAYHLGMQHVPYSQS-FFSHQAQPG  284

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
            P DSQ+ Q+  F+ LQ + S  H  +LA        D +QQDPLGRFQGLDI SR SH V
Sbjct  285  PGDSQSPQMAPFNPLQANMSNRHPSLLAPAQMHSFSDALQQDPLGRFQGLDIGSRTSHTV  344

Query  337  K  339
            K
Sbjct  345  K  345



>ref|XP_008359822.1| PREDICTED: transcription factor RF2b-like [Malus domestica]
Length=361

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE     D+Y+LGM H PY+QS FF  Q  +G
Sbjct  226  QAMEQQAQLRDALNDALKKELERLKVATGEQLTHXDSYNLGMHHFPYSQSPFFPSQSQTG  285

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S PH PML         D  QQDP+GRFQGLDI++RGSH+V
Sbjct  286  SRDSQNIHMPQFHQFQPNMSAPHQPMLGSSXSHACLDMSQQDPIGRFQGLDINNRGSHLV  345

Query  337  K  339
            +
Sbjct  346  R  346



>ref|XP_011084822.1| PREDICTED: transcription factor RF2b-like [Sesamum indicum]
Length=351

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 10/121 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERLR+ATGEI++ SD ++L MQH+PYNQS FF+  P S 
Sbjct  218  QAMEQQAQLRDALNEALKQEVERLRLATGEISSTSDTFNLAMQHVPYNQSTFFTSPPQSS  277

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
            P  ++NIQ+ QFHA+    S+  HPM        LAD+  QDPLGRFQGLDI SR SH+V
Sbjct  278  P--NENIQMQQFHAVPTGMSSHQHPMLSAAHVRGLADSFHQDPLGRFQGLDIGSRSSHLV  335

Query  337  K  339
            K
Sbjct  336  K  336



>ref|XP_008369370.1| PREDICTED: transcription factor RF2b [Malus domestica]
Length=358

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE    +D+Y+LGM H PY+QS F+S+Q   G
Sbjct  223  QAMEQQAQLRDALNDALKKELERLKVATGEQITHTDSYNLGMHHFPYSQSPFYSNQAQPG  282

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S  H PMLA        D  QQDP+GRFQGLDI++RGSH+V
Sbjct  283  SRDSQNIHMPQFHQFQPNMSAHHQPMLASSQLHACSDMSQQDPIGRFQGLDINNRGSHLV  342

Query  337  K  339
            +
Sbjct  343  R  343



>ref|XP_009349073.1| PREDICTED: transcription factor RF2b-like [Pyrus x bretschneideri]
Length=361

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE    +D+Y+LGM H PY+QS FF  Q   G
Sbjct  226  QAMEQQAQLRDALNDALKKELERLKVATGEQLTHTDSYNLGMHHFPYSQSPFFPSQSQPG  285

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S PH PML         D  QQDP+GRFQGLDI++RGSH+V
Sbjct  286  SRDSQNIHMPQFHQFQPNMSAPHQPMLGSSQSHACLDMSQQDPIGRFQGLDINNRGSHLV  345

Query  337  K  339
            +
Sbjct  346  R  346



>ref|XP_007218181.1| hypothetical protein PRUPE_ppa007645mg [Prunus persica]
 gb|EMJ19380.1| hypothetical protein PRUPE_ppa007645mg [Prunus persica]
Length=360

 Score =   149 bits (377),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL+IATGE+   +D+Y++GM   PY+QS FF  Q  +G
Sbjct  225  QAMEQQAQLRDALNDALKKELERLKIATGEVLTHTDSYNMGMHQSPYSQSPFFPSQSQAG  284

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S PH PML        +D +QQD +GRFQGLDIS+RGSH+V
Sbjct  285  QRDSQNIHMPQFHPFQPNMSAPHQPMLSAAQSHACSDMLQQDSIGRFQGLDISNRGSHLV  344

Query  337  K  339
            +
Sbjct  345  R  345



>ref|XP_009363876.1| PREDICTED: transcription factor RF2b-like [Pyrus x bretschneideri]
Length=362

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE    +D+Y+LGM H PY+QS F+ +Q   G
Sbjct  227  QAMEQQAQLRDALNDALKKELERLKVATGEQLTHTDSYNLGMHHFPYSQSLFYPNQSQPG  286

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              DSQNI +PQFH  QP+ S PH  MLA        D  QQDP+GRFQGLDI++RGSH+V
Sbjct  287  SRDSQNIHMPQFHQFQPNMSAPHQHMLASSQSHACSDMSQQDPIGRFQGLDINNRGSHLV  346

Query  337  K  339
            +
Sbjct  347  R  347



>ref|XP_007011316.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20126.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=365

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGE+  P+D ++LGM HIPY QS++F  QP   
Sbjct  230  QAMEQQAQLRDALNEALKKEVERLKIATGEMTTPTDTFNLGMHHIPYTQSSYFPPQPQHV  289

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDISSRGSHIV  336
              D+ NIQ+PQFH  Q +  TP+  ++        AD +QQDPLGR QGLDISSRGS +V
Sbjct  290  QVDTHNIQMPQFHPFQSNMLTPNQSVVAASNSHAYADMMQQDPLGRLQGLDISSRGSRLV  349

Query  337  K  339
            K
Sbjct  350  K  350



>gb|KDP21652.1| hypothetical protein JCGZ_03323 [Jatropha curcas]
Length=366

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+  P+D Y+LGM H+PY QS+FF  Q  + 
Sbjct  232  QAMEQQAQLRDALNEALKKEVERLKLATGEMMTPTDTYNLGMHHMPYTQSSFFLPQSQTR  291

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
              +SQN+Q+PQFH+ Q + STP  PM          D +QQDPLGR QGLDISSR + +V
Sbjct  292  IVNSQNMQMPQFHSFQSNMSTPLQPMGGSSHSHAFPDMLQQDPLGRLQGLDISSRSTLVV  351

Query  337  K  339
            K
Sbjct  352  K  352



>ref|XP_010067612.1| PREDICTED: transcription factor RF2b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW65775.1| hypothetical protein EUGRSUZ_G03135 [Eucalyptus grandis]
Length=356

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 10/121 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE   PSD Y+LG+ H PY + ++F HQP SG
Sbjct  223  QAMEQQAQLRDALNEALKKEVERLKVATGEAMTPSDTYNLGLHHFPYAKPSYFPHQPQSG  282

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              D QN+Q+ QFH  QP+ +  H P++A        D +QQ+ LGRFQGLDIS++GS IV
Sbjct  283  HVDPQNLQMTQFHMFQPNMA--HQPLVAAAHSNAFSDMMQQESLGRFQGLDISNKGSQIV  340

Query  337  K  339
            K
Sbjct  341  K  341



>ref|XP_007011315.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY20125.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=373

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 89/129 (69%), Gaps = 16/129 (12%)
 Frame = +1

Query  1    QAMEQQAQLRD--------ALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF  156
            QAMEQQAQLRD        ALNEALK EVERL+IATGE+  P+D ++LGM HIPY QS++
Sbjct  230  QAMEQQAQLRDGMFCPNQLALNEALKKEVERLKIATGEMTTPTDTFNLGMHHIPYTQSSY  289

Query  157  FSHQPPSGPSDSQNIQIPQFHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDI  312
            F  QP     D+ NIQ+PQFH  Q +  TP+  ++        AD +QQDPLGR QGLDI
Sbjct  290  FPPQPQHVQVDTHNIQMPQFHPFQSNMLTPNQSVVAASNSHAYADMMQQDPLGRLQGLDI  349

Query  313  SSRGSHIVK  339
            SSRGS +VK
Sbjct  350  SSRGSRLVK  358



>ref|XP_007017082.1| Basic-leucine zipper transcription factor family protein [Theobroma 
cacao]
 gb|EOY34701.1| Basic-leucine zipper transcription factor family protein [Theobroma 
cacao]
Length=395

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI +PS+++SLGM  +PY  S F S  P  G
Sbjct  263  QAMEQQAQLRDALNEALKKEVERLKIATGEIMSPSESFSLGMHQMPYTASTFLSLPPQQG  322

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             +  QN+Q+P F   Q + ST H P      L+D +Q DPLGR QGLDISS+GS++VK
Sbjct  323  AAGPQNMQLPSFTGSQSTMSTYHPPQMNQHHLSDIMQNDPLGRLQGLDISSKGSNLVK  380



>ref|XP_010253091.1| PREDICTED: transcription factor RF2b isoform X2 [Nelumbo nucifera]
Length=392

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI +P++ +SLGM HIPY  S FFS    +G
Sbjct  261  QAMEQQAQLRDALNEALKQEVERLKIATGEILSPAETFSLGMHHIPYTPSPFFSLPQQTG  320

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
                QNIQ+PQFH  Q + ++   PML        + +QQDPLGR QGLDISS  SH+VK
Sbjct  321  SRGHQNIQVPQFHPSQSNMAS--QPMLVANTRTLPEMLQQDPLGRLQGLDISSGPSHLVK  378



>ref|XP_010253090.1| PREDICTED: transcription factor RF2b isoform X1 [Nelumbo nucifera]
Length=410

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI +P++ +SLGM HIPY  S FFS    +G
Sbjct  279  QAMEQQAQLRDALNEALKQEVERLKIATGEILSPAETFSLGMHHIPYTPSPFFSLPQQTG  338

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA-------DTVQQDPLGRFQGLDISSRGSHIVK  339
                QNIQ+PQFH  Q + ++   PML        + +QQDPLGR QGLDISS  SH+VK
Sbjct  339  SRGHQNIQVPQFHPSQSNMAS--QPMLVANTRTLPEMLQQDPLGRLQGLDISSGPSHLVK  396



>emb|CBI15815.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN ALK EVERL+IATGEI +PS+++ LGMQ + Y  S+F S     G
Sbjct  87   QAMEQQAQLRDALNTALKQEVERLKIATGEIMSPSESFDLGMQQMLYTPSSFLSLPQQIG  146

Query  181  PSDSQNIQIPQFH---------ALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            P+   N+Q+P FH          LQP  S P    +++ +Q DPLGR QGLDISSRGSH+
Sbjct  147  PAGQPNMQLPPFHHSHSNMSTQYLQPINSQP----ISEILQNDPLGRLQGLDISSRGSHL  202

Query  334  VK  339
            VK
Sbjct  203  VK  204



>emb|CBI25364.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 73/113 (65%), Gaps = 27/113 (24%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI   SDAY+LGM H+PY QS+FFSHQ   G
Sbjct  98   QAMEQQAQLRDALNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPG  157

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P                           + +QQDPLGR QGLDISSRG  +VK
Sbjct  158  P---------------------------NMLQQDPLGRLQGLDISSRGPSLVK  183



>gb|EYU20095.1| hypothetical protein MIMGU_mgv1a008953mg [Erythranthe guttata]
Length=357

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 86/121 (71%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHIPYNQSAFFS---HQ  168
            QAMEQQAQLRDALNEALK EVERLR+ATGE+ AA SD ++L MQHI YNQS FFS   HQ
Sbjct  222  QAMEQQAQLRDALNEALKQEVERLRMATGEVSAANSDTFNLAMQHISYNQSGFFSSNQHQ  281

Query  169  P-PSGPSDSQNIQIPQFHALQPSTSTPHHPM---LADTVQQDPLGRFQGLDISSRGSHIV  336
              P+  + S  +Q+PQFHA Q   S   H     L+ ++  DPL  FQGLDISSR S++V
Sbjct  282  ARPNNNNSSHAVQMPQFHAFQAGFSNHQHNNMQELSGSMHHDPLRHFQGLDISSRESNLV  341

Query  337  K  339
            K
Sbjct  342  K  342



>ref|XP_010067613.1| PREDICTED: transcription factor RF2b-like isoform X2 [Eucalyptus 
grandis]
Length=352

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 14/121 (12%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDAL    K EVERL++ATGE   PSD Y+LG+ H PY + ++F HQP SG
Sbjct  223  QAMEQQAQLRDAL----KKEVERLKVATGEAMTPSDTYNLGLHHFPYAKPSYFPHQPQSG  278

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
              D QN+Q+ QFH  QP+ +  H P++A        D +QQ+ LGRFQGLDIS++GS IV
Sbjct  279  HVDPQNLQMTQFHMFQPNMA--HQPLVAAAHSNAFSDMMQQESLGRFQGLDISNKGSQIV  336

Query  337  K  339
            K
Sbjct  337  K  337



>ref|XP_010108472.1| Transcription factor RF2b [Morus notabilis]
 gb|EXC19534.1| Transcription factor RF2b [Morus notabilis]
Length=420

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PS++++LGM  +PYN S +FS Q  +G
Sbjct  289  QAMEQQAQLRDALNEALKKEVERLKIATGEMISPSESFNLGMHQMPYNPSGYFSLQQQAG  348

Query  181  PSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
             S  QN+Q+P F+  Q S S  H      HP L D +Q DP+GR QGLDISS+GS +VK
Sbjct  349  -SGHQNMQMPPFNHSQASMSAHHMQQSNSHP-LTDLLQNDPVGRLQGLDISSKGSSLVK  405



>ref|XP_010103645.1| Transcription factor RF2b [Morus notabilis]
 gb|EXB96528.1| Transcription factor RF2b [Morus notabilis]
Length=360

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY---NQSAFFSHQP  171
            QAMEQQA LRDALNEALK EVERL+IATGE    +D Y+ GM HIPY   +      HQ 
Sbjct  223  QAMEQQAHLRDALNEALKKEVERLKIATGETLTHTDTYNFGMHHIPYSSQSSFFSNQHQ-  281

Query  172  PSGPSDSQNIQIPQFHALQP-STSTPHHPML-------ADTVQQDPLGRFQGLDISSRGS  327
             +G  D++NIQ+PQF+ LQ  + ST H PML       ++T+Q DP+GR QGLDIS+RGS
Sbjct  282  -AGRGDTRNIQMPQFNPLQSNNVSTTHQPMLSAAYSHASETLQLDPIGRLQGLDISNRGS  340

Query  328  HIVK  339
            H+VK
Sbjct  341  HLVK  344



>ref|XP_010252066.1| PREDICTED: transcription factor RF2b-like [Nelumbo nucifera]
Length=378

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 15/123 (12%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFS--HQPP  174
            QAMEQQAQLRDALNEALK EVERLRIATGE+++P DA +L M H+ Y+ S FF    QP 
Sbjct  246  QAMEQQAQLRDALNEALKQEVERLRIATGEVSSPGDALNLVMHHVQYSPSPFFCLPQQPG  305

Query  175  SGPSDSQNIQIPQFHALQPSTST-PHHPMLA-------DTVQQDPLGRFQGLDISSRGSH  330
            SG    Q+ Q+PQF   QPS S    HP+LA       + +QQDPLGR QGLDI+SRGSH
Sbjct  306  SG--GHQSFQMPQF---QPSQSNMGSHPLLASQSHAFSEMLQQDPLGRLQGLDINSRGSH  360

Query  331  IVK  339
            +VK
Sbjct  361  LVK  363



>gb|KHN01885.1| Transcription factor RF2b [Glycine soja]
Length=219

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+ + +D+++LGM  +P++ S F    P SG
Sbjct  87   QAMEQQAQLRDALNEALKKEVERLKVATGEMMSHTDSFNLGMHLMPFSGSNFVPIPPQSG  146

Query  181  PSDSQNIQIPQFHALQPSTSTPH-------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QN+Q+P F  L PST   H       HP  ++ +Q D LGRFQGLDISS+GS +VK
Sbjct  147  PSGHQNMQMPPF-GLTPSTMPSHLLHQTSSHP-YSEILQNDQLGRFQGLDISSKGSTLVK  204



>gb|KHG09638.1| Transcription factor RF2b [Gossypium arboreum]
Length=369

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAM+QQA+L DALNEALK EVE L+IATGE   P++ ++LGM HIPY QS+F   QP   
Sbjct  234  QAMDQQARLCDALNEALKKEVEGLKIATGEATTPTNTFNLGMHHIPYTQSSFLPPQPQHM  293

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDISSRGSHIV  336
              D+QN+Q+P F  LQ +T T +  M+        AD +QQDPLG+ QGLDISS GSH V
Sbjct  294  QIDTQNVQMPPFQPLQSNTLTTNPSMVGATNSYAFADMMQQDPLGQLQGLDISSGGSHSV  353

Query  337  K  339
            K
Sbjct  354  K  354



>ref|XP_007011317.1| Basic-leucine zipper transcription factor family protein isoform 
3, partial [Theobroma cacao]
 gb|EOY20127.1| Basic-leucine zipper transcription factor family protein isoform 
3, partial [Theobroma cacao]
Length=284

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 8/110 (7%)
 Frame = +1

Query  34   ALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSGPSDSQNIQIPQ  213
            ALNEALK EVERL+IATGE+  P+D ++LGM HIPY QS++F  QP     D+ NIQ+PQ
Sbjct  160  ALNEALKKEVERLKIATGEMTTPTDTFNLGMHHIPYTQSSYFPPQPQHVQVDTHNIQMPQ  219

Query  214  FHALQPSTSTPHHPML--------ADTVQQDPLGRFQGLDISSRGSHIVK  339
            FH  Q +  TP+  ++        AD +QQDPLGR QGLDISSRGS +VK
Sbjct  220  FHPFQSNMLTPNQSVVAASNSHAYADMMQQDPLGRLQGLDISSRGSRLVK  269



>ref|XP_002520865.1| Transcription factor RF2b, putative [Ricinus communis]
 gb|EEF41574.1| Transcription factor RF2b, putative [Ricinus communis]
Length=355

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALN+ALK EVERL+ ATGE+  P+D+Y LGM H+PY QS+FF  Q    
Sbjct  221  QAMEQQAHLRDALNDALKKEVERLKFATGEMMTPTDSYHLGMNHMPYTQSSFFPPQSQPR  280

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA--------DTVQQDPLGRFQGLDISSRGSHIV  336
            P ++QN+Q+PQFH  Q +  T H  + A        + +  DPLGR QGLDI SR + +V
Sbjct  281  PVNTQNMQMPQFHPFQSNMLTSHQAIAAPSHSHAFPEMLPLDPLGRLQGLDIGSRSTVLV  340

Query  337  K  339
            K
Sbjct  341  K  341



>ref|XP_002266792.1| PREDICTED: transcription factor RF2b-like [Vitis vinifera]
Length=344

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN ALK EVERL+IATGEI +PS+++ LGMQ + Y  S+F S     G
Sbjct  212  QAMEQQAQLRDALNTALKQEVERLKIATGEIMSPSESFDLGMQQMLYTPSSFLSLPQQIG  271

Query  181  PSDSQNIQIPQFH---------ALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            P+   N+Q+P FH          LQP  S P    +++ +Q DPLGR QGLDISSRGSH+
Sbjct  272  PAGQPNMQLPPFHHSHSNMSTQYLQPINSQP----ISEILQNDPLGRLQGLDISSRGSHL  327

Query  334  VK  339
            VK
Sbjct  328  VK  329



>emb|CAN65087.1| hypothetical protein VITISV_035032 [Vitis vinifera]
Length=342

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN ALK EVERL+IATGEI +PS+++ LGMQ + Y  S+F S     G
Sbjct  210  QAMEQQAQLRDALNTALKQEVERLKIATGEIMSPSESFDLGMQXMLYTPSSFLSLPQQIG  269

Query  181  PSDSQNIQIPQFH---------ALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            P+   N+Q+P FH          LQP  S P    +++ +Q DPLGR QGLDISSRGSH+
Sbjct  270  PAGQPNMQLPPFHHSHSNMSTQYLQPINSQP----ISEILQNDPLGRLQGLDISSRGSHL  325

Query  334  VK  339
            VK
Sbjct  326  VK  327



>ref|XP_002319876.1| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE95799.1| bZIP transcription factor family protein [Populus trichocarpa]
Length=318

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+ ATGEI  P+D+Y+LG+QHIPYN S   S +P  G
Sbjct  185  QAMEQQAQLRDALNEALKKEVERLKFATGEIMTPTDSYNLGIQHIPYNHSPLVSPRPRPG  244

Query  181  PSDSQNIQIPQFHAL-------QPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
              D+ NIQIPQFH L       QP  +  H   L++ + QDPL   QG DI
Sbjct  245  SVDALNIQIPQFHPLQSNLSPRQPGIAASHSHALSEMLPQDPLRWLQGFDI  295



>ref|XP_002319969.2| hypothetical protein POPTR_0013s15280g [Populus trichocarpa]
 gb|EEE95892.2| hypothetical protein POPTR_0013s15280g [Populus trichocarpa]
Length=379

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV RL+IATGE+ +PSD+Y+LGM  +P+  S FF      G
Sbjct  247  QAMEQQAQLRDALNEALKKEVGRLKIATGEMLSPSDSYNLGMHQMPFTPSNFFPLPSQPG  306

Query  181  PSDSQNIQIPQFHALQPSTSTPH-HPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
            P+   N+Q+P F     S ST H H +    L+D +Q DP+GR QGLDIS++GSHIVK
Sbjct  307  PAGHPNMQLPSFTHSPSSMSTRHIHQVDSQSLSDYMQNDPIGRLQGLDISNKGSHIVK  364



>ref|XP_008782655.1| PREDICTED: transcription factor RF2b-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 83/117 (71%), Gaps = 7/117 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEAL+ EVERLRIATGEI+ P + Y++G+QH+PYN S  F   P   
Sbjct  263  QAMEQQAQLRDALNEALRQEVERLRIATGEISNPCETYNMGLQHVPYNPS--FYTLPQQQ  320

Query  181  PSDSQNIQI-PQFHALQPSTST---PHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P   Q IQ+ PQFH  QP+ S     H   L D +QQDPLGR QGLDI S+GS IVK
Sbjct  321  PVHHQGIQLQPQFHQSQPNVSNHQFAHPNALQDMMQQDPLGRLQGLDI-SKGSLIVK  376



>gb|KDP45689.1| hypothetical protein JCGZ_17296 [Jatropha curcas]
Length=394

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGEI +P+++++LGM  +PY  S FF H    G
Sbjct  262  QAMEQQAQLRDALNEALKKEVERLKVATGEIMSPAESFNLGMHQMPYTPSNFFPHPQQPG  321

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            P+   N+Q+P     QP  S P HP+       L++ +Q DPLGR QGLDISS+  +IVK
Sbjct  322  PAGHPNMQLPPLAHSQP--SMPSHPLHQTNSHALSEMMQNDPLGRLQGLDISSKAPNIVK  379



>ref|XP_010921141.1| PREDICTED: transcription factor RF2b-like [Elaeis guineensis]
Length=390

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 83/117 (71%), Gaps = 7/117 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEAL+ EVERLRIATGEI+ P + +++G+QH+PYN S  F   P   
Sbjct  262  QAMEQQAQLRDALNEALRQEVERLRIATGEISNPGETFNMGLQHVPYNPS--FYTLPQQQ  319

Query  181  PSDSQNIQI-PQFHALQPSTST---PHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P   Q IQ+ PQFH  QP+ S     H   L D +QQDPLGR QGLDI S+GS IVK
Sbjct  320  PVHHQGIQLQPQFHQSQPNVSNHQFAHSNALPDMMQQDPLGRLQGLDI-SKGSLIVK  375



>ref|XP_003544931.1| PREDICTED: transcription factor RF2b [Glycine max]
Length=362

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+ + +D+++LGM  +P++ S F    P SG
Sbjct  230  QAMEQQAQLRDALNEALKKEVERLKVATGEMMSHTDSFNLGMHLMPFSGSNFVPIPPQSG  289

Query  181  PSDSQNIQIPQFHALQPSTSTPH-------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QN+Q+P F  L PST   H       HP  ++ +Q D LGRFQGLDISS+GS +VK
Sbjct  290  PSGHQNMQMPPF-GLTPSTMPSHLLHQTSSHP-YSEILQNDQLGRFQGLDISSKGSTLVK  347



>gb|EYU35211.1| hypothetical protein MIMGU_mgv1a009267mg [Erythranthe guttata]
Length=347

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV+RLR+ATGE++  S+ Y L MQH+ YNQ+ +++  PP G
Sbjct  219  QAMEQQAQLRDALNEALKQEVDRLRVATGEMSTSSETYDLAMQHVQYNQTVYYT--PPGG  276

Query  181  --PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGS-HIVK  339
                +S+ +Q+ QFH  Q S    ++ +     QQDPLG FQGLDIS+RGS H+VK
Sbjct  277  GMNENSRYMQMQQFHNQQISGGGNNNHLRDAFNQQDPLGCFQGLDISNRGSQHLVK  332



>gb|KHG07492.1| Transcription factor RF2b [Gossypium arboreum]
Length=341

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 77/117 (66%), Gaps = 13/117 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQL DALNEALK EVERL+ ATGEI  P+D ++LGM HI Y QS+FF   PP  
Sbjct  219  QAMEQQAQLCDALNEALKKEVERLKTATGEITTPTDTFNLGMHHISYAQSSFF---PP--  273

Query  181  PSDSQNIQIPQFH----ALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
                QN Q+P FH     L  S S  +   LAD +QQDPLG  QGLD SSRG   VK
Sbjct  274  ----QNTQLPPFHPFHSNLLTSASNTNSHALADMMQQDPLGLLQGLDTSSRGLPFVK  326



>ref|XP_008465307.1| PREDICTED: transcription factor RF2b-like [Cucumis melo]
Length=402

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 10/121 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFS-HQPPS  177
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PS++++LGM H+ Y  S+F    Q  +
Sbjct  269  QAMEQQAQLRDALNEALKKEVERLKIATGEMMSPSESFNLGMHHMAYAPSSFIQLSQQQT  328

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIV  336
            G +  QN+QIPQF     + ST  HP+       L++ +Q D LGR QGLDISS+GS +V
Sbjct  329  GSTGLQNMQIPQFGHSPSNMST--HPLLPSDSHSLSEVLQTDSLGRLQGLDISSKGSSLV  386

Query  337  K  339
            K
Sbjct  387  K  387



>ref|XP_011041787.1| PREDICTED: transcription factor RF2b-like [Populus euphratica]
Length=386

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERLRIATGE+ +PS++++LGM  +P+ Q  FF   P  G
Sbjct  254  QAMEQQAQLRDALNEALKKEVERLRIATGEMVSPSESFNLGMHQMPFTQPNFFPLPPQPG  313

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
             S   N+Q+P F    PS S+ HH        L+D VQ DP+ + QGLDIS++G +IVK
Sbjct  314  SSGHPNMQLPSFTRTPPSMSS-HHLQQADSHNLSDYVQNDPIRQLQGLDISNKGLNIVK  371



>ref|XP_002325642.2| hypothetical protein POPTR_0019s15040g [Populus trichocarpa]
 gb|EEF00024.2| hypothetical protein POPTR_0019s15040g [Populus trichocarpa]
Length=375

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERLRIATGE+ +PS++++LGM  +P+ Q  FF   P  G
Sbjct  243  QAMEQQAQLRDALNEALKKEVERLRIATGEMVSPSESFNLGMHQMPFTQPNFFPLPPQPG  302

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
             S   N+Q+P F    PS ST HH        L+D +Q DP+ + QGLDIS++G +IVK
Sbjct  303  SSGHPNMQLPSFTHTPPSMST-HHLQQADSHNLSDYMQNDPIRQLQGLDISNKGLNIVK  360



>ref|XP_011006306.1| PREDICTED: transcription factor RF2b-like isoform X1 [Populus 
euphratica]
Length=335

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+  TGEI  P+D+Y+LG+QHI YN S   S +P  G
Sbjct  202  QAMEQQAQLRDALNEALKKEVERLKFTTGEIMTPTDSYNLGIQHISYNHSPLVSPRPRLG  261

Query  181  PSDSQNIQIPQFHAL-------QPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
              D+ NIQIPQFH L       QP+ +  H   L++ + QDPL   QG DI
Sbjct  262  SVDALNIQIPQFHPLQSNLSPRQPAIAASHSHDLSEMLPQDPLRWLQGFDI  312



>gb|KHN18663.1| Transcription factor RF2b [Glycine soja]
Length=224

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 82/122 (67%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRD LN+AL  EVERL+IATGE    S++++LGM  +PY  S FFS  P SG
Sbjct  92   QAMEQQAQLRDVLNDALMKEVERLKIATGEALNQSESFNLGMHQMPYAGSNFFSIPPHSG  151

Query  181  PSDSQNIQIPQF---------HALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            PS  QN+Q+P F         H LQ + S   H M +D +Q D LGR QGLDISS+G+ +
Sbjct  152  PSGHQNMQLPPFGHSHSTVPTHQLQQTNS---HQM-SDILQNDQLGRLQGLDISSKGTPV  207

Query  334  VK  339
            VK
Sbjct  208  VK  209



>ref|XP_008241588.1| PREDICTED: transcription factor RF2b [Prunus mume]
Length=443

 Score =   121 bits (303),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PSD+++LGM  +PYN  SA+F  Q   
Sbjct  310  QAMEQQAQLRDALNEALKKEVERLKIATGEMMSPSDSFNLGMHQMPYNHPSAYFPLQQQP  369

Query  178  GPSDSQNIQIPQFHALQPSTSTPH-----HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            GP+  QN+Q+PQF+  Q +  T H         +D +Q  P+G+ QGLDI ++G+ +VK
Sbjct  370  GPAGHQNMQMPQFNHSQSNMPTHHLQQSNSHTFSDIMQNGPVGQLQGLDIGTKGAPLVK  428



>ref|XP_007142045.1| hypothetical protein PHAVU_008G247800g [Phaseolus vulgaris]
 gb|ESW14039.1| hypothetical protein PHAVU_008G247800g [Phaseolus vulgaris]
Length=363

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+ + +++++LGM HIP+  S F      SG
Sbjct  232  QAMEQQAQLRDALNEALKKEVERLKLATGEMMSHTESFNLGMHHIPFTGSTFSPILSQSG  291

Query  181  PSDSQNIQIPQFHALQPSTSTPH-------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QNI +   H+  PST   H       HP L++ +Q D LGRFQGLDISS+GS +VK
Sbjct  292  PSGHQNIHLSFGHS--PSTMPTHQLHQTSSHP-LSEILQNDQLGRFQGLDISSKGSTVVK  348



>gb|KHN40989.1| Transcription factor RF2b [Glycine soja]
Length=219

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE  + +++++LGM  +P++ S F    P SG
Sbjct  87   QAMEQQAQLRDALNEALKKEVERLKVATGEGMSHTESFNLGMHQMPFSGSNFIPIPPQSG  146

Query  181  PSDSQNIQIPQF---------HALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            PS  QN+Q+P F         H L  ++S P+    ++ +Q + LGRFQGLDISS+GS +
Sbjct  147  PSGHQNMQMPPFGHSPSTMPTHQLHQTSSHPY----SEILQNEQLGRFQGLDISSKGSTL  202

Query  334  VK  339
            VK
Sbjct  203  VK  204



>ref|XP_002518293.1| Transcription factor RF2b, putative [Ricinus communis]
 gb|EEF44053.1| Transcription factor RF2b, putative [Ricinus communis]
Length=386

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IAT EI +PS++++LGM  +PY  S FFSH   SG
Sbjct  254  QAMEQQAQLRDALNEALKKEVERLKIATREIMSPSESFNLGMHQMPYTPSNFFSHPQQSG  313

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
             ++  N+Q P +   Q  TS P H +        ++ +Q D LGR QGLDISS+G +IVK
Sbjct  314  SANHPNMQFPPYAHSQ--TSIPGHHLHQTNSHTFSELMQNDSLGRLQGLDISSKGPNIVK  371



>ref|XP_007205237.1| hypothetical protein PRUPE_ppa006097mg [Prunus persica]
 gb|EMJ06436.1| hypothetical protein PRUPE_ppa006097mg [Prunus persica]
Length=427

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (72%), Gaps = 10/121 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PS++++LGM  +PYN  SA+F  Q   
Sbjct  294  QAMEQQAQLRDALNEALKKEVERLKIATGEMMSPSESFNLGMHQMPYNHPSAYFPLQQQP  353

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIV  336
            GP+  QN+Q+PQF+  Q  ++ P H +        +D +Q  P+G+ QGLDI ++G+ +V
Sbjct  354  GPAGHQNMQMPQFNHSQ--SNMPTHLLHQSNSHTFSDIMQNGPVGQLQGLDIGTKGAPLV  411

Query  337  K  339
            K
Sbjct  412  K  412



>ref|XP_004140027.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus]
 gb|KGN46759.1| hypothetical protein Csa_6G133680 [Cucumis sativus]
Length=396

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF--FSHQPP  174
            QAMEQQAQLRDALN+ALK EVERL+IATGE+ +PS++++LGM H+ Y  S+F   S Q P
Sbjct  263  QAMEQQAQLRDALNDALKKEVERLKIATGEMMSPSESFNLGMHHMAYAPSSFIQLSQQQP  322

Query  175  SGPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHI  333
             G +  QN+QIP F     + ST  HP+       L++ +Q D LGR QGLDISS+GS +
Sbjct  323  -GSTGLQNMQIPPFGHSPSNMST--HPLLPSDSHSLSEVLQTDSLGRLQGLDISSKGSSL  379

Query  334  VK  339
            VK
Sbjct  380  VK  381



>ref|XP_007137632.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
 ref|XP_007137633.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
 ref|XP_007137634.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
 gb|ESW09626.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
 gb|ESW09627.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
 gb|ESW09628.1| hypothetical protein PHAVU_009G142900g [Phaseolus vulgaris]
Length=288

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA+L DALNEALK EV+RLR+ATG++A P+D Y LGM  + Y+Q  FFSHQ   G
Sbjct  160  QAMEQQAKLCDALNEALKKEVDRLRVATGDMAMPADNYGLGMHQLTYSQGPFFSHQSQHG  219

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
             S  Q +Q+PQ H+L  + ST H P+        +++ +  + +G+FQGLDI +   H++
Sbjct  220  QSAVQAMQMPQMHSLSSNVSTSHEPLFDLDIPYDMSEMLSNESIGQFQGLDIGNGVPHVL  279



>ref|XP_008358922.1| PREDICTED: transcription factor RF2b-like [Malus domestica]
Length=448

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            Q+MEQQAQLRDALNEALK EVERL+IATGE+ + SD+++LGM  +PYN  SA+F  Q   
Sbjct  314  QSMEQQAQLRDALNEALKKEVERLKIATGEMMSASDSFTLGMHQMPYNHPSAYFPLQQQP  373

Query  178  GPSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            GP+  Q + +PQF+  Q S  T H         L+D +Q  P+G+ QGLDI S+G+ +VK
Sbjct  374  GPASHQTMHLPQFNHSQSSMPTQHLHQANSRTHLSDMLQNGPVGQLQGLDIGSKGAPLVK  433



>ref|XP_010031087.1| PREDICTED: transcription factor RF2b [Eucalyptus grandis]
 gb|KCW50354.1| hypothetical protein EUGRSUZ_J00119 [Eucalyptus grandis]
Length=343

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQAQLRDALNEALK EVERL+IATGE+  P+D Y+L M   PY+Q +FF  Q    
Sbjct  208  QVMEQQAQLRDALNEALKKEVERLKIATGEMMTPTDTYNLEMLQYPYSQPSFFPPQQQPR  267

Query  181  PSDSQNIQIPQFHAL--------QPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIV  336
              D +N+Q+PQF+          Q  T   H    ++ +Q D LGR +GL+IS+RGSH+V
Sbjct  268  SVDFRNMQMPQFNMFHMNIAASGQSPTVPTHSHGFSELLQHDSLGRLEGLEISNRGSHLV  327

Query  337  K  339
            K
Sbjct  328  K  328



>ref|XP_004500364.1| PREDICTED: transcription factor RF2b-like [Cicer arietinum]
Length=387

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALN+AL  EVERL+IATGE   PS++Y+LGM  + +  S FFS    SG
Sbjct  255  QAMEQQAHLRDALNDALMKEVERLKIATGEAMNPSESYNLGMHQMQFAGSNFFSMPQHSG  314

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QNIQ PQF     S++ P H +       +++ +Q D LGR QGLDISS+G+ +VK
Sbjct  315  PSGHQNIQFPQFG--HSSSNMPTHQLQQTNSHQISEMLQNDQLGRLQGLDISSKGTTLVK  372



>ref|XP_008384666.1| PREDICTED: transcription factor RF2b-like [Malus domestica]
Length=448

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            Q+MEQQAQLRDALNEALK EVERL+IATGE+ + SD+++LGM  +PYN  SA+F  Q   
Sbjct  314  QSMEQQAQLRDALNEALKKEVERLKIATGEMMSASDSFTLGMHQMPYNHPSAYFPLQQQP  373

Query  178  GPSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            GP+  Q + +PQF+  Q S  T H         L+D +Q  P+G+ QGLDI S+G+ +VK
Sbjct  374  GPASHQTMHLPQFNHSQSSMPTQHLHQANSRTHLSDMLQNGPVGQLQGLDIGSKGAPLVK  433



>ref|XP_003552912.1| PREDICTED: transcription factor RF2b-like [Glycine max]
Length=380

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 82/119 (69%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRD LN+AL  EVERL+IATGE    S++++LGM  +PY  S FFS  P SG
Sbjct  248  QAMEQQAQLRDVLNDALMKEVERLKIATGEALNQSESFNLGMHQMPYAGSNFFSIPPHSG  307

Query  181  PSDSQNIQIPQF---HALQPS---TSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QN+Q+P F   H+  P+     T  H M +D +Q D LGR QGLDISS+G+ +VK
Sbjct  308  PSGHQNMQLPPFGHSHSTVPTHQLQQTNSHQM-SDILQNDQLGRLQGLDISSKGTPVVK  365



>ref|XP_004502831.1| PREDICTED: transcription factor RF2b-like isoform X1 [Cicer arietinum]
Length=319

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA+L DALNEALKNEV+RL++ATGE+   ++ Y LGM    Y+Q+  F HQP  G
Sbjct  184  QAMEQQAKLCDALNEALKNEVDRLKMATGEMTTHAETYGLGMHQFSYSQAPSFQHQPQHG  243

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
            P++ + +Q+ QFH+   + STPH P         L++ +  D +G+FQGLDI  R SH++
Sbjct  244  PNELRAMQMQQFHSHSSNISTPHQPQFDLPTSYDLSEMLSSDSIGQFQGLDIGHRVSHVL  303



>ref|XP_011021042.1| PREDICTED: transcription factor RF2b-like isoform X2 [Populus 
euphratica]
Length=376

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PSD+Y+LGM  +P+  S FF      G
Sbjct  244  QAMEQQAQLRDALNEALKKEVERLKIATGEMLSPSDSYNLGMHQMPFTPSNFFPLPLQPG  303

Query  181  PSDSQNIQIPQFHALQPSTSTPH-HPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             +   N+Q+P F     S ST H H +    L+D +Q DP+ + QGLDIS++GS+IVK
Sbjct  304  TAGHPNMQLPSFTHSSSSMSTRHIHQVDSQSLSDYIQNDPIRQLQGLDISNKGSNIVK  361



>ref|XP_003537351.1| PREDICTED: transcription factor RF2b-like [Glycine max]
Length=385

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+AL  EVERL+IATGE    S++++LGM  +PY    FFS  P SG
Sbjct  253  QAMEQQAQLRDALNDALMKEVERLKIATGEALNQSESFNLGMHQMPYAGPNFFSIPPHSG  312

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  QN+Q+P F   Q  ++ P H +       ++D +Q D LGR QGLDISS+G+ +VK
Sbjct  313  PSGHQNMQLPPFGHSQ--STVPTHQLQQTNSHQMSDILQNDQLGRLQGLDISSKGTPMVK  370



>ref|XP_011021041.1| PREDICTED: transcription factor RF2b-like isoform X1 [Populus 
euphratica]
Length=387

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGE+ +PSD+Y+LGM  +P+  S FF      G
Sbjct  255  QAMEQQAQLRDALNEALKKEVERLKIATGEMLSPSDSYNLGMHQMPFTPSNFFPLPLQPG  314

Query  181  PSDSQNIQIPQFHALQPSTSTPH-HPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             +   N+Q+P F     S ST H H +    L+D +Q DP+ + QGLDIS++GS+IVK
Sbjct  315  TAGHPNMQLPSFTHSSSSMSTRHIHQVDSQSLSDYIQNDPIRQLQGLDISNKGSNIVK  372



>gb|KEH35548.1| bZIP transcription factor [Medicago truncatula]
Length=311

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 8/120 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQA+L DALNEALKNEV+RL++ATGE+   +D Y LGM  + Y+Q++ F HQP  G
Sbjct  176  QTMEQQAKLCDALNEALKNEVDRLKLATGEVPTHADTYGLGMHQLSYSQASSFMHQPQHG  235

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDISSRGSHIV  336
             ++ + +Q+  FH+L  + S PH P         L++ +  D +G+FQGLDI +R SH++
Sbjct  236  SNELRAMQMQHFHSLSSNGSNPHQPQFDLPTSYDLSEMLSSDSIGQFQGLDIGNRVSHVL  295



>ref|XP_003635981.1| Transcription factor RF2b [Medicago truncatula]
Length=161

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 13/120 (11%)
 Frame = +1

Query  7    MEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSGPS  186
            MEQQA LRDALN+AL  EV+RL+IATGE   PS++Y++GM  + +  S FFS    SGPS
Sbjct  1    MEQQAHLRDALNDALMKEVDRLKIATGEAMNPSESYNMGMHQLQFAGSNFFSMPQHSGPS  60

Query  187  DSQNIQIPQF---------HALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              QNIQ PQF         + LQ + S  H   ++D +Q D LGR QGLDISS+GS +VK
Sbjct  61   GHQNIQFPQFGHSPSDMPNYQLQQTNS--HQ--ISDMLQNDQLGRLQGLDISSKGSTLVK  116



>ref|XP_004166348.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus]
Length=396

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF--FSHQPP  174
            QAMEQQAQLRDALN+ALK EVERL+IATGE+ +PS++++LGM H+ Y  S+F   S Q P
Sbjct  263  QAMEQQAQLRDALNDALKKEVERLKIATGEMMSPSESFNLGMHHMAYAPSSFIQLSQQQP  322

Query  175  SGPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHI  333
             G +  QN+QIP F     + ST  HP+       L++ +Q D LGR QGLDISS+GS  
Sbjct  323  -GSTGLQNMQIPPFGHSPSNMST--HPLLPSDSHSLSEVLQTDSLGRLQGLDISSKGSSH  379

Query  334  VK  339
            VK
Sbjct  380  VK  381



>ref|XP_009374449.1| PREDICTED: transcription factor RF2b-like [Pyrus x bretschneideri]
Length=349

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            Q+MEQQAQLRDALNEALK EVERL+IATGE+ + SD+++LGM  +PYN  SA+F  Q   
Sbjct  215  QSMEQQAQLRDALNEALKKEVERLKIATGEMMSASDSFNLGMHQMPYNHPSAYFPLQQQP  274

Query  178  GPSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            GP+  Q + +PQF+  Q S    H         L+D +Q  P+G+ QGLDI S+G+ +VK
Sbjct  275  GPASHQTMHLPQFNHSQSSMPPQHLHQSNSRTHLSDMLQNGPVGQLQGLDIGSKGAPLVK  334



>ref|XP_004296017.1| PREDICTED: transcription factor RF2b-like [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 9/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY--NQSAFF--SHQ  168
            QAMEQQAQLRDALNEALK EVERL+ ATGE+   S++++LGMQ +PY  NQSA+F  + Q
Sbjct  292  QAMEQQAQLRDALNEALKKEVERLKFATGEMMNHSESFNLGMQQMPYNNNQSAYFPITQQ  351

Query  169  PPSGPSDSQNIQIPQFHALQPST-STPHHP---MLADTVQQDPLGRFQGLDISSRGSHIV  336
             P GP+  QN+Q+P F+  Q S  S  H P    L+D +Q  P+G+ QGLDIS++  H+V
Sbjct  352  QP-GPAGHQNMQMPPFNHSQSSMPSNLHQPNSHTLSDIMQNGPVGQLQGLDISNKMPHLV  410

Query  337  K  339
            K
Sbjct  411  K  411



>ref|XP_009354848.1| PREDICTED: transcription factor RF2b-like [Pyrus x bretschneideri]
Length=438

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            Q+MEQQAQ RDALNEALK EVERL+IATGE+ +PSD+++LGM  +PYN  SA+F  Q   
Sbjct  304  QSMEQQAQSRDALNEALKKEVERLKIATGEMMSPSDSFNLGMHQMPYNHPSAYFPLQQQP  363

Query  178  GPSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIV  336
            GP+  Q +Q+ QF+  Q S  T H      H  L+D +Q  P+ + QGLDI S+G+ +V
Sbjct  364  GPASHQTMQLRQFNHSQSSMPTQHLHQSNSHTRLSDMLQNGPVSQLQGLDIGSKGAPVV  422



>gb|KEH34480.1| bZIP transcription factor [Medicago truncatula]
Length=377

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 13/122 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q+MEQQA LRDALN+AL  EV+RL+IATGE   PS++Y++GM  + +  S FFS    SG
Sbjct  245  QSMEQQAHLRDALNDALMKEVDRLKIATGEAMNPSESYNMGMHQLQFAGSNFFSMPQHSG  304

Query  181  PSDSQNIQIPQF---------HALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHI  333
            PS  QNIQ PQF         + LQ + S  H   ++D +Q D LGR QGLDISS+GS +
Sbjct  305  PSGHQNIQFPQFGHSPSDMPNYQLQQTNS--HQ--ISDMLQNDQLGRLQGLDISSKGSTL  360

Query  334  VK  339
            VK
Sbjct  361  VK  362



>ref|XP_008344762.1| PREDICTED: transcription factor RF2b-like [Malus domestica]
Length=434

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 7/120 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQ-SAFFSHQPPS  177
            Q+MEQQAQ RD LNEALK EVERL+IATGE  +PSD+++LGM  +PYN  SA+F  Q   
Sbjct  300  QSMEQQAQSRDXLNEALKKEVERLKIATGERMSPSDSFNLGMHQMPYNHPSAYFPLQQQP  359

Query  178  GPSDSQNIQIPQFHALQPSTSTPH------HPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            GP+  Q +Q+ QF+  Q +  T H      H +L+D +Q  P+G+ QGLDI S+G+ I K
Sbjct  360  GPASHQTMQLRQFNHSQSNMPTQHLHQSNSHTLLSDMLQNGPVGQLQGLDIGSKGAPIGK  419



>ref|XP_006651350.1| PREDICTED: transcription factor RF2b-like, partial [Oryza brachyantha]
Length=264

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 10/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE+   ++ YS+G+QH+PYN + FF     S 
Sbjct  135  QAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYN-TPFFPLSQQSA  193

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPM-----LADTVQQDPLGRFQGLDISSRGSHIVK  339
            P  +   Q+ PQF A  P ++  +H +     L D +QQDPLGR QGLDI S+G  +VK
Sbjct  194  PRQNGGAQLPPQFQA--PRSNMANHILSHPNGLQDIMQQDPLGRLQGLDI-SKGPLVVK  249



>ref|XP_007146883.1| hypothetical protein PHAVU_006G078500g [Phaseolus vulgaris]
 gb|ESW18877.1| hypothetical protein PHAVU_006G078500g [Phaseolus vulgaris]
Length=416

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 10/121 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGE-IAAPSDAYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALN+AL  EVERL+IATGE +   S+++++GM  +P+  S FFS  P S
Sbjct  283  QAMEQQAQLRDALNDALMKEVERLKIATGEALNNHSESFNIGMHQMPFAGSNFFSIPPHS  342

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIV  336
            GP   QN+Q+P F   Q  +S P H +       ++D +Q D LGR QGLDISS GS  V
Sbjct  343  GPLSHQNMQLPPFGLSQ--SSMPAHQLHQTNSHQISDVLQNDQLGRLQGLDISSNGSSFV  400

Query  337  K  339
            K
Sbjct  401  K  401



>ref|XP_010685977.1| PREDICTED: transcription factor RF2b-like [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK+EVERLR+ATGE+  PS++++LGM  + YN S F+S  P   
Sbjct  252  QAMEQQAQLRDALNEALKHEVERLRMATGEMMEPSESFNLGMPSMQYNPSVFYS-VPQQQ  310

Query  181  PSDSQNIQIPQFHALQPS----TSTPHHPMLA----DTVQQDPLGRFQGLDISSRGSHIV  336
                QN+Q+P +H  Q +     +   H M +    + +  DPLGR QGLDISSRGS +V
Sbjct  311  QQQQQNMQLPSYHQSQGNMHHMNNIHSHNMNSQNPLEFMPNDPLGRLQGLDISSRGSPVV  370

Query  337  K  339
            K
Sbjct  371  K  371



>ref|XP_010938010.1| PREDICTED: transcription factor RF2b-like isoform X1 [Elaeis 
guineensis]
Length=386

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 77/117 (66%), Gaps = 7/117 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV+RL+IATGEI+ P + Y  G+QH+ Y  SA F       
Sbjct  258  QAMEQQAQLRDALNEALKQEVQRLKIATGEISNPGETYDTGLQHVRY--SAPFYVLSQQQ  315

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHP---MLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P   Q IQ+ PQ H  QPS S         L D +QQDPLGR QGLDI S+GS IVK
Sbjct  316  PVHHQGIQLQPQSHQSQPSVSNHQFARPTALPDRMQQDPLGRLQGLDI-SKGSLIVK  371



>ref|XP_004158959.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus]
Length=135

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 12/120 (10%)
 Frame = +1

Query  7    MEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSGPS  186
            MEQQA LRDALNEALK EVERL+IATGE+   +D+Y+ GM  + Y QS+ FSHQP  G  
Sbjct  1    MEQQAHLRDALNEALKKEVERLKIATGEVMTATDSYNFGMPQVSYPQSS-FSHQPQPGRH  59

Query  187  DSQ--NIQIPQFHALQPSTSTPHHPM---------LADTVQQDPLGRFQGLDISSRGSHI  333
            + Q   +Q PQ      +   PH  +         L +  QQDP+ R QGLDI SRG+ I
Sbjct  60   NPQRMTMQRPQVQPFHSNLPNPHQALFVASHQPHALTEMFQQDPITRLQGLDIGSRGTEI  119



>gb|ADN33710.1| b-zip DNA binding protein [Cucumis melo subsp. melo]
Length=335

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 74/122 (61%), Gaps = 12/122 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALNEALK EVERL+IATGE+   +D+Y+ GM  + Y QS  FSHQP  G
Sbjct  199  QAMEQQAHLRDALNEALKKEVERLKIATGEVMTATDSYNFGMPQVSYPQSC-FSHQPQPG  257

Query  181  PSDSQNI--QIPQFHALQPSTSTPHHPM---------LADTVQQDPLGRFQGLDISSRGS  327
              + Q +  Q PQ      +   PH  +         L +  QQDP+ R QGLDI SRG+
Sbjct  258  QHNPQRMTTQRPQVQPFHSNLPNPHQALFVASHQPHALTEMFQQDPITRLQGLDIGSRGT  317

Query  328  HI  333
             I
Sbjct  318  EI  319



>ref|XP_008456950.1| PREDICTED: transcription factor RF2b [Cucumis melo]
Length=344

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 74/122 (61%), Gaps = 12/122 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALNEALK EVERL+IATGE+   +D+Y+ GM  + Y QS  FSHQP  G
Sbjct  208  QAMEQQAHLRDALNEALKKEVERLKIATGEVMTATDSYNFGMPQVSYPQSC-FSHQPQPG  266

Query  181  PSDSQNI--QIPQFHALQPSTSTPHHPM---------LADTVQQDPLGRFQGLDISSRGS  327
              + Q +  Q PQ      +   PH  +         L +  QQDP+ R QGLDI SRG+
Sbjct  267  QHNPQRMTTQRPQVQPFHSNLPNPHQALFVASHQPHALTEMFQQDPITRLQGLDIGSRGT  326

Query  328  HI  333
             I
Sbjct  327  EI  328



>ref|XP_004146436.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus]
 gb|KGN50733.1| hypothetical protein Csa_5G221950 [Cucumis sativus]
Length=344

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 75/122 (61%), Gaps = 12/122 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALNEALK EVERL+IATGE+   +D+Y+ GM  + Y QS+ FSHQP  G
Sbjct  208  QAMEQQAHLRDALNEALKKEVERLKIATGEVMTATDSYNFGMPQVSYPQSS-FSHQPQPG  266

Query  181  PSDSQ--NIQIPQFHALQPSTSTPHHPM---------LADTVQQDPLGRFQGLDISSRGS  327
              + Q   +Q PQ      +   PH  +         L +  QQDP+ R QGLDI SRG+
Sbjct  267  RHNPQRMTMQRPQVQPFHSNLPNPHQALFVASHQPHALTEMFQQDPITRLQGLDIGSRGT  326

Query  328  HI  333
             I
Sbjct  327  EI  328



>ref|XP_003616032.1| Transcription factor RF2b [Medicago truncatula]
 gb|AES98990.1| bZIP transcription factor [Medicago truncatula]
Length=358

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALN+ALK EVERL++ATG+I + +++++LGM  + + +S  ++  PP G
Sbjct  227  QAMEQQAHLRDALNDALKKEVERLKVATGDIMSHTESFNLGMHQMQFTESD-YAPIPPQG  285

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
            PS  +NI++P F    PS S P H +        ++ +Q D +GRFQGLDISS+G+ +VK
Sbjct  286  PSGHRNIRLPLF-GHSPS-SMPSHQLHQTNSHSYSELLQNDQIGRFQGLDISSKGTAVVK  343



>gb|EAZ26838.1| hypothetical protein OsJ_10754 [Oryza sativa Japonica Group]
Length=274

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE+   ++ YS+G+QH+PYN + FF     + 
Sbjct  145  QAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYN-TPFFPLAQHNA  203

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPM-----LADTVQQDPLGRFQGLDISSRGSHIVK  339
               +   Q+ PQF    P  + P+H +     L D +QQDPLGR QGLDI S+G  +VK
Sbjct  204  ARQNGGTQLPPQFQP--PRPNVPNHMLSHPNGLQDIMQQDPLGRLQGLDI-SKGPLVVK  259



>sp|Q6S4P4.1|RF2B_ORYSJ RecName: Full=Transcription factor RF2b [Oryza sativa Japonica 
Group]
 gb|AAR28765.1| bZIP transcription factor RF2b [Oryza sativa Japonica Group]
Length=329

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE+   ++ YS+G+QH+PYN + FF     + 
Sbjct  200  QAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYN-TPFFPLAQHNA  258

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPM-----LADTVQQDPLGRFQGLDISSRGSHIVK  339
               +   Q+ PQF    P  + P+H +     L D +QQDPLGR QGLDI S+G  +VK
Sbjct  259  ARQNGGTQLPPQFQP--PRPNVPNHMLSHPNGLQDIMQQDPLGRLQGLDI-SKGPLVVK  314



>ref|NP_001050039.1| Os03g0336200 [Oryza sativa Japonica Group]
 gb|ABF95818.1| Transcription factor RF2b, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11953.1| Os03g0336200 [Oryza sativa Japonica Group]
 dbj|BAG91971.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE+   ++ YS+G+QH+PYN + FF     + 
Sbjct  200  QAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYN-TPFFPLAQHNA  258

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPM-----LADTVQQDPLGRFQGLDISSRGSHIVK  339
               +   Q+ PQF    P  + P+H +     L D +QQDPLGR QGLDI S+G  +VK
Sbjct  259  ARQNGGTQLPPQFQP--PRPNVPNHMLSHPNGLQDIMQQDPLGRLQGLDI-SKGPLVVK  314



>gb|EMS51355.1| hypothetical protein TRIUR3_04237 [Triticum urartu]
Length=221

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN  LK E+ERL+IATGE+  P +AY+ GM H+PYN S FF       
Sbjct  82   QAMEQQAQLRDALNNTLKQELERLKIATGEMTKPDEAYNTGMHHVPYNPS-FFQLSEQHT  140

Query  181  PSDSQNI-QIP-QFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIV  336
            P    ++ Q+P QF    P  + P H ML+      D +QQD LGRFQGLDI  +GS  V
Sbjct  141  PQHHSSVHQLPSQFQP--PHPNVPSHQMLSHPNTFPDMMQQDSLGRFQGLDI-GKGSVAV  197

Query  337  K  339
            K
Sbjct  198  K  198



>gb|EMT28167.1| Transcription factor RF2b [Aegilops tauschii]
Length=211

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 79/125 (63%), Gaps = 21/125 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL++ATGE++  SDAYS+G+QH+ YN S+FF       
Sbjct  81   QAMEQQAQLRDALNDALKQEVERLKMATGEMSNSSDAYSVGLQHVLYN-SSFF-------  132

Query  181  PSDSQNIQIPQFHA------LQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRG  324
            P   QN    Q  A        P  + P+H M      L+D +QQD L R QGLDI S+G
Sbjct  133  PQSQQNTAQHQGGARFPPPFHPPHPNVPNHQMLSHPNTLSDIMQQDHLARLQGLDI-SKG  191

Query  325  SHIVK  339
              +VK
Sbjct  192  HPVVK  196



>ref|XP_010658179.1| PREDICTED: transcription factor RF2b isoform X2 [Vitis vinifera]
Length=310

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI   SDAY+LGM H+PY QS+FFSHQ   G
Sbjct  224  QAMEQQAQLRDALNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPG  283

Query  181  PS  186
            P+
Sbjct  284  PT  285



>ref|XP_002463392.1| hypothetical protein SORBIDRAFT_02g042990 [Sorghum bicolor]
 gb|EER99913.1| hypothetical protein SORBIDRAFT_02g042990 [Sorghum bicolor]
Length=374

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE++  ++ +++GMQHI Y+ S FF       
Sbjct  236  QAMEQQAQLRDALNDALKQEVERLKIATGEMSKSNEQFNMGMQHISYSPS-FFQLSEQHT  294

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                 NIQ+P  H  QP  + P H M      L+D +QQD LGR QGLDI  +GS  VK
Sbjct  295  VQQHGNIQLPH-HFQQPPPNVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI-GKGSMAVK  351



>ref|XP_006658967.1| PREDICTED: transcription factor RF2b-like, partial [Oryza brachyantha]
Length=281

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 74/119 (62%), Gaps = 8/119 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+   ++AY+ GMQ +PYN S+FF       
Sbjct  142  QAMEQQAQLRDALNDALKQEVERLKIATGEMTKSNEAYNTGMQQVPYN-SSFFQLSEQHT  200

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                  +Q  Q    QP  S P H M      L+D +QQD LGR QGLDI  +G   VK
Sbjct  201  VQHHSGVQQLQHQFQQPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI-GKGQVAVK  258



>ref|XP_004958698.1| PREDICTED: transcription factor RF2b-like [Setaria italica]
Length=371

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 9/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALN+ALK EVERL+IATGE++  ++ Y++GMQHI Y+ S FF       
Sbjct  233  QAMEQQAHLRDALNDALKQEVERLKIATGEMSKSNEPYNMGMQHITYSPS-FFQLSEQHA  291

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                 NIQ+P  H  QP  S P H M      L+D +QQD LGR QGLDI  +GS  VK
Sbjct  292  VQHHGNIQLPP-HFQQPPPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI-GKGSVAVK  348



>gb|EMT03280.1| Transcription factor RF2b [Aegilops tauschii]
Length=324

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN  LK E+ERL+IATGE+  P +AY+ GM H+PYN S FF       
Sbjct  117  QAMEQQAQLRDALNNTLKQELERLKIATGEMTKPDEAYNTGMHHVPYNPS-FFQLSEQHT  175

Query  181  PSDSQNI-QIP-QFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIV  336
            P    ++ Q+P QF    P  + P H ML+      D +QQD LGRFQGLDI  +GS  V
Sbjct  176  PQHHSSVHQLPSQFQP--PHPNVPSHQMLSHPNTFPDMMQQDSLGRFQGLDI-GKGSVAV  232

Query  337  K  339
            K
Sbjct  233  K  233



>dbj|BAC84100.1| putative transcription activator RF2a [Oryza sativa Japonica 
Group]
Length=288

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 73/112 (65%), Gaps = 11/112 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+A  +DAY+ GMQ +PY+ S FF       
Sbjct  149  QAMEQQAQLRDALNDALKQEVERLKIATGEMAKSNDAYNTGMQQVPYSPS-FFQLSDQHA  207

Query  181  PSDSQNI-QIP-QFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDI  312
                  + Q+P QF   QP  S P H M      L+D +QQD LGR QGLDI
Sbjct  208  VQHHAGVQQLPHQFQ--QPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI  257



>gb|EAZ41100.1| hypothetical protein OsJ_25592 [Oryza sativa Japonica Group]
Length=278

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 24/127 (19%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+A  +DAY+ GMQ +PY+ S FF       
Sbjct  141  QAMEQQAQLRDALNDALKQEVERLKIATGEMAKSNDAYNTGMQQVPYSPS-FFQL-----  194

Query  181  PSDSQNI-------QIP-QFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISS  318
             SD   +       Q+P QF   QP  S P H M      L+D +QQD LGR QGLDI  
Sbjct  195  -SDQHAVQHHAGVQQLPHQFQ--QPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI-G  250

Query  319  RGSHIVK  339
            +G   VK
Sbjct  251  KGPVAVK  257



>gb|AAV85851.1| AT-rich element binding factor 1 [Pisum sativum]
Length=372

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 79/123 (64%), Gaps = 13/123 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LRDALN+ALK EVERL++ATG+I + +++++LGM  +P+ +S +    P SG
Sbjct  238  QAMEQQAHLRDALNDALKKEVERLKVATGDIRSHTESFNLGMHQMPFTESNYLPISPQSG  297

Query  181  PSDSQNIQIPQF-HA---------LQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSH  330
                +N Q+P F H+          QP+    H    A  +Q   +GRFQGLDISS+G+ 
Sbjct  298  HPGHRNTQLPLFGHSPILAWQLINWQPNKILIHFQNYAKWIQ---IGRFQGLDISSKGTT  354

Query  331  IVK  339
            IVK
Sbjct  355  IVK  357



>ref|NP_001060641.1| Os07g0679500 [Oryza sativa Japonica Group]
 dbj|BAF22555.1| Os07g0679500, partial [Oryza sativa Japonica Group]
Length=330

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 73/112 (65%), Gaps = 11/112 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+A  +DAY+ GMQ +PY+ S FF       
Sbjct  191  QAMEQQAQLRDALNDALKQEVERLKIATGEMAKSNDAYNTGMQQVPYSPS-FFQLSDQHA  249

Query  181  PSDSQNI-QIP-QFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDI  312
                  + Q+P QF   QP  S P H M      L+D +QQD LGR QGLDI
Sbjct  250  VQHHAGVQQLPHQFQ--QPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI  299



>gb|EAZ05151.1| hypothetical protein OsI_27345 [Oryza sativa Indica Group]
Length=336

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 24/127 (19%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+A  +DAY+ GMQ +PY+ S FF       
Sbjct  199  QAMEQQAQLRDALNDALKQEVERLKIATGEMAKSNDAYNTGMQQVPYSPS-FFQL-----  252

Query  181  PSDSQNI-------QIP-QFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISS  318
             SD   +       Q+P QF   QP  S P H M      L+D +QQD LGR QGLDI  
Sbjct  253  -SDQHAVQHHAGVQQLPHQFQ--QPHPSVPSHQMLSHPNSLSDMMQQDSLGRLQGLDI-G  308

Query  319  RGSHIVK  339
            +G   VK
Sbjct  309  KGPVAVK  315



>dbj|BAK06096.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 76/121 (63%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAME QAQLRDALN  LK E+ERL+IATGE+  P +AY+ GM H+PYN S FF       
Sbjct  233  QAMELQAQLRDALNNTLKQELERLKIATGEMTKPDEAYNTGMHHVPYNPS-FFQLSEQHA  291

Query  181  PSDSQNI-QIP-QFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIV  336
            P    ++ Q+P QF    P  + P H ML+      D +QQD LGRFQGLDI  +GS  V
Sbjct  292  PQHHSSVHQLPSQFQP--PHPNVPSHQMLSHPNTFPDMMQQDSLGRFQGLDI-GKGSAAV  348

Query  337  K  339
            K
Sbjct  349  K  349



>tpg|DAA64130.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=138

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 10/118 (8%)
 Frame = +1

Query  7    MEQQAQLRDALNEALKNEVERLRIATGEIAAPSDA-YSLGMQHIPYNQSAFFSHQPPSGP  183
            MEQQAQLRDALN+AL+ EVERL+IATGE++  ++  +++GMQH+ Y+ S FF        
Sbjct  1    MEQQAQLRDALNDALRQEVERLKIATGEMSKSNNEHFNMGMQHVSYSPS-FFQLSEQHTV  59

Query  184  SDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                NIQ+P  H  QP  + P H M      L++ VQQD LGR QGLDI  +GS  VK
Sbjct  60   QQHGNIQLPH-HFQQPPLNVPSHQMLSHPNSLSNMVQQDSLGRLQGLDI-GKGSMAVK  115



>ref|XP_010539313.1| PREDICTED: transcription factor RF2b-like [Tarenaya hassleriana]
Length=352

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 79/125 (63%), Gaps = 29/125 (23%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA+LRDALNEALK EV+RL+ ATGE++  +DAY+LGM      +S     QPP  
Sbjct  221  QAMEQQAKLRDALNEALKKEVDRLKFATGEMSH-ADAYNLGMA-----RSCVQYPQPP--  272

Query  181  PSDSQNIQI-PQFHALQPSTST---PHHPML-------------ADTVQQDPLGRFQGLD  309
                QN+Q+ PQF+  QP+ +T    HHP L             +D +QQDPLGR QGLD
Sbjct  273  ----QNLQMAPQFYVFQPNNTTSPSAHHPALVTASGQSPHSNSFSDAMQQDPLGRLQGLD  328

Query  310  ISSRG  324
            ISS G
Sbjct  329  ISSCG  333



>dbj|BAK00487.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 79/125 (63%), Gaps = 21/125 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL++ATGE++  SDAYS+G+QH+ YN S+FF       
Sbjct  225  QAMEQQAQLRDALNDALKQEVERLKMATGEMSNSSDAYSMGLQHVLYN-SSFF-------  276

Query  181  PSDSQNIQIPQFHA------LQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRG  324
            P   QN    Q  A        P  + P+H M      L+D +QQD L R QGLDI S+G
Sbjct  277  PQSQQNTAQHQGGARFPPPFHPPHPNVPNHQMLSHPNTLSDIMQQDHLARLQGLDI-SKG  335

Query  325  SHIVK  339
              +VK
Sbjct  336  HPVVK  340



>ref|XP_004984459.1| PREDICTED: transcription factor RF2b-like [Setaria italica]
Length=353

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 73/119 (61%), Gaps = 9/119 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE    S+ Y++  QH+PYN S F   Q  + 
Sbjct  223  QAMEQQAQLRDALNDALKQELERLKLATGETTNTSETYNMRFQHVPYNSSFFLLSQQNTA  282

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIVK  339
                     P FH   P  + P+H ML+      D +QQD LGR QGLDI  +G  +VK
Sbjct  283  SHPGSAQLAPPFHP--PHPNVPNHQMLSHPHTLPDIMQQDSLGRLQGLDI-GKGPLVVK  338



>ref|XP_003557964.1| PREDICTED: transcription factor RF2b [Brachypodium distachyon]
Length=358

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 21/125 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL++ATGE++  +D YS+G+QH+ YN S+FF       
Sbjct  228  QAMEQQAQLRDALNDALKQEVERLKMATGEMSNSNDTYSMGLQHVLYN-SSFF-------  279

Query  181  PSDSQNIQIPQFHA------LQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRG  324
            P   QN    Q  A        P  + P+H M      L+D +QQD L R QGLDI S+G
Sbjct  280  PQSQQNTSQHQGGARFPPPFHPPHPNVPNHQMLSHPNTLSDVMQQDHLARLQGLDI-SKG  338

Query  325  SHIVK  339
              +VK
Sbjct  339  HPVVK  343



>ref|NP_001266619.1| transcription factor RF2b [Zea mays]
 gb|ACG36988.1| transcription factor RF2b [Zea mays]
Length=374

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDA-YSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALN+AL+ EVERL+IATGE++  ++  +++GMQH+ Y+ S FF      
Sbjct  235  QAMEQQAQLRDALNDALRQEVERLKIATGEMSKSNNEHFNMGMQHVSYSPS-FFQLSEQH  293

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                  NIQ+P  H  QP  + P H M      L++ VQQD LGR QGLDI  +GS  VK
Sbjct  294  TMQQHGNIQLPH-HFQQPPLTVPSHQMLSHPNSLSNMVQQDSLGRLQGLDI-GKGSMAVK  351



>ref|XP_003523277.1| PREDICTED: transcription factor RF2b [Glycine max]
Length=296

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 9/112 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA L DALNEALK EV+ L+IATGEI    +A+ LGM  + Y+Q+ FFSHQ   G
Sbjct  162  QAMEQQANLCDALNEALKKEVDGLKIATGEIVM-HNAHGLGMHPLTYSQAPFFSHQSQHG  220

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM--------LADTVQQDPLGRFQGLDI  312
             S+ Q +Q+PQ H+L  +  T   P+        L++ +  + +G+FQGLDI
Sbjct  221  QSELQAMQMPQLHSLSSNVPTSDEPLFDLDIPYDLSEMLSSESIGQFQGLDI  272



>ref|NP_001141404.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF86319.1| unknown [Zea mays]
 tpg|DAA64131.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05411.1| bZIP transcription factor, partial [Zea mays]
Length=374

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDA-YSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALN+AL+ EVERL+IATGE++  ++  +++GMQH+ Y+ S FF      
Sbjct  235  QAMEQQAQLRDALNDALRQEVERLKIATGEMSKSNNEHFNMGMQHVSYSPS-FFQLSEQH  293

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM------LADTVQQDPLGRFQGLDISSRGSHIVK  339
                  NIQ+P  H  QP  + P H M      L++ VQQD LGR QGLDI  +GS  VK
Sbjct  294  TVQQHGNIQLPH-HFQQPPLNVPSHQMLSHPNSLSNMVQQDSLGRLQGLDI-GKGSMAVK  351



>ref|XP_003562448.1| PREDICTED: transcription factor RF2b-like [Brachypodium distachyon]
Length=351

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 73/120 (61%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS  177
            QAMEQQAQLRDALN+ALK EVERLRIATGE    ++AY  GM H+PY+ S F  S Q   
Sbjct  212  QAMEQQAQLRDALNDALKQEVERLRIATGETTKSNEAYDRGMHHVPYSPSFFQLSEQHSV  271

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIVK  339
                S +   PQF    P  S P H M +      D +QQD LGR QGLDI  +GS  VK
Sbjct  272  QHRASVHQLPPQFQPPHP--SAPGHQMASHPNTFPDMMQQDSLGRLQGLDI-GKGSVPVK  328



>ref|XP_010505811.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=369

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 83/148 (56%), Gaps = 44/148 (30%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQP---  171
            Q MEQQA+LRDALNE LK EVERL+ ATGE+ +P+DAY+LGM H+ Y       HQP   
Sbjct  216  QVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQ------HQPQQS  268

Query  172  ----PSGPSDSQNIQ--IPQFHALQPSTSTPH-----------HPML-------------  261
                    +D+QN+Q    QFH  QP+ +  H           H ++             
Sbjct  269  YYQHHQQQTDAQNLQQMTHQFHLFQPNNNQNHNTSSRQNPPTGHQLMHHATSNAAPAQSH  328

Query  262  --ADTVQQDPLGRFQGLDISS--RGSHI  333
              ++T+Q+DPLGR QGLDISS  RGS+ 
Sbjct  329  SYSETMQEDPLGRLQGLDISSCGRGSNF  356



>ref|XP_010554718.1| PREDICTED: transcription factor RF2b-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010554719.1| PREDICTED: transcription factor RF2b-like isoform X4 [Tarenaya 
hassleriana]
Length=407

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 80/137 (58%), Gaps = 31/137 (23%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLG--MQHIPYNQSAFFSHQPP  174
            QAMEQQA+LRDALNEALK EVERL+ ATGE++  SDAY+LG  M  + Y QS FF  QP 
Sbjct  254  QAMEQQAKLRDALNEALKKEVERLKSATGEMSR-SDAYNLGIAMGCMQYPQS-FFQRQPQ  311

Query  175  SGPSDSQNIQI-PQFHALQPSTSTP----------------HHPML----------ADTV  273
               SD+ N+++ PQF   QP+   P                H PML          ++ +
Sbjct  312  ESQSDAHNLRMPPQFLLFQPNNRMPNSNIITSSSSRPLPSAHQPMLVTASGQSHSFSEAM  371

Query  274  QQDPLGRFQGLDISSRG  324
            +QDPLGR + LDI S G
Sbjct  372  KQDPLGRLEDLDIGSCG  388



>ref|NP_001183764.1| uncharacterized protein LOC100502357 [Zea mays]
 gb|ACR38247.1| unknown [Zea mays]
Length=362

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 10/116 (9%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK EVERL+IATGE+   ++ +++GMQH+ Y+  +FF       
Sbjct  231  QAMEQQAQLRDALNDALKQEVERLKIATGEMPKSNEQFNMGMQHVSYSGPSFFHL-----  285

Query  181  PSDSQNIQIPQFHALQPSTST---PHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P    +IQ+P  H  QP  +     H   L+D  QQD LGR +GLDI  +GS  +K
Sbjct  286  PEQHVDIQLPH-HFQQPPRNVQMLSHPNSLSDMAQQDSLGRLRGLDI-GKGSMAMK  339



>ref|XP_010554715.1| PREDICTED: transcription factor RF2b-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010554716.1| PREDICTED: transcription factor RF2b-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010554717.1| PREDICTED: transcription factor RF2b-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010554720.1| PREDICTED: transcription factor RF2b-like isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 80/137 (58%), Gaps = 31/137 (23%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLG--MQHIPYNQSAFFSHQPP  174
            QAMEQQA+LRDALNEALK EVERL+ ATGE++  SDAY+LG  M  + Y QS FF  QP 
Sbjct  322  QAMEQQAKLRDALNEALKKEVERLKSATGEMSR-SDAYNLGIAMGCMQYPQS-FFQRQPQ  379

Query  175  SGPSDSQNIQI-PQFHALQPSTSTP----------------HHPML----------ADTV  273
               SD+ N+++ PQF   QP+   P                H PML          ++ +
Sbjct  380  ESQSDAHNLRMPPQFLLFQPNNRMPNSNIITSSSSRPLPSAHQPMLVTASGQSHSFSEAM  439

Query  274  QQDPLGRFQGLDISSRG  324
            +QDPLGR + LDI S G
Sbjct  440  KQDPLGRLEDLDIGSCG  456



>ref|XP_010554713.1| PREDICTED: transcription factor RF2b-like isoform X1 [Tarenaya 
hassleriana]
Length=521

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 80/137 (58%), Gaps = 31/137 (23%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLG--MQHIPYNQSAFFSHQPP  174
            QAMEQQA+LRDALNEALK EVERL+ ATGE++  SDAY+LG  M  + Y QS FF  QP 
Sbjct  368  QAMEQQAKLRDALNEALKKEVERLKSATGEMSR-SDAYNLGIAMGCMQYPQS-FFQRQPQ  425

Query  175  SGPSDSQNIQI-PQFHALQPSTSTP----------------HHPML----------ADTV  273
               SD+ N+++ PQF   QP+   P                H PML          ++ +
Sbjct  426  ESQSDAHNLRMPPQFLLFQPNNRMPNSNIITSSSSRPLPSAHQPMLVTASGQSHSFSEAM  485

Query  274  QQDPLGRFQGLDISSRG  324
            +QDPLGR + LDI S G
Sbjct  486  KQDPLGRLEDLDIGSCG  502



>ref|XP_009406876.1| PREDICTED: transcription factor RF2b-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 75/119 (63%), Gaps = 11/119 (9%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA-PSDAYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQL DALN ALK EVERL +ATGE++  PS AY+ G+QHIPY+ S   S Q   
Sbjct  248  QAMEQQAQLHDALNMALKQEVERLMLATGEVSNPPSGAYNGGLQHIPYDPSFASSQQ---  304

Query  178  GPSDSQNIQI-PQFHALQPSTSTPHHPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             P   Q IQ+ P+F   QP  S  H P     L   ++QDP+G  QGLDIS   S IVK
Sbjct  305  QPVHHQAIQLQPKFQQSQPGASCNHLPAHQNSLPAMMEQDPIGGLQGLDISK--SSIVK  361



>ref|XP_009386932.1| PREDICTED: transcription factor RF2b-like [Musa acuminata subsp. 
malaccensis]
Length=375

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAME QAQLRDAL+EALK EV+RL+IATGE++ P ++ ++G QH     S+FF+  P   
Sbjct  246  QAMELQAQLRDALSEALKQEVQRLKIATGEVSKPDESCNIG-QHSALYSSSFFT-LPQQQ  303

Query  181  PSDSQNIQI-PQFHALQPSTSTPH---HPM-LADTVQQDPLGRFQGLDISSRGSHIVK  339
            P   Q IQ  PQF  LQP     H   HP  L   +QQ PLGR QGLDI++ G+H+VK
Sbjct  304  PIHLQAIQFQPQFQHLQPGLLNQHMISHPNDLPQVMQQHPLGRLQGLDINN-GAHMVK  360



>ref|XP_010554714.1| PREDICTED: transcription factor RF2b-like isoform X2 [Tarenaya 
hassleriana]
Length=510

 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 80/137 (58%), Gaps = 31/137 (23%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLG--MQHIPYNQSAFFSHQPP  174
            QAMEQQA+LRDALNEALK EVERL+ ATGE++  SDAY+LG  M  + Y QS FF  QP 
Sbjct  357  QAMEQQAKLRDALNEALKKEVERLKSATGEMSR-SDAYNLGIAMGCMQYPQS-FFQRQPQ  414

Query  175  SGPSDSQNIQI-PQFHALQPSTSTP----------------HHPML----------ADTV  273
               SD+ N+++ PQF   QP+   P                H PML          ++ +
Sbjct  415  ESQSDAHNLRMPPQFLLFQPNNRMPNSNIITSSSSRPLPSAHQPMLVTASGQSHSFSEAM  474

Query  274  QQDPLGRFQGLDISSRG  324
            +QDPLGR + LDI S G
Sbjct  475  KQDPLGRLEDLDIGSCG  491



>ref|XP_008808308.1| PREDICTED: transcription factor RF2b-like [Phoenix dactylifera]
Length=349

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 70/117 (60%), Gaps = 7/117 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+IATGEI+   + Y +G QH+ Y  S  F   P   
Sbjct  221  QAMEQQAQLRDALNEALKQEVERLKIATGEISNLGETYKMGPQHVSY--STPFYMLPQQQ  278

Query  181  PSDSQNIQIPQFHALQPSTSTPH---HP-MLADTVQQDPLGRFQGLDISSRGSHIVK  339
                  IQ            + H   HP  L D +QQDPLGR QGLDI S+GS IVK
Sbjct  279  EVHHDGIQFQPQFQQSQPNVSNHQFAHPAALPDMMQQDPLGRLQGLDI-SKGSLIVK  334



>ref|XP_009406875.1| PREDICTED: transcription factor RF2b-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 75/119 (63%), Gaps = 11/119 (9%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA-PSDAYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQL DALN ALK EVERL +ATGE++  PS AY+ G+QHIPY+ S   S Q   
Sbjct  254  QAMEQQAQLHDALNMALKQEVERLMLATGEVSNPPSGAYNGGLQHIPYDPSFASSQQ---  310

Query  178  GPSDSQNIQI-PQFHALQPSTSTPHHPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             P   Q IQ+ P+F   QP  S  H P     L   ++QDP+G  QGLDIS   S IVK
Sbjct  311  QPVHHQAIQLQPKFQQSQPGASCNHLPAHQNSLPAMMEQDPIGGLQGLDISK--SSIVK  367



>gb|EAY89914.1| hypothetical protein OsI_11463 [Oryza sativa Indica Group]
Length=303

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 71/107 (66%), Gaps = 9/107 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL++ATGE+   ++ YS+G+QH+PYN + FF     + 
Sbjct  200  QAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYN-TPFFPLAQHNA  258

Query  181  PSDSQNIQIP-QFHALQPSTSTPHHPM-----LADTVQQDPLGRFQG  303
               +   Q+P QF    P  + P+H +     L D +QQDPLGR QG
Sbjct  259  ARQNGGTQLPAQFQP--PRPNVPNHMLSHPNGLQDIMQQDPLGRLQG  303



>ref|XP_006417873.1| hypothetical protein EUTSA_v10008146mg [Eutrema salsugineum]
 gb|ESQ36226.1| hypothetical protein EUTSA_v10008146mg [Eutrema salsugineum]
Length=335

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD+Y +GMQ I Y+ S F +  P  G
Sbjct  215  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSYDMGMQQIQYSPSTFMAIPPYHG  274

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
             ++ Q++Q+  F+ ++ S S      L +       GR QGLDISS  S +VK
Sbjct  275  STNGQDMQMHGFNPMEMSNSQSVSEFLQN-------GRLQGLDISSNSSSLVK  320



>ref|XP_010508829.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=369

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 83/147 (56%), Gaps = 43/147 (29%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQP---  171
            Q MEQQA+LRDALN+ LK EVERL+ ATGE+ +P+DAY+LGM H+ Y       HQP   
Sbjct  217  QVMEQQAKLRDALNDQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQ------HQPQQS  269

Query  172  ----PSGPSDSQNIQ--IPQFHALQP------STSTPHHP-------------------M  258
                    +D+QN+Q    QFH  QP      +TS+  +P                    
Sbjct  270  YYQHHQQQTDAQNLQQMTHQFHLFQPNNNQNQNTSSRQNPPTNHQLMHHATSNAPAQSHS  329

Query  259  LADTVQQDPLGRFQGLDISS--RGSHI  333
             ++T+Q+DPLGR QGLDISS  RGS+ 
Sbjct  330  YSETMQEDPLGRLQGLDISSCGRGSNF  356



>ref|XP_010517502.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=433

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 82/147 (56%), Gaps = 43/147 (29%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQP---  171
            Q MEQQA+LRDALNE LK EVERL+ ATGE+ +P+DAY+LGM H+ Y       HQP   
Sbjct  281  QVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQ------HQPQQS  333

Query  172  ----PSGPSDSQNIQ--IPQFHALQP------STSTPHHP-------------------M  258
                    +D+QN+Q    QFH  QP      +TS+  +P                    
Sbjct  334  YYQHHQQQTDAQNLQQMTHQFHLFQPNNNQNQNTSSRQNPPTNHQLMHHATSNAPAQSHS  393

Query  259  LADTVQQDPLGRFQGLDISS--RGSHI  333
             ++T+ +DPLGR QGLDISS  RGS+ 
Sbjct  394  YSETMHEDPLGRLQGLDISSCGRGSNF  420



>ref|XP_010931507.1| PREDICTED: transcription factor RF2b-like [Elaeis guineensis]
Length=387

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 79/120 (66%), Gaps = 13/120 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFF--SHQPP  174
            QAMEQQAQLRD LN+ LK EV RL+IATGE ++PS  YS+G+ ++ Y   +FF  S Q  
Sbjct  259  QAMEQQAQLRDVLNQTLKQEVGRLKIATGETSSPSGTYSMGLLNVSY--PSFFIPSQQQ-  315

Query  175  SGPSDSQNIQI-PQFHALQPSTST----PHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
               ++ Q IQ  PQF   QP+ S+     H+  L+D +QQ+P G+ QGLDI  +GSH+ K
Sbjct  316  --RANHQAIQSRPQFQRSQPNISSHQFLTHNHALSDVMQQEPHGKLQGLDI-RKGSHMAK  372



>ref|XP_008792225.1| PREDICTED: transcription factor RF2b [Phoenix dactylifera]
 ref|XP_008792226.1| PREDICTED: transcription factor RF2b [Phoenix dactylifera]
Length=228

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 75/120 (63%), Gaps = 13/120 (11%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFF--SHQPP  174
            QAMEQQ QLRDALNE LK EV RL+IATGE A+PS  YS+ + ++PY   +FF  SHQ  
Sbjct  100  QAMEQQTQLRDALNETLKQEVGRLKIATGEAASPSGTYSMELLNVPY--PSFFIPSHQQ-  156

Query  175  SGPSDSQNIQI-PQFHALQPSTS----TPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              P + Q IQ+ P+F   QP+ S      H    +D + QDP G+ Q LD + +GS + K
Sbjct  157  --PGNHQAIQLHPEFQQSQPNISGHQILTHCHAFSDGMWQDPHGKLQELD-TRKGSQMAK  213



>ref|NP_001152693.1| LOC100286334 [Zea mays]
 gb|ACG48999.1| transcription factor RF2b [Zea mays]
Length=343

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 76/123 (62%), Gaps = 20/123 (16%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALN+ALK E+ERL+ ATGE+   S+AY++  QH+PYN S+FF       
Sbjct  216  QAMEQQAQLRDALNDALKQELERLKHATGEMTNSSEAYNMRFQHVPYN-SSFF-------  267

Query  181  PSDSQNIQIPQFHALQ-------PSTSTPHHPM---LADTVQQDPLGRFQGLDISSRGSH  330
            P   QN   P   + Q       P  + P+H M   L D +QQ+ LGR QGLDI  +G  
Sbjct  268  PLSQQNAS-PHLGSTQLPLPFHPPHPNVPNHQMRNTLPDIMQQESLGRLQGLDI-GKGPL  325

Query  331  IVK  339
            +VK
Sbjct  326  VVK  328



>ref|XP_009387765.1| PREDICTED: transcription factor RF2b [Musa acuminata subsp. malaccensis]
Length=394

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV+RL++ATGEI+ P + Y +G+Q++ Y+ S F   Q P+ 
Sbjct  265  QAMEQQAQLRDALNEALKQEVQRLKLATGEISKPDETYDVGLQNMHYSPSFFTLPQQPA-  323

Query  181  PSDSQNIQIPQFHALQPSTSTPH----HP-MLADTVQQDPLGRFQGLDIS  315
                Q IQ+        S  + H    HP  L D  QQDPLGR QGLDI+
Sbjct  324  -VHHQAIQLQHQFQQPQSGISAHQMLIHPNNLPDVFQQDPLGRLQGLDIN  372



>gb|ACN26156.1| unknown [Zea mays]
 gb|AFU81597.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA45236.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=346

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 70/117 (60%), Gaps = 5/117 (4%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQ---  168
            QAMEQQAQLRDALN+ALK E+ERL+ ATGE+   S+AY++  QH+PYN S F  S Q   
Sbjct  216  QAMEQQAQLRDALNDALKQELERLKHATGEMTNSSEAYNMRFQHVPYNSSFFPLSQQNAS  275

Query  169  PPSGPSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
            P  G +       P    +       H   L D +QQ+ LGR QGLDI  +G  +VK
Sbjct  276  PHLGSTQLPLPFHPPHPNVPNHQMVSHRNTLPDIMQQESLGRLQGLDI-GKGPLVVK  331



>ref|NP_001130089.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF78215.1| unknown [Zea mays]
 gb|ACN27960.1| unknown [Zea mays]
 gb|AFW88454.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB05050.1| bZIP transcription factor, partial [Zea mays]
Length=353

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 9/118 (8%)
 Frame = +1

Query  4    AMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSGP  183
            AMEQQAQLRDALN+ALK E+ERL++ TGE+   S+ Y++  QHIPYN S F   Q  + P
Sbjct  224  AMEQQAQLRDALNDALKQELERLKLVTGEMTNSSETYNMRFQHIPYNSSFFPLSQQNASP  283

Query  184  SDSQNIQIPQFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIVK  339
                  Q+       P  + P+H ML+      D +QQ+ LGR QGLDI  +G  +VK
Sbjct  284  HPG-TTQL-PPPFHPPHPNVPNHQMLSHPNTLPDIMQQESLGRLQGLDI-GKGPLVVK  338



>gb|ABI34685.1| bZIP transcription factor bZIP43 [Glycine max]
Length=233

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL++ATGE+ + +D+++LGM  +P++ S F      SG
Sbjct  163  QAMEQQAQLRDALNEALKKEVERLKVATGEMMSHTDSFNLGMHLMPFSGSNFVPIPAQSG  222

Query  181  PSDSQNIQIP  210
            PS  QN+Q+P
Sbjct  223  PSGHQNMQMP  232



>ref|XP_002467902.1| hypothetical protein SORBIDRAFT_01g036120 [Sorghum bicolor]
 gb|EER94900.1| hypothetical protein SORBIDRAFT_01g036120 [Sorghum bicolor]
Length=128

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 12/118 (10%)
 Frame = +1

Query  7    MEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSGPS  186
            MEQQAQLRDALN+ALK E+ERL+ ATGE+   S+ Y++  QH+PYN S+FF   P S  +
Sbjct  1    MEQQAQLRDALNDALKQELERLKHATGEMTNSSETYNMRFQHVPYN-SSFF---PLSQQN  56

Query  187  DSQNIQIPQF-HALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIVK  339
             S ++   Q      P  + P+H ML+      D +QQ+ LGR QGLDI  +G  +VK
Sbjct  57   ASPHLGTTQLPPPYPPHPNVPNHQMLSHPNTLPDIMQQESLGRLQGLDI-GKGPLVVK  113



>ref|XP_006305297.1| hypothetical protein CARUB_v10009673mg [Capsella rubella]
 ref|XP_006305298.1| hypothetical protein CARUB_v10009673mg [Capsella rubella]
 gb|EOA38195.1| hypothetical protein CARUB_v10009673mg [Capsella rubella]
 gb|EOA38196.1| hypothetical protein CARUB_v10009673mg [Capsella rubella]
Length=336

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 8/114 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  215  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  274

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              + Q++Q+   F+ ++ S S      L +       GR QGL+ISS  S +VK
Sbjct  275  SMNGQDMQMHTSFNPMEMSNSQSVSEFLQN-------GRLQGLEISSNSSSLVK  321



>ref|XP_011006307.1| PREDICTED: transcription factor RF2b-like isoform X2 [Populus 
euphratica]
Length=320

 Score = 86.7 bits (213),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EVERL+  TGEI  P+D+Y+LG+QHI YN S   S +P  G
Sbjct  202  QAMEQQAQLRDALNEALKKEVERLKFTTGEIMTPTDSYNLGIQHISYNHSPLVSPRPRLG  261


 Score = 25.4 bits (54),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 0/56 (0%)
 Frame = +2

Query  227  SQALLLHITPCLQTQCSRILWVAFRVSISVAEALIL*RAKPLPYHQVKAAVVHSAL  394
             Q LL  I    Q  C RIL    R  IS AEAL         Y  VK AV    L
Sbjct  261  GQQLLHRIPMTCQRCCHRILSDGCRALISAAEALFWLDLNAPQYLAVKTAVFDEIL  316



>gb|KFK36932.1| hypothetical protein AALP_AA4G191400 [Arabis alpina]
Length=372

 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 81/151 (54%), Gaps = 47/151 (31%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPP--  174
            Q MEQQA+LRDALN+ LK EVERL+ ATGE+ +P+DAY+LGM H+ Y      SHQ P  
Sbjct  216  QVMEQQAKLRDALNDQLKKEVERLKFATGEV-SPADAYNLGMAHMQY------SHQQPQQ  268

Query  175  ------SGPSDSQNIQ--IPQFHALQPS----------TSTPHHPM--------------  258
                     +D+QN+Q    QFH  QP+          +S P+ P               
Sbjct  269  SFFQHHQQQTDAQNLQQMTHQFHLFQPNNNQNQNMTSPSSRPNPPTAHQLMHHATSNNSA  328

Query  259  ----LADTVQQDPLGRFQGLDISS--RGSHI  333
                 ++ + +D LGR QGLDISS  RGS+ 
Sbjct  329  QSHSFSEAMHEDHLGRLQGLDISSCGRGSNF  359



>ref|XP_010457837.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=337

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 18/120 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  214  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  273

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
              + Q++Q  Q H      ++ ++PM       ++D +Q    GR QGL+ISS  S +VK
Sbjct  274  SMNGQDMQ--QMH------TSFNNPMEMSNSQSVSDFLQN---GRLQGLEISSNSSSLVK  322



>ref|XP_009142704.1| PREDICTED: transcription factor RF2b-like [Brassica rapa]
Length=356

 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 78/140 (56%), Gaps = 30/140 (21%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY---------NQSA  153
            Q MEQQA+LRDALN+ LK EVERL+ ATGE++  +DAY+LGM H+ Y          QS 
Sbjct  205  QVMEQQAKLRDALNDQLKKEVERLKFATGEVSH-ADAYNLGMAHMQYSQQQQQPPQQQSF  263

Query  154  FFSHQPPSGPSDSQNIQ--IPQFHALQP----------------STSTPHHPMLADTVQQ  279
            F  H      +D+QN+Q    QFH  QP                S ++      A+ + +
Sbjct  264  FQHHHHQQQQTDAQNLQQMTHQFHLFQPNNNNNNQNLNIMHQATSNASGQSHSFAEAMNE  323

Query  280  DPLGRFQGLDISS--RGSHI  333
            DPLGR QGLDISS  RGS+ 
Sbjct  324  DPLGRLQGLDISSCGRGSNF  343



>ref|XP_002881732.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57991.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=368

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 78/147 (53%), Gaps = 43/147 (29%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQP---  171
            Q MEQQA+LRDALNE LK EVERL+ ATGE+ +P+DAY+LGM H+ Y       HQP   
Sbjct  216  QVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQ------HQPQQS  268

Query  172  ----PSGPSDSQNIQ--IPQFHAL------------QPSTSTPHHPM-------------  258
                    +D+QN+Q    QFH              + +  T H  M             
Sbjct  269  FFQHHQQQTDAQNLQQMTHQFHLFQPNNNQNPNSSSRSNPPTAHQLMHHATSNAPAQSHS  328

Query  259  LADTVQQDPLGRFQGLDISS--RGSHI  333
             ++ + +DPLGR QGLDISS  RGS+ 
Sbjct  329  YSEAMHEDPLGRLQGLDISSCGRGSNF  355



>emb|CDX79976.1| BnaA05g01800D [Brassica napus]
Length=356

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 78/140 (56%), Gaps = 30/140 (21%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY---------NQSA  153
            Q MEQQA+LRDALN+ LK EVERL+ ATGE++  +DAY+LGM H+ Y          QS 
Sbjct  205  QVMEQQAKLRDALNDQLKKEVERLKFATGEVSH-ADAYNLGMAHMQYSQQQQQPPQQQSF  263

Query  154  FFSHQPPSGPSDSQNIQ--IPQFHALQP----------------STSTPHHPMLADTVQQ  279
            F  H      +D+QN+Q    QFH  QP                S ++      A+ + +
Sbjct  264  FQHHHHQQQQTDAQNLQQMTHQFHLFQPNNNNNNQNLNIMHQATSNASGQSHSFAEAMNE  323

Query  280  DPLGRFQGLDISS--RGSHI  333
            DPLGR QGLDISS  RGS+ 
Sbjct  324  DPLGRLQGLDISSCGRGSNF  343



>ref|XP_010486780.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=337

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 18/120 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  214  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  273

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHIVK  339
              + Q++Q  Q H      S+ ++PM       +++ +Q    GR QGL+ISS  S +VK
Sbjct  274  SMNGQDMQ--QMH------SSFNNPMEMSNSQSVSEFLQN---GRLQGLEISSNSSSLVK  322



>ref|XP_002889621.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65880.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  207  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  266

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              +  ++Q+   F+ ++ S S      L +       GR QGL ISS  S +VK
Sbjct  267  SMNVHDMQMHTSFNPMEMSNSQSVSEFLQN-------GRLQGLGISSNSSSLVK  313



>ref|NP_172170.1| basic leucine-zipper 52 [Arabidopsis thaliana]
 gb|AAL32552.1| Similar to bZIP transcription factors [Arabidopsis thaliana]
 emb|CAD12035.1| AtbZIP transcription factor [Arabidopsis thaliana]
 gb|AAN15421.1| Similar to bZIP transcription factors [Arabidopsis thaliana]
 gb|AEE28045.1| basic leucine-zipper 52 [Arabidopsis thaliana]
Length=337

 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  216  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  275

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              +  ++Q+   F+ ++ S S      ++D +Q    GR QGL+ISS  S +VK
Sbjct  276  SMNLHDMQMHSSFNPMEMSNSQS----VSDFLQN---GRMQGLEISSNSSSLVK  322



>ref|XP_006842469.1| hypothetical protein AMTR_s00077p00070990 [Amborella trichopoda]
 gb|ERN04144.1| hypothetical protein AMTR_s00077p00070990 [Amborella trichopoda]
Length=356

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 9/118 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIA-APSDAYSLGMQHIPYNQSAFFSHQPPS  177
            Q ME+QAQ+RDALNEAL+ EV+RL+IATGEI     + ++LGMQ +P N   FF   P S
Sbjct  228  QEMERQAQVRDALNEALRQEVQRLKIATGEITPNGRENFNLGMQQMPTNHPPFF---PNS  284

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHPM----LADTVQQDPLGRFQGLDISSRGSHIVK  339
             PS    +Q  QF   Q  + + HH +    L+D +QQD LG  QGLDI SR S +VK
Sbjct  285  HPSSIHPVQFQQFQPSQQPSLSNHHQLRALSLSDILQQDSLGLMQGLDI-SRSSPLVK  341



>ref|XP_010525409.1| PREDICTED: transcription factor RF2b-like [Tarenaya hassleriana]
Length=368

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 25/128 (20%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQ--HIPYNQSAFFSHQP-  171
            Q MEQ A+LRD LNE LK E++RL+  TGE     DAY+LG+    + Y QS F   QP 
Sbjct  225  QTMEQHAKLRDELNEELKKEIDRLKFVTGETHG--DAYNLGIAPGCMQYPQSFF---QPL  279

Query  172  ---PSGPSDSQNIQIP--QFHALQPSTSTP---------HHPML---ADTVQQDPLGRFQ  300
                + PS++QN+Q+   QFH  +P+   P         H P+L   ++ +Q DPLGR Q
Sbjct  280  TRAAASPSNAQNMQMAPQQFHLFRPNNGIPNSANMTASAHQPLLNSFSEAMQYDPLGRLQ  339

Query  301  GLDISSRG  324
            GLDISS G
Sbjct  340  GLDISSCG  347



>gb|AAF63137.1|AC011001_7 Similar to bZIP transcription factors [Arabidopsis thaliana]
Length=412

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  P  G
Sbjct  216  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAIPPYHG  275

Query  181  PSDSQNIQI-PQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              +  ++Q+   F+ ++ S S      ++D +Q    GR QGL+ISS  S +VK
Sbjct  276  SMNLHDMQMHSSFNPMEMSNSQS----VSDFLQN---GRMQGLEISSNSSSLVK  322



>emb|CAB06697.1| b-Zip DNA binding protein [Arabidopsis thaliana]
Length=367

 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 80/143 (56%), Gaps = 36/143 (25%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFS-----H  165
            Q MEQQA+LRDALNE LK EVERL+ ATGE+ +P+DAY+LGM H+ Y Q    S     H
Sbjct  216  QVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQQQPQQSFFQHHH  274

Query  166  QPPSGPSDSQNIQ--IPQFHALQPSTS----------TPHHPM-------------LADT  270
            Q     +D+QN+Q    QFH  QP+ +          T H  M              ++ 
Sbjct  275  QQ---QTDAQNLQQMTHQFHLFQPNNNQNQSSRTNPPTAHQLMHHATSNAPAQSHSYSEA  331

Query  271  VQQDPLGRFQGLDISS--RGSHI  333
            + +D LGR QGLDISS  RGS+ 
Sbjct  332  MHEDHLGRLQGLDISSCGRGSNF  354



>ref|NP_181594.1| bZIP transcription factor [Arabidopsis thaliana]
 gb|AAB87576.1| putative bZIP transcription factor [Arabidopsis thaliana]
 gb|AAL66966.1| putative bZIP transcription factor [Arabidopsis thaliana]
 gb|AAM20380.1| putative bZIP transcription factor [Arabidopsis thaliana]
 gb|AEC09855.1| bZIP transcription factor [Arabidopsis thaliana]
Length=367

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 80/143 (56%), Gaps = 36/143 (25%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFS-----H  165
            Q MEQQA+LRDALNE LK EVERL+ ATGE+ +P+DAY+LGM H+ Y Q    S     H
Sbjct  216  QVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQYQQQPQQSFFQHHH  274

Query  166  QPPSGPSDSQNIQ--IPQFHALQPSTS----------TPHHPM-------------LADT  270
            Q     +D+QN+Q    QFH  QP+ +          T H  M              ++ 
Sbjct  275  Q---QQTDAQNLQQMTHQFHLFQPNNNQNQSSRTNPPTAHQLMHHATSNAPAQSHSYSEA  331

Query  271  VQQDPLGRFQGLDISS--RGSHI  333
            + +D LGR QGLDISS  RGS+ 
Sbjct  332  MHEDHLGRLQGLDISSCGRGSNF  354



>ref|XP_010475437.1| PREDICTED: transcription factor RF2b-like [Camelina sativa]
Length=349

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 21/122 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPS-  177
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ I Y+ S F +  PP  
Sbjct  225  QAMEQQAQLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQIQYSSSTFMAI-PPYH  283

Query  178  -GPSDSQNIQIPQFHALQPSTSTPHHPM-------LADTVQQDPLGRFQGLDISSRGSHI  333
             G  + Q++Q  Q H      ++ ++PM       ++D +Q    GR QGL+ISS  S +
Sbjct  284  HGSMNGQDMQ--QMH------TSFNNPMEMSNSQSVSDFLQN---GRLQGLEISSNSSSL  332

Query  334  VK  339
            VK
Sbjct  333  VK  334



>gb|KFK42999.1| hypothetical protein AALP_AA1G066300 [Arabis alpina]
Length=332

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 72/116 (62%), Gaps = 10/116 (9%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLR+ALNEAL+ EVER+++ TGE++  SD++ +GMQ I Y+ S F +  P  G
Sbjct  209  QAMEQQAQLRNALNEALRKEVERMKMETGEMSDHSDSFEMGMQQIQYSPSTFMAIPPYHG  268

Query  181  PSDSQNIQ---IPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGSHIVK  339
              + Q++Q      F+ ++ S S      L +       GR QGL+ISS  S +VK
Sbjct  269  SMNGQDMQHQMHSSFNPMEMSNSQSVSEFLQN-------GRLQGLEISSNSSSLVK  317



>emb|CDY09952.1| BnaC08g44990D [Brassica napus]
Length=328

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (62%), Gaps = 3/104 (3%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LR+ALNEAL+ E+ER++I TGEI+  SD++ +GMQ + Y+ S F +  P   
Sbjct  202  QAMEQQAHLRNALNEALRKELERMKIETGEISGNSDSFDMGMQQVQYSPSTFMAIPPYHH  261

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
             S +    + Q H   P  +  +   +++ +Q    GR QGL+I
Sbjct  262  GSINNGQDMQQMHGYNPMEAMSNSQSVSEFLQN---GRLQGLEI  302



>ref|XP_006411330.1| hypothetical protein EUTSA_v10016819mg [Eutrema salsugineum]
 gb|ESQ52783.1| hypothetical protein EUTSA_v10016819mg [Eutrema salsugineum]
Length=371

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 79/145 (54%), Gaps = 35/145 (24%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHI--PYNQSAFFSHQPP  174
            Q MEQQA+LRDALN+ LK EVERL+ ATGE+ +P+DAY+LGM H+     Q     +Q  
Sbjct  215  QVMEQQAKLRDALNDQLKKEVERLKFATGEV-SPADAYNLGMAHMQYSQQQPQQSYYQHH  273

Query  175  SGPSDSQNIQ--IPQFHALQ---------PSTSTPHHP-------------------MLA  264
               +D+QN+Q    QFH  Q          S+S+  +P                     +
Sbjct  274  QQQTDAQNLQQMTHQFHLFQPNNNQNPNITSSSSCQNPPSAHQLMHHATSNASGQSHSFS  333

Query  265  DTVQQDPLGRFQGLDISS--RGSHI  333
            + + +DPLGR QGLDISS  RGS+ 
Sbjct  334  EAMHEDPLGRLQGLDISSCGRGSNF  358



>ref|XP_009118474.1| PREDICTED: transcription factor RF2b [Brassica rapa]
Length=324

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 3/104 (3%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LR+ALNEAL+ E+ER++I TGEI+  SD++ +GMQ + Y+ S + +  P   
Sbjct  198  QAMEQQAHLRNALNEALRKELERMKIETGEISGNSDSFDMGMQQVQYSPSTYMAIPPYHH  257

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
             S +    + Q H   P  +  +   +++ +Q    GR QGL+I
Sbjct  258  GSINNGQDMQQMHGYNPMEAMSNSQSVSEFLQN---GRLQGLEI  298



>ref|XP_006296036.1| hypothetical protein CARUB_v10025182mg [Capsella rubella]
 gb|EOA28934.1| hypothetical protein CARUB_v10025182mg [Capsella rubella]
Length=368

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 76/141 (54%), Gaps = 31/141 (22%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHI-PYNQSAFFSHQPPS  177
            Q MEQQA+LRDALN+ LK EVERL+ ATGE++  +DAY+LGM H+    Q      Q   
Sbjct  216  QVMEQQAKLRDALNDQLKKEVERLKFATGEVSH-ADAYNLGMAHMQYQQQPQQSFFQHHQ  274

Query  178  GPSDSQNIQ--IPQFHAL------------QPSTSTPHHPM-------------LADTVQ  276
              +D+QN+Q    QFH              +P+  T H  M              ++ + 
Sbjct  275  QQTDAQNLQQMTHQFHLFQPNNNQNPNTSSRPNPPTAHQHMHHANSNGPAQSHSYSEAMH  334

Query  277  QDPLGRFQGLDISS--RGSHI  333
            +DPLGR QGLDISS  RGS+ 
Sbjct  335  EDPLGRLQGLDISSCGRGSNF  355



>gb|AHZ96958.1| bZIP transcription factor 14, partial [Saccharum hybrid cultivar 
CoC 671]
Length=65

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF  156
            QAMEQQAQLRDALN+ALK ++ERL+ ATGE+   S+ Y++  QH+PYN S F
Sbjct  1    QAMEQQAQLRDALNDALKQDLERLKHATGEMTNSSETYNMRFQHVPYNSSFF  52



>emb|CDY23889.1| BnaC04g01480D [Brassica napus]
Length=355

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 75/140 (54%), Gaps = 30/140 (21%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY---------NQSA  153
            Q MEQQA+LRDALNE LK EVERL+ ATGE++  +DAY LGM H+ Y          QS 
Sbjct  204  QVMEQQAKLRDALNEQLKEEVERLKFATGEVSH-ADAYDLGMAHMQYSQQQQQPPQQQSF  262

Query  154  FFSHQPPSGPSDSQNIQ--IPQFHALQ----------------PSTSTPHHPMLADTVQQ  279
            F  H      +D+QN+Q    QFH  Q                 S ++      A+ + +
Sbjct  263  FQHHHHQQQQTDAQNLQQMTHQFHLFQPNNNNNNQNPNIMHQATSNASGQSHSFAEAMSE  322

Query  280  DPLGRFQGLDISS--RGSHI  333
            DP GR QGLDISS  RGS+ 
Sbjct  323  DPPGRLQGLDISSCGRGSNF  342



>emb|CDX86512.1| BnaC08g01910D [Brassica napus]
Length=318

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 72/119 (61%), Gaps = 17/119 (14%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-----FSH  165
            QAMEQQA LR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ + Y+ S F     + H
Sbjct  196  QAMEQQAHLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQVQYSPSTFMAIPPYHH  255

Query  166  QPPSGPSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRG-SHIVK  339
               +   D Q  Q+  F+ +  S S      +++ +Q    GR QGL+ISS   S +VK
Sbjct  256  GSINNGQDMQ--QMRGFNQMSNSQS------VSEFLQN---GRLQGLEISSNNSSSLVK  303



>emb|CDY06231.1| BnaA09g49720D [Brassica napus]
Length=325

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 3/104 (3%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQA LR+ALNEAL+ E+ER++I TGEI+  SD++ +GMQ + Y+ S + +  P   
Sbjct  199  QAMEQQAHLRNALNEALRKELERMKIETGEISGNSDSFDMGMQQVQYSPSTYMAIPPYHH  258

Query  181  PSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
             + +    + Q H   P  +  +   +++ +Q    GR QGL+I
Sbjct  259  GAINNGQDMQQMHGYNPMEAMSNSQSVSEFLQN---GRLQGLEI  299



>ref|XP_009110972.1| PREDICTED: transcription factor RF2b-like [Brassica rapa]
Length=320

 Score = 75.9 bits (185),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 16/114 (14%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-----FSH  165
            QAMEQQA LR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ + Y+ S F     + H
Sbjct  198  QAMEQQAHLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQVQYSPSTFMAIPPYHH  257

Query  166  QPPSGPSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRGS  327
               +   D Q  Q+  F+ +  S S      +++ +Q    GR QGL+ISS  S
Sbjct  258  GSINNGQDMQ--QMRGFNQMSNSQS------VSEFLQN---GRLQGLEISSNNS  300



>emb|CDY15590.1| BnaA08g28740D [Brassica napus]
Length=321

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 72/119 (61%), Gaps = 17/119 (14%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-----FSH  165
            QAMEQQA LR+ALNEAL+ EVER+++ TGEI+  SD++ +GMQ + Y+ S F     + H
Sbjct  199  QAMEQQAHLRNALNEALRKEVERMKMETGEISGNSDSFDMGMQQVQYSPSTFMAIPPYHH  258

Query  166  QPPSGPSDSQNIQIPQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLDISSRG-SHIVK  339
               +   D Q  Q+  F+ +  S S      +++ +Q    GR QGL+ISS   S +VK
Sbjct  259  GSINNGQDMQ--QMRGFNQMSNSQS------VSEFLQN---GRLQGLEISSNNSSSLVK  306



>ref|XP_006581713.1| PREDICTED: transcription factor RF2b-like isoform X1 [Glycine 
max]
Length=106

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQA L DAL    KNEV+RL+IATGEI   +DAY LG+  + Y+Q+ FFSHQ   G
Sbjct  41   QGMEQQANLCDAL----KNEVDRLKIATGEIVMHTDAYGLGLHPLTYSQAPFFSHQSQHG  96

Query  181  PSDSQNIQI  207
              + Q +++
Sbjct  97   QRELQAMKM  105



>ref|XP_006581714.1| PREDICTED: transcription factor RF2b-like isoform X2 [Glycine 
max]
Length=105

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQA L DAL    KNEV+RL+IATGEI   +DAY LG+  + Y+Q+ FFSHQ   G
Sbjct  41   QGMEQQANLCDAL----KNEVDRLKIATGEIVMHTDAYGLGLHPLTYSQAPFFSHQSQHG  96

Query  181  PSDSQNIQI  207
              + Q +++
Sbjct  97   QRELQAMKM  105



>emb|CDY06974.1| BnaA04g23410D [Brassica napus]
Length=352

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 26/136 (19%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHI------PYNQSAFFS  162
            Q MEQQA+LRDALN+ LK EVERL+ ATGE+ + +DAY+L M H+               
Sbjct  205  QVMEQQAKLRDALNDQLKKEVERLKFATGEV-SHADAYNLQMSHMQYSQQPQQPSFFQHH  263

Query  163  HQPPSGPSDSQNIQ--IPQFHALQPSTSTP------HHPM---------LADTVQQDPLG  291
            HQ     +D+QN+Q    QFH  QP+ +        HH            A+ + +D LG
Sbjct  264  HQQQQQQTDAQNLQQMTHQFHLFQPNNNQNQNPQLMHHATSNASGQSHSFAEAMHEDHLG  323

Query  292  RFQGLDISS--RGSHI  333
            R QGLDISS  RGS+ 
Sbjct  324  RLQGLDISSCGRGSNF  339



>gb|AFW88453.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=124

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 13/110 (12%)
 Frame = +1

Query  34   ALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS-GPSDSQNIQI  207
            ALN+ALK E+ERL++ TGE+   S+ Y++  QHIPYN S F  S Q  S  P  +Q    
Sbjct  5    ALNDALKQELERLKLVTGEMTNSSETYNMRFQHIPYNSSFFPLSQQNASPHPGTTQ----  60

Query  208  PQFHALQPSTSTPHHPMLA------DTVQQDPLGRFQGLDISSRGSHIVK  339
                   P  + P+H ML+      D +QQ+ LGR QGLDI  +G  +VK
Sbjct  61   LPPPFHPPHPNVPNHQMLSHPNTLPDIMQQESLGRLQGLDI-GKGPLVVK  109



>ref|XP_009141921.1| PREDICTED: transcription factor RF2b-like [Brassica rapa]
Length=342

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 68/133 (51%), Gaps = 23/133 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQA+LRDALN+ LK EVERL+ ATGE++  +DAY+L M H+ Y+Q           
Sbjct  198  QVMEQQAKLRDALNDQLKKEVERLKFATGEVSH-ADAYNLQMSHMQYSQQPQQQSFFQHH  256

Query  181  PSDSQNIQIP-------QFHALQP-------------STSTPHHPMLADTVQQDPLGRFQ  300
                Q            QFH  QP             S S+      A+ + +D LGR Q
Sbjct  257  HQQQQQADAQNLQQMTHQFHLFQPNNNQNPQLMHHATSNSSGQSHSFAEAMHEDHLGRLQ  316

Query  301  GLDISS--RGSHI  333
            GLDISS  RGS+ 
Sbjct  317  GLDISSCGRGSNF  329



>emb|CDX93167.1| BnaC04g47290D [Brassica napus]
Length=343

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 19/128 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q MEQQA+LRDALN+ LK EVERL+ ATGE++  +DAY+L M H+ Y+Q   F  Q  + 
Sbjct  205  QVMEQQAKLRDALNDQLKKEVERLKFATGEVSH-ADAYNLQMSHMQYSQQQSFFQQQQAD  263

Query  181  PSDSQNIQIPQFHALQPSTSTP------HHPM---------LADTVQQDPLGRFQGLDIS  315
              + Q +   QFH  QP+ +        HH            A+ + +D LGR QGLDIS
Sbjct  264  AQNLQQM-THQFHLFQPNNNQNQNPQLMHHATSSASGQSHSFAEAMHEDHLGRLQGLDIS  322

Query  316  S--RGSHI  333
            S  RGS+ 
Sbjct  323  SCGRGSNF  330



>emb|CDY35020.1| BnaC06g13660D [Brassica napus]
Length=176

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQH  132
            QAMEQQA LR+ALNEAL+ +VER+++ TGEI+  SD++ +GMQ 
Sbjct  92   QAMEQQAHLRNALNEALRKKVERMKMETGEISGKSDSFDMGMQQ  135



>ref|XP_009384770.1| PREDICTED: transcription factor RF2b-like [Musa acuminata subsp. 
malaccensis]
Length=351

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPY  141
            Q+MEQQAQL D +N+ LK EVERL+IATGE    S+AY+LG+ ++P+
Sbjct  231  QSMEQQAQLNDGVNDGLKQEVERLKIATGEKVERSEAYNLGLMNLPF  277



>ref|XP_006371286.1| hypothetical protein POPTR_0019s08590g, partial [Populus trichocarpa]
 gb|ERP49083.1| hypothetical protein POPTR_0019s08590g, partial [Populus trichocarpa]
Length=204

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGM  126
            QAMEQQA+L DALNEALK E+ERL+ ATGEI AP+ A   G 
Sbjct  139  QAMEQQAELHDALNEALKKEIERLKFATGEIMAPTVAIIWGC  180



>gb|EPS70738.1| hypothetical protein M569_04023, partial [Genlisea aurea]
Length=233

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEALK EVERLR+ATGEI
Sbjct  203  QAMEQQAQLRDALNEALKQEVERLRMATGEI  233



>ref|XP_006423515.1| hypothetical protein CICLE_v10028062mg [Citrus clementina]
 gb|ESR36755.1| hypothetical protein CICLE_v10028062mg [Citrus clementina]
Length=597

 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQ  168
            QAMEQQAQLRDALNEAL  EV RL++AT E+A+ SD +  +  Q +P N   F  HQ
Sbjct  500  QAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQ  556



>ref|XP_006471421.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
 ref|XP_006487269.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
 ref|XP_006493636.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=597

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQ  168
            QAMEQQAQLRDALNEAL  EV RL++AT E+A+ SD +  +  Q +P N   F  HQ
Sbjct  500  QAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQ  556



>gb|KDO42321.1| hypothetical protein CISIN_1g007579mg [Citrus sinensis]
Length=597

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQ  168
            QAMEQQAQLRDALNEAL  EV RL++AT E+A+ SD +  +  Q +P N   F  HQ
Sbjct  500  QAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQ  556



>ref|XP_001764874.1| predicted protein [Physcomitrella patens]
 gb|EDQ70316.1| predicted protein [Physcomitrella patens]
Length=344

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFS  162
            QAMEQQA LRDALNEAL+ EV+RL++ATG++++ S  + S+G QH+   QS  F+
Sbjct  226  QAMEQQAHLRDALNEALREEVQRLKVATGQVSSGSGQSLSMGGQHVFQMQSQSFN  280



>ref|XP_010260915.1| PREDICTED: transcription factor VIP1 isoform X1 [Nelumbo nucifera]
Length=359

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHIPYNQSAFFSH  165
            QAMEQQAQLRDALNEAL+ EV+RLRIATG++ A   + +S G+    ++QS   SH
Sbjct  254  QAMEQQAQLRDALNEALREEVQRLRIATGQVPAVNGNTFSRGLPPPYFSQSQSLSH  309



>ref|XP_010938012.1| PREDICTED: transcription factor RF2b-like isoform X3 [Elaeis 
guineensis]
Length=336

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFS  162
            QAMEQQAQLRDALNEALK EV+RL+IATGEI+ P      G Q       +F +
Sbjct  258  QAMEQQAQLRDALNEALKQEVQRLKIATGEISNPGMWRCDGGQCFSKVGCSFIA  311



>emb|CDY24896.1| BnaC03g22760D [Brassica napus]
Length=339

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 23/125 (18%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QA+EQ+A+LRDALNE +K E ERLR A     + SDAY+L +  + Y+Q           
Sbjct  204  QAVEQKAKLRDALNEKMKKEAERLRFAAAGQVSHSDAYNLQVARMQYSQQQ----SFFQQ  259

Query  181  PSDSQNIQ--IPQFHALQPSTSTP--------HHPM---------LADTVQQDPLGRFQG  303
             +D+QN+Q   PQFH  QP+ +          HH            ++ V +D LG  QG
Sbjct  260  QADAQNMQQMTPQFHLFQPNNNNNNNQNPQLMHHATSNASGQSHSYSEEVHEDHLGSLQG  319

Query  304  LDISS  318
            LDIS+
Sbjct  320  LDISN  324



>gb|KDP27629.1| hypothetical protein JCGZ_19634 [Jatropha curcas]
Length=601

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF  156
            QAMEQQAQLRDALNEAL  EV RL++AT E+   SD     +QH+  N S F
Sbjct  493  QAMEQQAQLRDALNEALTAEVRRLKLATAELGGDSDPTKGMVQHLSINPSMF  544



>ref|XP_010938011.1| PREDICTED: transcription factor RF2b-like isoform X2 [Elaeis 
guineensis]
Length=349

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAP  102
            QAMEQQAQLRDALNEALK EV+RL+IATGEI+ P
Sbjct  258  QAMEQQAQLRDALNEALKQEVQRLKIATGEISNP  291



>ref|XP_010911966.1| PREDICTED: transcription factor VIP1-like [Elaeis guineensis]
Length=311

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 15/94 (16%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPS-DAYSLGMQHIPYNQSAFFSHQPPS  177
            QAME++A+LRDALNE L+ E++RL++ TGEI+  + + ++ G+Q  PY      SH P  
Sbjct  222  QAMEKEAELRDALNETLRQEIQRLKMVTGEISTVNGNTFNRGIQPSPY-----LSH-PQQ  275

Query  178  GPSDSQNIQIPQFHALQPSTS-------TPHHPM  258
             PS +   Q  QFH  QPS S       TP  PM
Sbjct  276  LPSQT-GYQAQQFHGSQPSFSVQSGSAQTPSDPM  308



>ref|XP_010670608.1| PREDICTED: transcription factor RF2b-like [Beta vulgaris subsp. 
vulgaris]
Length=406

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIP  138
            ++MEQQA LRDALN+ALK E++RL+IATG+   P+DA+++ +  IP
Sbjct  175  ESMEQQAHLRDALNDALKQELDRLKIATGDTLVPADAFAMPLHSIP  220



>ref|XP_009402213.1| PREDICTED: transcription factor RF2b-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 11/107 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            Q+MEQQAQL D +++ALK EVERL I TG     S+ Y+LG+ ++PY  S+F        
Sbjct  239  QSMEQQAQLHDGVSDALKKEVERLHIVTGGKVNKSEPYNLGLLNLPY--SSFMM------  290

Query  181  PSDSQNIQIPQ---FHALQPSTSTPHHPMLADTVQQDPLGRFQGLDI  312
            PS+ Q    PQ    HA    +   H+ + +D +QQ  L    GL+I
Sbjct  291  PSEEQPKIHPQGLECHAQFCQSQLYHNDVPSDMMQQGQLKVLPGLNI  337



>ref|XP_001755981.1| predicted protein [Physcomitrella patens]
 gb|EDQ79266.1| predicted protein [Physcomitrella patens]
Length=266

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPS-DAYSLGMQHI  135
            QAMEQQAQLRDAL+EAL++EV+RLR+ATG+++  S    SLG QH+
Sbjct  187  QAMEQQAQLRDALHEALRDEVQRLRVATGQLSNGSGQNSSLGGQHV  232



>ref|XP_011042922.1| PREDICTED: transcription factor VIP1-like [Populus euphratica]
Length=290

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 13/87 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSA---FFSHQP  171
            QAMEQQA LRDALNEAL+ EV+RL+IATG++ A +          P+N+     F SHQ 
Sbjct  199  QAMEQQAHLRDALNEALREEVQRLKIATGQVPAVNGN--------PFNRGLPPQFSSHQG  250

Query  172  PSGPSDSQNIQIPQFHALQPSTSTPHH  252
                 + Q  Q  Q H  QPST+   H
Sbjct  251  LQTFGNQQTQQ--QLHMPQPSTTGQTH  275



>ref|XP_001785739.1| predicted protein [Physcomitrella patens]
 gb|EDQ49445.1| predicted protein [Physcomitrella patens]
Length=349

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHI  135
            QAMEQQAQLRDAL+EAL++EV+RLR+ATG+++  S    SLG QH+
Sbjct  234  QAMEQQAQLRDALHEALRDEVQRLRVATGQLSNGSGQNSSLGGQHV  279



>ref|XP_001755887.1| predicted protein [Physcomitrella patens]
 ref|XP_001755982.1| predicted protein [Physcomitrella patens]
 gb|EDQ79172.1| predicted protein [Physcomitrella patens]
 gb|EDQ79267.1| predicted protein [Physcomitrella patens]
Length=333

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPS-DAYSLGMQHIPYNQSAFFSHQ  168
            QAMEQQA LRDALNEAL+ EV+RL++ATG+I+  S    S+G QH+   Q+  F+ Q
Sbjct  218  QAMEQQAHLRDALNEALREEVQRLKVATGQISNGSVQNLSMGGQHLFQMQNQAFNSQ  274



>emb|CDY10231.1| BnaC05g04740D [Brassica napus]
Length=159

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 14/94 (15%)
 Frame = +1

Query  34   ALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPP--SGPSDSQNIQI  207
            ALNEAL+ EVER++I TGE++  SD++ +G     Y+ S F +  PP  SG  + Q+++ 
Sbjct  52   ALNEALRKEVERMKIETGEVSGDSDSFDMG----QYSHSTFMA-IPPYHSGSVNGQDMRF  106

Query  208  PQFHALQPSTSTPHHPMLADTVQQDPLGRFQGLD  309
             Q H ++ S S      L +       GR QGL+
Sbjct  107  NQNHPMEKSNSQSVSEFLQN-------GRLQGLE  133



>gb|AFO63283.1| bZIP4 [Tamarix hispida]
Length=347

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 8/55 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSH  165
            QAMEQQAQLRDALNE L+ EV+RLR+ATG+++A +        H     S+ FSH
Sbjct  247  QAMEQQAQLRDALNETLREEVQRLRVATGQVSAAT--------HTNGGSSSHFSH  293



>ref|XP_010260917.1| PREDICTED: transcription factor VIP1-like [Nelumbo nucifera]
Length=364

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHIPYNQSAFFSH  165
            QAMEQQAQLRDALNEAL+ EV+RLRIATG++ A    ++S G+    +++S   SH
Sbjct  254  QAMEQQAQLRDALNEALREEVQRLRIATGQVPAVNGHSFSRGLPPPYFSRSQPLSH  309



>ref|XP_008785820.1| PREDICTED: transcription factor VIP1-like [Phoenix dactylifera]
Length=313

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 11/93 (12%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAME++AQLRDALNE L+ E++RL+IA GEI+   D  +   + I    S + SH P   
Sbjct  222  QAMEKEAQLRDALNETLRQEIQRLKIAAGEISM-VDGNTFN-REIQQAASPYISH-PQQL  278

Query  181  PSDSQNIQIPQFHALQPSTS-------TPHHPM  258
            PS +   Q  QFH  QPS S       TP  PM
Sbjct  279  PSQT-GYQALQFHGSQPSFSVQSGSAQTPQDPM  310



>ref|XP_010665860.1| PREDICTED: uncharacterized protein LOC104883107 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQ  129
            QAMEQQAQLRDALNEAL  E+ RL+IATGE+ A S +   G Q
Sbjct  479  QAMEQQAQLRDALNEALTAEIHRLKIATGELNAESMSKCFGQQ  521



>ref|XP_010680531.1| PREDICTED: transcription factor VIP1 [Beta vulgaris subsp. vulgaris]
Length=361

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGM  126
            QA+EQQAQLRDALNEAL+ EV+RLRIATG+I   +++   GM
Sbjct  267  QALEQQAQLRDALNEALRQEVQRLRIATGQIPPGNNSSGRGM  308



>ref|XP_002962855.1| hypothetical protein SELMODRAFT_77868 [Selaginella moellendorffii]
 gb|EFJ36318.1| hypothetical protein SELMODRAFT_77868 [Selaginella moellendorffii]
Length=330

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSL  120
            QAMEQQAQLRDALN+ALK+EV+RL+IATG+I+  +  + L
Sbjct  247  QAMEQQAQLRDALNDALKDEVQRLKIATGQISGENGQHQL  286



>ref|XP_006854522.1| hypothetical protein AMTR_s00030p00014690 [Amborella trichopoda]
 gb|ERN15989.1| hypothetical protein AMTR_s00030p00014690 [Amborella trichopoda]
Length=301

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQ---HIPYNQSAFFSHQ  168
            QAMEQQA LRDALNEAL+ EV+RL++ATG+I     + ++ G+Q   H  + Q    SHQ
Sbjct  207  QAMEQQAHLRDALNEALREEVQRLKVATGQIQGVNGNHFNRGLQQPNHSFFPQQQMHSHQ  266

Query  169  PP  174
             P
Sbjct  267  LP  268



>ref|XP_002989437.1| hypothetical protein SELMODRAFT_129846 [Selaginella moellendorffii]
 gb|EFJ09528.1| hypothetical protein SELMODRAFT_129846 [Selaginella moellendorffii]
Length=331

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSL  120
            QAMEQQAQLRDALN+ALK+EV+RL+IATG+I+  +  + L
Sbjct  247  QAMEQQAQLRDALNDALKDEVQRLKIATGQISGENGQHQL  286



>ref|NP_001131398.1| uncharacterized protein LOC100192726 [Zea mays]
 gb|ACF79794.1| unknown [Zea mays]
Length=99

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1   QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
           QAMEQQAQLRDALNEAL  EV+RL++ATGE+
Sbjct  21  QAMEQQAQLRDALNEALTAEVQRLKLATGEV  51



>ref|XP_008803311.1| PREDICTED: transcription factor RF2a-like [Phoenix dactylifera]
Length=531

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYN  144
            QAMEQQAQLRDALNEAL  EV+RL++ATGE+     + SL  Q IP N
Sbjct  450  QAMEQQAQLRDALNEALTAEVQRLKLATGELVNGRASNSLN-QQIPIN  496



>ref|XP_002300925.2| hypothetical protein POPTR_0002s07020g [Populus trichocarpa]
 gb|ABK96202.1| unknown [Populus trichocarpa]
 gb|EEE80198.2| hypothetical protein POPTR_0002s07020g [Populus trichocarpa]
Length=340

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 13/87 (15%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSA---FFSHQP  171
            QAMEQQA LRDALNEAL+ EV+RL+IATG++ A        +   P+N+     F SHQ 
Sbjct  249  QAMEQQAHLRDALNEALREEVQRLKIATGQVPA--------VNGNPFNRGLPPQFSSHQG  300

Query  172  PSGPSDSQNIQIPQFHALQPSTSTPHH  252
                 + Q  Q  Q H  QPST+   H
Sbjct  301  LQTFGNQQAQQ--QLHMPQPSTTGQTH  325



>ref|XP_002533020.1| hypothetical protein RCOM_1170820 [Ricinus communis]
 gb|EEF29374.1| hypothetical protein RCOM_1170820 [Ricinus communis]
Length=106

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1   QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
           QAMEQQA LRDALNEAL+ EV+RL+IATG+I A
Sbjct  26  QAMEQQAHLRDALNEALREEVQRLKIATGQIPA  58



>ref|XP_008782656.1| PREDICTED: transcription factor RF2b-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATG  87
            QAMEQQAQLRDALNEAL+ EVERLRIATG
Sbjct  263  QAMEQQAQLRDALNEALRQEVERLRIATG  291



>ref|XP_009404907.1| PREDICTED: transcription factor VIP1-like [Musa acuminata subsp. 
malaccensis]
Length=338

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQL DALN+AL+ EV+RL+IATG++ +A  + ++ G+QH   N  A     PP 
Sbjct  246  QAMEQQAQLHDALNDALREEVQRLKIATGQLPSANGNPFNGGLQHSVSNYYAHPQQLPPQ  305

Query  178  GPSDSQNIQIPQFHALQPSTSTPHHP  255
                 Q++   Q        S  H P
Sbjct  306  SLRHGQHLHPSQMQISSNGQSLVHSP  331



>ref|XP_011047123.1| PREDICTED: transcription factor RF2a [Populus euphratica]
 ref|XP_011047131.1| PREDICTED: transcription factor RF2a [Populus euphratica]
Length=597

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALNEAL  EV RL+IAT E    SD +  L  Q +  N   F     PS
Sbjct  493  QAMEQQAQLRDALNEALNGEVRRLKIATAERGGDSDPSKGLVQQQLSVNPQMFLQQPRPS  552



>ref|NP_001030982.1| basic leucine-zipper 52 [Arabidopsis thaliana]
 emb|CAD12036.1| AtbZIP transcription factor [Arabidopsis thaliana]
 gb|AEE28046.1| basic leucine-zipper 52 [Arabidopsis thaliana]
Length=250

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 3/38 (8%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAY  114
            QAMEQQAQLR+ALNEAL+ EVER+++ TGEI   SDA+
Sbjct  216  QAMEQQAQLRNALNEALRKEVERMKMETGEI---SDAF  250



>gb|KDP43006.1| hypothetical protein JCGZ_25192 [Jatropha curcas]
Length=359

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL+ EV+RL+IATG+I
Sbjct  255  QAMEQQAQLRDALNEALREEVQRLKIATGQI  285



>gb|ABR16513.1| unknown [Picea sitchensis]
Length=474

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 45/58 (78%), Gaps = 6/58 (10%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGM----QHIPYNQSAFFS  162
            Q+MEQQAQLRDALNE L+ +V+R++IATG++++ ++A +  M    Q +P N+S FFS
Sbjct  344  QSMEQQAQLRDALNETLREKVQRMKIATGQLSS-NNANAFNMSATAQQLPLNRS-FFS  399



>gb|EMS56823.1| Transcription factor RF2b [Triticum urartu]
Length=182

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGM  126
            QAMEQQAQLRDALNEAL  EV+RL+IAT E+       S GM
Sbjct  95   QAMEQQAQLRDALNEALTGEVQRLKIATIELGIGDSCSSNGM  136



>ref|XP_003562153.2| PREDICTED: transcription factor RF2b-like [Brachypodium distachyon]
Length=368

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGM  126
            QAMEQQAQLRDALN+AL  EV+RL+IAT EI       S GM
Sbjct  288  QAMEQQAQLRDALNDALTGEVQRLKIATAEIGVGDSCSSSGM  329



>ref|XP_010271435.1| PREDICTED: probable transcription factor PosF21 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271436.1| PREDICTED: probable transcription factor PosF21 isoform X1 [Nelumbo 
nucifera]
Length=600

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF  156
            QAMEQQAQLRDALNEAL  EV+RL++AT E++A + A S   Q +  N   F
Sbjct  490  QAMEQQAQLRDALNEALTAEVQRLKLATQELSANAHASSCLAQQLSMNPQMF  541



>emb|CBI37976.3| unnamed protein product [Vitis vinifera]
Length=369

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS  177
            QAMEQQAQLRDALNEAL  EV+RL++AT E+   S A    +  +  N   F   HQ P+
Sbjct  277  QAMEQQAQLRDALNEALTAEVQRLKLATAELGGESQASKCLVPQLSVNPQMFHLHHQQPT  336



>dbj|BAI66488.1| basic leucine zipper transcription factor [Hordeum vulgare subsp. 
vulgare]
Length=351

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  264  QAMEQQAQLRDALNEALTGEVQRLKLATGEI  294



>ref|XP_002313753.2| hypothetical protein POPTR_0009s12830g [Populus trichocarpa]
 gb|EEE87708.2| hypothetical protein POPTR_0009s12830g [Populus trichocarpa]
Length=600

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALNEAL  EV RL+IAT E    SD +  L  Q +  N   F     PS
Sbjct  493  QAMEQQAQLRDALNEALNGEVRRLKIATAEQGGDSDPSKGLVQQQLSVNPQMFMQQPRPS  552



>ref|XP_004139652.1| PREDICTED: transcription factor VIP1-like [Cucumis sativus]
 gb|KGN44521.1| hypothetical protein Csa_7G324150 [Cucumis sativus]
Length=351

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQAQLRDAL+EALK EV+RLRIA G++A+
Sbjct  253  QAMEQQAQLRDALSEALKEEVQRLRIAAGQVAS  285



>ref|XP_008461512.1| PREDICTED: transcription factor VIP1 [Cucumis melo]
Length=351

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQAQLRDAL+EALK EV+RLRIA G++A+
Sbjct  253  QAMEQQAQLRDALSEALKEEVQRLRIAAGQVAS  285



>ref|XP_004154456.1| PREDICTED: transcription factor VIP1-like [Cucumis sativus]
Length=357

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQAQLRDAL+EALK EV+RLRIA G++A+
Sbjct  253  QAMEQQAQLRDALSEALKEEVQRLRIAAGQVAS  285



>ref|XP_011044198.1| PREDICTED: transcription factor VIP1-like [Populus euphratica]
Length=338

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQA LRDALNEAL+ EV+RL+IATG+I A
Sbjct  242  QAMEQQAHLRDALNEALREEVQRLKIATGQITA  274



>gb|KCW69195.1| hypothetical protein EUGRSUZ_F02715 [Eucalyptus grandis]
Length=344

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 42/77 (55%), Gaps = 26/77 (34%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV+RL+IA G++ A + A                   P  G
Sbjct  270  QAMEQQAQLRDALNEALKEEVQRLKIAAGQMPAVNGA-------------------PFGG  310

Query  181  PSDSQNIQIPQFHALQP  231
            P       IPQF A QP
Sbjct  311  P-------IPQFSARQP  320



>gb|EEE69091.1| hypothetical protein OsJ_28152 [Oryza sativa Japonica Group]
Length=272

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  196  QAMEQQAQLRDALNEALTAEVQRLKLATGEI  226



>ref|XP_006472967.1| PREDICTED: transcription factor VIP1-like [Citrus sinensis]
Length=343

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGM  126
            QAMEQQA LRDALNEAL+ EV+RL+IATG+I AA  + +  G+
Sbjct  249  QAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGL  291



>ref|XP_010062128.1| PREDICTED: transcription factor VIP1 [Eucalyptus grandis]
 gb|KCW69194.1| hypothetical protein EUGRSUZ_F02715 [Eucalyptus grandis]
Length=368

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 42/77 (55%), Gaps = 26/77 (34%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QAMEQQAQLRDALNEALK EV+RL+IA G++ A + A                   P  G
Sbjct  270  QAMEQQAQLRDALNEALKEEVQRLKIAAGQMPAVNGA-------------------PFGG  310

Query  181  PSDSQNIQIPQFHALQP  231
            P       IPQF A QP
Sbjct  311  P-------IPQFSARQP  320



>ref|XP_006434439.1| hypothetical protein CICLE_v10001715mg [Citrus clementina]
 gb|ESR47679.1| hypothetical protein CICLE_v10001715mg [Citrus clementina]
Length=345

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGM  126
            QAMEQQA LRDALNEAL+ EV+RL+IATG+I AA  + +  G+
Sbjct  249  QAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGL  291



>ref|XP_002307491.2| hypothetical protein POPTR_0005s21300g [Populus trichocarpa]
 gb|EEE94487.2| hypothetical protein POPTR_0005s21300g [Populus trichocarpa]
Length=321

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQA LRDALNEAL+ EV+RL+IATG+I A
Sbjct  242  QAMEQQAHLRDALNEALREEVQRLKIATGQITA  274



>gb|KDO83691.1| hypothetical protein CISIN_1g019163mg [Citrus sinensis]
Length=345

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGM  126
            QAMEQQA LRDALNEAL+ EV+RL+IATG+I AA  + +  G+
Sbjct  249  QAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGL  291



>ref|XP_009420592.1| PREDICTED: transcription factor VIP1-like [Musa acuminata subsp. 
malaccensis]
Length=332

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQH-IPYNQSAFFSHQPP  174
            QAMEQQAQLRDALNEAL+ EV RL+IATG++     + ++ G+Q  +P   S     +PP
Sbjct  241  QAMEQQAQLRDALNEALREEVHRLKIATGQLPNTNGNRFNGGIQQSVPNYYSQPQQLRPP  300

Query  175  SG  180
            SG
Sbjct  301  SG  302



>emb|CBI18550.3| unnamed protein product [Vitis vinifera]
Length=195

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGM  126
            QAMEQQA LR+ALNEAL+ EV+RL+IATG+I A   ++++ G+
Sbjct  103  QAMEQQASLREALNEALREEVQRLKIATGQIPAVNGNSFNRGL  145



>ref|XP_008781393.1| PREDICTED: transcription factor VIP1 [Phoenix dactylifera]
Length=328

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHI--PYNQSA  153
            QAMEQQA LRDALNEAL+ EV+RL+IATG++     + ++ G+Q    PY+QS 
Sbjct  244  QAMEQQAHLRDALNEALREEVQRLKIATGQLPNINGNRFNWGLQQNVPPYHQSG  297



>ref|XP_011037233.1| PREDICTED: transcription factor RF2a-like [Populus euphratica]
Length=605

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSD-AYSLGMQHIPYNQSAFFSHQPPS  177
            QAMEQQAQLRDALNEAL  EV RL+IAT E    SD + S+  Q +  N   F     PS
Sbjct  496  QAMEQQAQLRDALNEALTAEVRRLKIATAEQGGDSDPSKSMVQQQLSINPQMFMQQPRPS  555



>dbj|BAK05721.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  384  QAMEQQAQLRDALNEALTGEVQRLKLATGEI  414



>ref|XP_009393798.1| PREDICTED: transcription factor VIP1-like [Musa acuminata subsp. 
malaccensis]
Length=339

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL+ EV+RL+IATG++
Sbjct  247  QAMEQQAQLRDALNEALREEVQRLKIATGQL  277



>gb|ADF83495.1| bZiP-like trancription factor [Triticum aestivum]
Length=471

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  384  QAMEQQAQLRDALNEALTGEVQRLKLATGEI  414



>dbj|BAI66489.1| basic leucine zipper proein [Hordeum vulgare]
Length=471

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  384  QAMEQQAQLRDALNEALTGEVQRLKLATGEI  414



>ref|XP_006660351.1| PREDICTED: transcription factor RF2a-like [Oryza brachyantha]
Length=331

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  251  QAMEQQAQLRDALNEALTAEVQRLKLATGEI  281



>ref|XP_010647563.1| PREDICTED: serine/threonine-protein kinase pakB isoform X3 [Vitis 
vinifera]
 ref|XP_010647567.1| PREDICTED: serine/threonine-protein kinase pakB isoform X3 [Vitis 
vinifera]
Length=559

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS  177
            QAMEQQAQLRDALNEAL  EV+RL++AT E+   S A    +  +  N   F   HQ P+
Sbjct  467  QAMEQQAQLRDALNEALTAEVQRLKLATAELGGESQASKCLVPQLSVNPQMFHLHHQQPT  526



>ref|XP_010647562.1| PREDICTED: serine/threonine-protein kinase pakB isoform X2 [Vitis 
vinifera]
Length=579

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS  177
            QAMEQQAQLRDALNEAL  EV+RL++AT E+   S A    +  +  N   F   HQ P+
Sbjct  487  QAMEQQAQLRDALNEALTAEVQRLKLATAELGGESQASKCLVPQLSVNPQMFHLHHQQPT  546



>ref|XP_010647556.1| PREDICTED: serine/threonine-protein kinase pakB isoform X1 [Vitis 
vinifera]
 ref|XP_010647559.1| PREDICTED: serine/threonine-protein kinase pakB isoform X1 [Vitis 
vinifera]
Length=589

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF-FSHQPPS  177
            QAMEQQAQLRDALNEAL  EV+RL++AT E+   S A    +  +  N   F   HQ P+
Sbjct  497  QAMEQQAQLRDALNEALTAEVQRLKLATAELGGESQASKCLVPQLSVNPQMFHLHHQQPT  556



>gb|EAZ07859.1| hypothetical protein OsI_30120 [Oryza sativa Indica Group]
Length=320

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  244  QAMEQQAQLRDALNEALTAEVQRLKLATGEI  274



>gb|EYU36846.1| hypothetical protein MIMGU_mgv1a011393mg [Erythranthe guttata]
Length=283

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQA LRDALNEAL+NE++RL+IA GEI
Sbjct  240  QAMEQQAHLRDALNEALRNELQRLKIAAGEI  270



>ref|XP_006359608.1| PREDICTED: transcription factor RF2a-like [Solanum tuberosum]
Length=577

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAY  114
            QAMEQQAQLRDALNEAL  EV+RL+IAT E++A +  +
Sbjct  487  QAMEQQAQLRDALNEALTAEVQRLKIATAELSADASKF  524



>ref|XP_004230901.1| PREDICTED: probable transcription factor PosF21 [Solanum lycopersicum]
Length=582

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAY  114
            QAMEQQAQLRDALNEAL  EV+RL+IAT E++A +  +
Sbjct  487  QAMEQQAQLRDALNEALTAEVQRLKIATAELSADASKF  524



>ref|XP_002445762.1| hypothetical protein SORBIDRAFT_07g025270 [Sorghum bicolor]
 gb|EES15257.1| hypothetical protein SORBIDRAFT_07g025270 [Sorghum bicolor]
Length=492

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI  93
            QAMEQQAQLRDALNEAL  EV+RL++ATGEI
Sbjct  408  QAMEQQAQLRDALNEALTAEVQRLKLATGEI  438



>ref|XP_010933933.1| PREDICTED: transcription factor RF2a-like [Elaeis guineensis]
Length=522

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQ  168
            QAMEQQAQLRDALNEAL  EV+RL++ATGE+     + SL  Q  P N   F   Q
Sbjct  442  QAMEQQAQLRDALNEALTAEVQRLKLATGELVDGHASNSLNQQR-PINPLMFRRQQ  496



>ref|XP_010919167.1| PREDICTED: transcription factor RF2a-like isoform X1 [Elaeis 
guineensis]
Length=537

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAF  156
            QAMEQQAQLRDALNEAL  EV RL++ATGE+       +L  Q +P N   F
Sbjct  452  QAMEQQAQLRDALNEALTAEVRRLKLATGELVDDCALNNLN-QQLPINPQIF  502



>ref|XP_007131742.1| hypothetical protein PHAVU_011G038200g [Phaseolus vulgaris]
 gb|ESW03736.1| hypothetical protein PHAVU_011G038200g [Phaseolus vulgaris]
Length=561

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPS  177
            Q+MEQQA+LRDALNEAL  EV+RL+IAT E++  S   S  +     N   F   QPP+
Sbjct  475  QSMEQQAKLRDALNEALTAEVQRLKIATAELSGDSHGSSCLIPQHSVNPLMFQQQQPPT  533



>ref|XP_010500116.1| PREDICTED: transcription factor VIP1-like [Camelina sativa]
Length=338

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 16/94 (17%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAAPSDAYSLGMQHIPYNQSAFFSHQPPSG  180
            QA+EQQA+LRDALNEAL++E+ RL+IA GEI   +           YN+  F S Q    
Sbjct  259  QALEQQAELRDALNEALRDELNRLKIAAGEIPQGNGN--------SYNRGQFSSQQSTMN  310

Query  181  P-SDSQNIQIPQFHALQPSTSTPHHPMLADTVQQ  279
               +++N+Q+        S   P HP   D  ++
Sbjct  311  QFGNNKNLQM-------SSNGQPSHPSFMDFTKR  337



>ref|XP_009627336.1| PREDICTED: probable transcription factor PosF21 [Nicotiana tomentosiformis]
 ref|XP_009627337.1| PREDICTED: probable transcription factor PosF21 [Nicotiana tomentosiformis]
Length=586

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIAA  99
            QAMEQQAQLRDALNEAL  EV+RL++AT EI+A
Sbjct  494  QAMEQQAQLRDALNEALTAEVQRLKLATAEISA  526



>ref|XP_008784139.1| PREDICTED: transcription factor VIP1-like [Phoenix dactylifera]
Length=349

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 8/58 (14%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEI-AAPSDAYSLGMQHI--PYNQSAFFSH  165
            QAMEQQA+LRDALNEAL+ EV+RL+IATG++     + ++ G+Q    PY     FSH
Sbjct  256  QAMEQQAKLRDALNEALREEVQRLKIATGQLPNINGNCFNGGLQQTVPPY-----FSH  308



>ref|XP_010479019.1| PREDICTED: transcription factor VIP1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479020.1| PREDICTED: transcription factor VIP1-like isoform X2 [Camelina 
sativa]
Length=338

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  1    QAMEQQAQLRDALNEALKNEVERLRIATGEIA-APSDAYSLG  123
            QA+EQQA+LRDALNEAL++E+ RL+IA GEI+    +AY+ G
Sbjct  259  QALEQQAELRDALNEALRDELNRLKIAAGEISQGNGNAYNGG  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3607887660968