BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21962_g2_i1 len=1309 path=[5191:0-813 6156:814-1308]

Length=1309
                                                                      Score     E

ref|XP_010060044.1|  PREDICTED: uncharacterized protein LOC104447982    289   4e-90   
ref|XP_004173484.1|  PREDICTED: uncharacterized LOC101217840            283   2e-89   
gb|KGN49906.1|  hypothetical protein Csa_5G139840                       283   6e-88   
ref|XP_004145910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    283   1e-87   
emb|CDP05121.1|  unnamed protein product                                278   6e-87   
ref|XP_008437553.1|  PREDICTED: uncharacterized protein LOC103482932    280   2e-86   
gb|ADN33781.1|  CAAX amino terminal protease family                     280   3e-86   
gb|AFK34486.1|  unknown                                                 270   4e-85   
gb|AFK38413.1|  unknown                                                 270   2e-84   
ref|XP_003556135.1|  PREDICTED: uncharacterized protein LOC100808...    272   7e-84   
ref|XP_003592164.1|  hypothetical protein MTR_1g099420                  272   1e-83   
ref|XP_004496505.1|  PREDICTED: uncharacterized protein LOC101505330    271   2e-83   
ref|XP_003556136.1|  PREDICTED: uncharacterized protein LOC100808...    272   2e-83   
ref|XP_003556137.1|  PREDICTED: uncharacterized protein LOC100808...    272   2e-83   
ref|XP_010261427.1|  PREDICTED: uncharacterized protein LOC104600265    271   2e-83   
ref|XP_006439445.1|  hypothetical protein CICLE_v10020944mg             271   4e-83   
ref|XP_007040382.1|  CAAX amino terminal protease family protein ...    271   4e-83   
ref|XP_006476474.1|  PREDICTED: uncharacterized protein LOC102608...    270   7e-83   
ref|XP_006476476.1|  PREDICTED: uncharacterized protein LOC102608...    268   1e-82   
ref|XP_010053192.1|  PREDICTED: uncharacterized protein LOC104441...    269   2e-82   
ref|NP_001239773.1|  uncharacterized protein LOC100775964               268   2e-82   
gb|KDP25361.1|  hypothetical protein JCGZ_20517                         269   3e-82   
ref|XP_003592165.1|  hypothetical protein MTR_1g099420                  271   3e-82   
emb|CAN67252.1|  hypothetical protein VITISV_023148                     264   3e-82   Vitis vinifera
ref|XP_007143506.1|  hypothetical protein PHAVU_007G077200g             268   4e-82   
gb|KHG09262.1|  Putative membrane peptidase ydiL                        268   5e-82   
ref|XP_009408532.1|  PREDICTED: uncharacterized protein LOC103990947    268   7e-82   
ref|XP_002298001.2|  hypothetical protein POPTR_0001s10060g             267   9e-82   Populus trichocarpa [western balsam poplar]
gb|KHG14846.1|  Putative membrane peptidase ydiL                        267   1e-81   
ref|XP_010662642.1|  PREDICTED: uncharacterized protein LOC100254...    266   2e-81   
ref|XP_010662641.1|  PREDICTED: uncharacterized protein LOC100254...    266   3e-81   
ref|XP_002276929.1|  PREDICTED: uncharacterized protein LOC100250094    266   3e-81   Vitis vinifera
ref|XP_011026961.1|  PREDICTED: uncharacterized protein LOC105127389    265   4e-81   
ref|XP_010662640.1|  PREDICTED: uncharacterized protein LOC100254...    265   9e-81   
ref|XP_002275682.2|  PREDICTED: uncharacterized protein LOC100254...    266   1e-80   Vitis vinifera
ref|XP_010662643.1|  PREDICTED: uncharacterized protein LOC100254...    264   1e-80   
ref|XP_011022594.1|  PREDICTED: uncharacterized protein LOC105124...    264   1e-80   
ref|XP_006476475.1|  PREDICTED: uncharacterized protein LOC102608...    263   2e-80   
ref|XP_010929565.1|  PREDICTED: uncharacterized protein LOC105051...    263   3e-80   
ref|XP_010929564.1|  PREDICTED: uncharacterized protein LOC105051...    263   7e-80   
ref|XP_002304526.1|  hypothetical protein POPTR_0003s13360g             262   8e-80   Populus trichocarpa [western balsam poplar]
ref|XP_008776534.1|  PREDICTED: uncharacterized protein LOC103696628    262   2e-79   
emb|CBI22601.3|  unnamed protein product                                268   3e-79   
gb|KEH21164.1|  CAAX amino terminal protease family protein             260   3e-79   
ref|XP_007160122.1|  hypothetical protein PHAVU_002G294300g             260   5e-79   
ref|XP_002509884.1|  prenyl-dependent CAAX protease, putative           260   6e-79   Ricinus communis
gb|ACU18810.1|  unknown                                                 254   2e-78   Glycine max [soybeans]
emb|CDP12096.1|  unnamed protein product                                259   3e-78   
ref|XP_004503658.1|  PREDICTED: uncharacterized protein LOC101509853    258   6e-78   
gb|KHN16775.1|  hypothetical protein glysoja_002872                     257   8e-78   
ref|XP_010676389.1|  PREDICTED: uncharacterized protein LOC104892223    256   2e-77   
ref|XP_009630290.1|  PREDICTED: uncharacterized protein LOC104120259    256   3e-77   
ref|XP_006343913.1|  PREDICTED: uncharacterized protein LOC102605715    256   4e-77   
ref|XP_006580547.1|  PREDICTED: uncharacterized protein LOC100779061    254   8e-77   
ref|XP_009796702.1|  PREDICTED: uncharacterized protein LOC104243239    255   9e-77   
ref|XP_004245558.1|  PREDICTED: uncharacterized protein LOC101244021    254   2e-76   
ref|XP_006858285.1|  hypothetical protein AMTR_s00064p00048290          249   5e-76   
gb|EYU23404.1|  hypothetical protein MIMGU_mgv1a008473mg                252   2e-75   
ref|XP_011080891.1|  PREDICTED: uncharacterized protein LOC105164040    251   2e-75   
ref|XP_008239007.1|  PREDICTED: uncharacterized protein LOC103337...    249   5e-75   
ref|XP_010533617.1|  PREDICTED: uncharacterized protein LOC104809356    249   6e-75   
ref|XP_008239006.1|  PREDICTED: uncharacterized protein LOC103337...    249   7e-75   
ref|XP_007209320.1|  hypothetical protein PRUPE_ppa007988mg             249   1e-74   
ref|XP_010272481.1|  PREDICTED: uncharacterized protein LOC104608243    249   1e-74   
ref|XP_011073439.1|  PREDICTED: uncharacterized protein LOC105158386    245   5e-73   
ref|XP_010106589.1|  Putative membrane peptidase ydiL                   244   1e-72   
gb|EPS73198.1|  hypothetical protein M569_01553                         238   5e-72   
ref|XP_004298847.1|  PREDICTED: uncharacterized protein LOC101297145    241   1e-71   
ref|XP_001779782.1|  predicted protein                                  234   2e-70   
dbj|BAB09848.1|  unnamed protein product                                236   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456718.1|  PREDICTED: uncharacterized protein LOC104738203    238   3e-70   
ref|XP_010443878.1|  PREDICTED: uncharacterized protein LOC104726664    237   4e-70   
ref|NP_568928.1|  endopeptidase SCO4                                    237   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483728.1|  PREDICTED: uncharacterized protein LOC104762182    237   4e-70   
ref|XP_002864700.1|  CAAX amino terminal protease family protein        237   5e-70   
emb|CDY09186.1|  BnaA02g06120D                                          236   7e-70   
ref|XP_006280734.1|  hypothetical protein CARUB_v10026703mg             236   9e-70   
emb|CDX73865.1|  BnaA03g31820D                                          236   1e-69   
ref|XP_009126584.1|  PREDICTED: uncharacterized protein LOC103851485    236   1e-69   
ref|XP_006400816.1|  hypothetical protein EUTSA_v10013994mg             235   2e-69   
ref|XP_009334489.1|  PREDICTED: uncharacterized protein LOC103927305    235   2e-69   
gb|KFK27600.1|  hypothetical protein AALP_AA8G404700                    234   4e-69   
ref|XP_006656998.1|  PREDICTED: uncharacterized protein LOC102717626    234   4e-69   
gb|EAZ01098.1|  hypothetical protein OsI_23126                          233   2e-68   Oryza sativa Indica Group [Indian rice]
ref|NP_001057716.1|  Os06g0505400                                       232   5e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EMT18677.1|  Elongation factor Ts                                    235   8e-66   
gb|EMT00631.1|  hypothetical protein F775_06991                         219   2e-63   
ref|NP_001146506.1|  uncharacterized protein LOC100280096               218   6e-63   Zea mays [maize]
ref|XP_008673077.1|  PREDICTED: uncharacterized protein LOC100280...    218   7e-63   
ref|XP_002437053.1|  hypothetical protein SORBIDRAFT_10g020020          218   8e-63   Sorghum bicolor [broomcorn]
dbj|BAJ93023.1|  predicted protein                                      218   1e-62   
dbj|BAJ92236.1|  predicted protein                                      218   1e-62   
gb|EMS51393.1|  hypothetical protein TRIUR3_21178                       218   2e-62   
gb|EMS53649.1|  hypothetical protein TRIUR3_25312                       215   8e-62   
dbj|BAK06142.1|  predicted protein                                      216   1e-61   
ref|XP_002993047.1|  hypothetical protein SELMODRAFT_136406             207   6e-60   
ref|XP_004965486.1|  PREDICTED: uncharacterized protein LOC101783762    209   2e-59   
ref|XP_010229836.1|  PREDICTED: uncharacterized protein LOC100833844    208   2e-59   
ref|XP_002972116.1|  hypothetical protein SELMODRAFT_148181             204   2e-58   
ref|XP_006858284.1|  hypothetical protein AMTR_s00064p00048070          198   3e-57   
ref|XP_007040384.1|  CAAX amino terminal protease family protein ...    195   1e-54   
gb|KDO76369.1|  hypothetical protein CISIN_1g022913mg                   183   1e-52   
ref|XP_007040383.1|  CAAX amino terminal protease family protein ...    189   4e-52   
gb|KHG20259.1|  uracil-dna glycosylase                                  189   4e-52   
gb|KDO76370.1|  hypothetical protein CISIN_1g022913mg                   184   1e-50   
ref|NP_001239624.1|  uncharacterized protein LOC100816897               181   6e-50   
ref|XP_011022597.1|  PREDICTED: uncharacterized protein LOC105124...    182   2e-49   
ref|XP_011022595.1|  PREDICTED: uncharacterized protein LOC105124...    182   2e-49   
ref|XP_002508579.1|  hypothetical protein MICPUN_85896                  170   1e-45   Micromonas commoda
ref|XP_006838673.1|  hypothetical protein AMTR_s00002p00243720          145   1e-38   
ref|WP_015130455.1|  abortive infection protein                         155   5e-38   
ref|WP_015172784.1|  abortive infection protein                         154   1e-37   
ref|WP_017316111.1|  abortive phage infection protein                   153   2e-37   
ref|XP_003064160.1|  predicted protein                                  147   2e-37   
ref|WP_038081935.1|  abortive phage infection protein                   151   6e-37   
ref|WP_008188312.1|  CAAX amino terminal protease family                144   6e-37   
gb|AHJ26426.1|  hypothetical protein NSP_690                            150   9e-37   
ref|WP_006194387.1|  abortive phage infection protein                   151   9e-37   
ref|WP_014274552.1|  hypothetical protein                               149   2e-36   
ref|WP_017655174.1|  abortive phage infection protein                   149   5e-36   
ref|WP_027843144.1|  abortive phage infection protein                   148   7e-36   
ref|XP_002948930.1|  hypothetical protein VOLCADRAFT_80447              145   1e-35   
ref|WP_019490774.1|  hypothetical protein                               147   1e-35   
ref|WP_015187177.1|  Abortive infection protein                         147   2e-35   
ref|XP_005646969.1|  metal-dependent CAAX amino terminal protease...    140   3e-35   
ref|WP_039714507.1|  abortive phage infection protein                   146   5e-35   
ref|WP_015157261.1|  abortive infection protein                         145   1e-34   
ref|WP_016878155.1|  abortive phage infection protein                   144   1e-34   
ref|WP_026135053.1|  abortive phage infection protein                   144   1e-34   
ref|WP_036479682.1|  abortive phage infection protein                   144   3e-34   
ref|WP_012407312.1|  abortive phage infection protein                   143   3e-34   
ref|WP_016951194.1|  abortive phage infection protein                   143   4e-34   
ref|WP_008050985.1|  abortive phage infection protein                   142   5e-34   
ref|WP_006619217.1|  MULTISPECIES: abortive phage infection protein     142   5e-34   
gb|KDR58696.1|  abortive phage infection protein                        142   6e-34   
ref|WP_010997926.1|  abortive phage infection protein                   142   6e-34   
ref|WP_015115811.1|  abortive infection protein                         142   6e-34   
ref|WP_026719661.1|  abortive phage infection protein                   142   7e-34   
ref|WP_011318362.1|  abortive phage infection protein                   142   8e-34   
ref|WP_029637233.1|  abortive phage infection protein [                 142   9e-34   
ref|WP_006516835.1|  putative metal-dependent membrane protease         142   1e-33   
ref|WP_016860061.1|  abortive phage infection protein                   142   1e-33   
ref|WP_017309079.1|  abortive phage infection protein                   142   1e-33   
ref|WP_015133566.1|  abortive infection protein                         141   1e-33   
ref|WP_023071621.1|  abortive infection protein                         141   2e-33   
ref|WP_026732987.1|  abortive phage infection protein                   140   3e-33   
ref|WP_017661438.1|  hypothetical protein                               140   3e-33   
gb|KEI69029.1|  hypothetical protein A19Y_4361                          140   4e-33   
ref|WP_015199187.1|  abortive infection protein                         140   4e-33   
ref|WP_016868025.1|  abortive phage infection protein                   139   7e-33   
ref|WP_013190948.1|  abortive phage infection protein                   139   7e-33   
ref|WP_006098562.1|  abortive phage infection protein                   139   7e-33   
ref|WP_026793425.1|  MULTISPECIES: abortive phage infection protein     139   8e-33   
ref|WP_008307815.1|  putative metal-dependent membrane protease         139   8e-33   
ref|WP_026798410.1|  MULTISPECIES: abortive phage infection protein     139   8e-33   
ref|WP_007356391.1|  MULTISPECIES: abortive phage infection protein     139   8e-33   
ref|WP_026787505.1|  MULTISPECIES: abortive phage infection protein     139   8e-33   
ref|WP_015211243.1|  putative metal-dependent membrane protease         139   8e-33   
ref|WP_009458258.1|  MULTISPECIES: abortive phage infection protein     139   9e-33   
ref|WP_012595794.1|  MULTISPECIES: abortive phage infection protein     139   9e-33   
ref|WP_039744126.1|  abortive phage infection protein                   139   1e-32   
ref|WP_015122741.1|  metal-dependent membrane protease                  139   1e-32   
ref|WP_015139741.1|  metal-dependent membrane protease                  139   1e-32   
ref|WP_015185319.1|  metal-dependent membrane protease                  138   2e-32   
ref|WP_015174715.1|  Abortive infection protein                         138   2e-32   
ref|WP_022604308.1|  putative metal-dependent membrane protease         137   4e-32   
ref|WP_015191891.1|  Abortive infection protein                         136   1e-31   
ref|WP_015227581.1|  abortive infection protein                         135   1e-31   
ref|WP_017304316.1|  hypothetical protein                               135   1e-31   
ref|WP_036003622.1|  abortive phage infection protein                   135   2e-31   
ref|WP_035154569.1|  abortive phage infection protein                   135   2e-31   
ref|WP_006633320.1|  abortive phage infection protein                   135   2e-31   
ref|WP_009784581.1|  abortive phage infection protein                   135   2e-31   
emb|CDN11786.1|  hypothetical protein RintRC_6086                       134   3e-31   
ref|XP_001700469.1|  metal-dependent CAAX amino terminal protease...    129   3e-31   Chlamydomonas reinhardtii
ref|WP_028083018.1|  abortive phage infection protein                   134   3e-31   
ref|WP_037218212.1|  abortive phage infection protein                   134   3e-31   
ref|WP_023064005.1|  CAAX protease self-immunity family protein         134   3e-31   
ref|WP_015221989.1|  abortive infection protein                         134   3e-31   
ref|WP_006530204.1|  putative metal-dependent membrane protease         134   5e-31   
ref|WP_028090624.1|  abortive phage infection protein                   133   7e-31   
ref|WP_006510963.1|  putative metal-dependent membrane protease         133   8e-31   
ref|WP_017715794.1|  hypothetical protein                               133   1e-30   
ref|WP_015160360.1|  putative metal-dependent membrane protease         133   1e-30   
ref|WP_006275617.1|  abortive phage infection protein                   132   1e-30   
ref|WP_039725813.1|  hypothetical protein                               132   1e-30   
ref|WP_017288393.1|  hypothetical protein                               132   2e-30   
ref|WP_019508695.1|  hypothetical protein                               132   2e-30   
ref|WP_026101894.1|  abortive phage infection protein                   131   3e-30   
ref|WP_030006069.1|  CAAX protease                                      131   4e-30   
ref|WP_012305909.1|  CAAX amino protease                                131   4e-30   
ref|WP_017320949.1|  abortive phage infection protein                   131   4e-30   
ref|WP_029681615.1|  CAAX protease                                      131   4e-30   
ref|WP_015212375.1|  Abortive infection protein                         131   4e-30   
ref|WP_009555084.1|  putative metal-dependent membrane protease         130   5e-30   
ref|WP_015203179.1|  abortive infection protein                         130   7e-30   
ref|WP_009344607.1|  abortive phage infection protein                   130   9e-30   
ref|WP_015230125.1|  metal-dependent membrane protease                  129   2e-29   
ref|WP_006456997.1|  CAAX amino terminal protease family                128   4e-29   
ref|WP_018399233.1|  hypothetical protein                               128   5e-29   
ref|WP_009631880.1|  putative metal-dependent membrane protease         128   5e-29   
dbj|BAP17592.1|  abortive infection protein                             127   8e-29   
gb|EHJ12771.1|  Abortive infection protein                              124   1e-28   
ref|WP_021836623.1|  Abortive infection protein                         123   2e-28   
ref|WP_035826525.1|  abortive phage infection protein                   125   2e-28   
ref|XP_001421859.1|  predicted protein                                  121   3e-28   Ostreococcus lucimarinus CCE9901
ref|WP_021829879.1|  Abortive infection protein                         125   5e-28   
ref|WP_007305940.1|  abortive phage infection protein                   125   5e-28   
ref|WP_008234090.1|  Abortive infection protein                         125   6e-28   
ref|WP_027401133.1|  abortive phage infection protein                   124   6e-28   
gb|KFF41437.1|  putative metal-dependent membrane protease              122   3e-27   
ref|WP_015080392.1|  abortive infection protein                         122   5e-27   
ref|WP_009544848.1|  MULTISPECIES: abortive phage infection protein     122   5e-27   
ref|WP_015219444.1|  abortive infection protein                         122   5e-27   
ref|WP_026099232.1|  hypothetical protein                               122   7e-27   
ref|WP_015955015.1|  abortive phage infection protein                   121   8e-27   
ref|XP_007512818.1|  predicted protein                                  120   1e-26   
ref|WP_010473563.1|  peptidase                                          119   6e-26   
ref|WP_039780122.1|  peptidase                                          119   7e-26   
ref|WP_008277033.1|  abortive phage infection protein                   119   8e-26   
ref|WP_011611783.1|  abortive phage infection protein                   118   1e-25   
ref|WP_016515540.1|  CAAX amino terminal protease self- immunity        117   2e-25   
ref|WP_002758417.1|  abortive phage infection protein                   117   2e-25   
ref|WP_002783197.1|  Abortive infection protein                         117   2e-25   
ref|WP_002789067.1|  abortive phage infection protein                   117   3e-25   
ref|WP_002795086.1|  abortive phage infection protein                   117   3e-25   
ref|WP_002747965.1|  CAAX amino terminal protease family protein        117   3e-25   
ref|WP_002801231.1|  abortive phage infection protein                   116   4e-25   
emb|CEG00547.1|  CAAX amino terminal protease                           114   5e-25   
ref|WP_012953634.1|  abortive phage infection protein                   116   6e-25   
dbj|GAL94240.1|  hypothetical protein N44_02820                         115   8e-25   
ref|WP_002738495.1|  CAAX amino terminal protease family protein        115   1e-24   
ref|WP_002778370.1|  abortive phage infection protein                   115   1e-24   
ref|WP_024969764.1|  abortive phage infection protein                   115   1e-24   
ref|WP_008229995.1|  Abortive infection protein                         108   2e-24   
ref|WP_008202035.1|  abortive phage infection protein                   115   2e-24   
ref|WP_002768655.1|  abortive phage infection protein                   115   2e-24   
ref|WP_011243347.1|  hypothetical protein                               114   2e-24   
ref|WP_002756130.1|  abortive phage infection protein                   114   2e-24   
ref|WP_015163386.1|  abortive infection protein                         114   2e-24   
ref|WP_012265482.1|  abortive phage infection protein                   114   2e-24   
ref|WP_011377596.1|  hypothetical protein                               114   2e-24   
ref|WP_002796784.1|  abortive phage infection protein                   114   3e-24   
ref|WP_015144430.1|  metal-dependent membrane protease                  112   1e-23   
ref|WP_013320567.1|  abortive phage infection protein                   110   9e-23   
ref|WP_015147945.1|  metal-dependent membrane protease                  109   2e-22   
ref|WP_026100828.1|  hypothetical protein                               106   2e-21   
ref|WP_011431455.1|  CAAX amino terminal protease                       105   3e-21   
ref|WP_012626968.1|  abortive infection protein                         103   1e-20   
ref|WP_015167154.1|  metal-dependent membrane protease                  103   1e-20   
ref|WP_035986145.1|  metal-dependent membrane protease                  103   2e-20   
ref|WP_011433748.1|  CAAX amino terminal protease                       102   3e-20   
ref|XP_003083864.1|  unnamed protein product                          99.4    5e-20   
ref|WP_026072788.1|  metal-dependent membrane protease                  101   9e-20   
ref|WP_019502188.1|  hypothetical protein                               101   1e-19   
ref|WP_012163967.1|  peptidase                                          100   1e-19   
ref|XP_001691345.1|  predicted protein                                94.4    3e-19   Chlamydomonas reinhardtii
ref|WP_010873047.1|  hypothetical protein                             99.8    3e-19   
gb|AIE72603.1|  Abortive infection protein                            99.8    3e-19   
ref|WP_009628867.1|  Abortive infection protein                       99.8    4e-19   
emb|CDY26986.1|  BnaC09g35970D                                        96.7    5e-19   
ref|XP_005651934.1|  Abi-domain-containing protein                    95.5    5e-19   
ref|XP_005848457.1|  hypothetical protein CHLNCDRAFT_144842           97.4    6e-19   
ref|XP_002946992.1|  hypothetical protein VOLCADRAFT_120396           96.7    2e-18   
ref|XP_001417530.1|  predicted protein                                93.6    2e-18   Ostreococcus lucimarinus CCE9901
gb|EKD06554.1|  abortive infection protein                            89.4    3e-18   
ref|XP_005819270.1|  hypothetical protein GUITHDRAFT_121552           93.6    3e-17   
gb|KFM28767.1|  Serine palmitoyltransferase 2                         92.4    1e-16   
ref|XP_003078834.1|  putative CAAX amino terminal protease family...  89.7    2e-16   
emb|CEF97615.1|  CAAX amino terminal protease                         89.7    3e-16   
ref|XP_005847247.1|  hypothetical protein CHLNCDRAFT_134232           87.0    5e-16   
ref|XP_005709210.1|  CAAX amino terminal protease family protein      89.4    6e-16   
ref|XP_005538284.1|  unknown protease                                 89.0    1e-15   
ref|XP_007512704.1|  predicted protein                                87.0    5e-15   
emb|CBJ33141.1|  conserved unknown protein                            85.9    1e-14   
ref|XP_010276955.1|  PREDICTED: uncharacterized protein LOC104611...  82.0    4e-14   
ref|NP_001077532.1|  CAAX amino terminal protease family protein      80.5    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|WP_015124194.1|  metal-dependent membrane protease                83.2    8e-14   
ref|XP_009110553.1|  PREDICTED: uncharacterized protein LOC103836...  80.1    9e-14   
ref|XP_010276954.1|  PREDICTED: uncharacterized protein LOC104611...  81.3    9e-14   
ref|XP_010276952.1|  PREDICTED: uncharacterized protein LOC104611...  81.6    9e-14   
ref|NP_973823.1|  CAAX amino terminal protease family protein         80.5    1e-13   
ref|WP_038556287.1|  protease                                         82.4    1e-13   
gb|EWM29775.1|  caax amino terminal protease family domain-contai...  82.8    1e-13   
ref|WP_032526819.1|  peptidase                                        82.0    2e-13   
gb|EPR63323.1|  CAAX amino terminal protease family protein           82.4    2e-13   
gb|KFG40832.1|  CAAX amino terminal protease family protein           81.6    2e-13   
ref|XP_010458920.1|  PREDICTED: uncharacterized protein LOC104740...  79.0    2e-13   
ref|XP_010495885.1|  PREDICTED: uncharacterized protein LOC104773...  79.0    3e-13   
emb|CDX84039.1|  BnaC08g16060D                                        80.1    3e-13   
gb|AAM65055.1|  unknown                                               80.1    4e-13   
ref|NP_563943.2|  CAAX amino terminal protease family protein         80.1    4e-13   
ref|XP_009110552.1|  PREDICTED: uncharacterized protein LOC103836...  79.7    4e-13   
ref|XP_009110551.1|  PREDICTED: uncharacterized protein LOC103836...  79.7    4e-13   
gb|AAF43926.1|AC012188_3  Contains similarity to a hypothetical p...  80.1    4e-13   
gb|KFG29121.1|  CAAX amino terminal protease family protein           81.3    5e-13   
gb|KGF93286.1|  putative membrane associated protease                 80.5    5e-13   
ref|WP_032513910.1|  peptidase                                        80.5    6e-13   
ref|XP_009148710.1|  PREDICTED: uncharacterized protein LOC103872...  77.8    7e-13   
ref|WP_011360425.1|  protease                                         79.7    8e-13   
ref|XP_002980171.1|  hypothetical protein SELMODRAFT_58140            77.4    8e-13   
ref|WP_032522502.1|  peptidase                                        79.7    9e-13   
ref|WP_006169711.1|  possible membrane associated protease            79.0    1e-12   
ref|WP_002805273.1|  peptidase                                        79.7    1e-12   
ref|XP_010931435.1|  PREDICTED: uncharacterized protein LOC105052...  78.6    1e-12   
emb|CDX96862.1|  BnaA08g24050D                                        78.6    1e-12   
ref|XP_010476474.1|  PREDICTED: uncharacterized protein LOC104755721  78.6    1e-12   
ref|XP_010495880.1|  PREDICTED: uncharacterized protein LOC104773...  78.6    1e-12   
ref|WP_009789258.1|  protease                                         79.3    1e-12   
ref|XP_010458918.1|  PREDICTED: uncharacterized protein LOC104740...  78.6    1e-12   
ref|XP_006417032.1|  hypothetical protein EUTSA_v10008130mg           78.2    2e-12   
gb|KFG46457.1|  CAAX amino terminal protease family protein           79.7    2e-12   
ref|XP_006306018.1|  hypothetical protein CARUB_v10011314mg           78.2    2e-12   
ref|XP_002892797.1|  hypothetical protein ARALYDRAFT_471595           77.8    2e-12   
ref|WP_025944521.1|  hypothetical protein                             75.5    2e-12   
gb|KFH02202.1|  CAAX amino terminal protease family protein           79.7    2e-12   
ref|XP_002367398.1|  CAAX amino terminal protease family domain-c...  79.7    2e-12   
gb|ESS34522.1|  CAAX amino terminal protease family protein           79.7    2e-12   
gb|KFH04691.1|  CAAX amino terminal protease family protein           79.7    2e-12   
gb|KFG57673.1|  CAAX amino terminal protease family protein           79.7    2e-12   
ref|XP_003886266.1|  Homology to unknown gene, related                79.7    2e-12   
ref|WP_012007339.1|  peptidase                                        78.6    2e-12   
ref|WP_011862535.1|  peptidase                                        78.6    2e-12   
ref|WP_024124923.1|  intramembrane C-terminal tripeptide endopept...  78.6    3e-12   
ref|WP_011363704.1|  protease                                         78.2    3e-12   
ref|WP_025956543.1|  hypothetical protein                             75.1    3e-12   
emb|CDY49101.1|  BnaA06g09050D                                        77.0    3e-12   
ref|XP_003061561.1|  predicted protein                                78.2    3e-12   
ref|XP_009148709.1|  PREDICTED: uncharacterized protein LOC103872...  77.0    3e-12   
ref|XP_002286185.1|  predicted protein                                78.2    4e-12   
ref|XP_008888309.1|  CAAX amino terminal protease family protein      78.6    4e-12   
ref|XP_008788011.1|  PREDICTED: uncharacterized protein LOC103705...  76.6    5e-12   
gb|AHF63152.1|  putative membrane associated protease                 77.4    5e-12   
ref|XP_010523460.1|  PREDICTED: uncharacterized protein LOC104801...  75.1    5e-12   
ref|NP_001142170.1|  hypothetical protein                             73.6    5e-12   
ref|WP_025957615.1|  peptidase                                        76.3    5e-12   
ref|WP_032524700.1|  peptidase                                        77.4    6e-12   
gb|EMS56159.1|  Putative membrane peptidase ydiL                      75.5    7e-12   
ref|WP_015107741.1|  metal-dependent membrane protease                77.4    7e-12   
ref|WP_025945771.1|  peptidase                                        77.0    7e-12   
ref|WP_025975749.1|  peptidase                                        77.0    7e-12   
ref|WP_025929235.1|  peptidase                                        76.3    8e-12   
ref|WP_032519402.1|  peptidase                                        77.0    8e-12   
ref|WP_032517783.1|  peptidase                                        76.6    9e-12   
gb|EYU28747.1|  hypothetical protein MIMGU_mgv1a008800mg              76.3    9e-12   
ref|WP_025971854.1|  peptidase                                        76.6    9e-12   
ref|WP_025934917.1|  peptidase                                        76.6    1e-11   
gb|ACF78295.1|  unknown                                               72.8    1e-11   
ref|WP_025965439.1|  peptidase                                        76.6    1e-11   
ref|WP_025931530.1|  MULTISPECIES: peptidase                          76.6    1e-11   
ref|XP_008625145.1|  hypothetical protein YYE_03274                   76.3    1e-11   
ref|WP_025967929.1|  peptidase                                        76.6    1e-11   
ref|WP_025955355.1|  peptidase                                        76.6    1e-11   
ref|WP_025924271.1|  peptidase                                        76.6    1e-11   
ref|WP_011818024.1|  peptidase                                        76.6    1e-11   
ref|WP_025969092.1|  peptidase                                        76.6    1e-11   
ref|WP_025894165.1|  MULTISPECIES: peptidase                          76.6    1e-11   
ref|WP_025926155.1|  peptidase                                        76.6    1e-11   
gb|EJK75171.1|  hypothetical protein THAOC_03116                      77.0    1e-11   
ref|WP_025953554.1|  peptidase                                        76.6    1e-11   
ref|WP_025943687.1|  peptidase                                        76.6    1e-11   
ref|WP_025973200.1|  peptidase                                        76.6    1e-11   
ref|WP_025929943.1|  peptidase                                        76.6    1e-11   
tpg|DAA61425.1|  TPA: hypothetical protein ZEAMMB73_931097            72.4    1e-11   
ref|WP_025947226.1|  peptidase                                        76.3    1e-11   
ref|WP_025941435.1|  peptidase                                        76.6    1e-11   
ref|WP_025890520.1|  peptidase                                        76.3    1e-11   
ref|WP_025978818.1|  peptidase                                        76.3    1e-11   
ref|WP_025962261.1|  peptidase                                        76.3    1e-11   
tpg|DAA48960.1|  TPA: hypothetical protein ZEAMMB73_611537            73.6    1e-11   
ref|WP_025972884.1|  peptidase                                        76.3    1e-11   
ref|WP_025959387.1|  peptidase                                        76.3    1e-11   
ref|WP_025948175.1|  peptidase                                        76.3    1e-11   
ref|WP_025959710.1|  peptidase                                        76.3    1e-11   
ref|WP_025939799.1|  peptidase                                        76.3    1e-11   
ref|WP_025887768.1|  MULTISPECIES: peptidase                          76.3    1e-11   
ref|WP_025964664.1|  peptidase                                        76.3    1e-11   
ref|WP_025891499.1|  MULTISPECIES: peptidase                          76.3    1e-11   
ref|WP_025925098.1|  MULTISPECIES: peptidase                          76.3    1e-11   
ref|WP_011057727.1|  hypothetical protein                             76.3    2e-11   
gb|AIQ94584.1|  putative membrane associated protease                 75.9    2e-11   
gb|ETW32065.1|  hypothetical protein PFFCH_00428                      73.2    2e-11   
ref|WP_032514888.1|  peptidase                                        75.9    2e-11   
ref|XP_001692462.1|  predicted protein                                73.2    2e-11   
ref|WP_025954012.1|  peptidase                                        75.5    2e-11   
ref|WP_025954465.1|  peptidase                                        75.5    2e-11   
ref|WP_028951467.1|  protease                                         75.5    2e-11   
ref|WP_025963608.1|  peptidase                                        75.5    2e-11   
ref|XP_010523459.1|  PREDICTED: uncharacterized protein LOC104801...  74.7    2e-11   
ref|XP_010523458.1|  PREDICTED: uncharacterized protein LOC104801...  74.7    2e-11   
ref|WP_025914334.1|  peptidase                                        75.5    3e-11   
ref|XP_745229.1|  protease                                            75.1    3e-11   
gb|EYU28749.1|  hypothetical protein MIMGU_mgv1a024984mg              74.7    3e-11   
dbj|BAJ85717.1|  predicted protein                                    74.3    3e-11   
gb|ACF86904.1|  unknown                                               72.8    3e-11   
ref|XP_010937146.1|  PREDICTED: uncharacterized protein LOC105056...  72.8    3e-11   
emb|CDR12589.1|  protease, putative                                   75.1    3e-11   
ref|XP_002886301.1|  CAAX amino terminal protease family protein      73.6    3e-11   
emb|CDS46245.1|  protease, putative                                   74.7    4e-11   
ref|XP_010257309.1|  PREDICTED: uncharacterized protein LOC104597460  74.3    4e-11   
ref|WP_011132151.1|  peptidase                                        74.7    4e-11   
ref|XP_677962.1|  protease                                            74.7    4e-11   
ref|XP_010937145.1|  PREDICTED: uncharacterized protein LOC105056...  73.6    4e-11   
ref|WP_029983698.1|  peptidase                                        69.7    4e-11   
ref|WP_025913506.1|  peptidase                                        74.7    4e-11   
ref|XP_010044740.1|  PREDICTED: uncharacterized protein LOC104433...  72.4    5e-11   
ref|XP_004135178.1|  PREDICTED: uncharacterized protein LOC101219539  73.9    5e-11   
gb|KEH19737.1|  CAAX amino terminal protease family protein           73.6    5e-11   
ref|XP_004516087.1|  PREDICTED: uncharacterized protein LOC101490706  73.6    5e-11   
gb|KEF43220.1|  metal-dependent membrane protease                     74.3    5e-11   
ref|XP_008784102.1|  PREDICTED: uncharacterized protein LOC103703133  73.6    6e-11   
ref|WP_006354756.1|  hypothetical protein [                           73.6    6e-11   
ref|XP_010937144.1|  PREDICTED: uncharacterized protein LOC105056...  73.6    6e-11   
ref|WP_035828872.1|  caax amino terminal protease family protein      74.3    6e-11   
tpg|DAA48961.1|  TPA: hypothetical protein ZEAMMB73_611537            73.2    7e-11   
ref|XP_010931434.1|  PREDICTED: uncharacterized protein LOC105052...  72.8    8e-11   
ref|XP_001785505.1|  predicted protein                                72.0    8e-11   
ref|XP_008668484.1|  PREDICTED: hypothetical protein isoform X1       73.2    8e-11   
ref|XP_008446340.1|  PREDICTED: uncharacterized protein LOC103489...  73.2    9e-11   
ref|XP_008788017.1|  PREDICTED: uncharacterized protein LOC103705...  71.2    9e-11   
ref|NP_001141914.1|  uncharacterized protein LOC100274063             73.2    9e-11   
ref|XP_003578112.1|  PREDICTED: uncharacterized protein LOC100835467  72.8    9e-11   
tpg|DAA61422.1|  TPA: CAAX amino terminal protease family protein     72.8    9e-11   
gb|ACG31838.1|  CAAX amino terminal protease family protein           72.8    1e-10   
ref|XP_010931436.1|  PREDICTED: uncharacterized protein LOC105052...  72.4    1e-10   
emb|CDP00329.1|  unnamed protein product                              72.4    1e-10   
ref|XP_002951692.1|  hypothetical protein VOLCADRAFT_117916           70.9    2e-10   
ref|XP_010044739.1|  PREDICTED: uncharacterized protein LOC104433...  72.0    2e-10   
ref|XP_002270372.1|  PREDICTED: uncharacterized protein LOC100251779  72.0    2e-10   
ref|XP_007198805.1|  hypothetical protein PRUPE_ppa025767mg           69.3    2e-10   
ref|NP_001063162.1|  Os09g0413200                                     68.9    2e-10   
ref|XP_006366111.1|  PREDICTED: uncharacterized protein LOC102579521  72.0    2e-10   
ref|WP_034130016.1|  hypothetical protein                             69.3    2e-10   
gb|AAT38683.2|  CAAX amino terminal protease family protein, puta...  71.2    2e-10   
ref|XP_008389475.1|  PREDICTED: uncharacterized protein LOC103451824  72.0    2e-10   
ref|XP_009360341.1|  PREDICTED: uncharacterized protein LOC103950826  71.6    2e-10   
ref|XP_008339907.1|  PREDICTED: uncharacterized protein LOC103402902  71.6    2e-10   
gb|EYU28746.1|  hypothetical protein MIMGU_mgv1a008810mg              71.6    3e-10   
ref|XP_006388524.1|  hypothetical protein POPTR_0163s00230g           67.8    3e-10   
ref|XP_004956805.1|  PREDICTED: uncharacterized protein LOC101774...  71.2    3e-10   
gb|ETW38295.1|  hypothetical protein PFTANZ_01027                     72.0    3e-10   
ref|XP_004956804.1|  PREDICTED: uncharacterized protein LOC101774...  71.6    3e-10   
ref|XP_001352007.1|  protease, putative                               72.0    3e-10   
emb|CDO64195.1|  protease, putative                                   72.0    3e-10   
gb|EWC88710.1|  hypothetical protein PFNF54_02554                     72.0    3e-10   
ref|WP_021137404.1|  CAAX amino terminal protease                     68.9    3e-10   
ref|XP_002311592.1|  CAAX amino terminal protease family protein      71.2    3e-10   
ref|WP_019476266.1|  hypothetical protein                             71.6    3e-10   
ref|XP_011025753.1|  PREDICTED: uncharacterized protein LOC105126551  71.2    3e-10   
ref|XP_008788008.1|  PREDICTED: uncharacterized protein LOC103705...  70.9    4e-10   
ref|WP_011376075.1|  peptidase                                        71.6    4e-10   
gb|KDO42457.1|  hypothetical protein CISIN_1g026106mg                 68.9    4e-10   
gb|EKN36857.1|  CAAX amino terminal protease                          69.7    4e-10   
ref|WP_034542056.1|  hypothetical protein                             67.8    4e-10   
ref|XP_007224691.1|  hypothetical protein PRUPE_ppa025479mg           70.9    4e-10   
ref|XP_007046110.1|  CAAX amino terminal protease family protein ...  70.9    5e-10   
gb|ABO93007.1|  putative CAAX aminoterminal protease                  70.5    5e-10   
gb|AAT38755.2|  CAAX amino terminal protease family protein, puta...  70.1    5e-10   
ref|WP_027378295.1|  CAAX protease                                    69.7    5e-10   
ref|XP_007046109.1|  CAAX amino terminal protease family protein ...  70.9    5e-10   
ref|XP_004238797.1|  PREDICTED: uncharacterized protein LOC101265823  70.5    5e-10   
emb|CDU17537.1|  protease, putative                                   71.2    5e-10   
ref|XP_006491646.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    5e-10   
ref|XP_009624680.1|  PREDICTED: uncharacterized protein LOC104115706  70.5    5e-10   
ref|WP_021134049.1|  CAAX amino terminal protease                     69.3    5e-10   
gb|AAU90306.2|  CAAX amino terminal protease family protein, puta...  70.5    6e-10   
ref|WP_019474046.1|  hypothetical protein                             71.2    6e-10   
ref|WP_011948283.1|  CAAX amino terminal protease                     69.3    6e-10   
ref|XP_002522426.1|  prenyl-dependent CAAX protease, putative         70.5    6e-10   
gb|ETB60326.1|  hypothetical protein YYC_02633                        70.9    6e-10   
ref|XP_009775664.1|  PREDICTED: uncharacterized protein LOC104225...  68.9    6e-10   
ref|WP_013042498.1|  abortive infection protein                       69.7    6e-10   
ref|XP_011075500.1|  PREDICTED: uncharacterized protein LOC105159963  70.5    6e-10   
gb|KDO42455.1|  hypothetical protein CISIN_1g026106mg                 68.9    7e-10   
ref|XP_008221625.1|  PREDICTED: uncharacterized protein LOC103321584  70.5    7e-10   
ref|WP_016428711.1|  hypothetical protein                             69.3    7e-10   
gb|KDO42456.1|  hypothetical protein CISIN_1g026106mg                 68.6    7e-10   
ref|WP_036897514.1|  peptidase                                        70.9    7e-10   
ref|XP_006371570.1|  CAAX amino terminal protease family protein      68.2    8e-10   
ref|WP_011128622.1|  protease                                         70.5    8e-10   
ref|XP_006827217.1|  hypothetical protein AMTR_s00010p00259870        70.1    8e-10   
ref|WP_011143167.1|  hypothetical protein                             70.5    9e-10   
ref|WP_024536060.1|  hypothetical protein                             68.9    9e-10   
ref|XP_001420366.1|  predicted protein                                69.7    1e-09   
ref|XP_009775663.1|  PREDICTED: uncharacterized protein LOC104225...  69.3    1e-09   
ref|WP_034678739.1|  CAAX protease                                    68.9    1e-09   
ref|XP_007158659.1|  hypothetical protein PHAVU_002G171700g           69.7    1e-09   
ref|XP_006491645.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    1e-09   
gb|ABO92979.1|  putative CAAX amino terminal protease                 69.7    1e-09   
ref|XP_009794989.1|  PREDICTED: uncharacterized protein LOC104241...  69.3    1e-09   
gb|KDP41192.1|  hypothetical protein JCGZ_15599                       69.7    1e-09   
ref|XP_006438679.1|  hypothetical protein CICLE_v10032082mg           69.3    1e-09   
ref|XP_006660160.1|  PREDICTED: uncharacterized protein LOC102705837  69.7    1e-09   
ref|XP_006483160.1|  PREDICTED: uncharacterized protein LOC102618349  69.7    1e-09   
gb|KHN06857.1|  hypothetical protein glysoja_033098                   69.3    1e-09   
ref|XP_006586026.1|  PREDICTED: uncharacterized protein LOC100808...  69.3    1e-09   
gb|ABI34291.1|  CAAX amino terminal protease family protein, puta...  69.3    1e-09   
ref|XP_006660621.1|  PREDICTED: uncharacterized protein LOC102712385  69.3    2e-09   
ref|XP_009591219.1|  PREDICTED: uncharacterized protein LOC104088...  67.8    2e-09   
ref|XP_006586025.1|  PREDICTED: uncharacterized protein LOC100808...  68.9    2e-09   



>ref|XP_010060044.1| PREDICTED: uncharacterized protein LOC104447982 [Eucalyptus grandis]
 gb|KCW90578.1| hypothetical protein EUGRSUZ_A02683 [Eucalyptus grandis]
Length=352

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR LA+F PLPS+WF+FSL GKWHFDVGL C+MFPL+NRLSQVNLNL 
Sbjct  174  DVVEGLAGIAILHRCLARFRPLPSDWFRFSLKGKWHFDVGLGCLMFPLVNRLSQVNLNLL  233

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVTVS V QSIV RDPVAM LYA++VSICAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  234  PVLPSTPVTVSTVEQSIVARDPVAMALYAVVVSICAPIWEEIVFRGFLLPSLTKYMPVWC  293

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLLA M+LH LWNA+VFLDLMK
Sbjct  294  SILVSSLAFALAHFNMQRMLPLIFLGVVMGAVFARSRNLLASMVLHSLWNAFVFLDLMK  352


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDD-IPQVVNSEFDQPNNAKSDLVFHLKKAFHAVLHIE  855
             RWR SC R +  + E+ + ESV+D  + ++ N + DQ NN K +    + K   A+   +
Sbjct  58    RWRFSCFRPDEFASENPDSESVEDKRLEKLENHDIDQSNNGKKNWFSSILKVRDAIFRAK  117

Query  854   PWTVPWTVRTIVQ  816
             PWTVPWT  TI+Q
Sbjct  118   PWTVPWTAETILQ  130



>ref|XP_004173484.1| PREDICTED: uncharacterized LOC101217840, partial [Cucumis sativus]
Length=253

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   GMAILHR L++F PLPS+WFKFS+ GKW FDVGL C+MFPL+NRLSQVNLNL 
Sbjct  75   DVAEGLTGMAILHRCLSRFHPLPSSWFKFSIEGKWQFDVGLGCLMFPLVNRLSQVNLNLL  134

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+TVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  135  PVLPSTPITVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWC  194

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+ LG+++GT++ R+RNLL  MLLH LWNA+VFLDLMK
Sbjct  195  SILVSSIAFALAHFNMQRMLPLILLGMVMGTVYARTRNLLPSMLLHSLWNAFVFLDLMK  253



>gb|KGN49906.1| hypothetical protein Csa_5G139840 [Cucumis sativus]
Length=350

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   GMAILHR L++F PLPS+WFKFS+ GKW FDVGL C+MFPL+NRLSQVNLNL 
Sbjct  172  DVAEGLTGMAILHRCLSRFHPLPSSWFKFSIEGKWQFDVGLGCLMFPLVNRLSQVNLNLL  231

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+TVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  232  PVLPSTPITVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWC  291

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+ LG+++GT++ R+RNLL  MLLH LWNA+VFLDLMK
Sbjct  292  SILVSSIAFALAHFNMQRMLPLILLGMVMGTVYARTRNLLPSMLLHSLWNAFVFLDLMK  350


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDDIPQ--VVNSEFDQPNNAKSDLVFHLKKAFHAVLHI  858
             +W + C RRE TS E+   +SV+D + +  V   E +QP++ + + V  L KA  ++   
Sbjct  55    KWEILCFRREETSPENFESKSVEDKLAEDLVTTPEINQPSDPRKEWVSSLYKAVESIFVT  114

Query  857   EPWTVPWTVRTIVQG---WQSSIVVLQSF  780
             +PW VPWT +TIVQ    W +S  V+ S+
Sbjct  115   KPWVVPWTAKTIVQVMLLWVASFWVIGSW  143



>ref|XP_004145910.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217840 
[Cucumis sativus]
Length=366

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   GMAILHR L++F PLPS+WFKFS+ GKW FDVGL C+MFPL+NRLSQVNLNL 
Sbjct  188  DVAEGLTGMAILHRCLSRFHPLPSSWFKFSIEGKWQFDVGLGCLMFPLVNRLSQVNLNLL  247

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+TVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  248  PVLPSTPITVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWC  307

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+ LG+++GT++ R+RNLL  MLLH LWNA+VFLDLMK
Sbjct  308  SILVSSIAFALAHFNMQRMLPLILLGMVMGTVYARTRNLLPSMLLHSLWNAFVFLDLMK  366



>emb|CDP05121.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR LA+F PL S+WF+FS  GKW  DVGL C+MFPL+N+LSQVNLNLF
Sbjct  97   DVAEGLTGIAILHRCLARFHPLSSDWFRFSFRGKWQIDVGLGCLMFPLVNQLSQVNLNLF  156

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPS+PVTVSNV QSIV RDP+AMTLYAI+V++CAPIWEE++FRGFLLPSLT+YMPVW 
Sbjct  157  PLLPSSPVTVSNVEQSIVARDPIAMTLYAIVVAVCAPIWEEVVFRGFLLPSLTKYMPVWS  216

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QRMLPL+FLG+++G +F R+RNL A +LLH LWNA+VFLDL+K
Sbjct  217  SILVSSVAFALAHFNVQRMLPLIFLGIVMGVVFARTRNLFASILLHSLWNAFVFLDLLK  275



>ref|XP_008437553.1| PREDICTED: uncharacterized protein LOC103482932 [Cucumis melo]
Length=350

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   GMAILHR L++F PLP +WFKFS  GKW FDVGL C+MFPL+NRLSQVNLNL 
Sbjct  172  DVAEGLTGMAILHRCLSRFHPLPPSWFKFSFEGKWQFDVGLGCLMFPLVNRLSQVNLNLL  231

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+TVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  232  PVLPSTPITVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWC  291

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+ LG+++GT++ R+RNLL  MLLH LWNA+VFLDLMK
Sbjct  292  SILVSSIAFALAHFNMQRMLPLILLGMVMGTVYARTRNLLPSMLLHSLWNAFVFLDLMK  350



>gb|ADN33781.1| CAAX amino terminal protease family [Cucumis melo subsp. melo]
Length=363

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   GMAILHR L++F PLP +WFKFS  GKW FDVGL C+MFPL+NRLSQVNLNL 
Sbjct  185  DVAEGLTGMAILHRCLSRFHPLPPSWFKFSFEGKWQFDVGLGCLMFPLVNRLSQVNLNLL  244

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+TVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  245  PVLPSTPITVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWC  304

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+ LG+++GT++ R+RNLL  MLLH LWNA+VFLDLMK
Sbjct  305  SILVSSIAFALAHFNMQRMLPLILLGMVMGTVYARTRNLLPSMLLHSLWNAFVFLDLMK  363



>gb|AFK34486.1| unknown [Medicago truncatula]
Length=174

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPSTP  637
            G+AILHR L KF PL S+WFKF L GKW FDVGL C+MFPLIN LSQ+NLNL+P L   P
Sbjct  3    GIAILHRCLEKFKPLSSDWFKFELKGKWQFDVGLGCLMFPLINHLSQMNLNLWPVLQYAP  62

Query  636  VTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSI  457
            VTVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMPVW ++L+SS+
Sbjct  63   VTVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPVWSAVLVSSV  122

Query  456  AFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            AFA AHF++QRMLPLVFLG+++G +FVRSRNLL  MLLH LWNA+VFLDLMK
Sbjct  123  AFAFAHFNIQRMLPLVFLGMVMGAVFVRSRNLLPSMLLHSLWNAFVFLDLMK  174



>gb|AFK38413.1| unknown [Medicago truncatula]
Length=233

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR L KF PL S+WFKF L GKW FDVGL C+MFPLIN LSQ+NLNL+
Sbjct  55   DVAEGMVGIAILHRCLEKFKPLSSDWFKFELKGKWQFDVGLGCLMFPLINHLSQMNLNLW  114

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L   PVTVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMPVW 
Sbjct  115  PVLQYAPVTVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPVWS  174

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++L+SS+AFA AHF++QRMLPLVFLG+++G +FVRSRNLL  MLLH LWNA+VFLDL K
Sbjct  175  AVLVSSVAFAFAHFNIQRMLPLVFLGMVMGAVFVRSRNLLPSMLLHSLWNAFVFLDLTK  233



>ref|XP_003556135.1| PREDICTED: uncharacterized protein LOC100808097 isoform 1 [Glycine 
max]
Length=336

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AIL   LAKF PL S+WFKF + GKW FDVGL C+MFPLIN+LSQ+NLNL 
Sbjct  158  DVAEGVVGIAILRHCLAKFQPLSSDWFKFEVKGKWQFDVGLGCLMFPLINQLSQMNLNLL  217

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L  TPVT+S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  218  PVLQYTPVTISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWS  277

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QRMLPLVFLG+++GT+FVRSRNL   MLLH LWNA+VFLDLMK
Sbjct  278  AILVSSIAFALAHFNIQRMLPLVFLGMVMGTVFVRSRNLFPSMLLHSLWNAFVFLDLMK  336



>ref|XP_003592164.1| hypothetical protein MTR_1g099420 [Medicago truncatula]
 gb|AES62415.1| CAAX amino terminal protease family protein [Medicago truncatula]
Length=342

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR L KF PL S+WFKF L GKW FDVGL C+MFPLIN LSQ+NLNL+
Sbjct  164  DVAEGMVGIAILHRCLEKFKPLSSDWFKFELKGKWQFDVGLGCLMFPLINHLSQMNLNLW  223

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L   PVTVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMPVW 
Sbjct  224  PVLQYAPVTVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPVWS  283

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++L+SS+AFA AHF++QRMLPLVFLG+++G +FVRSRNLL  MLLH LWNA+VFLDLMK
Sbjct  284  AVLVSSVAFAFAHFNIQRMLPLVFLGMVMGAVFVRSRNLLPSMLLHSLWNAFVFLDLMK  342


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 5/112 (4%)
 Frame = -3

Query  1139  PPPSSRYRLNPPALSKLSL--PQLRTSIVTASLQLQNARWRLSCSRREHTSLESVNYESV  966
             PP S   R N  + S++SL  P + +     S  L   +WR+ C +  +   ES + E  
Sbjct  10    PPFSLPIRHNSSS-SRVSLFNPTISSPFPLQSFTLSTNKWRVLCFKHRNNPSESTDSEFK  68

Query  965   DDDIPQ-VVNSEFDQPNN-AKSDLVFHLKKAFHAVLHIEPWTVPWTVRTIVQ  816
             +D + Q  V  + D+P +  K D +  L    H VL +EPW VPWT +TIVQ
Sbjct  69    EDKLSQDSVKFKGDEPKDLKKKDWLTALHTIIHTVLSVEPWKVPWTAKTIVQ  120



>ref|XP_004496505.1| PREDICTED: uncharacterized protein LOC101505330 [Cicer arietinum]
Length=335

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR LAKF PL S+WFKF L GKW FDVG  C+MFPLIN LSQ+NLNL 
Sbjct  157  DVAEGVVGIAILHRCLAKFKPLSSDWFKFELKGKWQFDVGFGCLMFPLINHLSQMNLNLL  216

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L   PVTVS+V QSIV RDPVAM LYA++VS+CAPIWEE++FRGFLLPSLT+YMPVW 
Sbjct  217  PVLQYAPVTVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEVVFRGFLLPSLTKYMPVWS  276

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++++SS+AFALAHF++QRMLPLVFLG+++G +FVRSRNLL  MLLH LWNA+VF+DLMK
Sbjct  277  AVIVSSVAFALAHFNIQRMLPLVFLGMVMGAVFVRSRNLLPSMLLHSLWNAFVFMDLMK  335



>ref|XP_003556136.1| PREDICTED: uncharacterized protein LOC100808097 isoform 2 [Glycine 
max]
 gb|KHN12922.1| hypothetical protein glysoja_042180 [Glycine soja]
Length=359

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AIL   LAKF PL S+WFKF + GKW FDVGL C+MFPLIN+LSQ+NLNL 
Sbjct  181  DVAEGVVGIAILRHCLAKFQPLSSDWFKFEVKGKWQFDVGLGCLMFPLINQLSQMNLNLL  240

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L  TPVT+S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  241  PVLQYTPVTISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWS  300

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QRMLPLVFLG+++GT+FVRSRNL   MLLH LWNA+VFLDLMK
Sbjct  301  AILVSSIAFALAHFNIQRMLPLVFLGMVMGTVFVRSRNLFPSMLLHSLWNAFVFLDLMK  359



>ref|XP_003556137.1| PREDICTED: uncharacterized protein LOC100808097 isoform 3 [Glycine 
max]
Length=360

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AIL   LAKF PL S+WFKF + GKW FDVGL C+MFPLIN+LSQ+NLNL 
Sbjct  182  DVAEGVVGIAILRHCLAKFQPLSSDWFKFEVKGKWQFDVGLGCLMFPLINQLSQMNLNLL  241

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L  TPVT+S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  242  PVLQYTPVTISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWS  301

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QRMLPLVFLG+++GT+FVRSRNL   MLLH LWNA+VFLDLMK
Sbjct  302  AILVSSIAFALAHFNIQRMLPLVFLGMVMGTVFVRSRNLFPSMLLHSLWNAFVFLDLMK  360



>ref|XP_010261427.1| PREDICTED: uncharacterized protein LOC104600265 [Nelumbo nucifera]
Length=349

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH  +A+F+PLPS+WF FS  G W FDV L C+ FPL+NRLSQ+NL+LF
Sbjct  171  DVAEGLAGIAILHSCIARFYPLPSDWFSFSFSGNWQFDVTLGCLTFPLVNRLSQINLDLF  230

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPV VS+V QSI+ RDPVAM LYA++VS+CAP+WEEIIFRGFLLPSL++YMPVW 
Sbjct  231  PLLPSTPVAVSSVEQSIIARDPVAMALYAVVVSVCAPVWEEIIFRGFLLPSLSKYMPVWC  290

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SILLSS+AFALAHF++QRM+PL+FLGV++G +F RSRNLLA MLLH LWN +VFLDL+K
Sbjct  291  SILLSSVAFALAHFNVQRMVPLIFLGVVMGAVFARSRNLLASMLLHSLWNGFVFLDLLK  349



>ref|XP_006439445.1| hypothetical protein CICLE_v10020944mg [Citrus clementina]
 gb|ESR52685.1| hypothetical protein CICLE_v10020944mg [Citrus clementina]
Length=346

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLL  227

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PS PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  228  PLMPSAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  287

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  288  AILVSSVAFALAHFNVQRMLPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  346


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N+ K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNSIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|XP_007040382.1| CAAX amino terminal protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24883.1| CAAX amino terminal protease family protein isoform 1 [Theobroma 
cacao]
Length=347

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WFKFSL GKW FDV L C+MFP++NRLSQ NLNL 
Sbjct  169  DVTEGLAGIAILHRCLSQFHPLPSDWFKFSLKGKWLFDVVLGCLMFPVVNRLSQFNLNLL  228

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PSTPVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  229  PLMPSTPVTLSSVEQSILARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  288

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLG+++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  289  AILVSSVAFALAHFNVQRMLPLIFLGMVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  347



>ref|XP_006476474.1| PREDICTED: uncharacterized protein LOC102608238 isoform X1 [Citrus 
sinensis]
Length=346

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLL  227

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PS PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  228  PLMPSAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  287

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  288  AILVSSVAFALAHFNVQRMLPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  346


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N  K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNPIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|XP_006476476.1| PREDICTED: uncharacterized protein LOC102608238 isoform X3 [Citrus 
sinensis]
Length=320

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  825  YCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
            + AG+AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL P +P
Sbjct  146  HVAGIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLLPLMP  205

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW +IL+
Sbjct  206  SAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWCAILV  265

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  266  SSVAFALAHFNVQRMLPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  320


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N  K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNPIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|XP_010053192.1| PREDICTED: uncharacterized protein LOC104441702 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77457.1| hypothetical protein EUGRSUZ_D01795 [Eucalyptus grandis]
Length=351

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILHR L++F+PLPS+WF FSL GKWHFDV L C++FPL+NRLSQ+NL+L 
Sbjct  173  DVTEGVAGILILHRCLSRFYPLPSDWFSFSLKGKWHFDVALGCLLFPLVNRLSQINLDLL  232

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDP+AM LYA++V++CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  233  PILPSTPVTLSSVEQSILARDPIAMALYALVVTVCAPVWEEIVFRGFLLPSLTKYMPVWC  292

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +ILLSS+AFALAHF+ QRMLPL+FLGV++G +F RSRNLL  MLLH LWNA+VFL LM+
Sbjct  293  AILLSSVAFALAHFNGQRMLPLIFLGVVMGLLFTRSRNLLPSMLLHSLWNAFVFLSLMR  351



>ref|NP_001239773.1| uncharacterized protein LOC100775964 [Glycine max]
 gb|ACU17900.1| unknown [Glycine max]
 gb|KHN21804.1| hypothetical protein glysoja_027688 [Glycine soja]
Length=336

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILH  LAKF PL S+WFKF L GKW FDVGL C+MFPLIN+LSQ+NLNL 
Sbjct  158  DVAEGVIGIAILHHCLAKFQPLSSDWFKFELKGKWPFDVGLGCLMFPLINQLSQMNLNLL  217

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L  TPV +S+V QSIV RD VAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  218  PVLQYTPVAISSVEQSIVARDLVAMALYAVIVSVCAPIWEEIVFRGFLLPSLTKYMPVWS  277

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QR+LPLVFLG+++GT+FVRSRNLL  MLLH LWNA+VFLDLMK
Sbjct  278  AILVSSIAFALAHFNIQRVLPLVFLGMVMGTVFVRSRNLLPSMLLHSLWNAFVFLDLMK  336



>gb|KDP25361.1| hypothetical protein JCGZ_20517 [Jatropha curcas]
Length=352

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WF+FSL G W FDV L C MFPL+NRLSQ NL+L 
Sbjct  174  DVTEGLAGIAILHRCLSRFRPLPSDWFRFSLKGNWMFDVALGCFMFPLVNRLSQFNLSLL  233

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  234  PILPSTPVTLSSVEQSIAARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  293

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLGV++G IF RSRNL+  MLLH LWN +VFLDLM+
Sbjct  294  AILVSSVAFALAHFNVQRMLPLIFLGVVMGVIFARSRNLMPSMLLHSLWNGFVFLDLMR  352



>ref|XP_003592165.1| hypothetical protein MTR_1g099420 [Medicago truncatula]
Length=437

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR L KF PL S+WFKF L GKW FDVGL C+MFPLIN LSQ+NLNL+
Sbjct  259  DVAEGMVGIAILHRCLEKFKPLSSDWFKFELKGKWQFDVGLGCLMFPLINHLSQMNLNLW  318

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L   PVTVS+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMPVW 
Sbjct  319  PVLQYAPVTVSSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPVWS  378

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++L+SS+AFA AHF++QRMLPLVFLG+++G +FVRSRNLL  MLLH LWNA+VFLDLMK
Sbjct  379  AVLVSSVAFAFAHFNIQRMLPLVFLGMVMGAVFVRSRNLLPSMLLHSLWNAFVFLDLMK  437


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 5/112 (4%)
 Frame = -3

Query  1139  PPPSSRYRLNPPALSKLSL--PQLRTSIVTASLQLQNARWRLSCSRREHTSLESVNYESV  966
             PP S   R N  + S++SL  P + +     S  L   +WR+ C +  +   ES + E  
Sbjct  10    PPFSLPIRHNSSS-SRVSLFNPTISSPFPLQSFTLSTNKWRVLCFKHRNNPSESTDSEFK  68

Query  965   DDDIPQ-VVNSEFDQPNN-AKSDLVFHLKKAFHAVLHIEPWTVPWTVRTIVQ  816
             +D + Q  V  + D+P +  K D +  L    H VL +EPW VPWT +TIVQ
Sbjct  69    EDKLSQDSVKFKGDEPKDLKKKDWLTALHTIIHTVLSVEPWKVPWTAKTIVQ  120



>emb|CAN67252.1| hypothetical protein VITISV_023148 [Vitis vinifera]
Length=223

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            +  +  +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL 
Sbjct  45   EVTEGLSGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLL  104

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P  PSTPVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW 
Sbjct  105  PVAPSTPVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWC  164

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  165  SILVSSVAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  223



>ref|XP_007143506.1| hypothetical protein PHAVU_007G077200g [Phaseolus vulgaris]
 gb|ESW15500.1| hypothetical protein PHAVU_007G077200g [Phaseolus vulgaris]
Length=336

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AIL   LAKF PL S+WFKF L GKW FDVGL C+MFP IN+LSQ+NLNL 
Sbjct  158  DVAEGVVGIAILWHCLAKFQPLSSDWFKFELKGKWQFDVGLGCLMFPFINQLSQMNLNLL  217

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L  TPVT+S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLT+YMPVW 
Sbjct  218  PVLQYTPVTISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTKYMPVWS  277

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS++FALAHF++QR+LPLVFLG+++GT+FVRSRNLL  MLLH LWNA+VFLDLMK
Sbjct  278  AILVSSVSFALAHFNIQRILPLVFLGMVMGTVFVRSRNLLPSMLLHSLWNAFVFLDLMK  336


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query  1055  ASLQLQNARWRLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHLKKA  879
             +S+     +WR  C R E++S E    E  DD + + +V  E DQ ++ K D    + + 
Sbjct  34    SSITFPTKKWRFLCYRHENSSSEINGSELKDDKLAEDLVKLEGDQSDDLKKDWFAAIHEV  93

Query  878   FHAVLHIEPWTVPWTVRTIVQ  816
                + ++EPWTVPWT +TIVQ
Sbjct  94    ITVIHNVEPWTVPWTAKTIVQ  114



>gb|KHG09262.1| Putative membrane peptidase ydiL [Gossypium arboreum]
Length=347

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+AILHR L++F PLPS+WFKFSL GKW FDV L C+MFP+INRLSQ NLNL 
Sbjct  169  DVSEGLTGIAILHRCLSQFHPLPSDWFKFSLRGKWVFDVALGCLMFPIINRLSQFNLNLL  228

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PS PVT+S+V QSI+ RDPVAM LYAI+VS+CAPIWEEIIFRGFLLPSLT+YMPVW 
Sbjct  229  PVIPSAPVTLSSVEQSILARDPVAMALYAIVVSVCAPIWEEIIFRGFLLPSLTKYMPVWC  288

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLG+++G +F R+RNLL  MLLH LWN +VFLDLM+
Sbjct  289  AILVSSVAFALAHFNVQRMLPLIFLGMVMGVVFARTRNLLPSMLLHSLWNGFVFLDLMR  347



>ref|XP_009408532.1| PREDICTED: uncharacterized protein LOC103990947 [Musa acuminata 
subsp. malaccensis]
Length=379

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR LA+F PLPS WF+FSL G WHFDV L C++FPL+N LSQ+N+NL 
Sbjct  201  DVAEGLAGIAILHRCLARFRPLPSGWFQFSLKGCWHFDVALGCLLFPLVNFLSQININLV  260

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LP+ PV VS+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLTRYMP+WG
Sbjct  261  PVLPAPPVGVSSVEQSILARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTRYMPLWG  320

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+S++AFALAHF+ QR+LPLVFLGV++G +F RSRNLLA MLLH LWN +VFLDLMK
Sbjct  321  SILVSAVAFALAHFNAQRLLPLVFLGVVMGAVFARSRNLLASMLLHSLWNGFVFLDLMK  379



>ref|XP_002298001.2| hypothetical protein POPTR_0001s10060g [Populus trichocarpa]
 gb|EEE82806.2| hypothetical protein POPTR_0001s10060g [Populus trichocarpa]
Length=342

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  164  DVTEGLAGIAILHRCLSRFRPLSSDWFRFRLKGNWVFDVALGCLMFPLVNRLSQFNLSLL  223

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  224  PILPSTPVTLSSVEQSIAARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  283

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  284  AILVSSVAFALAHFNVQRMLPLIFLGVVMGVIFTRSRNLLPSMLLHSLWNGFVFLDLMK  342



>gb|KHG14846.1| Putative membrane peptidase ydiL [Gossypium arboreum]
Length=346

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F+PLPS+WFKFSL GKW FDV L C+MFP INRLSQ +LNL 
Sbjct  168  DVTEGLAGIAILHRCLSQFYPLPSDWFKFSLRGKWLFDVMLGCLMFPAINRLSQFSLNLL  227

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PSTPVT+S+V QSI  RDPVAM LYAI+VSICAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  228  PLMPSTPVTLSSVEQSIYARDPVAMALYAIVVSICAPVWEEIVFRGFLLPSLTKYMPVWC  287

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF+++RMLPL+FLG+++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  288  AILVSSVAFALAHFNVRRMLPLIFLGMVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  346



>ref|XP_010662642.1| PREDICTED: uncharacterized protein LOC100254162 isoform X4 [Vitis 
vinifera]
Length=341

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  169  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  228

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  229  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  288

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  289  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  341


 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDDIP-QVVNSEFDQPNNAKSDLVFHLKKAFH---AVL  864
             +WR SC R+E +S E   +E+V+D +P ++   E +Q +  K D V  ++KA     A  
Sbjct  44    KWRGSCHRQEESSAEIPEFETVEDKLPEELAKPEVEQSDKLKKDCVSKVRKALKAADAFF  103

Query  863   HIEPWTVPWTVRTIVQ  816
              ++PWTVPWT  TI+Q
Sbjct  104   GMKPWTVPWTAMTILQ  119



>ref|XP_010662641.1| PREDICTED: uncharacterized protein LOC100254162 isoform X3 [Vitis 
vinifera]
Length=344

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  172  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  231

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  232  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  291

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  292  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  344


 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDDIP-QVVNSEFDQPNNAKSDLVFHLKKAFH---AVL  864
             +WR SC R+E +S E   +E+V+D +P ++   E +Q +  K D V  ++KA     A  
Sbjct  47    KWRGSCHRQEESSAEIPEFETVEDKLPEELAKPEVEQSDKLKKDCVSKVRKALKAADAFF  106

Query  863   HIEPWTVPWTVRTIVQ  816
              ++PWTVPWT  TI+Q
Sbjct  107   GMKPWTVPWTAMTILQ  122



>ref|XP_002276929.1| PREDICTED: uncharacterized protein LOC100250094 [Vitis vinifera]
 emb|CBI34413.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WF+FSL G W  DV + C+MFPL+NRLSQ NL+L 
Sbjct  169  DVAEGLAGIAILHRCLSRFSPLPSDWFRFSLRGNWLADVAIGCLMFPLVNRLSQFNLDLL  228

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  229  PLLPSTPVTLSSVEQSIMARDPVAMGLYALVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  288

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  289  SILVSSVAFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  347


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 8/115 (7%)
 Frame = -3

Query  1145  NLPPPSSRYRL--NPPALSKLSLPQLRTSIVTASLQLQNARWRLSCSRREHTSLESVNYE  972
             +LPP  SR RL   P  L  LS    R S   +  +   ++W++SC R E +S E+   E
Sbjct  14    SLPPTISRLRLPNRPGTLYPLS-SGFRIS--ESHSKFPKSKWKISCFRHEDSSSETPKSE  70

Query  971   SVDDDI-PQVVNSEFDQPNNAKSDLVFHLKKAFHAVLHI--EPWTVPWTVRTIVQ  816
             S+DD +  ++V  EF++P+  + D     ++A   +L +  +PW VPWT  TI+Q
Sbjct  71    SIDDILSGELVKPEFNKPSTVQKDWASSFREAADVILRVIGKPWVVPWTSETILQ  125



>ref|XP_011026961.1| PREDICTED: uncharacterized protein LOC105127389 [Populus euphratica]
Length=342

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  164  DVTEGLAGIAILHRCLSRFRPLSSDWFRFRLKGNWVFDVALGCLMFPLVNRLSQFNLSLL  223

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDP+AM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  224  PILPSTPVTLSSVEQSIAARDPMAMALYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  283

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLMK
Sbjct  284  AILVSSVAFALAHFNVQRMLPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMK  342



>ref|XP_010662640.1| PREDICTED: uncharacterized protein LOC100254162 isoform X2 [Vitis 
vinifera]
Length=372

 Score =   265 bits (678),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  200  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  259

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  260  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  319

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  320  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  372


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 5/108 (5%)
 Frame = -3

Query  1136  PPSSRYRLNPPALSKLSLPQLRTSIVTASLQLQNARWRLSCSRREHTSLESVNYESVDDD  957
             PP SR R++    + LSL Q R  IV    +    +WR SC R+E +S E   +E+V+D 
Sbjct  47    PPISRIRISNLPRTSLSLNQ-RFRIVDTLSRYSKNKWRGSCHRQEESSAEIPEFETVEDK  105

Query  956   IP-QVVNSEFDQPNNAKSDLVFHLKKAFHAVLHIEPWTVPWTVRTIVQ  816
             +P ++   E +Q +  K D V    KA  A   ++PWTVPWT  TI+Q
Sbjct  106   LPEELAKPEVEQSDKLKKDCV---SKAADAFFGMKPWTVPWTAMTILQ  150



>ref|XP_002275682.2| PREDICTED: uncharacterized protein LOC100254162 isoform X1 [Vitis 
vinifera]
Length=378

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  206  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  265

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  266  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  325

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  326  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  378


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -3

Query  1136  PPSSRYRLNPPALSKLSLPQLRTSIVTASLQLQNARWRLSCSRREHTSLESVNYESVDDD  957
             PP SR R++    + LSL Q R  IV    +    +WR SC R+E +S E   +E+V+D 
Sbjct  47    PPISRIRISNLPRTSLSLNQ-RFRIVDTLSRYSKNKWRGSCHRQEESSAEIPEFETVEDK  105

Query  956   IP-QVVNSEFDQPNNAKSDLVFHLKKAFH---AVLHIEPWTVPWTVRTIVQ  816
             +P ++   E +Q +  K D V  ++KA     A   ++PWTVPWT  TI+Q
Sbjct  106   LPEELAKPEVEQSDKLKKDCVSKVRKALKAADAFFGMKPWTVPWTAMTILQ  156



>ref|XP_010662643.1| PREDICTED: uncharacterized protein LOC100254162 isoform X5 [Vitis 
vinifera]
Length=324

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  152  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  211

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  212  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  271

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  272  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  324



>ref|XP_011022594.1| PREDICTED: uncharacterized protein LOC105124322 isoform X1 [Populus 
euphratica]
Length=343

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  165  DVTEGLAGIAILHRCLSRFRPLSSDWFRFRLKGNWVFDVALGCLMFPLVNRLSQFNLSLL  224

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDP+AM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  225  PILPSTPVTLSSVEQSIAARDPMAMVLYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  284

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFAL HF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  285  AILVSSVAFALVHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  343


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHL  888
             I  ++ +L   +WR+SC R E  S  +   +SV+   P+ +V  E D   N K D +  L
Sbjct  36    IFVSNSKLPKHKWRVSCFRNEEISQVNPGSDSVERYAPEELVKPELDNSTNVKRDWISSL  95

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A + VL      WTVPWT  TIVQ
Sbjct  96    REAANVVLRAFGSSWTVPWTAETIVQ  121



>ref|XP_006476475.1| PREDICTED: uncharacterized protein LOC102608238 isoform X2 [Citrus 
sinensis]
Length=322

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  825  YCAG--MAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPF  652
            + AG  +AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL P 
Sbjct  146  HVAGFRIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLLPL  205

Query  651  LPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
            +PS PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW +I
Sbjct  206  MPSAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWCAI  265

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            L+SS+AFALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  266  LVSSVAFALAHFNVQRMLPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  322


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N  K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNPIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|XP_010929565.1| PREDICTED: uncharacterized protein LOC105051013 isoform X2 [Elaeis 
guineensis]
Length=345

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR LA+F PLPS WF+FSL G WHFDVGL C++FPL+N LSQ+N++L 
Sbjct  167  DIAEGLAGIAILHRCLARFQPLPSGWFRFSLKGNWHFDVGLGCLLFPLVNLLSQINISLV  226

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LP+ PV +S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMP+W 
Sbjct  227  PVLPAPPVGISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPLWW  286

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +I++S+  FALAHF++QR+LPLVFLGV++G +F +SRNLLA MLLH LWN +VFLDLMK
Sbjct  287  AIIVSAFVFALAHFNVQRLLPLVFLGVVMGVVFAKSRNLLASMLLHSLWNGFVFLDLMK  345



>ref|XP_010929564.1| PREDICTED: uncharacterized protein LOC105051013 isoform X1 [Elaeis 
guineensis]
Length=369

 Score =   263 bits (672),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR LA+F PLPS WF+FSL G WHFDVGL C++FPL+N LSQ+N++L 
Sbjct  191  DIAEGLAGIAILHRCLARFQPLPSGWFRFSLKGNWHFDVGLGCLLFPLVNLLSQINISLV  250

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LP+ PV +S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMP+W 
Sbjct  251  PVLPAPPVGISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPLWW  310

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +I++S+  FALAHF++QR+LPLVFLGV++G +F +SRNLLA MLLH LWN +VFLDLMK
Sbjct  311  AIIVSAFVFALAHFNVQRLLPLVFLGVVMGVVFAKSRNLLASMLLHSLWNGFVFLDLMK  369



>ref|XP_002304526.1| hypothetical protein POPTR_0003s13360g [Populus trichocarpa]
 gb|EEE79505.1| hypothetical protein POPTR_0003s13360g [Populus trichocarpa]
Length=343

 Score =   262 bits (670),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH  L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  165  DVTEGLAGIAILHCCLSRFHPLSSDWFRFRLKGNWLFDVALGCLMFPLVNRLSQFNLSLL  224

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  225  PILPSTPVTLSSVEQSIAARDPVAMVLYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  284

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFAL HF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  285  AILVSSVAFALVHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  343


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = -3

Query  1046  QLQNARWRLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHLKKAFHA  870
             +L   +WR+SC R E  S  +   +SV+  +P+ +V  E D   N K D +  L++A + 
Sbjct  42    KLPKHKWRVSCFRNEEISQVNPGSDSVERYVPEELVKPELDNSTNVKRDWISSLREAANV  101

Query  869   VLHI--EPWTVPWTVRTIVQ  816
             VL      WTVPWT  TIVQ
Sbjct  102   VLRAFGSSWTVPWTAETIVQ  121



>ref|XP_008776534.1| PREDICTED: uncharacterized protein LOC103696628 [Phoenix dactylifera]
Length=369

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R LA+F PLPS WF+FSL G WHFDVGL C++FPL+N LSQ+N++L 
Sbjct  191  DVAEGLAGIAILQRCLARFHPLPSGWFRFSLKGNWHFDVGLGCLLFPLVNLLSQINISLV  250

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LP+ PV +S+V QSIV RDPVAM LYA++VS+CAPIWEEI+FRGFLLPSLTRYMP+W 
Sbjct  251  PVLPAPPVGISSVEQSIVARDPVAMALYAVVVSVCAPIWEEIVFRGFLLPSLTRYMPLWW  310

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +I++S++ FALAHF++QR+LPLVFLGV++G +F RSRNLLA MLLH LWN +VFLDL+K
Sbjct  311  AIVVSAVVFALAHFNVQRLLPLVFLGVVMGVVFSRSRNLLASMLLHSLWNGFVFLDLLK  369



>emb|CBI22601.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            +G+AILH  LA+F PLPS+WF+ SL GKWHFDVGL C+MFPL+NRLSQ+N NL P  PST
Sbjct  169  SGIAILHICLARFHPLPSDWFRLSLEGKWHFDVGLGCLMFPLVNRLSQINENLLPVAPST  228

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            PVT S+V QSIV RDP+AM LYA+ +S+CAPIWEEI FRGFLLPSLTRYMPVW SIL+SS
Sbjct  229  PVTGSSVQQSIVARDPLAMALYAVFLSVCAPIWEEIFFRGFLLPSLTRYMPVWCSILVSS  288

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +AFA AH +LQ MLP +FLG+L+G +F RSRNLLA MLLH LWNA+VF+DLMK
Sbjct  289  VAFASAHLNLQTMLPFIFLGMLIGAVFARSRNLLASMLLHSLWNAFVFVDLMK  341


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDDIP-QVVNSEFDQPNNAKSDLVFHLKKAFHAV---L  864
             +WR SC R+E +S E   +E+V+D +P ++   E +Q +  K D V  ++KA  A     
Sbjct  44    KWRGSCHRQEESSAEIPEFETVEDKLPEELAKPEVEQSDKLKKDCVSKVRKALKAADAFF  103

Query  863   HIEPWTVPWTVRTIVQ  816
              ++PWTVPWT  TI+Q
Sbjct  104   GMKPWTVPWTAMTILQ  119



>gb|KEH21164.1| CAAX amino terminal protease family protein [Medicago truncatula]
Length=343

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WFKFS  GKWHFDV + C+MFPL+NRLSQ NL+L 
Sbjct  165  DVTEGLAGIAILVRCLSRFRPLPPDWFKFSPEGKWHFDVVMGCLMFPLVNRLSQFNLDLL  224

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPST VT+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  225  PILPSTQVTLSSVEQSIKARDPVAMLLYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  284

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLG+++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  285  AILVSSVAFALAHFNIQRMLPLIFLGMVMGVIFTRSRNLLPSMLLHSLWNGFVFLDLMK  343



>ref|XP_007160122.1| hypothetical protein PHAVU_002G294300g [Phaseolus vulgaris]
 gb|ESW32116.1| hypothetical protein PHAVU_002G294300g [Phaseolus vulgaris]
Length=340

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WF+FSL G W  DV + C+MFPL+NRLSQ NL+L 
Sbjct  162  DVTEGLAGVAILLRCLSRFRPLPPDWFRFSLKGNWQLDVIMGCLMFPLVNRLSQFNLDLL  221

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDPVAM LYA +VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  222  PLLPSTPVTLSSVEQSIRARDPVAMLLYATVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  281

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QRMLPL+FLG+++G I+ RSRNLL PMLLH LWN +VFLDLMK
Sbjct  282  AILVSSIAFALAHFNIQRMLPLIFLGMVMGVIYTRSRNLLPPMLLHSLWNGFVFLDLMK  340



>ref|XP_002509884.1| prenyl-dependent CAAX protease, putative [Ricinus communis]
 gb|EEF51271.1| prenyl-dependent CAAX protease, putative [Ricinus communis]
Length=355

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHF--DVGLCCVMFPLINRLSQVNLN  664
            D  +  AG+AILHR L++F PLPS+WF+FSL G W +  DV L C MFPLINRLSQVNL+
Sbjct  175  DVTEGLAGIAILHRCLSRFCPLPSDWFRFSLKGNWAWLLDVALGCFMFPLINRLSQVNLS  234

Query  663  LFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPV  484
            L P LPS PVT+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPV
Sbjct  235  LLPILPSAPVTLSSVEQSIAARDPVAMALYAIVVSVCAPVWEEILFRGFLLPSLTRYMPV  294

Query  483  WGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            W +IL+SSIAFALAHF++QRMLPL+ LG ++G IF RSRNL+  MLLH LWN +VFLDLM
Sbjct  295  WCAILVSSIAFALAHFNVQRMLPLILLGAVMGVIFARSRNLMPSMLLHSLWNGFVFLDLM  354

Query  303  K  301
            +
Sbjct  355  R  355



>gb|ACU18810.1| unknown [Glycine max]
Length=227

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WFKFSL G W  DV   C+MFPL+NRLSQ NL+L 
Sbjct  49   DVTEGLAGVAILLRCLSRFRPLPPDWFKFSLKGYWQLDVITGCLMFPLVNRLSQFNLDLL  108

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA +VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  109  PLLPSTPVTLSSVEQSIMARDPVAMLLYATVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  168

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++L+SSIAFALAHF++Q MLPL+FLG+++G I+ RSRNLL  MLLH LWN +VFLDLMK
Sbjct  169  AVLVSSIAFALAHFNIQSMLPLIFLGMVMGVIYTRSRNLLPSMLLHSLWNGFVFLDLMK  227



>emb|CDP12096.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILHR L++F PLPS+WFKFSL GKW FDV L C+MFPL+NRLSQ NL+L 
Sbjct  194  DVTEGLAGILILHRCLSRFRPLPSDWFKFSLKGKWLFDVVLGCLMFPLVNRLSQFNLDLL  253

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S V QSI+ RDPVAM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  254  PVLPSTPVTLSTVEQSIMARDPVAMGLYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  313

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            S+L+SS+AFALAHF++QRMLPL+FLGV++G I+ RSR+LL  +LLH LWN +VFLDLMK
Sbjct  314  SVLMSSVAFALAHFNVQRMLPLIFLGVVMGVIYARSRSLLPSILLHSLWNGFVFLDLMK  372


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 10/103 (10%)
 Frame = -3

Query  1031  RWRLSCSRREHTSLESVNYESVDDDI--PQVVNSEFDQPNNAKSDLVFHLKKAFHAVLHI  858
             +W++SC R E  S   +N ES+ ++I    +  +E ++P+  K   +  L +   AVL +
Sbjct  75    KWKISCFRHEECSSAGINRESLGEEIRHENLRKTEVEKPSTGKRSWISSLGEWVDAVLRV  134

Query  857   --EPWTVPWTVRTIVQG---WQSSIVVLQSF---FHFHPIGSN  753
               +PWTVPWT  TI+Q    W  S   + S+   F  H +G N
Sbjct  135   IGKPWTVPWTAETILQVTLLWVVSFWFVGSWMIPFGAHMVGFN  177



>ref|XP_004503658.1| PREDICTED: uncharacterized protein LOC101509853 [Cicer arietinum]
Length=351

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WFKFSL GKW  DV + C+MFPL+NRLSQ NL+L 
Sbjct  173  DVTEGLAGIAILVRCLSRFRPLPPDWFKFSLKGKWQLDVIMGCLMFPLVNRLSQFNLDLL  232

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPST +T+S+V QSI  RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  233  PILPSTQITLSSVEQSIKARDPVAMLLYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  292

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLG+++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  293  AILVSSVAFALAHFNIQRMLPLIFLGMVMGVIFTRSRNLLPSMLLHSLWNGFVFLDLMK  351



>gb|KHN16775.1| hypothetical protein glysoja_002872 [Glycine soja]
Length=341

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WF+FSL G W  DV + C+MFPL+NRLSQ NL+L 
Sbjct  163  DVTEGLAGVAILLRCLSRFRPLPPDWFEFSLKGNWQLDVIMGCLMFPLVNRLSQFNLDLL  222

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDPVAM LYA +VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  223  PLLPSTPVTLSSVEQSIRARDPVAMLLYATVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  282

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++QRMLPL+FLG+++G I+ RSRNLL  MLLH LWN +VFLDLMK
Sbjct  283  AILVSSIAFALAHFNIQRMLPLIFLGMVMGVIYTRSRNLLPSMLLHSLWNGFVFLDLMK  341



>ref|XP_010676389.1| PREDICTED: uncharacterized protein LOC104892223 [Beta vulgaris 
subsp. vulgaris]
Length=347

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL + L++F PLP  WFKFSL G WHFDV   C+MFPL+NRLSQ NL++F
Sbjct  169  DLAEGLAGIAILRQCLSRFRPLPLEWFKFSLKGNWHFDVAFGCLMFPLVNRLSQFNLDIF  228

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPS PV  S+V QSI+ RDPVAM LY ++VS+CAPIWEE+IFRGFLLPSLT+YMPVW 
Sbjct  229  PSLPSIPVNTSSVEQSIMARDPVAMGLYIVVVSVCAPIWEEVIFRGFLLPSLTKYMPVWC  288

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+S+I FALAHF++QR+LPL+FLGV++G +F R++NL+  MLLH LWNA+VFLDLMK
Sbjct  289  SILVSAIVFALAHFNVQRILPLIFLGVVMGALFARTKNLMPSMLLHSLWNAFVFLDLMK  347



>ref|XP_009630290.1| PREDICTED: uncharacterized protein LOC104120259 [Nicotiana tomentosiformis]
Length=372

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L++F PLPS+WFKFSL G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  194  DVTEGLAGILILKRCLSRFRPLPSDWFKFSLKGNWLFDVLLGCLMFPLVNRLSQFNLDLL  253

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  254  PVLPSTPVTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  313

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QRMLPL+FLGV++G I+ RSRNLL  +LLH LWN +VFLDLMK
Sbjct  314  SILMSSVAFALAHFNVQRMLPLIFLGVVMGVIYGRSRNLLPSILLHSLWNGFVFLDLMK  372


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 62/123 (50%), Gaps = 11/123 (9%)
 Frame = -3

Query  1088  SLPQL--RTSIVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPN  918
             SLP L  R  I     ++   RW++SC R E  S  + N E +D+ +  ++   E D+P+
Sbjct  55    SLPTLPHRVKISEPHHRISTKRWKISCFRNEEPSPGASNPEFIDEVLHEELKKPEIDKPS  114

Query  917   NAKSDLVFHLKKAFHAVLHI--EPWTVPWTVRTIVQGWQSSIVVLQSFFHFHPIGSNLA*  744
               K + +  L++A   V  +  +PWTVPWT  TI+Q      V+L     F  IGS +  
Sbjct  115   VEKRNWISRLREAADVVFKVIGKPWTVPWTAETILQ------VMLLWIVSFWFIGSWMIP  168

Query  743   AGS  735
              G+
Sbjct  169   FGA  171



>ref|XP_006343913.1| PREDICTED: uncharacterized protein LOC102605715 [Solanum tuberosum]
Length=372

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L++F PLPS+WFKFSL G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  194  DVTEGLAGILILQRCLSRFRPLPSDWFKFSLKGNWLFDVLLGCLMFPLVNRLSQFNLDLL  253

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+T+S+V QSI+ RDPVAM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  254  PVLPSTPLTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  313

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+FLGV++G I+ RSRNLL  +LLH LWN +VFLDLMK
Sbjct  314  SILMSSIAFALAHFNVQRMLPLIFLGVVMGVIYGRSRNLLPSILLHSLWNGFVFLDLMK  372


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 71/137 (52%), Gaps = 13/137 (9%)
 Frame = -3

Query  1130  SSRYRLNPPALSKLSLPQL--RTSIVTASLQLQNARWRLSCSRREHTSLESVNYESVDDD  957
             S R+R++    S  SLP L  R  I     ++   RW++SC R E +S  + N ES+DD 
Sbjct  43    SPRFRVS--TFSPKSLPTLSHRIRISEPHHRISTKRWKISCFRNEESSSGASNPESIDDV  100

Query  956   I-PQVVNSEFDQPNNAKSDLVFHLKKAFHAVLHI--EPWTVPWTVRTIVQGWQSSIVVLQ  786
             +  ++ N E D+P+  K + +   ++A   V  +  +PWTVPWT  TI+Q      V+L 
Sbjct  101   LHKELENPEIDKPSVQKRNWISRFREAADVVFKVIGKPWTVPWTAETILQ------VMLL  154

Query  785   SFFHFHPIGSNLA*AGS  735
                 F  IGS +   G+
Sbjct  155   WIVSFWFIGSWMIPFGA  171



>ref|XP_006580547.1| PREDICTED: uncharacterized protein LOC100779061 [Glycine max]
 gb|KHM99934.1| hypothetical protein glysoja_017632 [Glycine soja]
Length=341

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L++F PLP +WFKFSL G W  DV   C+MFPL+NRLSQ NL+L 
Sbjct  163  DVTEGLAGVAILLRCLSRFRPLPPDWFKFSLKGYWQLDVITGCLMFPLVNRLSQFNLDLL  222

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA +VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  223  PLLPSTPVTLSSVEQSIMARDPVAMLLYATVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  282

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SSIAFALAHF++Q MLPL+FLG+++G I+ RSRNLL  MLLH LWN +VFLDLMK
Sbjct  283  AILVSSIAFALAHFNIQSMLPLIFLGMVMGVIYTRSRNLLPSMLLHSLWNGFVFLDLMK  341



>ref|XP_009796702.1| PREDICTED: uncharacterized protein LOC104243239 [Nicotiana sylvestris]
Length=372

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L++F PLPS+WFKFSL G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  194  DVTEGLAGILILKRCLSRFRPLPSDWFKFSLKGNWLFDVLLGCLMFPLVNRLSQFNLDLL  253

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  254  PVLPSTPVTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  313

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QR+LPL+FLGV++G I+ RSRNLL  +LLH LWN +VFLDLMK
Sbjct  314  SILMSSVAFALAHFNVQRLLPLIFLGVVMGVIYGRSRNLLPSILLHSLWNGFVFLDLMK  372


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 62/123 (50%), Gaps = 11/123 (9%)
 Frame = -3

Query  1088  SLPQL--RTSIVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPN  918
             SLP L  R  I     ++   RW++SC R E  S  + N E +D+ +  ++   E D+P+
Sbjct  55    SLPTLPHRIKISEPHHRISTKRWKISCFRNEEPSPGASNPEFIDEVLHEELKKPEIDKPS  114

Query  917   NAKSDLVFHLKKAFHAVLHI--EPWTVPWTVRTIVQGWQSSIVVLQSFFHFHPIGSNLA*  744
               K + +  L++A   V  +  +PWTVPWT  TI+Q      V+L     F  IGS +  
Sbjct  115   VEKRNWISRLREAADVVFKLIGKPWTVPWTAETILQ------VMLLWIVSFWFIGSWMIP  168

Query  743   AGS  735
              G+
Sbjct  169   FGA  171



>ref|XP_004245558.1| PREDICTED: uncharacterized protein LOC101244021 [Solanum lycopersicum]
Length=369

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L +F PLPS+WFKFSL G W FDV + C+MFPL+NRLSQ NL+L 
Sbjct  191  DVTEGLAGILILQRCLTRFRPLPSDWFKFSLKGNWLFDVLVGCLMFPLVNRLSQFNLDLL  250

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTP+T+S+V QSI+ RDPVAM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  251  PVLPSTPLTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  310

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+FLGV++G I+ RSRNLL  +LLH LWN +VFLDLMK
Sbjct  311  SILMSSIAFALAHFNVQRMLPLIFLGVVMGVIYGRSRNLLPSILLHSLWNGFVFLDLMK  369



>ref|XP_006858285.1| hypothetical protein AMTR_s00064p00048290 [Amborella trichopoda]
 gb|ERN19752.1| hypothetical protein AMTR_s00064p00048290 [Amborella trichopoda]
Length=261

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+ ILHR LA+F PLP++WF F+L G WH DVGL C++FP +N LSQ+NL L 
Sbjct  85   DVVEGLTGIVILHRCLARFKPLPAHWFSFTLKGSWHIDVGLGCLLFPFVNCLSQINLKLL  144

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LP+ PV+ S+V +SI+ RDPVAM LYAI+VS+CAPIWEEIIFRGFLLPSLTRYMPVW 
Sbjct  145  P-LPN-PVSASSVERSIMARDPVAMALYAIVVSVCAPIWEEIIFRGFLLPSLTRYMPVWC  202

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            S+ +SS+AFA+ HF+LQR+LPLVFLGV++G +FVRSRNLLA MLLH LWN +VFLDLMK
Sbjct  203  SVAMSSLAFAVVHFNLQRLLPLVFLGVVMGAVFVRSRNLLASMLLHSLWNGFVFLDLMK  261



>gb|EYU23404.1| hypothetical protein MIMGU_mgv1a008473mg [Erythranthe guttata]
Length=372

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L++F PLP +WFKFSL G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  194  DVTEGLAGILILVRCLSRFRPLPPDWFKFSLRGNWPFDVLLGCLMFPLVNRLSQFNLDLL  253

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDP+AM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  254  PVLPSTPVTLSSVEQSIMSRDPIAMGLYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  313

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SSIAFALAHF++QRMLPL+FLGV++G  + RSRNLL  MLLH LWN +VFLDLMK
Sbjct  314  SILVSSIAFALAHFNVQRMLPLIFLGVVMGVTYSRSRNLLPSMLLHSLWNGFVFLDLMK  372



>ref|XP_011080891.1| PREDICTED: uncharacterized protein LOC105164040 [Sesamum indicum]
Length=370

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILHR L++F PLPS+WFKFSL G W  DV L C+MFPL+N LSQ NL+L 
Sbjct  192  DVTEGLAGILILHRCLSRFRPLPSDWFKFSLKGNWLVDVLLGCLMFPLVNCLSQFNLDLL  251

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPV +S+V QSI+ RDP+AM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  252  PVLPSTPVALSSVEQSILARDPIAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  311

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF++QRMLPL+FLGV++G  + RSRNLL  MLLH LWN +VFLDLMK
Sbjct  312  SILVSSVAFALAHFNVQRMLPLIFLGVVMGVTYARSRNLLPSMLLHSLWNGFVFLDLMK  370



>ref|XP_008239007.1| PREDICTED: uncharacterized protein LOC103337617 isoform X2 [Prunus 
mume]
Length=337

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL+R L++F PLP +WFKFSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  159  DVTEGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLL  218

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  219  PLLPSTPVTISSVEQSILARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTKYMPVWS  278

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+ FALAHF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  279  AILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  337



>ref|XP_010533617.1| PREDICTED: uncharacterized protein LOC104809356 [Tarenaya hassleriana]
Length=350

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PLP +WF+F+L G W  D+ L C MFPL+NR+SQ NLNL 
Sbjct  171  DVTEGLAGIAILHRCLSPFRPLPQDWFRFTLKGNWQLDIILGCFMFPLVNRISQFNLNLL  230

Query  657  PF-LPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P   PS+PVT+S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW
Sbjct  231  PLPAPSSPVTLSSVEQSIMARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTKYMPVW  290

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+S+ AFALAHF++QR+LPLVFLGV++G IF RSRNLL  MLLH LWN +VFL+LM+
Sbjct  291  CAILVSAFAFALAHFNVQRLLPLVFLGVVMGLIFARSRNLLPSMLLHSLWNGFVFLELMR  350



>ref|XP_008239006.1| PREDICTED: uncharacterized protein LOC103337617 isoform X1 [Prunus 
mume]
Length=349

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL+R L++F PLP +WFKFSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  171  DVTEGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLL  230

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  231  PLLPSTPVTISSVEQSILARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTKYMPVWS  290

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+ FALAHF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  291  AILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  349


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = -3

Query  1037  NARW-RLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHLKKAFHAVL  864
             + RW R+SC R+E +S E+   + +   +P+ VV +EFD     K D  F L++A  AV 
Sbjct  50    STRWTRISCFRKEDSSSETPKADYIGHLVPEEVVKTEFDDSKVVKKDWGFTLREAADAVF  109

Query  863   HI--EPWTVPWTVRTIVQ  816
                   W+VPWT  TI+Q
Sbjct  110   RAIGSRWSVPWTAETIMQ  127



>ref|XP_007209320.1| hypothetical protein PRUPE_ppa007988mg [Prunus persica]
 gb|EMJ10519.1| hypothetical protein PRUPE_ppa007988mg [Prunus persica]
Length=349

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL+R L++F PLP +WFKFSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  171  DVTEGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLL  230

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  231  PLLPSTPVTISSVEQSILARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTKYMPVWS  290

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+ FALAHF++QRMLPL+FLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  291  AILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  349


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 7/112 (6%)
 Frame = -3

Query  1139  PPPSSRYRLNPPALSKLSLPQLRTSIVTASLQLQNARW-RLSCSRREHTSLESVNYESVD  963
             P P +R    P AL  +S       I  +  +  + RW R+SC R+E++S E+   + + 
Sbjct  19    PAPKTRVSTRPGALYPISR---SFRIFESHSRPSSTRWTRISCFRQENSSSETPKADYIG  75

Query  962   DDIPQ-VVNSEFDQPNNAKSDLVFHLKKAFHAVLHI--EPWTVPWTVRTIVQ  816
               +P+ VV SEFD     K D  F L++A  AV       W+VPWT  TI+Q
Sbjct  76    HLVPEEVVKSEFDDSKVVKKDWGFTLREAADAVFRAIGSRWSVPWTAETIMQ  127



>ref|XP_010272481.1| PREDICTED: uncharacterized protein LOC104608243 [Nelumbo nucifera]
Length=348

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AIL R L +F PLPS+WF+FSL G W  DV L C+MFPL+N+LSQVNLNL 
Sbjct  170  DVAEGLAGIAILQRCLNRFRPLPSDWFRFSLNGNWQLDVVLGCLMFPLVNQLSQVNLNLL  229

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPV VS+V QSIV RDPVAM LYAI+VSICAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  230  PLLPSTPVVVSSVEQSIVARDPVAMALYAIVVSICAPVWEEIVFRGFLLPSLTKYMPVWC  289

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+SS+AFALAHF+ QR+LPL FLGV++G +F RSRNL+A MLLH LWN +VFLDLMK
Sbjct  290  SILVSSVAFALAHFNAQRILPLFFLGVVMGVVFARSRNLVASMLLHSLWNGFVFLDLMK  348



>ref|XP_011073439.1| PREDICTED: uncharacterized protein LOC105158386 [Sesamum indicum]
Length=369

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILH  L++F PLPS WF+FSL GKW FDV L C+MFPL+NRLSQ NLNL 
Sbjct  191  DVTEGLAGILILHCCLSRFRPLPSEWFRFSLRGKWIFDVFLGCLMFPLVNRLSQFNLNLL  250

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P L STP T+S+V QSI+ RDP+AM LYA+++ +CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  251  PVLQSTPFTLSSVEQSIMARDPIAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWC  310

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            S+L+SS+AFALAHF++QRMLPL+ LGV++G    RSRNLL  MLLH LWN +VFLDLM+
Sbjct  311  SVLVSSVAFALAHFNVQRMLPLILLGVVMGVSCARSRNLLPSMLLHSLWNGFVFLDLMR  369



>ref|XP_010106589.1| Putative membrane peptidase ydiL [Morus notabilis]
 gb|EXC10843.1| Putative membrane peptidase ydiL [Morus notabilis]
Length=368

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ IL R L++F PLP +WF+FS  G W+ DV L C+MFPL+N LS  NL L 
Sbjct  190  DITEGLAGIMILLRCLSRFRPLPPDWFRFSFKGNWYIDVVLGCLMFPLVNGLSHFNLKLL  249

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QS++  D VAM LY I+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  250  PILPSTPVTLSSVEQSVLACDRVAMALYVIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  309

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+ FALAHF++QRMLPL+FLGV++G +F RSRNLL  MLLH LWN++VFLDLMK
Sbjct  310  AILVSSVVFALAHFNIQRMLPLIFLGVVMGAVFARSRNLLPSMLLHSLWNSFVFLDLMK  368



>gb|EPS73198.1| hypothetical protein M569_01553, partial [Genlisea aurea]
Length=243

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILHR L++F PLP +WFK +L GKW  DV + C MFPL+NRLSQ N++L 
Sbjct  65   DVAEGIAGILILHRCLSRFRPLPPDWFKLTLRGKWAIDVFVGCSMFPLVNRLSQFNMDLL  124

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V  SI+ RDPVAM LYA+++ +CAP+WEE++FRGFLLPSLT+YMPV  
Sbjct  125  PILPSTPVTLSSVEHSIMARDPVAMGLYALVLVVCAPVWEEVVFRGFLLPSLTKYMPVGL  184

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SI++SS+AFALAH ++QRMLPL+FLG+++G  + RSRNL+  MLLH LWN +VFLDLMK
Sbjct  185  SIVVSSVAFALAHLNVQRMLPLIFLGMVMGVTYARSRNLVPCMLLHSLWNGFVFLDLMK  243



>ref|XP_004298847.1| PREDICTED: uncharacterized protein LOC101297145 [Fragaria vesca 
subsp. vesca]
Length=349

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+ ILHR L++F PLP +WFKFSL G W  DV L C+MFPL+NRLS  NLNL 
Sbjct  171  DVTEGLAGIMILHRCLSRFRPLPPDWFKFSLKGTWQIDVVLGCLMFPLVNRLSLFNLNLL  230

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  231  PLLPSTPVTISSVEQSILARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWS  290

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+S++ FALAHF++QRMLPLVFLGV++G IF RSRNLL  MLLH LWN +VFLDLMK
Sbjct  291  AILVSAVVFALAHFNVQRMLPLVFLGVVMGVIFARSRNLLPSMLLHSLWNGFVFLDLMK  349



>ref|XP_001779782.1| predicted protein [Physcomitrella patens]
 gb|EDQ55383.1| predicted protein [Physcomitrella patens]
Length=232

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+ IL++ L +F PLP+ WF  S  G W+ +  L C+MFPL+NRLSQ+NL++ 
Sbjct  56   DIAEGTVGLGILYKCLTRFHPLPNEWFPVSWRGTWYVEACLGCLMFPLVNRLSQLNLDIL  115

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            PF    P   S+V QSI+ RDPVA  LYA++VS+CAPIWEE++FRGFLLPSLTRY+PVWG
Sbjct  116  PF--PAPFNSSHVEQSIMARDPVATLLYAVVVSVCAPIWEEVMFRGFLLPSLTRYLPVWG  173

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            S+++S+IAFALAHFSLQRMLPL FLG+++G +FVRSRNLLA MLLH LWN +VFLDL++
Sbjct  174  SVIVSAIAFALAHFSLQRMLPLTFLGLVMGIVFVRSRNLLASMLLHSLWNGFVFLDLLR  232



>dbj|BAB09848.1| unnamed protein product [Arabidopsis thaliana]
Length=312

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  133  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  192

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  193  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  252

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SSIAFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  253  CAILVSSIAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  312



>ref|XP_010456718.1| PREDICTED: uncharacterized protein LOC104738203 [Camelina sativa]
Length=349

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+FSL G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  170  DVTEGLAGIAILHRCLSMFRPLASDWFRFSLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  229

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  230  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  289

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  290  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFIELMR  349



>ref|XP_010443878.1| PREDICTED: uncharacterized protein LOC104726664 [Camelina sativa]
Length=350

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+FSL G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  171  DVTEGLAGIAILHRCLSMFRPLASDWFRFSLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  230

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  231  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  290

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  291  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFIELMR  350



>ref|NP_568928.1| endopeptidase SCO4 [Arabidopsis thaliana]
 gb|AAL38707.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20181.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63634.1| unknown [Arabidopsis thaliana]
 gb|AED97373.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
Length=347

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  227

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  228  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  287

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SSIAFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  288  CAILVSSIAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  347



>ref|XP_010483728.1| PREDICTED: uncharacterized protein LOC104762182 [Camelina sativa]
Length=350

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+FSL G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  171  DVTEGLAGIAILHRCLSMFRPLASDWFRFSLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  230

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  231  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  290

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  291  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFIELMR  350



>ref|XP_002864700.1| CAAX amino terminal protease family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40959.1| CAAX amino terminal protease family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=347

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  227

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  228  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  287

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  288  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  347



>emb|CDY09186.1| BnaA02g06120D [Brassica napus]
Length=346

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  167  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  226

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  227  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTRYMPVW  286

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  287  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  346



>ref|XP_006280734.1| hypothetical protein CARUB_v10026703mg [Capsella rubella]
 gb|EOA13632.1| hypothetical protein CARUB_v10026703mg [Capsella rubella]
Length=347

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  227

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VSICAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  228  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSICAPVWEEIVFRGFLLPSLTRYMPVW  287

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  288  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  347



>emb|CDX73865.1| BnaA03g31820D [Brassica napus]
Length=342

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  163  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  222

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  223  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTRYMPVW  282

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  283  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  342



>ref|XP_009126584.1| PREDICTED: uncharacterized protein LOC103851485 [Brassica rapa]
Length=346

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  167  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  226

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  227  PLPPTSSPVSLSSVEQSIMARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTRYMPVW  286

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SS+AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  287  CAILVSSVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  346



>ref|XP_006400816.1| hypothetical protein EUTSA_v10013994mg [Eutrema salsugineum]
 gb|ESQ42269.1| hypothetical protein EUTSA_v10013994mg [Eutrema salsugineum]
Length=347

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  227

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+P+++S+V QSI+ RDPVAM LYA++VS+CAP+WEEI+FRGFLLPSLTRYMPVW
Sbjct  228  PLPPTSSPISLSSVEQSIMARDPVAMALYAVVVSVCAPVWEEIVFRGFLLPSLTRYMPVW  287

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+SSIAFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  288  CAILVSSIAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  347



>ref|XP_009334489.1| PREDICTED: uncharacterized protein LOC103927305 [Pyrus x bretschneideri]
Length=349

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+ I+ R L++F PLP +WFKFSL G W  DV L C+MFPL+N+LSQ NL+L 
Sbjct  171  DVTEGLVGIMIICRCLSRFRPLPPDWFKFSLKGTWQLDVALGCLMFPLVNQLSQFNLSLL  230

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPV VS+V QSI+ RDPVAM +YA++VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  231  PLLPSTPVAVSSVEQSIMARDPVAMAMYAVVVSVCAPMWEEILFRGFLLPSLTKYMPVWS  290

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            ++L+SS+ FALAH+++QR+LPL+FLGV++G +F RSRNLL  MLLH LWN +VFLDLMK
Sbjct  291  AVLVSSVVFALAHWNVQRILPLIFLGVVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMK  349



>gb|KFK27600.1| hypothetical protein AALP_AA8G404700 [Arabis alpina]
Length=348

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PL S+WF+F+L G W  DV + C MFP +NRLSQ+NLNL 
Sbjct  169  DVTEGLAGIAILHRCLSMFRPLASDWFRFTLKGNWQLDVIIGCFMFPFVNRLSQLNLNLL  228

Query  657  PFL-PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P    S+PV++S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW
Sbjct  229  PLPPTSSPVSLSSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVW  288

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             +IL+S++AFALAHF++QRMLPLVFLGV+LG IF RSRNLL  MLLH LWN +VF++LM+
Sbjct  289  CAILVSAVAFALAHFNVQRMLPLVFLGVVLGLIFARSRNLLPSMLLHSLWNGFVFMELMR  348



>ref|XP_006656998.1| PREDICTED: uncharacterized protein LOC102717626 [Oryza brachyantha]
Length=335

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH  L +F PLP  WF+F+L G+W+ DV L C++FPL+N LS +N+NL 
Sbjct  157  DITEGLAGIAILHHCLGRFRPLPPGWFEFNLKGRWYLDVALGCLLFPLVNFLSHININLV  216

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P        VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  217  PMSSGPVAGVSSVEQSIVARDPVAMVLYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLPW  276

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  277  SILVSAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  335



>gb|EAZ01098.1| hypothetical protein OsI_23126 [Oryza sativa Indica Group]
Length=366

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH  L +F PLP  WF+F+L G+W+ DV L C++FPL+N LS +N+NL 
Sbjct  188  DITEGLAGIAILHHCLGRFRPLPPGWFEFNLKGRWYLDVALGCLLFPLVNFLSHININLI  247

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P        VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  248  PMSSGPVAGVSSVEQSIVARDPVAMVLYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLPW  307

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL+S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  308  SILVSAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  366



>ref|NP_001057716.1| Os06g0505400 [Oryza sativa Japonica Group]
 dbj|BAD45834.1| metal-dependent membrane protease-like [Oryza sativa Japonica 
Group]
 dbj|BAF19630.1| Os06g0505400 [Oryza sativa Japonica Group]
 gb|EAZ37142.1| hypothetical protein OsJ_21482 [Oryza sativa Japonica Group]
Length=366

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH  L +F PLP  WF+F+L G+W+ DV L C++FPL+N LS +N+NL 
Sbjct  188  DITEGLAGIAILHHCLGRFRPLPPGWFEFNLKGRWYLDVALGCLLFPLVNFLSHININLI  247

Query  657  PFLPSTPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  248  P-MSSGPVPGVSSVEQSIVARDPVAMVLYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  306

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SIL+S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  307  WSILVSAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  366



>gb|EMT18677.1| Elongation factor Ts [Aegilops tauschii]
Length=750

 Score =   235 bits (600),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L GKWH+DV L C++FPL+N LS +N++L 
Sbjct  572  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGKWHWDVALGCLLFPLVNLLSHINISLV  631

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAP+WEEI+FRGFLLPSLTRYMP+ 
Sbjct  632  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPMWEEIVFRGFLLPSLTRYMPLP  690

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS++AFALAHF++QR+LPL+FLGV++G +F RSRNLLA  +LH LWN +VFLDLMK
Sbjct  691  WSILLSAVAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASTVLHSLWNGFVFLDLMK  750



>gb|EMT00631.1| hypothetical protein F775_06991 [Aegilops tauschii]
Length=321

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L G+WH+DV L C++FPL+N LS +N++L 
Sbjct  143  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGRWHWDVALGCLLFPLVNLLSHINISLV  202

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  203  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  261

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  262  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  321



>ref|NP_001146506.1| uncharacterized protein LOC100280096 [Zea mays]
 gb|ACN31336.1| unknown [Zea mays]
Length=359

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F+L GKWH DV   C++FPL+N LS +N++L 
Sbjct  181  DITEGLAGIAILHQCLGRFRPLPPGWFEFNLKGKWHLDVAFGCLLFPLVNLLSHINISLV  240

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P  P   V VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  241  PASPGPAVGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLPW  300

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  301  SILASAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  359



>ref|XP_008673077.1| PREDICTED: uncharacterized protein LOC100280096 isoform X1 [Zea 
mays]
 ref|XP_008673085.1| PREDICTED: uncharacterized protein LOC100280096 isoform X1 [Zea 
mays]
 ref|XP_008673090.1| PREDICTED: uncharacterized protein LOC100280096 isoform X1 [Zea 
mays]
 gb|ACL54170.1| unknown [Zea mays]
 gb|ACN34010.1| unknown [Zea mays]
 tpg|DAA47576.1| TPA: hypothetical protein ZEAMMB73_915996 [Zea mays]
 tpg|DAA47577.1| TPA: hypothetical protein ZEAMMB73_915996 [Zea mays]
Length=359

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F+L GKWH DV   C++FPL+N LS +N++L 
Sbjct  181  DITEGLAGIAILHQCLGRFRPLPPGWFEFNLKGKWHLDVAFGCLLFPLVNLLSHINISLV  240

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P  P   V VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  241  PASPGPAVGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLPW  300

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  301  SILASAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  359



>ref|XP_002437053.1| hypothetical protein SORBIDRAFT_10g020020 [Sorghum bicolor]
 gb|EER88420.1| hypothetical protein SORBIDRAFT_10g020020 [Sorghum bicolor]
Length=357

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F+L GKWH DV   C++FPL+N LS +N++L 
Sbjct  179  DITEGLAGIAILHQCLGRFRPLPPGWFEFNLKGKWHLDVAFGCLLFPLVNLLSHINISLV  238

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P  P   V VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  239  PMSPGPVVGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLPW  298

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL S+ AFALAHF+ QR++PLVFLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  299  SILASAAAFALAHFNAQRVMPLVFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  357



>dbj|BAJ93023.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L G+WH+DV L C++FPL+N LS +N++L 
Sbjct  181  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGRWHWDVALGCLLFPLVNLLSHINISLV  240

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  241  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  299

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  300  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  359



>dbj|BAJ92236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L G+WH+DV L C++FPL+N LS +N++L 
Sbjct  181  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGRWHWDVALGCLLFPLVNLLSHINISLV  240

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  241  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  299

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  300  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  359



>gb|EMS51393.1| hypothetical protein TRIUR3_21178 [Triticum urartu]
Length=360

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L GKWH+DV L C++FPL+N LS +N++L 
Sbjct  182  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGKWHWDVALGCLLFPLVNLLSHINISLV  241

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSI+ RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  242  -HMSSGPVAGVSSVEQSIMARDPVAMVLYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  300

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  301  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  360



>gb|EMS53649.1| hypothetical protein TRIUR3_25312 [Triticum urartu]
Length=345

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L G+WH+DV L C++FPL+N LS +N++L 
Sbjct  167  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGRWHWDVALGCLLFPLVNLLSHINISLV  226

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  227  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  285

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLM 
Sbjct  286  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMN  345



>dbj|BAK06142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L GKWH+DV L C++FPL+N LS +N++L 
Sbjct  187  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGKWHWDVVLGCLLFPLVNLLSHINISLV  246

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS V QSIV RDPVAM LYA++V++CAPIWEEI+FRGFLLPSLTRYMP+ 
Sbjct  247  -HMSSGPVAGVSGVEQSIVARDPVAMALYAVVVTVCAPIWEEIVFRGFLLPSLTRYMPLP  305

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SILLS+ AFALAHF++QR+LPL+FLGV++G +F RSRNLLA ++LH LWN +VFLDLMK
Sbjct  306  WSILLSAAAFALAHFNVQRVLPLIFLGVVMGGVFARSRNLLASIVLHSLWNGFVFLDLMK  365



>ref|XP_002993047.1| hypothetical protein SELMODRAFT_136406, partial [Selaginella 
moellendorffii]
 gb|EFJ05886.1| hypothetical protein SELMODRAFT_136406, partial [Selaginella 
moellendorffii]
Length=232

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+ ILHR LA+F PL  +WF  S  G+W+ +  L C++FPL+NRLSQ NL+L 
Sbjct  56   DIAEGTVGLGILHRCLAEFHPLSKDWFPVSWQGQWYVEACLGCLIFPLVNRLSQFNLDLL  115

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPS P T S+V QSI  RDP+A  LYA++VS+CAP+WEE++FRGFLLPSLTRY+P+W 
Sbjct  116  P-LPS-PFTASSVEQSISARDPIATLLYAVVVSVCAPVWEEVLFRGFLLPSLTRYLPLWA  173

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SI +S++AFALAHFS QR+LPL FLG+++G +FVR+RNLL+ MLLH LWN +VF++L++
Sbjct  174  SIAISALAFALAHFSPQRLLPLTFLGLVMGVVFVRNRNLLSSMLLHSLWNVFVFVELLR  232



>ref|XP_004965486.1| PREDICTED: uncharacterized protein LOC101783762 [Setaria italica]
Length=361

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F+L G+W  DV L C++FPL+N LS +N++L 
Sbjct  183  DITEGLAGIAILHQCLGRFRPLPPGWFEFNLKGRWILDVVLGCLLFPLVNLLSHINISLV  242

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P  P   V VS+V QSIV RDPVAM LYA++V +CAPIWEEI+FRGFLLPSLTRYMP+  
Sbjct  243  PMSPGPVVGVSSVEQSIVARDPVAMALYAVVVIVCAPIWEEIVFRGFLLPSLTRYMPLPL  302

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SIL S+ AFALAHF+ QR++PL+FLGV++G +F RSRNLLA M+LH LWN +VFLDLMK
Sbjct  303  SILASAAAFALAHFNAQRVMPLIFLGVVMGGVFARSRNLLASMVLHSLWNGFVFLDLMK  361



>ref|XP_010229836.1| PREDICTED: uncharacterized protein LOC100833844 [Brachypodium 
distachyon]
Length=312

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILH+ L +F PLP  WF+F L G WH+DV   C++FPL+N LS +N+NL 
Sbjct  134  DITEGLAGIAILHQCLGRFRPLPPGWFEFKLKGGWHWDVAFGCLLFPLVNLLSHININLV  193

Query  657  PFLPSTPVT-VSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
              + S PV  VS+V QSIV RDPVAM LYA++V++CAPIWEE++FRGFLLPSLTRYMP+ 
Sbjct  194  -HMSSGPVAGVSSVEQSIVARDPVAMALYAVVVTVCAPIWEEVVFRGFLLPSLTRYMPLP  252

Query  480  GSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
             SIL S+ AFALAHF+ QR+LPL+FLGV++G +F +SRNLLA M+LH LWN +VFLDLMK
Sbjct  253  WSILASAAAFALAHFNAQRVLPLIFLGVVMGGVFAKSRNLLASMVLHSLWNGFVFLDLMK  312



>ref|XP_002972116.1| hypothetical protein SELMODRAFT_148181 [Selaginella moellendorffii]
 gb|EFJ27033.1| hypothetical protein SELMODRAFT_148181 [Selaginella moellendorffii]
Length=253

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +   G+ ILHR LA+F PL  +WF  S  G+W+ +  L C++FPL+N LSQ+NL+L 
Sbjct  77   DIAEGTVGLGILHRCLAEFHPLSKDWFPVSWQGQWYVEACLGCLIFPLVNCLSQLNLDLL  136

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPS P T S+V QSI  RDP+A  LYA++VS+CAP+WEE++FRGFLLPSLTRY+P+W 
Sbjct  137  P-LPS-PFTASSVEQSISARDPIATLLYAVVVSVCAPVWEEVLFRGFLLPSLTRYLPLWA  194

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            SI +S++AFALAHFS QR+LPL FLG+++G +FVR+RNLL+ MLLH LWN +VF++L++
Sbjct  195  SIAISALAFALAHFSPQRLLPLTFLGLVMGVVFVRNRNLLSSMLLHSLWNVFVFVELLR  253



>ref|XP_006858284.1| hypothetical protein AMTR_s00064p00048070 [Amborella trichopoda]
 gb|ERN19751.1| hypothetical protein AMTR_s00064p00048070 [Amborella trichopoda]
Length=195

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLPSTP  637
            G+ ILHR LA+F PLP++WF F+L G WH DVGL C++FP +N LSQ+NL L P LP+ P
Sbjct  40   GIVILHRCLARFKPLPAHWFSFTLKGSWHIDVGLGCLLFPFVNCLSQINLKLLP-LPN-P  97

Query  636  VTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSI  457
            V+ S+V +SI+ RDPVAM LY+I+VS+CAPIWEEIIFRGFLLPSLTRY+PVW  + +SS+
Sbjct  98   VSASSVERSIMARDPVAMALYSIMVSVCAPIWEEIIFRGFLLPSLTRYIPVWCLVAVSSL  157

Query  456  AFALAHFSLQRMLPLVFLGVLLGTIF  379
            AFA+ HF+LQR+LPLVFLG+++G +F
Sbjct  158  AFAVVHFNLQRLLPLVFLGLVMGAVF  183



>ref|XP_007040384.1| CAAX amino terminal protease family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24885.1| CAAX amino terminal protease family protein isoform 3 [Theobroma 
cacao]
Length=311

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 125/179 (70%), Gaps = 36/179 (20%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL                                    L 
Sbjct  169  DVTEGLAGIAILHRCLSQFHPL------------------------------------LL  192

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PSTPVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  193  PLMPSTPVTLSSVEQSILARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  252

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
            +IL+SS+AFALAHF++QRMLPL+FLG+++G +F RSRNLL  MLLH LWN +VFLDLM+
Sbjct  253  AILVSSVAFALAHFNVQRMLPLIFLGMVMGVVFARSRNLLPSMLLHSLWNGFVFLDLMR  311



>gb|KDO76369.1| hypothetical protein CISIN_1g022913mg [Citrus sinensis]
Length=264

 Score =   183 bits (464),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  825  YCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
            + AG+AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL P +P
Sbjct  146  HVAGIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLLPLMP  205

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            S PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW
Sbjct  206  SAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVW  260


 Score = 52.8 bits (125),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N  K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNPIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|XP_007040383.1| CAAX amino terminal protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY24884.1| CAAX amino terminal protease family protein isoform 2 [Theobroma 
cacao]
Length=308

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WFKFSL GKW FDV L C+MFP++NRLSQ NLNL 
Sbjct  169  DVTEGLAGIAILHRCLSQFHPLPSDWFKFSLKGKWLFDVVLGCLMFPVVNRLSQFNLNLL  228

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PSTPVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW 
Sbjct  229  PLMPSTPVTLSSVEQSILARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVWC  288

Query  477  SILL  466
            +IL+
Sbjct  289  AILV  292



>gb|KHG20259.1| uracil-dna glycosylase [Gossypium arboreum]
Length=314

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L+ F PLPS+WF+FSL GKW FDV L C+MFP +N+LSQ NL L 
Sbjct  163  DVTEGIAGIAILHRCLSHFHPLPSDWFRFSLRGKWLFDVALGCLMFPFVNQLSQFNLTLL  222

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P +PSTPVT+S+V QSI+ RDPVAM LYAI+VSICAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  223  PLMPSTPVTLSSVEQSILARDPVAMALYAIVVSICAPLWEEIVFRGFLLPSLTRYMPVWS  282

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVL  394
            +IL S   +A A   L+R+  L F  ++
Sbjct  283  AILESIAIYASAQ-PLERLCVLGFNEII  309



>gb|KDO76370.1| hypothetical protein CISIN_1g022913mg [Citrus sinensis]
Length=290

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PLPS+WF+FSL G W  DV L C+MFPL+NRLSQ NLNL 
Sbjct  168  DVTEGLAGIAILHRCLSRFHPLPSDWFRFSLKGNWQLDVALGCLMFPLVNRLSQFNLNLL  227

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVW  481
            P +PS PVT+S+V QSI+ RDPVAM LYAI+VS+CAP+WEEI+FRGFLLPSLT+YMPVW
Sbjct  228  PLMPSAPVTISSVEQSIMARDPVAMALYAIVVSVCAPVWEEIVFRGFLLPSLTKYMPVW  286


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDI-PQVVNSEFDQPNNAKSDLVFHL  888
             I  ++L+L   +W++SC R E  S E+   ES++  +  ++V  E DQ N  K D    L
Sbjct  39    IFDSTLKLTRNKWKISCFRHEEISPENSKPESIEHFVQDELVKPEIDQSNPIKRDWATTL  98

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQ  816
             ++A   VL      WTVPWT  TI+Q
Sbjct  99    REAADGVLRAIGSRWTVPWTAETILQ  124



>ref|NP_001239624.1| uncharacterized protein LOC100816897 [Glycine max]
 gb|ACU23366.1| unknown [Glycine max]
Length=259

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 128/193 (66%), Gaps = 0/193 (0%)
 Frame = +2

Query  263  TDLSK*SMNKQIYFIRSRNT*AFQRPCSSMGASKFLDRTNIVPSSTPRNTSGSILCKLKC  442
            T L++ S   + YFI+S+ T  FQR C+S+  SKFLDR  I P + PRN  GSILC LKC
Sbjct  12   TLLTRESQRLRSYFIKSKKTKPFQRLCNSIDGSKFLDRVYITPITIPRNIRGSILCMLKC  71

Query  443  ANAKAIELNKIEPHTGIYLVNEGKRNPRKIISSQMGAQIETSIA*RVIATGSLTTIDCPT  622
            A AKAIEL  I  HTG+YLV EG R PRK ISS  GAQ +T++A   IATGSL  IDC T
Sbjct  72   ARAKAIELTSIAHHTGMYLVREGSRKPRKTISSHTGAQTDTTVAYNSIATGSLALIDCST  131

Query  623  FETVTGVDGRKGNKFKFTCDSRLIKGNITQHKPTSKCHFPPKLNLNQLDGSGKNFARRRW  802
             E VTGV+G++G + +  C+SRL  GN+     TS C FP +LN NQ  G G+N  R+R 
Sbjct  132  LERVTGVEGKRGRRSRLNCESRLTSGNMRHPIMTSNCQFPFRLNSNQSGGRGRNRERQRR  191

Query  803  RIAIPAQ*SLLSM  841
            RIA PA  S+ S+
Sbjct  192  RIATPASPSVTSV  204



>ref|XP_011022597.1| PREDICTED: uncharacterized protein LOC105124322 isoform X3 [Populus 
euphratica]
 ref|XP_011022598.1| PREDICTED: uncharacterized protein LOC105124322 isoform X3 [Populus 
euphratica]
Length=324

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  165  DVTEGLAGIAILHRCLSRFRPLSSDWFRFRLKGNWVFDVALGCLMFPLVNRLSQFNLSLL  224

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDP+AM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  225  PILPSTPVTLSSVEQSIAARDPMAMVLYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  284

Query  477  SILLSS  460
            +IL+ +
Sbjct  285  AILIQA  290


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHL  888
             I  ++ +L   +WR+SC R E  S  +   +SV+   P+ +V  E D   N K D +  L
Sbjct  36    IFVSNSKLPKHKWRVSCFRNEEISQVNPGSDSVERYAPEELVKPELDNSTNVKRDWISSL  95

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQGWQSSIVVLQSFFHFHPIGS  756
             ++A + VL      WTVPWT  TIVQ      V+L     F  IGS
Sbjct  96    REAANVVLRAFGSSWTVPWTAETIVQ------VMLLWVVSFWFIGS  135



>ref|XP_011022595.1| PREDICTED: uncharacterized protein LOC105124322 isoform X2 [Populus 
euphratica]
 ref|XP_011022596.1| PREDICTED: uncharacterized protein LOC105124322 isoform X2 [Populus 
euphratica]
Length=343

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  837  DSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLF  658
            D  +  AG+AILHR L++F PL S+WF+F L G W FDV L C+MFPL+NRLSQ NL+L 
Sbjct  165  DVTEGLAGIAILHRCLSRFRPLSSDWFRFRLKGNWVFDVALGCLMFPLVNRLSQFNLSLL  224

Query  657  PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
            P LPSTPVT+S+V QSI  RDP+AM LYAI+VS+CAP+WEEI+FRGFLLPSLTRYMPVW 
Sbjct  225  PILPSTPVTLSSVEQSIAARDPMAMVLYAIVVSVCAPVWEEIVFRGFLLPSLTRYMPVWC  284

Query  477  SILL  466
            +ILL
Sbjct  285  AILL  288


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = -3

Query  1064  IVTASLQLQNARWRLSCSRREHTSLESVNYESVDDDIPQ-VVNSEFDQPNNAKSDLVFHL  888
             I  ++ +L   +WR+SC R E  S  +   +SV+   P+ +V  E D   N K D +  L
Sbjct  36    IFVSNSKLPKHKWRVSCFRNEEISQVNPGSDSVERYAPEELVKPELDNSTNVKRDWISSL  95

Query  887   KKAFHAVLHI--EPWTVPWTVRTIVQGWQSSIVVLQSFFHFHPIGS  756
             ++A + VL      WTVPWT  TIVQ      V+L     F  IGS
Sbjct  96    REAANVVLRAFGSSWTVPWTAETIVQ------VMLLWVVSFWFIGS  135



>ref|XP_002508579.1| hypothetical protein MICPUN_85896 [Micromonas sp. RCC299]
 gb|ACO69837.1| hypothetical protein MICPUN_85896 [Micromonas sp. RCC299]
Length=271

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -2

Query  843  TMDSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLN  664
            + D  +   G+ +L + L  +FPLP  WF  SL G W  ++ L C +FP+++ L+ +N N
Sbjct  78   SADVVEMFVGLFVLFQCLRPYFPLPERWFPASLRGGWIKEILLGCALFPIVSTLNNLNSN  137

Query  663  LFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPV  484
            + P +PS  + VS   QS++  D V++  Y  +VS+ APIWEE+IFRGFLLPS+TRY  V
Sbjct  138  MMP-IPSNTLPVSPWEQSLMSNDLVSILFYVAVVSLVAPIWEEMIFRGFLLPSITRYFRV  196

Query  483  WGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
              ++LLSS+ FALAHFS++R++PL FLG+L+  +++RSRN+LAP++LH LWNA+ F++L+
Sbjct  197  DVAVLLSSLIFALAHFSMERLIPLTFLGMLMCVVYIRSRNILAPIILHSLWNAFAFVELI  256



>ref|XP_006838673.1| hypothetical protein AMTR_s00002p00243720 [Amborella trichopoda]
 gb|ERN01242.1| hypothetical protein AMTR_s00002p00243720 [Amborella trichopoda]
Length=98

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 4/100 (4%)
 Frame = -2

Query  600  RDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRM  421
            RDPVAM LYAI+VS+CAPIW++IIFR FLLPSLTRY+PVW S+ +SS+AFA+ HF++   
Sbjct  3    RDPVAMALYAIVVSVCAPIWDDIIFRAFLLPSLTRYIPVWCSVAMSSLAFAVVHFNVL--  60

Query  420  LPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLMK  301
              LVFLGV LG +FVRSRNLLA M+LH LWN +VFLDLMK
Sbjct  61   --LVFLGVALGAVFVRSRNLLASMILHSLWNGFVFLDLMK  98



>ref|WP_015130455.1| abortive infection protein [Calothrix sp. PCC 7507]
 ref|YP_007067487.1| abortive infection protein [Calothrix sp. PCC 7507]
 gb|AFY34653.1| Abortive infection protein [Calothrix sp. PCC 7507]
Length=527

 Score =   155 bits (391),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             A + +L+  + +FFPLP +WF FS   KW  + +G  C   P++  +S +N  L+    
Sbjct  351  SAALLVLYVSIKRFFPLPDSWFSFSFQNKWFLWGLGGYCAALPIVVLVSLINQQLWQGRG  410

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    + Q++  +D VA+ ++ +  +I AP +EE++FRGFLLPSLTRY+PVWG+IL
Sbjct  411  GSNPL----LQQALESQDSVALGIFYLTAAIAAPFFEEVLFRGFLLPSLTRYLPVWGAIL  466

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SS+ FALAH SL  +LPL  LG++LG ++ RSR+LLAPMLLH LWN+   L L
Sbjct  467  ASSLLFALAHLSLSEILPLTALGIVLGVVYTRSRSLLAPMLLHSLWNSGTLLSL  520



>ref|WP_015172784.1| abortive infection protein [Geitlerinema sp. PCC 7407]
 ref|YP_007110272.1| abortive infection protein [Geitlerinema sp. PCC 7407]
 gb|AFY67220.1| Abortive infection protein [Geitlerinema sp. PCC 7407]
Length=507

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -2

Query  783  FFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLPSTPVTVSNVGQSI  607
            F PLP +WF+FSL G W  + VG  CV  PL+  +S +N  ++     +   +S   Q+ 
Sbjct  343  FRPLPPDWFRFSLRGNWVWWAVGGYCVALPLVIAVSLINQQIWQGQGGSNPILSLALQA-  401

Query  606  VVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQ  427
               DPVA+ ++    SI AP++EEI+FRGFLLPSLTRY+PVWG+I LSS+ FALAH SL 
Sbjct  402  --EDPVALLIFFSTASIAAPLFEEILFRGFLLPSLTRYVPVWGAIALSSLIFALAHLSLS  459

Query  426  RMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
             +LPL  LG +LG ++ RSRNLLAPMLLHGLWN+   + L+
Sbjct  460  EVLPLATLGCVLGFVYTRSRNLLAPMLLHGLWNSGTLVSLV  500



>ref|WP_017316111.1| abortive phage infection protein [Mastigocladopsis repens]
Length=526

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + +FFPLP +WF+F L G W  + +G  CV  P++  +S VN  L+     
Sbjct  350  GALSVLYLSIKRFFPLPEDWFRFRLQGAWFLWGLGGYCVALPIVVVVSLVNQQLWQGQGG  409

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++     I API+EEI+FRGFLLPSLTRY+PVWGSIL 
Sbjct  410  SNPL----LQLALESQDTVALGIFFFTAGIAAPIFEEILFRGFLLPSLTRYLPVWGSILA  465

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS  FA AH SL  ++PL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  466  SSFLFAAAHLSLSEIIPLFTLGIVLGIVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|XP_003064160.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51782.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=229

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 117/179 (65%), Gaps = 1/179 (1%)
 Frame = -2

Query  843  TMDSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLN  664
            + D  +   G+ +L++ L  +FPLP  WF  +L G+W  ++   CV FP++     +N  
Sbjct  52   SADVVEMFVGLGVLYQCLRPYFPLPKRWFPIALKGRWWMEILRGCVAFPIVTATVNLNSA  111

Query  663  LFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPV  484
            + P + S  + +S   Q ++  D +++  Y  +VS+ AP+WEE+IFRGFL+PSLTRY  +
Sbjct  112  MMP-VSSASLPMSPWEQVMISNDILSVCFYIGVVSLVAPVWEEMIFRGFLMPSLTRYFRM  170

Query  483  WGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
              +I+LSS  FA AHFS++R+LPL  LG+L+  +++RS+N+LAP++LH LWN   F ++
Sbjct  171  DVAIVLSSFLFAAAHFSMERLLPLTVLGMLMCVVYIRSKNILAPIVLHSLWNFCAFFEI  229



>ref|WP_038081935.1| abortive phage infection protein [Tolypothrix bouteillei]
 gb|KIE08186.1| abortive phage infection protein [Tolypothrix bouteillei VB521301]
Length=527

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              +++L+  + +F PLP  WF+F    KW F  +G  CV  P++  +S VN  L+     
Sbjct  351  GALSVLYLAINRFLPLPDGWFRFRFKDKWFFWGLGGYCVALPVVVIVSLVNQQLWKGQGG  410

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +  V +S   +D VA++++    +I AP +EEI+FRGFLLPSLTRY+PVWGSIL+S
Sbjct  411  SNPLLQLVLES---QDSVALSIFFSTAAIAAPFFEEILFRGFLLPSLTRYLPVWGSILIS  467

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S  FA AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  468  SFLFAAAHLSLAEVLPLFSLGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  519



>ref|WP_008188312.1| CAAX amino terminal protease family [Moorea producens]
 gb|EGJ30098.1| CAAX amino terminal protease family [Moorea producens 3L]
Length=190

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 114/179 (64%), Gaps = 18/179 (10%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLF-----  658
             G+ +++  +  F PLP +WF+F     W  + VG   +  PL+  +S +N  L+     
Sbjct  16   GGLLVMYLSIKPFLPLPQDWFRFKWRSNWIVWGVGGYLIALPLVIVVSLINQQLWQGNGG  75

Query  657  --PFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPV  484
              P LP     ++  GQ     D +A+T++ +  ++ AP++EEIIFRGFLLPSLTRY+PV
Sbjct  76   SNPLLP-----LALEGQ-----DSIALTIFFLTAAVAAPVFEEIIFRGFLLPSLTRYLPV  125

Query  483  WGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            WG+I LSS+ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  126  WGAIALSSLIFAIAHLSLSEVLPLATLGIVLGFVYTRSRNLLAPMLLHSLWNSGTLLSL  184



>gb|AHJ26426.1| hypothetical protein NSP_690 [Nodularia spumigena CCY9414]
Length=504

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  L +FFPLP NWF+F L  +W  +  G  C   P++  +S VN  L+    
Sbjct  328  SGALSVLYFSLKRFFPLPENWFRFRLQDRWILWGFGGYCAALPIVVLVSLVNQQLWQGQG  387

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ ++    +I API+EE++FRGFLLPSLTRY+PVWG+I+
Sbjct  388  GSNPL----LQLALESQDTVALGMFFFTAAIAAPIFEELLFRGFLLPSLTRYVPVWGAII  443

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +SS+ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  444  VSSLLFAIAHLSLSEILPLTALGIVLGVVYTRSRNLLAPMLLHSLWN  490



>ref|WP_006194387.1| abortive phage infection protein [Nodularia spumigena]
 gb|EAW47168.1| hypothetical protein N9414_04925 [Nodularia spumigena CCY9414]
Length=522

 Score =   151 bits (381),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  L +FFPLP NWF+F L  +W  +  G  C   P++  +S VN  L+    
Sbjct  346  SGALSVLYFSLKRFFPLPENWFRFRLQDRWILWGFGGYCAALPIVVLVSLVNQQLWQGQG  405

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ ++    +I API+EE++FRGFLLPSLTRY+PVWG+I+
Sbjct  406  GSNPL----LQLALESQDTVALGMFFFTAAIAAPIFEELLFRGFLLPSLTRYVPVWGAII  461

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +SS+ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  462  VSSLLFAIAHLSLSEILPLTALGIVLGVVYTRSRNLLAPMLLHSLWN  508



>ref|WP_014274552.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005067475.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI88937.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=491

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 109/176 (62%), Gaps = 12/176 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFL--  649
             G+ +L+  +  FFPLP  WF+F L   W F   G  CV  PL+   S VN  L+     
Sbjct  315  GGLGVLYLSIKSFFPLPEGWFRFKLWDSWLFWGFGGYCVALPLVILTSLVNQRLWDGQGG  374

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ + N       RDPVA+ ++    SI AP +EE++FRGFLLPSLTRY P+WG+
Sbjct  375  SNPILPIALEN-------RDPVALGIFFFTASIAAPWFEEVLFRGFLLPSLTRYFPLWGA  427

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            I+ S + FA+AH ++  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  428  IIASGLLFAVAHLNVSEILPLFVLGIVLGFVYTRSRNLLAPMLLHSLWNSGTLISL  483



>ref|WP_017655174.1| abortive phage infection protein [Microchaete sp. PCC 7126]
Length=525

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               + +L+  + +FFPLP +WF F    KW  + +G  C   P++  +S +N  L+    
Sbjct  349  AGALLVLYSSIKRFFPLPDSWFSFRFQNKWFLWGLGGYCAALPIVVLVSLINQQLWQGKG  408

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    + Q++  +D VA+ ++ +  +I AP +EE++FRGFLLPSLTRY+ VWG+I+
Sbjct  409  GSNPL----LQQALESQDSVALGIFYVTAAIAAPFFEEVLFRGFLLPSLTRYLSVWGAII  464

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SS+ FALAH SL  +LPL  LG++LG ++ RSR+LLAPMLLH LWN+   L L
Sbjct  465  ASSLLFALAHLSLSEILPLTALGIVLGVVYTRSRSLLAPMLLHSLWNSGTLLSL  518



>ref|WP_027843144.1| abortive phage infection protein [Mastigocoleus testarum]
Length=513

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              + +L+  +  FFPL  +WF+F    KW  +  G  C   P++  +S +N  L+     
Sbjct  337  GALGVLYFSIKNFFPLAEDWFRFHFRDKWFLWGFGGYCAALPIVLLVSVINQKLWEGQGG  396

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +  V +S   +D VA+ ++    +I AP++EEI+FRGFLLPSLT+Y+PVWGSI++S
Sbjct  397  SNPLLQLVLKS---QDSVALAIFFFTAAIAAPLFEEILFRGFLLPSLTKYLPVWGSIIIS  453

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+ FA AHFSL  ++PL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  454  SVLFAAAHFSLSELIPLTSLGIILGIVYTRSRNLLAPMLLHSLWNSGTLLSL  505



>ref|XP_002948930.1| hypothetical protein VOLCADRAFT_80447 [Volvox carteri f. nagariensis]
 gb|EFJ49865.1| hypothetical protein VOLCADRAFT_80447 [Volvox carteri f. nagariensis]
Length=341

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 110/187 (59%), Gaps = 1/187 (1%)
 Frame = -2

Query  864  SH*TLDSTMDSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINR  685
            SH  L   +D       ++IL   L +F PL    F   L G W   V LCC  FPL++ 
Sbjct  152  SHAVLHLCLDLSQLIITLSILWSCLREFRPLSLGLFPVRLRGLWPLAVVLCCASFPLVDW  211

Query  684  LSQVNLNLFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPS  505
            L+  ++  FPF P      SN+  S+ V D V   +Y  +VS+CAPIWEE IFRGFLL S
Sbjct  212  LAHQSMGWFPFEPDAS-WASNLEHSLSVGDWVTNVVYFSVVSLCAPIWEEAIFRGFLLTS  270

Query  504  LTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNA  325
            L RYMP   ++ +SS+ FA  HF +Q  LPL+ LGV+   +F+R++NL+ P+LLH  WN 
Sbjct  271  LARYMPTPAAVAVSSVVFASCHFRMQTFLPLLVLGVVFSGVFIRTKNLIPPILLHSAWNM  330

Query  324  YVFLDLM  304
            YV + L+
Sbjct  331  YVLVTLV  337



>ref|WP_019490774.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=519

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  +  F PL  +WF+F LGGKW  + +G  CV  P++  +S VN  ++    
Sbjct  342  AGSISVLYFSIKPFLPLNHDWFRFRLGGKWILWGLGGYCVAIPIVLFVSLVNQQIWQGQG  401

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ ++    +I AP++EE +FRGFLLPSLTRYMPVW SI+
Sbjct  402  GSNPL----LQLALEAKDSVALGIFFTTAAIAAPLFEEFLFRGFLLPSLTRYMPVWASII  457

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS  FA AH SL  +LPL  LG++LG ++ RSRNLLAPM+LH LWN+   L L
Sbjct  458  VSSFIFAAAHLSLSEILPLTSLGIILGIVYTRSRNLLAPMMLHSLWNSGTLLTL  511



>ref|WP_015187177.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007126460.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ29300.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
Length=529

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
             G+ +L+  +  FFPLP +WF+F+L G W  + +G  C   PL+  +S +N  ++     
Sbjct  353  GGLVVLYFSIKPFFPLPKDWFRFNLQGNWFLWGLGGYCAALPLVVIVSLINQQIWQGQGG  412

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +S   Q+   +D VA+ ++    +I API+EE++FRGFLLPSLTRY+ V G+ILLS
Sbjct  413  SNPLLSLALQA---QDQVALAIFFFTAAIAAPIFEELLFRGFLLPSLTRYVSVSGAILLS  469

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+ FA+AH S+  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  470  SLLFAVAHLSVAEILPLTVLGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  521



>ref|XP_005646969.1| metal-dependent CAAX amino terminal protease-like protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE22425.1| metal-dependent CAAX amino terminal protease-like protein [Coccomyxa 
subellipsoidea C-169]
Length=228

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 109/182 (60%), Gaps = 5/182 (3%)
 Frame = -2

Query  843  TMDSKDYCAGMAILHRRLAKFFPLPSNWFKFSLG--GKWHFDVGLCCVMFPLINRLSQVN  670
             +D  +  A + IL   L  + P    WF   L     W   + L C  FPL++  +  +
Sbjct  41   VLDVGELGATLGILWGCLRAYRPRALGWFHARLWPPHPWLGHMVLACAAFPLVDLAAARS  100

Query  669  LNLFPFLPSTPVTVSNV-GQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRY  493
               FP          NV  QS+   D V+  +Y ++V++CAPIWEE IFRGFLLPSLTRY
Sbjct  101  QGWFPH--DIDAWGPNVLEQSLAAGDLVSNAIYFVVVTVCAPIWEEAIFRGFLLPSLTRY  158

Query  492  MPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFL  313
            MPV  ++L+S++ FA AHFSLQR LPLV LGV+ G++ VR+RNL   +LLH LWNAY+F 
Sbjct  159  MPVAAAVLVSALGFAAAHFSLQRFLPLVMLGVIFGSLLVRTRNLAPCVLLHSLWNAYIFW  218

Query  312  DL  307
             L
Sbjct  219  QL  220



>ref|WP_039714507.1| abortive phage infection protein [Scytonema millei]
 gb|KIF22213.1| abortive phage infection protein [Scytonema millei VB511283]
Length=549

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  FFPLP  WF+F+    W  + VG  CV  PL+  +S +N  L+    
Sbjct  372  AGGLGVLYLSIKSFFPLPEGWFRFNWRSNWILWGVGGYCVALPLVLIVSIINQQLWQGQG  431

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  RD VA++++    +I AP++EE +FRGFLLPSLTRY+ VW +I+
Sbjct  432  GSNPL----LSLALEARDSVALSIFFFTAAIAAPLFEEFLFRGFLLPSLTRYISVWWAII  487

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LS+  FALAH SL  +LPL+ LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  488  LSAFLFALAHLSLSEILPLMTLGIILGIVYTRSRNLLAPMLLHSLWNSGTLLSL  541



>ref|WP_015157261.1| abortive infection protein [Chroococcidiopsis thermalis]
 ref|YP_007094592.1| abortive infection protein [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY90723.1| Abortive infection protein [Chroococcidiopsis thermalis PCC 7203]
Length=549

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  FFPLP  WF+F+    W  +  G  CV  PL+  +S +N  L+    
Sbjct  372  AGGLGVLYLSIKSFFPLPEGWFRFNWRSNWILWGFGGYCVALPLVLIVSIINQQLWQGQG  431

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  RD VA++++    +I AP++EE +FRGFLLPSLTRYM VW +I+
Sbjct  432  GSNPL----LSLALEARDSVALSIFFFTAAIAAPLFEEFLFRGFLLPSLTRYMSVWWAII  487

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LS+  FALAH SL  +LPL+ LG++LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  488  LSAFLFALAHLSLSEILPLMTLGIILGIVYTRSRNLLAPMLLHSLWNSGTLVSL  541



>ref|WP_016878155.1| abortive phage infection protein [Chlorogloeopsis fritschii]
Length=526

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               + +L+  + +FFPLPS+WF+F     W  +  G  C   P++  +S +N  L+    
Sbjct  349  SGALLVLYLSIKRFFPLPSDWFRFRWQSNWFLWGFGGYCAALPIVVVVSLINQQLWQGQG  408

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ L+ +  +I API+EE +FRGFLLPSLTRY+ VWG+I+
Sbjct  409  GSNPL----LQLALESQDSVALGLFFVTAAIAAPIFEEFLFRGFLLPSLTRYLSVWGAII  464

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  465  VSSLLFAVAHLSLSEVLPLFSLGVVLGVVYTRSRNLLAPMLLHSLWNSGTLISL  518



>ref|WP_026135053.1| abortive phage infection protein [Scytonema hofmanni]
Length=528

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              +++L+  + +FFPL ++WF+      W  +  G  CV  P++  +S +N  L+     
Sbjct  352  GALSVLYLAIKRFFPLSNDWFRVRFKENWFLWGFGGYCVALPVVVVVSLINQQLWKGQGG  411

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +  V +S   +D VA+T++    +I API+EEI+FRGFLLPSLTRY+PVWGSIL+S
Sbjct  412  SNPLLQLVLES---QDSVALTIFFSTAAIAAPIFEEILFRGFLLPSLTRYLPVWGSILIS  468

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S  FA AH SL  + PL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  469  SFLFAAAHLSLAEIFPLFSLGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  520



>ref|WP_036479682.1| abortive phage infection protein [Myxosarcina sp. GI1]
Length=524

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 114/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             +G+ +L+  +  FFPLP +WFK  L   W  + +G   V  P +  +S +N  ++    
Sbjct  348  ASGILVLYLSVKSFFPLPQDWFKIKLFSNWVLWGLGGYLVAVPSVLIVSLINQQIWNGQG  407

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+       ++  +D VA+T++ +  SI API+EEI+FRGFLLPSLTRY+ VWG+I+
Sbjct  408  GSNPLLFL----ALQAQDKVALTIFFVTASIAAPIFEEIMFRGFLLPSLTRYVSVWGAII  463

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +S++ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  464  ISALIFAVAHLSLSEVLPLATLGIVLGVVYTRSRNLLAPMLLHSLWNSGTLISL  517



>ref|WP_012407312.1| abortive phage infection protein [Nostoc punctiforme]
 ref|YP_001864230.1| hypothetical protein Npun_R0514 [Nostoc punctiforme PCC 73102]
 gb|ACC79287.1| Abortive infection protein [Nostoc punctiforme PCC 73102]
Length=524

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = -2

Query  792  LAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPVTVSNV  619
            L  FFPLP  WF+F     W  + +G  C   P++  +S +N  L+     S P+    +
Sbjct  359  LKPFFPLPEFWFRFRFQNNWFLWGLGGYCTALPIVVMVSLINQQLWQGQGGSNPL----L  414

Query  618  GQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAH  439
              ++  +D VA+ ++    +I AP +EEI+FRGFLLPSLTRY+PVWGSI++SS+ FA+AH
Sbjct  415  QLALESQDGVALGIFFFTAAIAAPFFEEILFRGFLLPSLTRYLPVWGSIIISSLLFAIAH  474

Query  438  FSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  475  LSLSEILPLTALGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_016951194.1| abortive phage infection protein [Anabaena sp. PCC 7108]
Length=513

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 109/167 (65%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + ++FPL   WF+F   G W  + +G  C   P++  +S +N  L+    
Sbjct  337  SGALSVLYFSIRRYFPLAEEWFRFRFQGNWFLWGLGGYCTALPIVVIVSLINQKLWQGQG  396

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  RD +A+ ++    +I AP++EE++FRGFLLPSLTRY+PVWGSIL
Sbjct  397  GSNPL----LQLALESRDSIALGIFFFTAAIAAPLFEELLFRGFLLPSLTRYLPVWGSIL  452

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +SS+ FA AH SL  +LPL  LG++LG ++ RSRNL APMLLH LWN
Sbjct  453  VSSLLFAAAHLSLSEILPLTALGMVLGVVYTRSRNLFAPMLLHSLWN  499



>ref|WP_008050985.1| abortive phage infection protein [Arthrospira sp. PCC 8005]
 emb|CCE16715.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
 emb|CDM95393.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
Length=492

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 12/176 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL--  649
             G+ +L+  +  FFPLP  WF+F L   W  +  G  CV  PL+   S VN  L+     
Sbjct  316  GGLGVLYLSIKSFFPLPEGWFRFKLWDSWLLWGFGGYCVALPLVILTSLVNQRLWDGQGG  375

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ + N       RDPVA+ ++    SI AP +EE++FRGFLLPSLTRY  +WG+
Sbjct  376  SNPILPIALEN-------RDPVALGIFFFTASIAAPWFEEVLFRGFLLPSLTRYFSLWGA  428

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            I+ S + FA+AH ++  +LPL  LG++LG ++ RSRNL APMLLH LWN+   + L
Sbjct  429  IIASGLLFAVAHLNVSEILPLFVLGIVLGFVYTRSRNLWAPMLLHSLWNSGTLISL  484



>ref|WP_006619217.1| MULTISPECIES: abortive phage infection protein [Arthrospira]
 gb|EDZ94156.1| Abortive infection protein [Arthrospira maxima CS-328]
Length=500

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 12/176 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL--  649
             G+ +L+  +  FFPLP  WF+F L   W  +  G  CV  PL+   S VN  L+     
Sbjct  324  GGLGVLYLSIKSFFPLPEGWFRFKLWDSWLLWGFGGYCVALPLVILTSLVNQRLWDGQGG  383

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ + N       RDPVA+ ++    SI AP +EE++FRGFLLPSLTRY  +WG+
Sbjct  384  SNPILPIALEN-------RDPVALGIFFFTASIAAPWFEEVLFRGFLLPSLTRYFSLWGA  436

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            I+ S + FA+AH ++  +LPL  LG++LG ++ RSRNL APMLLH LWN+   + L
Sbjct  437  IIASGLLFAVAHLNVSEILPLFVLGIVLGFVYTRSRNLWAPMLLHSLWNSGTLISL  492



>gb|KDR58696.1| abortive phage infection protein [Arthrospira platensis str. 
Paraca]
Length=492

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 12/176 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL--  649
             G+ +L+  +  FFPLP  WF+F L   W  +  G  CV  PL+   S VN  L+     
Sbjct  316  GGLGVLYLSIKSFFPLPEGWFRFKLWDSWLLWGFGGYCVALPLVILTSLVNQRLWDGQGG  375

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ + N       RDPVA+ ++    SI AP +EE++FRGFLLPSLTRY  +WG+
Sbjct  376  SNPILPIALEN-------RDPVALGIFFFTASIAAPWFEEVLFRGFLLPSLTRYFSLWGA  428

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            I+ S + FA+AH ++  +LPL  LG++LG ++ RSRNL APMLLH LWN+   + L
Sbjct  429  IIASGLLFAVAHLNVSEILPLFVLGIVLGFVYTRSRNLWAPMLLHSLWNSGTLISL  484



>ref|WP_010997926.1| abortive phage infection protein [Nostoc sp. PCC 7120]
 ref|NP_487825.1| hypothetical protein all3785 [Nostoc sp. PCC 7120]
 dbj|BAB75484.1| all3785 [Nostoc sp. PCC 7120]
Length=528

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 111/167 (66%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + +FFPLP  WF+F L   W    +G  C   P++  +S +N  L+    
Sbjct  352  SGALSVLYFSIKRFFPLPQYWFRFRLRDNWFLWGLGGYCAALPIVVIVSLINQQLWQGQG  411

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D  A++++ +  +I AP++EE++FRGFLLPSLTRY+PVWG+I+
Sbjct  412  GSNPL----LQLALESQDFTALSIFYVTAAIAAPLFEEVLFRGFLLPSLTRYIPVWGAII  467

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             S++ FA+AH SL  +LPL  LG++LG ++ RSRNLLAP+LLH LWN
Sbjct  468  ASAVLFAVAHLSLSEILPLTALGIVLGVVYTRSRNLLAPILLHSLWN  514



>ref|WP_015115811.1| abortive infection protein [Nostoc sp. PCC 7107]
 ref|YP_007052773.1| abortive infection protein [Nostoc sp. PCC 7107]
 gb|AFY45623.1| Abortive infection protein [Nostoc sp. PCC 7107]
Length=521

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 111/167 (66%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++++  + +FFPLP  WFKF L   W  + +G  C   P++  +S +N  L+    
Sbjct  345  VGALSVMYFSIKRFFPLPRLWFKFQLRDSWWLWGLGGYCTALPIVVVVSLINQKLWQGQG  404

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ ++    +I AP++EEI+FRGFLLPSLTRY+PVWG+I+
Sbjct  405  GSNPL----LQLALESQDGVALGIFFSTAAISAPLFEEILFRGFLLPSLTRYLPVWGAII  460

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             SS+ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  461  ASSLLFAIAHLSLSEVLPLTALGIVLGIVYTRSRNLLAPMLLHSLWN  507



>ref|WP_026719661.1| abortive phage infection protein [Fischerella sp. PCC 9431]
Length=525

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + +FFPL SNWF+F+L GKW  +  G  C   P++  +S +N  ++     
Sbjct  350  GAISVLYLSIKRFFPLESNWFRFNLRGKWFLWGFGGYCAALPVVVVVSLINQQIWQGQGG  409

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++ +  +I AP++EE +FRGFLL SLTRYM VW +I+ 
Sbjct  410  SNPL----LQLALKSQDSVALGIFFVTAAIAAPLFEEFLFRGFLLSSLTRYMSVWWAIIT  465

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+  FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  466  SAFLFAIAHLSLSEVLPLFALGVVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_011318362.1| abortive phage infection protein [Anabaena variabilis]
 ref|YP_322064.1| abortive infection protein [Anabaena variabilis ATCC 29413]
 gb|ABA21169.1| Abortive infection protein [Anabaena variabilis ATCC 29413]
Length=528

 Score =   142 bits (358),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + +FFPLP  WF+F L   W  + +G  C   P++  +S +N  L+    
Sbjct  352  SGALSVLYFSIKRFFPLPQYWFRFRLRDNWFLWGLGGYCAALPIVVIVSLINQQLWQGQG  411

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D  A++++ +  +I AP++EE++FRGFLLPSLTRY+PVWG+I+
Sbjct  412  GSNPL----LQLALESQDFTALSIFYVTAAIAAPLFEEVLFRGFLLPSLTRYVPVWGAII  467

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             S++ FA+AH SL  +LPL  LG++LG ++ RSRNLLAP+LLH LWN
Sbjct  468  TSAVLFAVAHLSLSEILPLTALGIVLGVVYTRSRNLLAPILLHSLWN  514



>ref|WP_029637233.1| abortive phage infection protein [[Scytonema hofmanni] UTEX B 
1581]
Length=522

 Score =   142 bits (358),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  L  F PL S+WF+F +  KW  +  G  CV FP++  +S +N  L+    
Sbjct  346  SGALSVLYFSLKPFLPLESDWFRFRVLDKWFLWGFGGYCVAFPIVVVVSLINQQLWQGQG  405

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D  A++++    +I AP++EE++FRGFLLPSLTRY  VWG+I 
Sbjct  406  GSNPL----LQLALESQDTTALSIFFFTAAIAAPLFEEVLFRGFLLPSLTRYFSVWGAIF  461

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +S++ FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  462  ISALLFAIAHLSLSEILPLSALGVVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  515



>ref|WP_006516835.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 7375]
 gb|EKV02452.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 7375]
Length=497

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             +G+A+L   +  + PLP +WF+  + G+W  + VG   V  PL+  +S +N  ++    
Sbjct  322  ASGIAVLAGSIWTYRPLPQDWFQIKVLGRWPLWGVGGYVVALPLMIAISALNQQIWRGQG  381

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
                 +  V Q     D +A+ L+ +  ++ AP++EE++FRGFLLPSLTRYMPVWG+ILL
Sbjct  382  GNNPLLQTVLQE---SDSIALLLFFLTAAVAAPLFEEVLFRGFLLPSLTRYMPVWGAILL  438

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS  FA AH SL  +LPL  LG +L  ++ RSRNLLAPML+H LWN+   + L
Sbjct  439  SSFIFASAHLSLSEVLPLTMLGTILAWVYSRSRNLLAPMLIHSLWNSATLIGL  491



>ref|WP_016860061.1| abortive phage infection protein [Fischerella muscicola]
Length=525

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + +FFPL S+WF+F+L GKW  +  G  CV  P++  +S +N  ++     
Sbjct  350  GAVSVLYLSIKRFFPLESSWFRFNLRGKWFLWGFGGYCVALPVVVVVSLINQQIWQGQGG  409

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++ +  +I AP++EE +FRGFLLPSLTRY+ VW +I++
Sbjct  410  SNPL----LQLALEGQDSVALGIFFVTAAIAAPLFEEFLFRGFLLPSLTRYVSVWWAIII  465

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S++ FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  466  SALLFAIAHLSLSEVLPLFALGVVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_017309079.1| abortive phage infection protein [Fischerella sp. PCC 9339]
Length=525

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + +F PL S+WF+F+LGGKW  +  G  C   P++  +S +N  ++     
Sbjct  350  GAISVLYLSIKRFLPLESSWFRFNLGGKWFLWGFGGYCAALPVVVVVSLINQQIWQGQGG  409

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++ +  +I AP++EE +FRGFLLPSLTRY+ VW +I+ 
Sbjct  410  SNPL----LQLALEGQDSVALGIFFVTAAIAAPLFEEFLFRGFLLPSLTRYVSVWWAIIT  465

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+  FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  466  SAFLFAIAHLSLSEVLPLFALGVVLGIVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_015133566.1| abortive infection protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007070628.1| abortive infection protein [Leptolyngbya sp. PCC 7376]
 gb|AFY37794.1| Abortive infection protein [Leptolyngbya sp. PCC 7376]
Length=497

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             AG+ +L   + KF PLP NWF+      W  +  G   V  PL+  +S +N  ++    
Sbjct  323  IAGILVLVASIWKFRPLPKNWFQIKWLDNWTVWGFGGYMVALPLVLIVSLINQQIWQGQG  382

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+       ++  +D VA+T++ +  S+ AP++EEI+FRGFLLPSLTRY+PVWGSI+
Sbjct  383  GSNPILFL----ALKAQDQVALTIFFMTASVLAPLYEEIMFRGFLLPSLTRYLPVWGSIV  438

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LS+  FA+AH SL  +LPL+ LG++LG ++ +S+N+LAPMLLH LWN+   L L
Sbjct  439  LSAFLFAIAHLSLSEVLPLMTLGIILGFVYTKSKNILAPMLLHSLWNSGTLLSL  492



>ref|WP_023071621.1| abortive infection protein [Leptolyngbya sp. Heron Island J]
 gb|ESA37592.1| abortive infection protein [Leptolyngbya sp. Heron Island J]
Length=496

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 109/173 (63%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             +G+A+L   +  + PLP  WF+F L G+W  + VG   V  PL+  +S +N  ++    
Sbjct  322  VSGIAVLVGSIWAYRPLPKGWFQFKLFGRWPLWGVGGYLVALPLMIAISALNQQIWRGQG  381

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
                 +  V Q     D VA+ L+ +  ++ AP++EE++FRGFLLPSLTRYMPVW +ILL
Sbjct  382  GNNPLLQTVLQE---SDSVALLLFFLTAAVAAPLFEEVLFRGFLLPSLTRYMPVWSAILL  438

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA AH SL  +LPL  LG +L  ++ RSRNLL+PML+H LWN+   + L
Sbjct  439  SSLIFAAAHLSLSEVLPLTLLGTILAWVYARSRNLLSPMLIHSLWNSATLVGL  491



>ref|WP_026732987.1| abortive phage infection protein [Fischerella sp. PCC 9605]
Length=527

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 109/164 (66%), Gaps = 6/164 (4%)
 Frame = -2

Query  792  LAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPVTVSNV  619
            + +FFPL  +WF+F L GKW  +  G  C   P++  +S +N  L+     S P+    +
Sbjct  360  IKRFFPLSPDWFRFKLQGKWFLWGFGGYCAALPIVVVVSLINQELWQGQGGSNPL----L  415

Query  618  GQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAH  439
              ++  +D +A++++ +  +I AP++EE +FRGFLLPSLTRYM VW +I+ SS+ FA+AH
Sbjct  416  QLALESQDSIALSIFFLTAAIAAPLFEEFLFRGFLLPSLTRYMSVWWAIIASSLLFAIAH  475

Query  438  FSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  476  LSLSEVLPLFALGVVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  519



>ref|WP_017661438.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=523

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 116/175 (66%), Gaps = 9/175 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSL--GGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
            A +++L+  L  +FPL  +WF+FS+  G  W F   L  V  PL+  +S VN  ++    
Sbjct  349  AALSVLYLSLKPYFPLKPDWFRFSVPKGIGWGFAGYLAAV--PLVLGVSLVNQEIWDGKG  406

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++   D +A+T + I  SI AP++EE IFRGFLLPSLT+Y+PVWG+I+
Sbjct  407  GSNPI----LEIALKSGDWIAITCFFITASILAPVFEEFIFRGFLLPSLTKYVPVWGAIV  462

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            +SS+ FALAH S+  +LPL  LG++LG I+ RSRNLLA ML+HGLWN+   L L+
Sbjct  463  ISSLVFALAHLSVSEVLPLATLGIVLGVIYARSRNLLAAMLMHGLWNSGTLLSLV  517



>gb|KEI69029.1| hypothetical protein A19Y_4361 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=526

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L+  +  +FPLP  WF F L   W  + +G   V  PL+  +S +N   +    
Sbjct  349  VGGFSVLYFSIKSYFPLPEGWFTFKLKDNWFVWGLGGYLVALPLVILVSLINQKFWDGQG  408

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + +       RD VA+ ++ I  SI API+EE +FRGFLLPSLTRY+P+  
Sbjct  409  GSNPLLPIALES-------RDSVALGIFFITASIAAPIFEETMFRGFLLPSLTRYLPLGS  461

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +ILLS   FA+AHF++  +LPL+ LG++LG ++ RSRNLLAPM +HGLWN+   L L
Sbjct  462  AILLSGFLFAVAHFNVSEILPLMTLGIVLGFVYTRSRNLLAPMFMHGLWNSGTLLSL  518



>ref|WP_015199187.1| abortive infection protein [Calothrix parietina]
 ref|YP_007138532.1| abortive infection protein [Calothrix sp. PCC 6303]
 gb|AFZ02560.1| Abortive infection protein [Calothrix sp. PCC 6303]
Length=507

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 113/175 (65%), Gaps = 7/175 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLG-GKW-HFDVGLCCVMFPLINRLSQVNLNLFPFL  649
               + +L+  + +F PLP  WF+ + G GKW  + +G  CV  P++  +S +N  ++   
Sbjct  329  AGALLVLYFSIKRFLPLPEGWFRLNFGNGKWILWGIGGYCVAVPVVLIVSLLNQKIWQGQ  388

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  +D VA+ ++    +I AP++EE +FRGFLLPSLTRY+PVWG+I
Sbjct  389  GGSNPL----LQLALESQDSVALGIFFFTAAIAAPLFEEFLFRGFLLPSLTRYLPVWGAI  444

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +LSS+ FA AH SL  ++PL FLG +LG ++ RSRNLLA MLLH LWN+   L L
Sbjct  445  VLSSLLFAAAHLSLSEIIPLFFLGCILGVVYTRSRNLLASMLLHSLWNSGTLLAL  499



>ref|WP_016868025.1| abortive phage infection protein [Fischerella muscicola]
Length=526

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + +F PL S WF+F+L GKW  +  G  C   P++  +S +N  ++    
Sbjct  349  SGAISVLYLSIKRFLPLESGWFRFNLQGKWFLWGFGGYCAALPVVVVVSLINQQIWQGQG  408

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D +A+ ++ +  +I AP++EE +FRGFLLPSLTRYM VW +I+
Sbjct  409  GSNPL----LQLALESQDSLALGIFFLTAAIAAPLFEEFLFRGFLLPSLTRYMSVWWAII  464

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SS  FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  465  ASSFLFAIAHLSLSEVLPLFALGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_013190948.1| abortive phage infection protein [Trichormus azollae]
 ref|YP_003721053.1| abortive infection protein ['Nostoc azollae' 0708]
 gb|ADI63930.1| Abortive infection protein ['Nostoc azollae' 0708]
Length=515

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + ++FPLP  WF+F     W  + +G  C   P++  +S +N  L+     
Sbjct  339  GALSVLYYSIKRYFPLPQGWFRFRFQSNWFLWGLGGYCTALPIVVIVSLINQQLWQGQGG  398

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  RD +A+ ++     I AP +EE +FRGFLLPSLTRY+PVWG+I  
Sbjct  399  SNPL----LQLALESRDNIALGIFFFTAGIAAPFFEEFLFRGFLLPSLTRYVPVWGAIGA  454

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FA AH SL  +LPL  LG++LG I+ RSRNLLAPMLLH LWN
Sbjct  455  SSLLFAAAHLSLSEILPLTALGIVLGIIYTRSRNLLAPMLLHSLWN  500



>ref|WP_006098562.1| abortive phage infection protein [Coleofasciculus chthonoplastes]
 gb|EDX78126.1| CAAX amino terminal protease family [Coleofasciculus chthonoplastes 
PCC 7420]
Length=547

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 109/174 (63%), Gaps = 4/174 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  F PLP +WF+     K   F +G   V  PL+  +S +N  L+    
Sbjct  370  AGGLGVLYLSIKDFLPLPEDWFRIKFRKKGIIFGLGGYLVALPLVILVSLLNQKLWQGQG  429

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   +S V   +  +D VA+ ++     I AP++EE +FRGFLLPSLTRYMPVWG+I+ 
Sbjct  430  GSNPILSLV---LEGQDTVAIVIFFSTACIAAPLFEEFMFRGFLLPSLTRYMPVWGAIVT  486

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            SS+ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPM++H LWN+   L L+
Sbjct  487  SSLVFAIAHLSLSEVLPLATLGIVLGIVYTRSRNLLAPMIVHSLWNSGTLLSLV  540



>ref|WP_026793425.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L+  +  +FPLP  WF F L   W  + +G   V  PL+  +S +N   +    
Sbjct  332  VGGFSVLYFSIKSYFPLPEGWFTFKLKDNWFVWGLGGYLVALPLVILVSLINQKFWDGQG  391

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + +       RD VA+ ++ I  SI API+EE +FRGFLLPSLTRY+P+  
Sbjct  392  GSNPLLPIALES-------RDSVALGIFFITASIAAPIFEETMFRGFLLPSLTRYLPLGS  444

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +I+LS   FA+AHF++  +LPL+ LG++LG ++ RSRNLLAPM +HGLWN+   L L
Sbjct  445  AIILSGFLFAVAHFNVSEILPLMTLGIVLGFVYTRSRNLLAPMFMHGLWNSGTLLSL  501



>ref|WP_008307815.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 6406]
Length=508

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              +A+L   + ++ PLP  WF+F L G W  + VG      PL+  +S +N  L+     
Sbjct  333  GAIAVLGVSIRRYRPLPQGWFQFQLKGSWLLWGVGGYLAALPLMLSISLLNQQLWRGQGG  392

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +  V   +   DPVA+ L+ +  +I AP++EE +FRGFLLPSLTRYMPV G+I LS
Sbjct  393  SNPLLQTV---LEAHDPVALGLFFVTAAIAAPLFEEFLFRGFLLPSLTRYMPVGGAIWLS  449

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S  FA AH SL  +LPL+ LG++LG ++ RSRNLLAPM+LH  WN+   + L
Sbjct  450  SFIFAAAHLSLSEILPLMVLGMVLGLVYTRSRNLLAPMVLHSAWNSVTMIGL  501



>ref|WP_026798410.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L+  +  +FPLP  WF F L   W  + +G   V  PL+  +S +N   +    
Sbjct  332  VGGFSVLYFSIKSYFPLPEGWFTFKLKDNWFVWGLGGYLVALPLVILVSLINQKFWDGQG  391

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + +       RD VA+ ++ I  SI API+EE +FRGFLLPSLTRY+P+  
Sbjct  392  GSNPLLPIALES-------RDSVALGIFFITASIAAPIFEETMFRGFLLPSLTRYLPLGS  444

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +I+LS   FA+AHF++  +LPL+ LG++LG ++ RSRNLLAPM +HGLWN+   L L
Sbjct  445  AIILSGFLFAVAHFNVSEILPLMTLGIVLGFVYTRSRNLLAPMFMHGLWNSGTLLSL  501



>ref|WP_007356391.1| MULTISPECIES: abortive phage infection protein [Kamptonema]
 emb|CBN57189.1| abortive infection protein [ [[Oscillatoria] sp. PCC 6506]
Length=528

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 108/177 (61%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G+ +L   +  F PLP  WF+  LGG W  + +G   V  PL+  +S +N  ++    
Sbjct  351  AGGILVLFLCVKPFLPLPKGWFEVKLGGSWFLWGLGGYFVALPLVILVSLINQQIWQGKG  410

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + +       +D +A+ ++    SI AP++EEIIFRGFLLPSLTRY+P+WG
Sbjct  411  GSNPILPIALES-------KDGIALAVFFATASIAAPLFEEIIFRGFLLPSLTRYLPIWG  463

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +I LS   FA+AH +   +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  464  AIALSGFVFAIAHLNASEVLPLATLGMILGFVYTRSRNLLAPMLLHSLWNSGTLLSL  520



>ref|WP_026787505.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L+  +  +FPLP  WF F L   W  + +G   V  PL+  +S +N   +    
Sbjct  332  VGGFSVLYFSIKSYFPLPEGWFTFKLKDNWFVWGLGGYLVALPLVILVSLINQKFWDGQG  391

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + +       RD VA+ ++ I  SI API+EE +FRGFLLPSLTRY+P+  
Sbjct  392  GSNPLLPIALES-------RDSVALGIFFITASIAAPIFEETMFRGFLLPSLTRYLPLGS  444

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +I+LS   FA+AHF++  +LPL+ LG++LG ++ RSRNLLAPM +HGLWN+   L L
Sbjct  445  AIILSGFLFAVAHFNVSEILPLMTLGIVLGFVYTRSRNLLAPMFMHGLWNSGTLLSL  501



>ref|WP_015211243.1| putative metal-dependent membrane protease [Cylindrospermum stagnale]
 ref|YP_007150690.1| putative metal-dependent membrane protease [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ28010.1| putative metal-dependent membrane protease [Cylindrospermum stagnale 
PCC 7417]
Length=534

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 15/183 (8%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               + +L+  + +FFPLP  WF F L G W  + +G  C   P++  +S +N  L+    
Sbjct  348  SGALLVLYYSIKRFFPLPELWFGFRLQGNWFLWGLGGYCTALPIVVLVSLINQQLWQGQG  407

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  RD VA+ ++    +I AP++EE++FRGFLLPSLTRY+PVWG+IL
Sbjct  408  GSNPL----LQLALESRDGVALGIFFFTAAIAAPLFEELLFRGFLLPSLTRYLPVWGAIL  463

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVR---------SRNLLAPMLLHGLWNAYVF  316
            +SS+ FA AH SL  +LPL  LG++LG ++ R         +RNLLAPMLLH LWN+   
Sbjct  464  VSSLLFAAAHLSLSEILPLTALGIVLGLVYTRCLTTSPSGSTRNLLAPMLLHSLWNSGTL  523

Query  315  LDL  307
            L L
Sbjct  524  LSL  526



>ref|WP_009458258.1| MULTISPECIES: abortive phage infection protein [Fischerella]
 gb|EHC11041.1| Abortive infection protein [Fischerella sp. JSC-11]
Length=526

 Score =   139 bits (350),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + +F PL S WF+F+L GKW  +  G  C   P++  +S +N  ++    
Sbjct  349  SGAISVLYLSIKRFLPLDSGWFRFNLRGKWFLWGFGGYCAALPVVVVVSLINQQIWQGQG  408

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D +A+ ++ +  +I AP++EE +FRGFLLPSLTRYM VW +I+
Sbjct  409  GSNPL----LQLALESQDSLALGIFFLTAAIAAPLFEEFLFRGFLLPSLTRYMSVWWAII  464

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SS  FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  465  ASSFLFAIAHLSLSEVLPLFALGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  518



>ref|WP_012595794.1| MULTISPECIES: abortive phage infection protein [Cyanothece]
 ref|YP_002372683.1| abortive infection protein [Cyanothece sp. PCC 8801]
 ref|YP_003139241.1| hypothetical protein Cyan8802_3587 [Cyanothece sp. PCC 8802]
 gb|ACK66527.1| Abortive infection protein [Cyanothece sp. PCC 8801]
 gb|ACV02406.1| Abortive infection protein [Cyanothece sp. PCC 8802]
Length=527

 Score =   139 bits (350),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 111/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             +G+++L+  +  FFPL  +WF+F     W  + +G   V  PL+  +S +N  L+    
Sbjct  350  ISGISVLYLSIKSFFPLAKDWFQFKWQSNWIVWGIGGYLVALPLVIIVSLINQQLWNGQG  409

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D + + ++ +  S+ AP++EEIIFRGFLLPSLTRY+PVW +I 
Sbjct  410  GSNPL----LSLALEAQDSLVLAIFYVTASLAAPVYEEIIFRGFLLPSLTRYIPVWAAIG  465

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LSS+ FALAH +L  +LPL  LG++LG ++ RSRNLL+ ML+H LWN+     L
Sbjct  466  LSSLIFALAHLNLSEVLPLAILGIVLGVVYTRSRNLLSSMLVHSLWNSGTLFSL  519



>ref|WP_039744126.1| abortive phage infection protein [Hassallia byssoidea]
 gb|KIF36090.1| abortive phage infection protein [Hassallia byssoidea VB512170]
Length=524

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 112/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++++  L +F PL S+WF+F +  KW  +  G  C   P++  +S +N  L+     
Sbjct  349  GALSVMYFSLKRFLPLESDWFRFRVLDKWFLWGFGGYCAALPIVVVVSLINQQLWQGQGG  408

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D  A++++    +I AP++EE++FRGFLLPSLTRY  VWG+I +
Sbjct  409  SNPL----LQLALESQDSTALSIFFFTAAIAAPLFEEVLFRGFLLPSLTRYFSVWGAIFV  464

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S++ FA+AH SL  +LPL  LGV+LG ++ RSRNLLAPMLLH LWN+   L L
Sbjct  465  SALLFAIAHLSLSEILPLSALGVVLGVVYTRSRNLLAPMLLHSLWNSGTLLSL  517



>ref|WP_015122741.1| metal-dependent membrane protease [Rivularia sp. PCC 7116]
 ref|YP_007059739.1| metal-dependent membrane protease [Rivularia sp. PCC 7116]
 gb|AFY59192.1| putative metal-dependent membrane protease [Rivularia sp. PCC 
7116]
Length=525

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              +++L+  + +FFPLP +WF F L   W  + +G  C + P+   +S +N  L+     
Sbjct  349  GSLSVLYLSIKQFFPLPEDWFCFRLYDSWLLWGIGGYCAVIPIFIIVSLINQQLWQGQGG  408

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +  V +S   +D VA+ ++    +I AP++EE +FRGFLLPSLTRY PVWGSIL+S
Sbjct  409  SNPLLQIVLES---QDNVALLIFFSTAAIAAPLFEEFLFRGFLLPSLTRYFPVWGSILIS  465

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            S  FA  H SL  ++PL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  466  SFVFAAVHLSLSEVIPLTVLGIVLGVVYSRSRNLLAPMLLHSLWN  510



>ref|WP_015139741.1| metal-dependent membrane protease [Nostoc sp. PCC 7524]
 ref|YP_007076909.1| metal-dependent membrane protease [Nostoc sp. PCC 7524]
 gb|AFY49312.1| putative metal-dependent membrane protease [Nostoc sp. PCC 7524]
Length=525

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 111/167 (66%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +++L+  + +FFPLP  WF++     W  + +G  C   P++  +S +N  L+    
Sbjct  349  SGALSVLYFSIKRFFPLPRLWFRWQWLDNWLWWGLGGYCAALPIVILVSLINQQLWQGQG  408

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D +A+ ++ +  +I AP++EE++FRGFLLPSLTRY+PVWGSIL
Sbjct  409  GSNPL----LQLALESQDFIALGIFYLTAAIAAPLFEEVLFRGFLLPSLTRYLPVWGSIL  464

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             S++ FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  465  ASALLFAIAHLSLSEILPLTALGIVLGVVYTRSRNLLAPMLLHSLWN  511



>ref|WP_015185319.1| metal-dependent membrane protease [Microcoleus sp. PCC 7113]
 ref|YP_007124592.1| metal-dependent membrane protease [Microcoleus sp. PCC 7113]
 gb|AFZ21186.1| putative metal-dependent membrane protease [Microcoleus sp. PCC 
7113]
Length=551

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 108/174 (62%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  L  FFPLP +WF F     W  + +G   V  PL+  +S +N  L+    
Sbjct  374  SGGLLVLYFSLKPFFPLPQDWFSFKWRLSWIAWGLGGYFVALPLVILVSFLNQKLWQGQG  433

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  +D VA+ L+ +   + AP++EEI FRGFLLPSLTRY+PVWG+I+
Sbjct  434  GSNPI----LSLALEGQDNVALFLFCVTACVAAPMFEEIFFRGFLLPSLTRYLPVWGAIV  489

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             S   FALAH S   +LPL  LG++LG ++ RSRNLLA MLLHGLWNA   L L
Sbjct  490  ASGFLFALAHLSFSEVLPLATLGIVLGIVYTRSRNLLASMLLHGLWNAGTLLSL  543



>ref|WP_015174715.1| Abortive infection protein [Oscillatoria nigro-viridis]
 ref|YP_007113802.1| Abortive infection protein [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ05386.1| Abortive infection protein [Oscillatoria nigro-viridis PCC 7112]
Length=530

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 105/170 (62%), Gaps = 12/170 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G+++L+  +  F PLP  WF+ +  GKW  +  G   V  PL+  +S +N   +    
Sbjct  353  AGGLSVLYFSVKSFLPLPEGWFRINWRGKWFLWGFGGYFVALPLVVLVSLINQQFWQGQG  412

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ +         RD VA+ ++    +I AP++EEI+FRGFLLPSLTRY+PVWG
Sbjct  413  GSNPILPIVLEG-------RDNVALAVFFGTAAIAAPVFEEIVFRGFLLPSLTRYLPVWG  465

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +I  S++ FA+AH S+  +LPL  LG +LG ++ RSRNLLAPMLLH LWN
Sbjct  466  AIAASALLFAVAHLSVSEILPLATLGAVLGFVYTRSRNLLAPMLLHSLWN  515



>ref|WP_022604308.1| putative metal-dependent membrane protease [Rubidibacter lacunae]
 gb|ERN42841.1| putative metal-dependent membrane protease [Rubidibacter lacunae 
KORDI 51-2]
Length=507

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 105/167 (63%), Gaps = 7/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ IL   +  + PLP  WF +  GG W  + +G   V  PL+  +S +N  ++    
Sbjct  331  AGGLGILWVSIRAYLPLPEEWFVWR-GGNWLAWGIGGYLVAIPLVTFVSLINQQIWQGQG  389

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+  + V      +D +A+ +Y +  S  AP++EE+IFRGFLLPSLTRYM VW +I 
Sbjct  390  GSNPLLFAIV----ETQDRLALAIYLLTASAAAPLFEELIFRGFLLPSLTRYMSVWSAIA  445

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            LS+  F++AH SL  MLPL  LG++LG ++ RSRNLLAPM+LHGLWN
Sbjct  446  LSAAIFSIAHLSLAEMLPLATLGLVLGVVYTRSRNLLAPMVLHGLWN  492



>ref|WP_015191891.1| Abortive infection protein [Stanieria cyanosphaera]
 ref|YP_007131184.1| Abortive infection protein [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34218.1| Abortive infection protein [Stanieria cyanosphaera PCC 7437]
Length=530

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 109/173 (63%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            +G+ +L+  +  F PL  +WFKF L   W  +  G   +  P +  +S +N  ++     
Sbjct  355  SGIGVLYLSIKSFLPLSKDWFKFKLFSNWFVWGFGGYLIALPSVLLVSLINQQIWHGQGG  414

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+       ++  +D VA+ ++ I  SI AP++EE++FRGFLLPSLTRY+PVWG+I++
Sbjct  415  SNPLLF----LALQAQDRVALAIFFITASIAAPLFEEVMFRGFLLPSLTRYVPVWGAIII  470

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S   FA+AH SL  +LPL  LG++LG ++ RSRNLLAP+ LH LWN+   L L
Sbjct  471  SGFIFAVAHLSLSEVLPLATLGIILGIVYTRSRNLLAPIFLHSLWNSGTLLSL  523



>ref|WP_015227581.1| abortive infection protein [Halothece sp. PCC 7418]
 ref|YP_007169923.1| abortive infection protein [Halothece sp. PCC 7418]
 gb|AFZ45709.1| Abortive infection protein [Halothece sp. PCC 7418]
Length=520

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 111/174 (64%), Gaps = 7/174 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  +FPLP  WF+   G  W  + +G   V  P++  +S +N  ++    
Sbjct  344  AGGLGVLYFSIRDYFPLPEGWFQLK-GNNWIVWGIGGYLVAIPIVVIVSILNQQIWQGQG  402

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+       ++  +DPVA+ ++    +I API+EEIIFRGFLLPSLTRY+PVW +I+
Sbjct  403  GSNPLLFL----AVQAQDPVALLIFFSTAAIAAPIFEEIIFRGFLLPSLTRYIPVWSAIV  458

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LSS+ F++AH SL  +LPL  LG++LG ++ RSRN+LA M++H LWN+   L L
Sbjct  459  LSSLLFSIAHLSLSEVLPLTALGLVLGVVYTRSRNILASMVVHSLWNSGTLLSL  512



>ref|WP_017304316.1| hypothetical protein [Spirulina subsalsa]
Length=518

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 107/173 (62%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  L  FFPLP  WFK      W  + VG      PL+  +S VN  ++    
Sbjct  343  VGGLGVLYLSLKPFFPLPDGWFKVKWLSNWPLWGVGGYFAAIPLVVVISLVNQQIWQGQG  402

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   +S   QS   +D +A+ ++    S+ AP++EEIIFRGF LPSLTRY+PVWG+I L
Sbjct  403  GSNPIISLALQS---QDTLALLIFFSTASLAAPLFEEIIFRGFFLPSLTRYIPVWGAITL  459

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA+AH ++  +LPL  LG++LG ++VRSRNLLA + LH LWN+   L L
Sbjct  460  SSLVFAIAHLNISEVLPLTVLGMVLGFVYVRSRNLLASICLHSLWNSGTLLSL  512



>ref|WP_036003622.1| abortive phage infection protein [Leptolyngbya sp. JSC-1]
Length=530

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 109/173 (63%), Gaps = 8/173 (5%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            G+ +L+R +  F PLP++WF+ +    W  + +G   V  PL+  +S VN   +      
Sbjct  355  GLFVLYRAVKPFSPLPNDWFRLTGKRNWFLWGLGGYFVALPLMFAVSLVNQQFWQGQGG-  413

Query  639  PVTVSNVGQSIVVR--DPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
                SN    IV+   DPVA+ ++    ++ API+EE +FRGFLLPSLTRY+PVWG+I +
Sbjct  414  ----SNPLLQIVLEEGDPVALLIFFFTAAVAAPIFEETLFRGFLLPSLTRYLPVWGAIGV  469

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA AH SL  +LPL  LG++LGT++ RSR LLA MLLH LWN+   + L
Sbjct  470  SSLIFATAHLSLSEVLPLTTLGIVLGTVYTRSRGLLASMLLHSLWNSVTMIGL  522



>ref|WP_035154569.1| abortive phage infection protein [Calothrix sp. 336/3]
 gb|KFB84374.1| abortive phage infection protein [Calothrix sp. 336/3]
Length=509

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +A+L   +  +FPL  +WF+F L  +W  + +G  C   P++  +S VN   +    
Sbjct  332  SGAIAVLFATIKPYFPLSPDWFRFQLRSRWFLWGLGGYCAALPIVVIISLVNQKFWQGQG  391

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   +  V  S      +A+ L+    +I AP++EE +FRGFLLPSLTRYM VWG+IL+
Sbjct  392  GSNPLLQLVLSS---HSNIALFLFFFTAAIAAPVFEEFLFRGFLLPSLTRYMSVWGAILI  448

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA+AH SL  +LPL  LGV+LG ++ RSRNLLA MLLH LWN+   L L
Sbjct  449  SSLVFAVAHLSLSEILPLFALGVVLGVVYTRSRNLLASMLLHSLWNSGTLLSL  501



>ref|WP_006633320.1| abortive phage infection protein [Microcoleus vaginatus]
 gb|EGK87764.1| Abortive infection protein [Microcoleus vaginatus FGP-2]
Length=530

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 103/170 (61%), Gaps = 12/170 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G+++L+  +  F PLP  WF+ +  G W  +  G   V  PL+  +S +N   +    
Sbjct  353  AGGLSVLYFSVKSFLPLPEGWFRINWRGSWFLWGFGGYFVALPLVVLVSLINQQFWQGQG  412

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ +         RD VA+ ++    +I AP++EEI+FRGFLLPSLTRY+PVWG
Sbjct  413  GSNPILPIVLEG-------RDNVALAVFFGTAAIAAPVFEEIVFRGFLLPSLTRYLPVWG  465

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +I  S+  FA+AH S+  +LPL  LG +LG ++ RSRNLLAPMLLH LWN
Sbjct  466  AIAASAFLFAVAHLSVSEILPLATLGAVLGFVYTRSRNLLAPMLLHSLWN  515



>ref|WP_009784581.1| abortive phage infection protein [Lyngbya sp. PCC 8106]
 gb|EAW36845.1| hypothetical protein L8106_26827 [Lyngbya sp. PCC 8106]
Length=499

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 108/177 (61%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L   L  FFPLP  WF F     W  + +G      PL+  +S +N  L+    
Sbjct  322  AGGFSVLFFSLKPFFPLPEGWFNFDWKKNWFLWGLGGYVSALPLVILVSLINQQLWHGQG  381

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + N       RDPVA+ ++ +  SI AP++EEI+FRGFLLPSLTRYM +  
Sbjct  382  GSNPLLPIALEN-------RDPVALVIFFVTASIAAPVFEEIMFRGFLLPSLTRYMSMGS  434

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +ILLSS+ FA+AH ++  ++PL+ LG++LG ++ RSRNLL+ MLLH LWN+   L L
Sbjct  435  AILLSSLFFAVAHMNISEIIPLMTLGIVLGFVYTRSRNLLSSMLLHCLWNSGTLLSL  491



>emb|CDN11786.1| hypothetical protein RintRC_6086 [Richelia intracellularis]
Length=487

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            A +A+L+  +  F PL ++WF      KW  +  G  CV  P++  +S +N  L+     
Sbjct  311  AVLAVLYFSIKNFLPLTADWFHARFQEKWFLWGCGGYCVALPIVVIVSLLNQQLWQGQGG  370

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++ I   + AP++EE +FRGFLLPSLTRY+P+WG+I++
Sbjct  371  SNPL----LQLALESQDTVALFIFFITAGVAAPLFEECLFRGFLLPSLTRYLPMWGAIVV  426

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS  FA+AH SL  ++PL  LG++LG ++VRSRNLLAPMLLH LWN+   + L
Sbjct  427  SSFLFAIAHLSLSEIIPLTALGMVLGFVYVRSRNLLAPMLLHSLWNSGTLISL  479



>ref|XP_001700469.1| metal-dependent CAAX amino terminal protease-like protein [Chlamydomonas 
reinhardtii]
 gb|EDO98158.1| metal-dependent CAAX amino terminal protease-like protein [Chlamydomonas 
reinhardtii]
Length=223

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 101/187 (54%), Gaps = 1/187 (1%)
 Frame = -2

Query  864  SH*TLDSTMDSKDYCAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINR  685
            SH  L   +D       + IL   L  + P     F     G W   V L C  FP ++ 
Sbjct  34   SHAVLHLCLDITQLFVTLGILWSCLRAYKPRSRGLFPVRWRGLWWVAVLLGCATFPFVDW  93

Query  684  LSQVNLNLFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPS  505
            L+  ++  FP         SN+  S+ + D +    Y  +VS+CAPIWEE IFRGFLL S
Sbjct  94   LAHQSMGWFPS-EWDANWASNLEHSLSIGDWITNAAYFSVVSLCAPIWEEAIFRGFLLTS  152

Query  504  LTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNA  325
            L RYMP  G++ LSS+ FA+ HF LQ  LPL+ LG +   IF+R+ NLL P+LLH  WN 
Sbjct  153  LARYMPTPGAVALSSVVFAMCHFRLQTFLPLLVLGGVFSAIFIRTNNLLPPILLHSAWNL  212

Query  324  YVFLDLM  304
            YV + L+
Sbjct  213  YVLVSLV  219



>ref|WP_028083018.1| abortive phage infection protein [Dolichospermum circinale]
Length=508

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 107/171 (63%), Gaps = 6/171 (4%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLP-ST  640
            +++++  + +FFPLP NWF+F+    W +  +G  C   P++  +S +N  L+     S 
Sbjct  335  LSVVYFSIKRFFPLPPNWFRFNFLSNWFWWGIGGYCTALPIVVIVSLINQKLWQGQGGSN  394

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            P+    +  ++  RD  A+ ++    +I AP++EE +FRGFLLPSLTRY  VWG+I  S+
Sbjct  395  PL----LQMALESRDNTALGIFFFTAAIAAPVFEEFLFRGFLLPSLTRYTSVWGAIFTSA  450

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            + FA AH SL  +LPL  LG++LG ++ R+RNLLA M LH LWN+   + L
Sbjct  451  LLFAAAHLSLSEILPLTALGIVLGVVYTRTRNLLASMFLHSLWNSGTLISL  501



>ref|WP_037218212.1| abortive phage infection protein [Richelia intracellularis]
Length=522

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            A +A+L+  +  F PL ++WF      KW  +  G  CV  P++  +S +N  L+     
Sbjct  346  AVLAVLYFSIKNFLPLTADWFHARFQEKWFLWGCGGYCVALPIVVIVSLLNQQLWQGQGG  405

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++ I   + AP++EE +FRGFLLPSLTRY+P+WG+I++
Sbjct  406  SNPL----LQLALESQDTVALFIFFITAGVAAPLFEECLFRGFLLPSLTRYLPMWGAIVV  461

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS  FA+AH SL  ++PL  LG++LG ++VRSRNLLAPMLLH LWN+   + L
Sbjct  462  SSFLFAIAHLSLSEIIPLTALGMVLGFVYVRSRNLLAPMLLHSLWNSGTLISL  514



>ref|WP_023064005.1| CAAX protease self-immunity family protein [Lyngbya aestuarii]
 gb|ERT09943.1| CAAX protease self-immunity family protein [Lyngbya aestuarii 
BL J]
Length=499

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G ++L   L  FFPLP  WF       W F  +G      PL+  +S +N  L+    
Sbjct  322  AGGFSVLFFSLKPFFPLPEGWFNVDWKKNWFFWGLGGYVSALPLVILVSLINQQLWNGQG  381

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + N       RDPVA+ ++ +  SI AP++EEI+FRGFLLPSLTRYM +  
Sbjct  382  GSNPLLPIALEN-------RDPVALIIFFVTASIAAPVFEEIMFRGFLLPSLTRYMSMGS  434

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +ILLSS+ FA+AH ++  ++PL+ LG++LG ++ RSRNLL+ MLLH LWN+   L L
Sbjct  435  AILLSSLFFAVAHMNISEIIPLMTLGIVLGFVYTRSRNLLSSMLLHCLWNSGTLLSL  491



>ref|WP_015221989.1| abortive infection protein [Cyanobacterium stanieri]
 ref|YP_007164320.1| abortive infection protein [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46671.1| Abortive infection protein [Cyanobacterium stanieri PCC 7202]
Length=491

 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP-S  643
            +G+ +L+  +  FFPLP  WFK +    + + +G      PL+  +S +N  ++     S
Sbjct  316  SGLLVLYLSVKPFFPLPEGWFKLTNKNWFWWGLGGYLTAIPLVFLVSFLNQQIWDGQGGS  375

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
             P+ +     ++  +D VA+ ++ I  S+ API+EEIIFRGFLLPSLTRYMPVWG+I+LS
Sbjct  376  NPLLLL----ALESQDKVALLIFFITASVAAPIFEEIIFRGFLLPSLTRYMPVWGAIVLS  431

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNA  325
               FA+AH SL  +LPL  LG+LLG I+ RSR+LL+ +++H LWN+
Sbjct  432  GGVFAIAHLSLSEILPLATLGILLGIIYTRSRSLLSSIMVHSLWNS  477



>ref|WP_006530204.1| putative metal-dependent membrane protease [Gloeocapsa sp. PCC 
73106]
 gb|ELR96955.1| putative metal-dependent membrane protease [Gloeocapsa sp. PCC 
73106]
Length=484

 Score =   134 bits (336),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 110/172 (64%), Gaps = 6/172 (3%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-S  643
            G+ +L+  +  F P P +WF F  GG W  +  G   V FPL+  +S +N  L+     S
Sbjct  312  GLLVLYLSIRSFRPFPEHWFPFQWGGNWIIWGFGGYLVAFPLVLLVSLLNQQLWQGQGGS  371

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
             P+ +     ++  +D +A+ ++ +  +I AP++EEIIFRGFLL SLTRY   WG+I+LS
Sbjct  372  NPLILL----ALESKDTLALLIFFVTAAIAAPLFEEIIFRGFLLASLTRYFSTWGAIVLS  427

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+ F++AH SL  +LPL  LG++LG ++ RSRNLLAP+LLH LWN+   + L
Sbjct  428  SLVFSIAHLSLSEVLPLTVLGMILGFVYSRSRNLLAPILLHSLWNSGTLMSL  479



>ref|WP_028090624.1| abortive phage infection protein [Dolichospermum circinale]
Length=508

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 107/171 (63%), Gaps = 6/171 (4%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLP-ST  640
            +++L+  + +FFPLP +WF+F+    W +  +G  C   P++  +S +N  L+     S 
Sbjct  335  LSVLYFSIKRFFPLPPHWFRFNFFSNWFWWGIGGYCAALPIVVIVSLINQKLWQGQGGSN  394

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            P+    +  ++  RD  A+ ++    +I API+EE +FRGFLLPSLTRY  VWG+I  S+
Sbjct  395  PL----LQMALESRDYTALGIFFFTAAIAAPIFEEFLFRGFLLPSLTRYTSVWGAIFTSA  450

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            + FA AH SL  +LPL  LG++LG ++ R+RNLLA M LH LWN+   + L
Sbjct  451  LLFAAAHLSLSEILPLTALGIVLGVVYTRTRNLLASMFLHSLWNSGTLISL  501



>ref|WP_006510963.1| putative metal-dependent membrane protease [Xenococcus sp. PCC 
7305]
 gb|ELS01931.1| putative metal-dependent membrane protease [Xenococcus sp. PCC 
7305]
Length=524

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLPS  643
             G+ +L+  +  +FPLP++WFK  L   W F   G   +  P +  +S +N  ++     
Sbjct  349  GGIGVLYYSIKSYFPLPNDWFKVKLFDNWIFWGFGGYLLAVPAVLFVSLINQQIWQGQGG  408

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +S   Q+   +D VA+ ++ +  SI AP++EEI+FRGFLLPSLTRY+ V  +I++S
Sbjct  409  SNPLLSLALQA---QDRVALLIFFVTASIAAPVFEEIMFRGFLLPSLTRYLSVSTAIVIS  465

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
               FA+AH SL  +LPL  LG++LG ++ RSRN+LAPMLLH LWN+   L L
Sbjct  466  GFIFAIAHLSLSEVLPLTTLGIILGAVYTRSRNILAPMLLHSLWNSGTLLSL  517



>ref|WP_017715794.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=530

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 99/164 (60%), Gaps = 12/164 (7%)
 Frame = -2

Query  783  FFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFL----PSTPVTVSNV  619
            F PLP  WF+    G W  +  G   V  PL+  +S +N  L+       P  P+ + N 
Sbjct  366  FLPLPDGWFRADWRGSWFVWGAGGYFVALPLVIGVSLLNQRLWQGQGGSNPILPIALEN-  424

Query  618  GQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAH  439
                  RD VA+ ++ +  S+ AP++EEI+FRGFLLPSLTRY+PVWG+I  SS+ FA+AH
Sbjct  425  ------RDSVALAVFFLTASVAAPVFEEIMFRGFLLPSLTRYLPVWGAIAASSLLFAVAH  478

Query  438  FSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             +L  +LPL  LG +LG ++ R+RNL A MLLH LWN    L L
Sbjct  479  LNLSEVLPLATLGAVLGFVYTRTRNLFASMLLHSLWNTGTLLSL  522



>ref|WP_015160360.1| putative metal-dependent membrane protease [Chamaesiphon minutus]
 ref|YP_007097748.1| putative metal-dependent membrane protease [Chamaesiphon minutus 
PCC 6605]
 gb|AFY94221.1| putative metal-dependent membrane protease [Chamaesiphon minutus 
PCC 6605]
Length=532

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 108/171 (63%), Gaps = 4/171 (2%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
             + IL+  +  + PLP++WF+F+    W  + +G   V  P++  +S +N  ++     +
Sbjct  358  ALGILYLSIKSYLPLPADWFEFNWKSHWLLWGIGGYLVATPIVVIVSLLNDKIWHGQGGS  417

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
               +  V Q    RD +A+ L+    ++ AP++EE +FRGFLLPSLTRYMP WG+I LS 
Sbjct  418  NPILQIVLQG---RDSIALWLFFATAAVAAPLFEEFLFRGFLLPSLTRYMPTWGAICLSG  474

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            + F +AH SL  +LPL  LG++LG ++VR+R+LLAPMLLH LWN+   + L
Sbjct  475  LLFGVAHLSLSEILPLTSLGIILGIVYVRTRSLLAPMLLHSLWNSSTLVSL  525



>ref|WP_006275617.1| abortive phage infection protein [Cylindrospermopsis raciborskii]
 gb|EFA71378.1| Abortive infection protein [Cylindrospermopsis raciborskii CS-505]
Length=495

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = -2

Query  807  ILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPV  634
            +L+  + ++ PLP  WFKF L   W  + +G  C   P++  +S +N  L+     S P+
Sbjct  323  VLYISIKRYLPLPEGWFKFRLFDNWLLWGIGGYCAAVPIVIIVSLINQILWKGEGGSNPL  382

Query  633  TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIA  454
                +  ++  RD VA+ ++ +  +I AP++EE +FRGFLLPSLT ++PV  +I++SS  
Sbjct  383  ----LQMALENRDGVALGIFFLTAAIAAPLFEEFLFRGFLLPSLTSHLPVSWAIVVSSFI  438

Query  453  FALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            FA+AH SL  MLPL  LG++LG ++ RSRNLLAPMLLHGLWN+   + L
Sbjct  439  FAIAHLSLSEMLPLTALGIVLGVVYTRSRNLLAPMLLHGLWNSGTLVSL  487



>ref|WP_039725813.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF14127.1| hypothetical protein QP59_24995 [Aphanocapsa montana BDHKU210001]
 gb|KIF39063.1| hypothetical protein QQ91_17950 [Lyngbya confervoides BDU141951]
Length=510

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (61%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
               +A+L   +  + PLP +WFKF L   W  + +G      PL+  +S +N  ++    
Sbjct  333  VGAIAVLWFAIRSYRPLPPDWFKFKLRSNWWLWGLGGYFAALPLMLTVSVLNQQIWQGQG  392

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   +  V   +  +DP A+ ++    S+ AP++EE +FRGFLLPSLTRYMPV G+I +
Sbjct  393  GSNPLLQTV---LEAQDPFALAIFFTTASVAAPLFEEFLFRGFLLPSLTRYMPVGGAIAV  449

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA+AH SL  +LPL  LG +LG ++ RSRNLLAPMLLH  WN+   L L
Sbjct  450  SSLVFAIAHLSLSEVLPLAVLGGVLGIVYTRSRNLLAPMLLHSAWNSVTMLGL  502



>ref|WP_017288393.1| hypothetical protein [Leptolyngbya boryana]
Length=502

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 106/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  + +F  L  NWF+FSL GKW  + VG     +PL+  +S VN  ++    
Sbjct  325  AGGLGVLYASIKRFLSLEDNWFRFSLKGKWLLWGVGGYVAAYPLLVGVSWVNEKIWQGRG  384

Query  645  -STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
             S P+ +++  GQ     D +A+TL+ I  +I AP++EE  FRGFLLPSLTRY   W +I
Sbjct  385  GSNPLLSIALEGQ-----DGIAITLFFITAAILAPLFEETFFRGFLLPSLTRYFTTWQAI  439

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +LS + FA+ H SL  + PL  LG++LG ++ R++NL+A +LLH LWN
Sbjct  440  VLSGLIFAIVHLSLSEVAPLTVLGIILGFVYTRTQNLMASVLLHALWN  487



>ref|WP_019508695.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=522

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 111/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+++L+  +  F PL  +WFKF L   W  + VG   V  PL+  +S +N  ++    
Sbjct  346  VGGVSVLYFSIKSFIPLSQDWFKFKLTSNWFVWGVGGYLVAVPLVLLVSLINQQIWQGQG  405

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+       ++  +D VA+ ++    SI AP++EEI+FRGFLLPSLTRY+ V G+I+
Sbjct  406  GSNPLLFL----ALQAQDQVALAIFFSTASIAAPLFEEIMFRGFLLPSLTRYVSVSGAIM  461

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +S+I FA+AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  462  ISAIIFAVAHLSLSEVLPLTTLGIVLGVVYTRSRNLLAPMLLHSLWNSGTLISL  515



>ref|WP_026101894.1| abortive phage infection protein [Geminocystis herdmanii]
Length=487

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP-S  643
             G+ +L+  +  FFPLP +WFK +    + + +G   V  P +  +S +N  L+     S
Sbjct  314  GGLLVLYLSIKSFFPLPEDWFKLTAKNWYWWGIGGYLVAIPSVFLVSILNQQLWQGRGGS  373

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
             P+ +     ++  +D  A+ ++ I  SI API+EEI+FRGFLLPSLTRY+P WG+I++S
Sbjct  374  NPLLLL----ALESQDKFALIIFFITASIAAPIFEEIMFRGFLLPSLTRYLPSWGAIVVS  429

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             + FA+AH SL   +PL  LG++LG ++ RSR+LLA M++H LWN
Sbjct  430  GVIFAVAHLSLAETIPLATLGIILGIVYTRSRSLLASMMVHSLWN  474



>ref|WP_030006069.1| CAAX protease [Synechococcus sp. NKBG042902]
Length=502

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 113/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            AG+ +L   + +F PLP  WF+      W  +  G   V  PL+  +S +N  ++     
Sbjct  329  AGLIVLAASVWEFRPLPQGWFQVKWLDNWTVWGFGGYMVALPLVLLVSLLNQQIWQGQGG  388

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+       ++  +D VA+T++ +  S+ AP++EEI+FRGFLLPSLTRY+PVWGSI+L
Sbjct  389  SNPILFL----ALKAQDQVALTIFFLTASVMAPLFEEIMFRGFLLPSLTRYVPVWGSIIL  444

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+  FA+AH SL  +LPL+ LG++LG ++V+SRNLLAPMLLH LWN+   L L
Sbjct  445  SAFLFAIAHMSLSEVLPLMTLGIILGFVYVKSRNLLAPMLLHSLWNSGTLLSL  497



>ref|WP_012305909.1| CAAX amino protease [Synechococcus sp. PCC 7002]
 ref|YP_001733541.1| CAAX amino protease [Synechococcus sp. PCC 7002]
 gb|ACA98285.1| CAAX amino terminal protease family; membrane protein [Synechococcus 
sp. PCC 7002]
Length=502

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 113/173 (65%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            AG+ +L   + +F PLP  WF+      W  +  G   V  PL+  +S +N  ++     
Sbjct  329  AGLIVLAASVWEFRPLPQGWFQVKWLDNWTVWGFGGYMVALPLVLLVSLLNQQIWQGQGG  388

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+       ++  +D VA+T++ +  S+ AP++EEI+FRGFLLPSLTRY+PVWGSI+L
Sbjct  389  SNPILFL----ALKAQDQVALTIFFLTASVMAPLFEEIMFRGFLLPSLTRYVPVWGSIIL  444

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+  FA+AH SL  +LPL+ LG++LG ++V+SRNLLAPMLLH LWN+   L L
Sbjct  445  SAFLFAIAHMSLSEVLPLMTLGIILGFVYVKSRNLLAPMLLHSLWNSGTLLSL  497



>ref|WP_017320949.1| abortive phage infection protein [cyanobacterium PCC 7702]
Length=521

 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  792  LAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPVTVSNV  619
            + +F PL   WF+F    KW  + +G  C   P++  +S +N  ++     S P+    +
Sbjct  354  IKRFLPLSPEWFRFRWQDKWFLWGLGGYCAALPIVVVVSLINQKIWQGQGGSNPL----L  409

Query  618  GQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAH  439
              ++  +D VA+ ++ +  +I AP++EE +FRGFLLPSLTRYM VW +I  SS+ FA+AH
Sbjct  410  QLALESQDSVALGIFFLTAAIAAPLFEEFLFRGFLLPSLTRYMSVWQAIFASSLLFAVAH  469

Query  438  FSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             SL  +LPL  LGV+LG ++ RSRNLLAPML+H LWN+   L L
Sbjct  470  LSLSEVLPLFALGVVLGVVYTRSRNLLAPMLIHSLWNSGTLLSL  513



>ref|WP_029681615.1| CAAX protease [Synechococcus sp. NKBG15041c]
Length=501

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 24/183 (13%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRL-----------SQ  676
             AG+ +L   L +F PLP +WF+      W    G    M  L   L            Q
Sbjct  327  IAGLGVLAISLWEFRPLPRDWFQVKWLDNWTV-WGFGGYMVALPLVLLVSLLNQLIWQGQ  385

Query  675  VNLNLFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTR  496
               N   FL            ++  +D VA+T++ +  S+ AP++EEI+FRGFLLPSLTR
Sbjct  386  GGSNPLLFL------------ALKAQDQVALTIFFLTASVMAPLFEEIMFRGFLLPSLTR  433

Query  495  YMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVF  316
            YMPVWGSI+LS+  FA+AH SL  +LPL+ LG++LG ++V+SRNLLAPMLLH LWN+   
Sbjct  434  YMPVWGSIILSAFLFAIAHMSLSEVLPLMTLGIILGFVYVKSRNLLAPMLLHSLWNSGTL  493

Query  315  LDL  307
            L L
Sbjct  494  LSL  496



>ref|WP_015212375.1| Abortive infection protein [Anabaena cylindrica]
 ref|YP_007154629.1| Abortive infection protein [Anabaena cylindrica PCC 7122]
 gb|AFZ55719.1| Abortive infection protein [Anabaena cylindrica PCC 7122]
Length=526

 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + ++ PL  +WF+F     W  + +G  C   P++  +S +N  L+     
Sbjct  350  GALSVLYFSIRRYLPLSEDWFRFRFQSNWFLWGLGGYCTALPIVVVVSLINQQLWNGQGG  409

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D VA+ ++     I AP +EE +FRGFLLPSLTRY+PVW SI+ 
Sbjct  410  SNPL----LQLALENKDNVALGIFFFTAGIAAPFFEEFLFRGFLLPSLTRYIPVWASIVA  465

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FA AH SL  +LPL  LG++LG ++ RSRNLLAPMLLH LWN
Sbjct  466  SSLLFAAAHLSLSEILPLTALGMVLGIVYTRSRNLLAPMLLHSLWN  511



>ref|WP_009555084.1| putative metal-dependent membrane protease [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70510.1| putative metal-dependent membrane protease [Oscillatoriales cyanobacterium 
JSC-12]
Length=510

 Score =   130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFL--  649
             G+ IL+  +  F PLP  WF+ +L G W +  +G      PL+  +S +N  ++     
Sbjct  334  GGLGILYVSIEPFLPLPEGWFRINLKGNWFWWGLGGYFAALPLVILVSLINQQIWQGQGG  393

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ +         ++ +A+ ++    +I API+EEI+FRGFLL SLTRY+ +WG+
Sbjct  394  SNPILPIALEE-------KNNLALFIFFSTAAIAAPIFEEILFRGFLLASLTRYVSIWGA  446

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            I LSS+ FA+AH SL  +LPL  LG++LG ++VRSRNLLA MLLH LWN+   + L+
Sbjct  447  IALSSLIFAIAHLSLSEVLPLTVLGMVLGFVYVRSRNLLACMLLHSLWNSGTLISLI  503



>ref|WP_015203179.1| abortive infection protein [Crinalium epipsammum]
 ref|YP_007142573.1| abortive infection protein [Crinalium epipsammum PCC 9333]
 gb|AFZ13063.1| Abortive infection protein [Crinalium epipsammum PCC 9333]
Length=540

 Score =   130 bits (328),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 110/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFL-  649
              G+ +L+  + KF PLP +WF+F   G W  +  G   V  PL+  +S VN  L+    
Sbjct  363  AGGVTVLYLSIKKFLPLPKDWFRFDWRGGWILWGFGGYFVALPLVILVSLVNQKLWQGQG  422

Query  648  ---PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWG  478
               P  P+ + N       RD +A+T++    +I AP++EE +FRGFLLPSLTRY P WG
Sbjct  423  GSNPILPIALEN-------RDGIALTIFFTTAAIAAPLFEEFLFRGFLLPSLTRYFPAWG  475

Query  477  SILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +I+LSS  FA+AH SL  +LPL+ LG++LG ++ RSRNLL+ +LLH LWN+   L L
Sbjct  476  AIILSSFLFAIAHLSLSEVLPLMTLGIILGVVYTRSRNLLSSILLHSLWNSGTLLSL  532



>ref|WP_009344607.1| abortive phage infection protein [Raphidiopsis brookii]
 gb|EFA71530.1| Abortive infection protein [Raphidiopsis brookii D9]
Length=493

 Score =   130 bits (326),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 108/169 (64%), Gaps = 6/169 (4%)
 Frame = -2

Query  807  ILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPV  634
            +L+  + ++ PLP  WFKF L   W  + +G  C   P++  +S +N  L+     S P+
Sbjct  321  VLYSSIKRYLPLPEEWFKFRLFDNWLLWGIGGYCAAVPIVIIVSLINQILWKGEGGSNPL  380

Query  633  TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIA  454
                +  ++  RD VA+ ++    +I AP++EE +FRGFLLPSLT ++PV  +I++SS  
Sbjct  381  ----LQMALENRDGVALGIFFFTAAIAAPLFEEFLFRGFLLPSLTPHLPVSWAIVVSSFI  436

Query  453  FALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            FA+AH SL  MLPL  LG++LG ++ RSRNLL+PMLLHGLWN+   + L
Sbjct  437  FAIAHLSLSEMLPLTVLGMVLGVVYTRSRNLLSPMLLHGLWNSGTLVSL  485



>ref|WP_015230125.1| metal-dependent membrane protease [Dactylococcopsis salina]
 ref|YP_007172492.1| metal-dependent membrane protease [Dactylococcopsis salina PCC 
8305]
 gb|AFZ51135.1| putative metal-dependent membrane protease [Dactylococcopsis 
salina PCC 8305]
Length=520

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  +FPLP  WF +  G  W  + +G   V  PL+  +S +N  ++    
Sbjct  344  TGGLTVLYFSIRTYFPLPEGWFNWK-GNNWLLWGIGGYLVAIPLVVIVSIINQEIWQGQG  402

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+       ++  +D +A+ ++    +I API+EEIIFRGFLLPSLT+Y PVW SI 
Sbjct  403  GSNPLLFL----AVQAQDTIALLIFFTTAAIAAPIFEEIIFRGFLLPSLTKYFPVWVSIA  458

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            LSS+ F++AH SL  +LPL  LG++LG ++ RSRN+LA +++H LWN+   L L
Sbjct  459  LSSLLFSVAHLSLSEVLPLTVLGLVLGVVYTRSRNILASIVVHSLWNSGTLLSL  512



>ref|WP_006456997.1| CAAX amino terminal protease family [Synechococcus sp. PCC 7335]
 gb|EDX87212.1| CAAX amino terminal protease family [Synechococcus sp. PCC 7335]
Length=529

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 103/173 (60%), Gaps = 4/173 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             + + +L+  + ++ PL   WF+F L G+W  +  G   V  PL+  +S +N  ++    
Sbjct  353  ASTLGVLYWAIRQYLPLSKAWFRFELAGRWPLWGGGGYLVALPLMLGVSALNQQIWQGQG  412

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
                 +  V   +  RDPVA+ ++    +I API+EEI+FRGFLLPSLTRYM  W +I L
Sbjct  413  GNNPILQLV---LEERDPVALGMFLFTAAIAAPIFEEILFRGFLLPSLTRYMSTWTAIGL  469

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA AH S   +LPL  LG +LG ++ +SRNL++ +LLH  WN+   + L
Sbjct  470  SSLIFATAHLSFSEVLPLTVLGAILGFVYAKSRNLMSSILLHSTWNSITMIGL  522



>ref|WP_018399233.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=518

 Score =   128 bits (321),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 99/161 (61%), Gaps = 6/161 (4%)
 Frame = -2

Query  783  FFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STPVTVSNVGQS  610
            F PLP  WF       W  + +G   V  PL+  +S +N  ++     S P+       +
Sbjct  357  FSPLPKLWFNLEWRSNWFLWGLGGYLVAIPLVVIVSILNQQIWQGQGGSNPILFL----A  412

Query  609  IVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSL  430
            +  +D  A+ ++    SI AP++EEIIFRGFLLPSLTRY+PVWG+ILLSS+ FA+AH S 
Sbjct  413  LQAQDTFALAIFFTTASIAAPVFEEIIFRGFLLPSLTRYLPVWGAILLSSLIFAIAHLSP  472

Query  429  QRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
              +LPL  LG++LGT + RSRNLL+ M+LH  WN+   L L
Sbjct  473  SEILPLTILGIVLGTTYTRSRNLLSSMMLHSFWNSGTLLSL  513



>ref|WP_009631880.1| putative metal-dependent membrane protease [Synechocystis sp. 
PCC 7509]
Length=521

 Score =   128 bits (321),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
              + +L+  + KF PLP +WF+  L   W  + +G  C   PL+  +S +N  L+  L  
Sbjct  345  GAVTVLYLSIKKFLPLPPSWFRVKLRENWFLWGLGGYCAALPLVVVVSLLNQQLWQGLGG  404

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +S V +    +D +A+ ++    ++ AP++EE +FRGFLLPSLTRY  VW +IL+S
Sbjct  405  SNPLLSLVLEG---QDKIALGIFFFTAAVAAPLFEEFLFRGFLLPSLTRYFSVWQAILIS  461

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +  FA+AH SL  +LPL+ LGV+LG ++ RSRNLLAPMLLH LWN+   + L
Sbjct  462  AFLFAIAHLSLSEVLPLMVLGVVLGFVYTRSRNLLAPMLLHSLWNSGTLVSL  513



>dbj|BAP17592.1| abortive infection protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=532

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
            A + +L+  +  +FPLP +WF+F +   W  + VG   V  PL+  +S +N  ++     
Sbjct  356  ASLFVLYWSIKSYFPLPKDWFRFEIKSNWLMWGVGGYLVALPLVIIISLINQQIWDGQGG  415

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  +D V + ++    S+ AP +EEI+FRGFLL SLTRY+PVW +I +
Sbjct  416  SNPL----LFLALETQDTVVLAIFYFTASLLAPFYEEIMFRGFLLSSLTRYIPVWAAITI  471

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS  FA+AH +L  + PL  LG++LG ++ +SRNLL+ ML+H LWN
Sbjct  472  SSFIFAIAHLNLSEVFPLAILGMVLGVVYTKSRNLLSSMLVHSLWN  517



>gb|EHJ12771.1| Abortive infection protein [Crocosphaera watsonii WH 0003]
Length=272

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G+ +L+  +  FFPLP +WF FS    W  + VG   V  PL+  +S +N N++     
Sbjct  96   GGIGVLYLSIKSFFPLPKDWFNFSWSSNWIIWGVGGYLVALPLVVIISLINQNIWDGQGG  155

Query  645  STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
            S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY P+WG+I 
Sbjct  156  SNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYFPLWGAIA  210

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH +L  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  211  ISSLIFAVAHLNLSEVLPLTVLGMVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  264



>ref|WP_021836623.1| Abortive infection protein [Crocosphaera watsonii]
 emb|CCQ63649.1| Abortive infection protein [Crocosphaera watsonii WH 0401]
Length=272

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G+ +L+  +  FFPLP +WF FS    W  + VG   V  PL+  +S +N N++     
Sbjct  96   GGIGVLYLSIKSFFPLPKDWFNFSWSSNWIIWGVGGYLVALPLVVIISLINQNIWDGQGG  155

Query  645  STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
            S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY P+WG+I 
Sbjct  156  SNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYFPLWGAIS  210

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH +L  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  211  ISSLIFAVAHLNLSEVLPLTVLGMVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  264



>ref|WP_035826525.1| abortive phage infection protein, partial [Crocosphaera watsonii]
Length=403

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G+ +L+  +  FFPLP +WF FS    W  + VG   V  PL+  +S +N N++     
Sbjct  227  GGIGVLYLSIKSFFPLPKDWFNFSWSSNWIIWGVGGYLVALPLVVIISLINQNIWDGQGG  286

Query  645  STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
            S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY P+WG+I 
Sbjct  287  SNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYFPLWGAIA  341

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH +L  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  342  ISSLIFAVAHLNLSEVLPLTVLGMVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  395



>ref|XP_001421859.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00153.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=234

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 96/168 (57%), Gaps = 5/168 (3%)
 Frame = -2

Query  807  ILHRRLAKFFPLPSNWF--KFSLGGKWHFDVGLCCVMFPLI---NRLSQVNLNLFPFLPS  643
            +L + L  F P   NWF  ++    K+  DV + CV FP +   + LS   L     +  
Sbjct  66   VLRQSLRPFRPFGVNWFPVRWFEDRKYLRDVAVACVAFPFVVWLHGLSTTLLEHIGLIAF  125

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
                 +   QS+   D ++   Y +L S  AP+WEE+IFRGF   SLT +     ++L+S
Sbjct  126  DETVTAAWEQSMKSNDIISKAFYMLLASFAAPVWEELIFRGFFFASLTAFTGAARAMLIS  185

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYV  319
            S  FA AHFSL++ LPL FLG L+  +FVR+RNLLAP+L+H  WNA+V
Sbjct  186  STLFACAHFSLEQFLPLTFLGCLMCVVFVRTRNLLAPVLVHSAWNAWV  233



>ref|WP_021829879.1| Abortive infection protein [Crocosphaera watsonii]
 emb|CCQ50107.1| Abortive infection protein [Crocosphaera watsonii WH 8502]
Length=519

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G+ +L+  +  FFPLP +WF FS    W  + VG   V  PL+  +S +N N++     
Sbjct  343  GGIGVLYLSIKSFFPLPKDWFNFSWSSNWIIWGVGGYLVALPLVVIISLINQNIWDGQGG  402

Query  645  STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
            S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY P+WG+I 
Sbjct  403  SNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYFPLWGAIA  457

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH +L  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  458  ISSLIFAVAHLNLSEVLPLTVLGMVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  511



>ref|WP_007305940.1| abortive phage infection protein [Crocosphaera watsonii]
 gb|EAM50385.1| Abortive infection protein [Crocosphaera watsonii WH 8501]
Length=519

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G+ +L+  +  FFPLP +WF FS    W  + VG   V  PL+  +S +N N++     
Sbjct  343  GGIGVLYLSIKSFFPLPKDWFNFSWSSNWIIWGVGGYLVALPLVVIISLINQNIWDGQGG  402

Query  645  STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
            S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY P+WG+I 
Sbjct  403  SNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYFPLWGAIA  457

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +SS+ FA+AH +L  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  458  ISSLIFAVAHLNLSEVLPLTVLGMVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  511



>ref|WP_008234090.1| Abortive infection protein [Richelia intracellularis]
 emb|CCH67475.1| Abortive infection protein [Richelia intracellularis HH01]
Length=507

 Score =   125 bits (313),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 106/172 (62%), Gaps = 8/172 (5%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLC--CVMFPLINRLSQVNLNLFPFLP-S  643
            + +L+  +  F PL   WF     GKW F  G C  CV  P++  +S +N  LF     S
Sbjct  333  LTVLYFSIKNFLPLHEGWFHLHFQGKW-FLWGSCGYCVAGPIVVFVSALNQKLFQGQGGS  391

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
             P+    +  ++  +D VA+ ++ I   + AP++EE +FRGFLLPSLTRY  +WG+I +S
Sbjct  392  NPL----LQLALDSQDTVALFIFFITAGVAAPLFEEYLFRGFLLPSLTRYFSMWGAITVS  447

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+ FA+ H +L  ++PL  LG++LG ++ RSRNL+AP++LH +WN+   + L
Sbjct  448  SLLFAIVHLNLSEIIPLTALGMVLGFVYTRSRNLMAPIVLHSIWNSSTLVSL  499



>ref|WP_027401133.1| abortive phage infection protein [Aphanizomenon flos-aquae]
Length=508

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
              +++L+  + +FFPLP+NWF+F+  G W  +  G  C   P++  +S +N  L+     
Sbjct  333  GSLSVLYFSIRRFFPLPNNWFRFNFFGNWVLWGFGGYCTALPIVVVVSLINQKLWQGQGG  392

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+    +  ++  RD  A+ ++    +I AP +EE +FRGFLLPSLTRY  VWG+IL+
Sbjct  393  SNPL----LQMALESRDNTALGIFFFTAAIAAPFFEEFLFRGFLLPSLTRYTSVWGAILI  448

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            SS+ FA AH SL  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  449  SSLLFAAAHLSLSEILPLTALGIVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  501



>gb|KFF41437.1| putative metal-dependent membrane protease [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=514

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 105/171 (61%), Gaps = 4/171 (2%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            G+ +L+  +  FFPLP   F F +   W  + VG      PL+  +S +N N +     +
Sbjct  339  GILVLYLSIKPFFPLPQKLFNFKIFSHWITWGVGGYLAALPLVLIVSLLNDNFWGGQGGS  398

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
               +S V ++   +D VA+ ++ +  +I AP++EEIIFRGFLLPSLTRY+  W +I +SS
Sbjct  399  NPLLSLVLEN---QDLVALAIFYLTAAIAAPLYEEIIFRGFLLPSLTRYISPWAAIGVSS  455

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            + FA AH ++  +LPL  LG++LG ++ RSRNLL+ +L+H LWN    L L
Sbjct  456  LVFAAAHLNISEILPLTTLGIILGVVYTRSRNLLSSILMHSLWNTGTLLSL  506



>ref|WP_015080392.1| abortive infection protein [Anabaena sp. 90]
 ref|YP_006997049.1| abortive infection protein [Anabaena sp. 90]
 gb|AFW95236.1| abortive infection protein [Anabaena sp. 90]
Length=508

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 108/170 (64%), Gaps = 6/170 (4%)
 Frame = -2

Query  810  AILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-STP  637
            ++L+  + +FFPLP NWF+F+    W  + +G  C   P++  +S +N  L+     S P
Sbjct  336  SVLYFSIRRFFPLPENWFRFNFFSNWFLWGLGGYCTALPIVVIVSLINQKLWQGQGGSNP  395

Query  636  VTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSI  457
            +    +  ++  RD  A+ ++    +I AP +EE +FRGFLLPSLTRY  VWG+IL+SS+
Sbjct  396  L----LQMALESRDNTALGIFFFTAAIAAPFFEEFLFRGFLLPSLTRYTSVWGAILISSL  451

Query  456  AFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             FA AH SL  +LPL  LG++LG ++ RSRNLL+ MLLH LWN+   + L
Sbjct  452  LFAAAHLSLSEILPLTALGIVLGIVYTRSRNLLSSMLLHSLWNSGTLISL  501



>ref|WP_009544848.1| MULTISPECIES: abortive phage infection protein [Cyanothece]
 ref|YP_001803871.1| hypothetical protein cce_2457 [Cyanothece sp. ATCC 51142]
 gb|ACB51805.1| unknown [Cyanothece sp. ATCC 51142]
Length=520

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 113/175 (65%), Gaps = 8/175 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  F PLP +WF F+    W  + VG   V  PL+  +S +N N++    
Sbjct  343  VGGIGVLYLSIKPFLPLPKDWFNFNWLSNWIVWGVGGYLVALPLVVIISLINQNIWDGQG  402

Query  645  -STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
             S P+ +++  GQ IVV     + ++    +I AP++EEI+FRGFLLPSLTRY+P+WG+I
Sbjct  403  GSNPLLSLALEGQDIVV-----LAIFYFTAAIAAPVYEEIMFRGFLLPSLTRYLPLWGAI  457

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             LSS+ FA+AH +L  +LPL  LG++LG ++ +SRNLL+ MLLH LWN+   + L
Sbjct  458  GLSSVVFAVAHLNLSEVLPLTILGMVLGVVYTKSRNLLSSMLLHSLWNSGTLISL  512



>ref|WP_015219444.1| abortive infection protein [Cyanobacterium aponinum]
 ref|YP_007161761.1| abortive infection protein [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53717.1| Abortive infection protein [Cyanobacterium aponinum PCC 10605]
Length=494

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 105/166 (63%), Gaps = 5/166 (3%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVMFPLINRLSQVNLNLFPFLP-S  643
             G+++L+  +  FFPLP++WFK +    + + +G      PL+  +S +N  ++     S
Sbjct  319  GGLSVLYLSIKSFFPLPTDWFKLTNKNWFWWGLGGYLTAIPLVFFVSLLNQQIWQGKGGS  378

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
             P+ +     ++  +D  A+ ++ I  SI API+EEIIFRGFLLPSLTRYM V  +I++S
Sbjct  379  NPLLM----LALESQDKFALIIFFITASIAAPIFEEIIFRGFLLPSLTRYMSVGSAIVVS  434

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNA  325
             I FA+AH SL   LPL  LG++LG ++ RS  LLA +++H LWN+
Sbjct  435  GIIFAIAHLSLAEALPLAVLGIILGIVYTRSGCLLASIMVHSLWNS  480



>ref|WP_026099232.1| hypothetical protein [Prochlorothrix hollandica]
Length=540

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 103/172 (60%), Gaps = 6/172 (3%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP-ST  640
            + +L+  +  + PLP +WF    GG W  + VG   +  PL+   + +N  ++     S 
Sbjct  367  IGVLYNAIKAYLPLPPSWFALRWGGNWVVWGVGGYLMALPLVTLTALINQQIWQGQGGSN  426

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
            P+    +  ++  +D VA+  +    +I AP++EE +FRGFLL SLTRY   WG+I LS+
Sbjct  427  PI----LSLALENKDNVALACFFATAAIAAPLFEEFLFRGFLLASLTRYFSSWGAIALSA  482

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            + F++AH SL  +LPL  LG +LG ++ RS+NLLAPMLLH LWN+     L+
Sbjct  483  LIFSIAHLSLSEVLPLFVLGAVLGYVYRRSQNLLAPMLLHSLWNSATLAGLV  534



>ref|WP_015955015.1| abortive phage infection protein [Cyanothece sp. PCC 7424]
 ref|YP_002378286.1| hypothetical protein PCC7424_3016 [Cyanothece sp. PCC 7424]
 gb|ACK71418.1| Abortive infection protein [Cyanothece sp. PCC 7424]
Length=527

 Score =   121 bits (304),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 112/174 (64%), Gaps = 6/174 (3%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHF-DVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  +FP+P +WF+F     W F  +G   V  PL+  +S +N  ++    
Sbjct  350  VGGILVLYLSIKSYFPIPKDWFRFRWLSNWIFWGLGGYLVAIPLVVIVSLINQKIWQGQG  409

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+ +     ++  +D VA+ ++    +I AP++EEI+FRGFLLPSLTRYMPVWG+I+
Sbjct  410  GSNPLLML----ALESQDTVALIIFFFTAAIAAPLFEEIMFRGFLLPSLTRYMPVWGAIV  465

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +S + FA+AH +L  ++PL  LG++LG ++ RSRNLL+ +LLH LWN+   L L
Sbjct  466  VSGLIFAVAHLNLSEVIPLATLGIILGVVYTRSRNLLSSILLHSLWNSGTLLSL  519



>ref|XP_007512818.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17418.1| predicted protein [Bathycoccus prasinos]
Length=423

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 103/186 (55%), Gaps = 33/186 (18%)
 Frame = -2

Query  768  SNWFKFSLGGKWHF-----DVGLCCVMFPLINRLSQVNLNLFPF----------------  652
            +NWF+ +      F     +  L    FPL+N ++++N  L  +                
Sbjct  216  TNWFRVTFESVEEFKRCSKETLLFVATFPLVNLVAELNSKLCDYFANGGTIFSLRGILTS  275

Query  651  ----------LPSTPVTV--SNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLP  508
                      L +TPV V  SN  +  +  D V++  YA+LV++ APIWEE+IFRGFL+P
Sbjct  276  LFGGNGSSTQLTTTPVVVNPSNFERVAMSGDGVSVLFYAVLVAVVAPIWEEVIFRGFLMP  335

Query  507  SLTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SLT+   V  SI LSS  FALAHFS+ R LPL  L V L  ++VR+RN++AP++LH LWN
Sbjct  336  SLTKKWRVSTSICLSSCIFALAHFSMDRFLPLTALSVALSILYVRTRNVVAPIVLHALWN  395

Query  327  AYVFLD  310
            A   L+
Sbjct  396  AAAVLE  401



>ref|WP_010473563.1| peptidase [Acaryochloris sp. CCMEE 5410]
Length=543

 Score =   119 bits (298),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 4/172 (2%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            G++IL   L  F   P  WF+    G W  + +       PL+  ++ +N  +       
Sbjct  368  GLSILIWSLKGFLSTPFKWFRIRWQGNWLVWGMSGYFAALPLVILIALLNQKILGDQGGG  427

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
               +  + QS    DPV  +L  I+V++ AP++EEI+FRGF L SLTRY+P+WG+I +S 
Sbjct  428  NPLLELIIQS---HDPVTASLLFIMVAVLAPVFEEILFRGFFLTSLTRYLPMWGAIGISG  484

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            I FA+AH +L  +LPL  LG +LG ++ RSRNLLA MLLH LWN+  FL L+
Sbjct  485  IVFAVAHLNLADILPLSVLGCVLGFVYSRSRNLLASMLLHSLWNSGSFLSLL  536



>ref|WP_039780122.1| peptidase [Acaryochloris sp. CCMEE 5410]
Length=537

 Score =   119 bits (298),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 4/172 (2%)
 Frame = -2

Query  816  GMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLPST  640
            G++IL   L  F   P  WF+    G W  + +       PL+  ++ +N  +       
Sbjct  362  GLSILIWSLKGFLSTPFKWFRIRWQGNWLVWGMSGYFAALPLVILIALLNQKILGDQGGG  421

Query  639  PVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSS  460
               +  + QS    DPV  +L  I+V++ AP++EEI+FRGF L SLTRY+P+WG+I +S 
Sbjct  422  NPLLELIIQS---HDPVTASLLFIMVAVLAPVFEEILFRGFFLTSLTRYLPMWGAIGISG  478

Query  459  IAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            I FA+AH +L  +LPL  LG +LG ++ RSRNLLA MLLH LWN+  FL L+
Sbjct  479  IVFAVAHLNLADILPLSVLGCVLGFVYSRSRNLLASMLLHSLWNSGSFLSLL  530



>ref|WP_008277033.1| abortive phage infection protein [Cyanothece sp. CCY0110]
 gb|EAZ89864.1| Abortive infection protein [Cyanothece sp. CCY0110]
Length=520

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 8/175 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP  646
              G+ +L+  +  FFPLP +WF F+    W  + VG   V  PL+  +S +N N++    
Sbjct  343  VGGIGVLYLSIKPFFPLPKDWFNFNWLSNWIVWGVGGYLVALPLVVIISLINQNIWDGQG  402

Query  645  -STPV-TVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
             S P+ +++  GQ IVV     + ++    +I AP +EEI+FRGFLLPSLTRY+P+W +I
Sbjct  403  GSNPLLSLALEGQDIVV-----LAIFYFTAAIAAPFYEEIMFRGFLLPSLTRYIPLWAAI  457

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             +SS+ FA+AH +L  +LPL  LG++LG ++ +SRNLL+ MLLH LWN+   + L
Sbjct  458  GISSLIFAVAHLNLSEVLPLTVLGIVLGIVYTKSRNLLSSMLLHSLWNSGTLISL  512



>ref|WP_011611783.1| abortive phage infection protein [Trichodesmium erythraeum]
 ref|YP_721886.1| abortive infection protein [Trichodesmium erythraeum IMS101]
 gb|ABG51413.1| Abortive infection protein [Trichodesmium erythraeum IMS101]
Length=511

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 110/176 (63%), Gaps = 12/176 (7%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCCVM-FPLINRLSQVNLNLFPFL--  649
             G+ +L+  L  FFPLP  WFKF L G W F       +  P++  +S +N  L+     
Sbjct  335  GGLLVLYLSLKSFFPLPKGWFKFDLRGGWFFWGLGGYFLALPMVILISLINQQLWQGQGG  394

Query  648  --PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGS  475
              P  P+ ++        +D +A+ L+ +  SI AP++EE++FRGFLLPSLT+YMP+WG+
Sbjct  395  SNPILPIALNG-------QDGLALGLFFVTASIAAPVFEEVMFRGFLLPSLTKYMPIWGA  447

Query  474  ILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            I++S   FA+AH ++  +LPL  LG++LG ++ RSRNLL+ +LLH LWN+   L L
Sbjct  448  IIVSGFLFAIAHLNISEVLPLAVLGIILGAVYTRSRNLLSSILLHSLWNSGTLLSL  503



>ref|WP_016515540.1| CAAX amino terminal protease self- immunity [Microcystis aeruginosa]
 gb|EPF22049.1| CAAX amino terminal protease self- immunity [Microcystis aeruginosa 
SPC777]
Length=518

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFLP  646
            + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++    
Sbjct  342  SSLSVLYLAIKPFRPLPPDWFRFKLFSPWLF-WGLAGYFVALPLVIIISLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002758417.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCH96318.1| Abortive infection protein [Microcystis aeruginosa PCC 9717]
Length=518

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 104/167 (62%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLC--CVMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPW-FLWGLAGYVVALPLVIIVSLLNQLIWQGQ  399

Query  648  PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
              +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I 
Sbjct  400  GGSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIA  456

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  457  LSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002783197.1| Abortive infection protein [Microcystis aeruginosa]
 emb|CCI12812.1| Abortive infection protein [Microcystis aeruginosa PCC 9806]
Length=518

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 106/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F+L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKSFRPLPPDWFRFNLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  ++  A+  +A   S+ AP +EEI+FRGFLL SLTRY+PVWG+I
Sbjct  400  GGSNPL----LTLALESQNTFALLCFAFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAI  455

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  456  ALSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002789067.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI19032.1| Genome sequencing data, contig C294 [Microcystis aeruginosa PCC 
9807]
Length=518

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 105/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPW-FLWGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  ++  A+  +A   S+ AP +EEI+FRGFLL SLTRY+PVWG+I
Sbjct  400  GGSNPL----LTLALESQNTFALLCFAFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAI  455

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             LSS  FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  456  ALSSFIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002795086.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI27743.1| Genome sequencing data, contig C294 [Microcystis aeruginosa PCC 
9808]
Length=518

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFLP  646
            + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++    
Sbjct  342  SSLSVLYLAIKPFRPLPPDWFRFKLFSPW-FLWGLAGYFVALPLVIIVSLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002747965.1| CAAX amino terminal protease family protein [Microcystis aeruginosa]
 emb|CAO86887.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS45621.1| CAAX amino terminal protease family protein [Microcystis aeruginosa 
DIANCHI905]
Length=518

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 105/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLC--CVMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPW-FLWGLAGYVVALPLVIIVSLLNQLIWQGQ  399

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I
Sbjct  400  GGSNPL----LTLALESQNTFALLCFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAI  455

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  456  ALSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002801231.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI38829.1| Genome sequencing data, contig C294 [Microcystis aeruginosa PCC 
9701]
Length=518

 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 105/167 (63%), Gaps = 8/167 (5%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFLP  646
            + +++L+  +  F PLP +WF+F L   W F  GL    V  PL+  +S +N  ++    
Sbjct  342  SSLSVLYLAIKPFRPLPPDWFRFKLFSPW-FLWGLAGYFVALPLVIIVSLLNQLIWQGQG  400

Query  645  -STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
             S P+    +  ++  ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I 
Sbjct  401  GSNPL----LTLALESQNTFALLCFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIT  456

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  457  LSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>emb|CEG00547.1| CAAX amino terminal protease [Ostreococcus tauri]
Length=358

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 110/215 (51%), Gaps = 19/215 (9%)
 Frame = -2

Query  948  SGELGIRSTQ*CQERLGIPS*EGFSCCSSH*TLDSTMDSKDYCAGMAILHRRLAKFFPLP  769
            +G LG  ST   Q  L +     +S C         +D         +L + L  F PL 
Sbjct  136  AGALGFDSTNFTQRGLAV-----YSFC---------LDIAQMFMTGFVLRQSLRAFTPLG  181

Query  768  SNWFKFS-LGGKWHF-DVGLCCVMFPLI---NRLSQVNLNLFPFLPSTPVTVSNVGQSIV  604
            ++WF       K H  DV L C  FP++   + +S   L     L       +   QS+ 
Sbjct  182  ASWFPVRWFEDKKHVRDVLLACAAFPIVVWLHGISVTALETTGLLVFDDAITTGWEQSMR  241

Query  603  VRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQR  424
              D ++   Y +L S+ AP+WEE+IFRGF   +L+  + V  ++++SS+ FA+AH SL++
Sbjct  242  SDDLLSKAFYVLLASVAAPVWEELIFRGFFFSALSAVISVKRAMIISSVVFAVAHLSLEQ  301

Query  423  MLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYV  319
             LPL FLG L   +FVR+RNLLAP L+H  WNA V
Sbjct  302  FLPLTFLGCLHCVVFVRTRNLLAPALVHSAWNASV  336



>ref|WP_012953634.1| abortive phage infection protein [Candidatus Atelocyanobacterium 
thalassa]
 ref|YP_003421327.1| putative metal-dependent membrane protease [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB94969.1| predicted metal-dependent membrane protease [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=517

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 4/172 (2%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPS  643
             G+ +L+  +  FFPLP   F F +   W  + +    V  P +  +S +N N +     
Sbjct  341  GGILVLYLSIKPFFPLPQKLFNFKIFKNWIIWGISGYLVALPSVLIISLINDNFWGGKGG  400

Query  642  TPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLS  463
            +   +S V ++   +D  A+ ++ +  ++ AP +EEIIFRGFLLPSLTRY+  WG+I++S
Sbjct  401  SNPLLSLVLEN---QDLFALAIFYLTAAVAAPFYEEIIFRGFLLPSLTRYISPWGAIIVS  457

Query  462  SIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            S+ FA+AH ++  +LPL  LG++LG ++ RS NLL+ +L+H LWN    + L
Sbjct  458  SLIFAVAHLNISEILPLTTLGIILGVVYTRSGNLLSSILMHSLWNTGTLVSL  509



>dbj|GAL94240.1| hypothetical protein N44_02820 [Microcystis aeruginosa NIES-44]
Length=518

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFLP  646
            + +++L+  +  F PLP +WF+F L   W    GL    V  PL+  +S +N  ++    
Sbjct  342  SSLSVLYLAIKPFRPLPPDWFRFKLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALVCFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002738495.1| CAAX amino terminal protease family protein [Microcystis aeruginosa]
 gb|ELP52623.1| CAAX amino terminal protease family protein [Microcystis aeruginosa 
TAIHU98]
Length=518

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 103/166 (62%), Gaps = 4/166 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             + +++L+  +  F PLP +WF+F L   W  + +    V  PL+  +S +N  ++    
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPWLLWGLAGYFVALPLVIIVSLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002778370.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI08570.1| Genome sequencing data, contig C294 [Microcystis aeruginosa PCC 
7941]
Length=518

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFLP  646
            + +++L+  +  F PLP +WF+F L   W    GL    V  PL+  +S +N  ++    
Sbjct  342  SSLSVLYLAIKPFRPLPPDWFRFKLFSPWLL-WGLAGYFVALPLVIIISLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_024969764.1| abortive phage infection protein [Microcystis aeruginosa]
Length=518

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
              +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I 
Sbjct  400  GGSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIA  456

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  457  LSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_008229995.1| Abortive infection protein [Richelia intracellularis]
 emb|CCH65770.1| Abortive infection protein [Richelia intracellularis HM01]
Length=139

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  600  RDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRM  421
            +D VA+ ++ I   + AP++EE +FRGFLLPSLTRY  +WG+I +SS+ FA+ H +L  +
Sbjct  34   QDTVALFIFFITAGVAAPLFEEYLFRGFLLPSLTRYFSMWGAITVSSLLFAIVHLNLSEI  93

Query  420  LPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +PL  LG++LG ++ RSRNL+AP+LLH +WN+   + L
Sbjct  94   IPLTALGMVLGFVYTRSRNLMAPILLHSIWNSSTLVSL  131



>ref|WP_008202035.1| abortive phage infection protein [Microcystis sp. T1-4]
 emb|CCI32626.1| Abortive infection protein [Microcystis sp. T1-4]
Length=518

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F+L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFNLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I
Sbjct  400  GGSNPL----LTLALESQNTFALLCFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAI  455

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  456  ALSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_002768655.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI02944.1| Abortive infection protein [Microcystis aeruginosa PCC 9443]
Length=518

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 103/167 (62%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
              +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I 
Sbjct  400  GGSNPLLTLALES---QNTFALLCFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIA  456

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  457  LSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_011243347.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171745.1| hypothetical protein syc1035_d [Synechococcus elongatus PCC 6301]
 dbj|BAD79225.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=480

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 102/171 (60%), Gaps = 4/171 (2%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPSTP  637
            + +L   L ++ PLP +WF      +W  + +G   V  P++   S +N  ++     + 
Sbjct  308  LGLLAWTLQRYRPLPPDWFVLRWRSRWPLWGIGGYWVALPVVIGTSLLNQLIWQGRGGSN  367

Query  636  VTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSI  457
              +  V  S       A+  + +  +I AP++EE++FRGFLL SLTR++PV G+I LS +
Sbjct  368  PLLELVLDS---GSRSALFWFWVTAAIAAPLFEEVLFRGFLLASLTRWLPVRGAIALSGL  424

Query  456  AFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
             FALAH SL  +LPL  LG LLG ++ RSRNLLAPMLLHGLWN+   + L+
Sbjct  425  LFALAHLSLSEVLPLFALGCLLGEVYTRSRNLLAPMLLHGLWNSGTLISLL  475



>ref|WP_002756130.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCH94434.1| Abortive infection protein [Microcystis aeruginosa PCC 9432]
Length=518

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 103/166 (62%), Gaps = 4/166 (2%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLP  646
             + +++L+  +  F PLP +WF+F L   W  + +    V  PL+  +S +N  ++    
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFKLFSFWLLWGLAGYFVALPLVIIVSLLNQLIWQGQG  400

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
             +   ++   +S   ++  A+  +    S+ AP +EEI+FRGFLL SLTRY+PVWG+I L
Sbjct  401  GSNPLLTLALES---QNTFALICFGFTASLAAPFFEEIVFRGFLLASLTRYLPVWGAIAL  457

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  458  SSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_015163386.1| abortive infection protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007100840.1| abortive infection protein [Pseudanabaena sp. PCC 7367]
 gb|AFY68412.1| Abortive infection protein [Pseudanabaena sp. PCC 7367]
Length=509

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 108/203 (53%), Gaps = 31/203 (15%)
 Frame = -2

Query  849  DSTMDSKD--------YCAGMA----ILHRRLAKFFPLPSNWFKFSLG---------GKW  733
            D +  S+D        Y A M+    IL +RL  F PLP   F+  L          G +
Sbjct  313  DDSWQSRDRAIFVLLSYVAYMSPVLIILQQRLKPFMPLPETLFRLKLNPPSWLGWGIGGY  372

Query  732  HFDVGLCCVMFPLINRLSQVNLNLFPFLPSTPVTVSNVGQSIVVRDPVAMTLYAILVSIC  553
               + +  V   L  +L Q N    P L    +   N        D VA  +  + +++ 
Sbjct  373  LTAIPMVFVASVLSEQLLQGNGGGNPLLE---ILADN-------NDGVAKIVLWLTLAVA  422

Query  552  APIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVR  373
            AP +EEI+FRGFLLPSLT+ MP W ++ LS + FA+ H +L  ++PL  LG++LG ++VR
Sbjct  423  APFFEEILFRGFLLPSLTKLMPFWAALCLSGLTFAVTHQNLSDIIPLTILGIVLGFVYVR  482

Query  372  SRNLLAPMLLHGLWNAYVFLDLM  304
            S+NLLAPMLLH LWN+  FL L+
Sbjct  483  SKNLLAPMLLHCLWNSGSFLSLL  505



>ref|WP_012265482.1| abortive phage infection protein [Microcystis aeruginosa]
 ref|YP_001657327.1| abortive infection protein [Microcystis aeruginosa NIES-843]
 dbj|BAG02135.1| abortive infection protein [Microcystis aeruginosa NIES-843]
Length=518

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 8/168 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F+L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPPDWFRFNLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  ++  A+  +A   S+ AP +EEI+FRGFLL SLTRY+PVW +I
Sbjct  400  GGSNPL----LTLALESQNTFALLCFAFTASLAAPFFEEIVFRGFLLASLTRYLPVWAAI  455

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
             LSS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  456  ALSSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_011377596.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_399503.1| hypothetical protein Synpcc7942_0484 [Synechococcus elongatus 
PCC 7942]
 gb|ABB56516.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD56441.1| hypothetical protein M744_00540 [Synechococcus sp. UTEX 2973]
Length=480

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 102/171 (60%), Gaps = 4/171 (2%)
 Frame = -2

Query  813  MAILHRRLAKFFPLPSNWFKFSLGGKWH-FDVGLCCVMFPLINRLSQVNLNLFPFLPSTP  637
            + +L   L ++ PLP +WF      +W  + +G   V  P++   S +N  ++     + 
Sbjct  308  LGLLAWTLQRYRPLPPDWFVLRWRSRWPLWGIGGYWVALPVVIGTSLLNQLIWQGRGGSN  367

Query  636  VTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSI  457
              +  V  S       A+  + +  +I AP++EE++FRGFLL SLTR++PV G+I LS +
Sbjct  368  PLLELVLDS---GSRSALFWFWVTAAIAAPLFEEVLFRGFLLASLTRWLPVRGAIALSGL  424

Query  456  AFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
             FALAH SL  +LPL  LG LLG ++ RSRNLLAPMLLHGLWN+   + L+
Sbjct  425  LFALAHLSLSEVLPLFALGCLLGEVYTRSRNLLAPMLLHGLWNSGTLISLL  475



>ref|WP_002796784.1| abortive phage infection protein [Microcystis aeruginosa]
 emb|CCI24198.1| Abortive infection protein [Microcystis aeruginosa PCC 9809]
Length=518

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 104/167 (62%), Gaps = 6/167 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKWHFDVGLCC--VMFPLINRLSQVNLNLFPFL  649
             + +++L+  +  F PLP +WF+F+L   W    GL    V  PL+  +S +N  ++   
Sbjct  341  VSSLSVLYLAIKPFRPLPRDWFRFNLFSPWLL-WGLAGYFVALPLVIIVSLLNQLIWQGQ  399

Query  648  PSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSIL  469
              +   ++   +S   ++  A+  +A   S+ AP +EEI+FRGFLL SLTRY+PVW +I 
Sbjct  400  GGSNPLLTLALES---QNTFALLCFAFTASLAAPFFEEIVFRGFLLASLTRYLPVWAAIA  456

Query  468  LSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            +SS+ FALAH +L  +LPL  LG +LG ++ RS+NLL+ ML+H LWN
Sbjct  457  ISSLIFALAHQNLSEVLPLTVLGCVLGFVYTRSKNLLSSMLVHSLWN  503



>ref|WP_015144430.1| metal-dependent membrane protease [Pleurocapsa minor]
 ref|YP_007081686.1| metal-dependent membrane protease [Pleurocapsa sp. PCC 7327]
 gb|AFY78129.1| putative metal-dependent membrane protease [Pleurocapsa sp. PCC 
7327]
Length=516

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 106/175 (61%), Gaps = 8/175 (5%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLF--PF  652
             + + +L+  +  F PL  +WF+F     W  + +G   V  PL+  +S  N  LF    
Sbjct  339  ASELLVLYFSVKSFLPLAKDWFRFQWLSSWILWGIGGYLVALPLVFVVSLAN-QLFWQGK  397

Query  651  LPSTPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  +D   + ++    S+ AP++EEIIFRGFLLPSLTRY+PVWG+I
Sbjct  398  GGSNPL----LSLALQAQDKWVLAIFFFTASVAAPVFEEIIFRGFLLPSLTRYLPVWGAI  453

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
             +SSI FA+AH +L  +LPL  LG++LG ++ RSRNLL+ +LLH LWN    L L
Sbjct  454  AISSIVFAIAHLNLSEVLPLATLGIVLGVVYTRSRNLLSSILLHSLWNGGTLLSL  508



>ref|WP_013320567.1| abortive phage infection protein [Cyanothece sp. PCC 7822]
 ref|YP_003885732.1| abortive infection protein [Cyanothece sp. PCC 7822]
 gb|ADN12457.1| Abortive infection protein [Cyanothece sp. PCC 7822]
Length=535

 Score =   110 bits (274),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 108/166 (65%), Gaps = 6/166 (4%)
 Frame = -2

Query  819  AGMAILHRRLAKFFPLPSNWFKFSLGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFLP-  646
             G ++L+  +  +FP+P +WF+F     W  + +G   V  PL+  +S +N  ++     
Sbjct  359  GGFSVLYLSIRPYFPIPKDWFRFRWLSNWIVWGLGGYLVAIPLVVIVSLINQKIWQGEGG  418

Query  645  STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILL  466
            S P+ +     ++  +D VA+ ++ +  +I AP++EE++FRGFLLPSLTRY+PVW +I +
Sbjct  419  SNPLLML----ALESQDTVALIIFFVTAAIAAPLFEEVMFRGFLLPSLTRYIPVWAAIGV  474

Query  465  SSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWN  328
            S + FA+AH ++  ++PL  LG++LG ++ RSRNLL+ MLLH LWN
Sbjct  475  SGLIFAVAHLNVSEVMPLATLGIILGVVYTRSRNLLSSMLLHSLWN  520



>ref|WP_015147945.1| metal-dependent membrane protease [Oscillatoria acuminata]
 ref|YP_007085219.1| metal-dependent membrane protease [Oscillatoria acuminata PCC 
6304]
 gb|AFY81299.1| putative metal-dependent membrane protease [Oscillatoria acuminata 
PCC 6304]
Length=526

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 7/175 (4%)
 Frame = -2

Query  822  CAGMAILHRRLAKFFPLPSNWFKFS-LGGKW-HFDVGLCCVMFPLINRLSQVNLNLFPFL  649
              G+ +L   +  FFPL  +WF+F+ L   W  +  G      PL+  +S +N   +   
Sbjct  348  IGGLLVLFFSIRSFFPLAKDWFRFNVLQASWISWGFGGYFAALPLVILVSIINQQFWQGR  407

Query  648  P-STPVTVSNVGQSIVVRDPVAMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSI  472
              S P+    +  ++  RD VA+T++ I  S+ API+EEI+FRGFLLPSLTRY  V  +I
Sbjct  408  GGSNPI----LSIALENRDTVALTIFFITASVAAPIFEEIMFRGFLLPSLTRYFSVTTAI  463

Query  471  LLSSIAFALAHFSLQRMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDL  307
            +LSS+ FALAH +L  +LPL  LG++LG ++ RSRNLL+ +LLH LWN+     L
Sbjct  464  VLSSLLFALAHLNLSEVLPLATLGMVLGFVYTRSRNLLSSILLHSLWNSGTLFSL  518



>ref|WP_026100828.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=518

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  579  LYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLG  400
            ++ I+V++ API+EE +FRGF+LPSL + MPVWG+I+ S++ FA  H +   +LPL  LG
Sbjct  421  IFLIVVAVFAPIFEETLFRGFVLPSLAKVMPVWGAIVASAVLFAAVHLNFSDLLPLTVLG  480

Query  399  VLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
            ++LG ++ RSRNLLAPMLLH  WNA  F  L+
Sbjct  481  IVLGLVYSRSRNLLAPMLLHSCWNAGTFATLL  512



>ref|WP_011431455.1| CAAX amino terminal protease [Synechococcus sp. JA-3-3Ab]
 ref|YP_476047.1| CAAX amino terminal protease family protein [Synechococcus sp. 
JA-3-3Ab]
 gb|ABD00784.1| CAAX amino terminal protease family protein [Synechococcus sp. 
JA-3-3Ab]
Length=537

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  588  AMTLYAILVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRMLPLV  409
            A  ++  +VS+CAP++EE++FRGF LP+L+RY+P+  +ILLS+  FALAH +L  +LPL 
Sbjct  437  ARLVFLAVVSVCAPVFEEVLFRGFWLPTLSRYLPMGAAILLSAFTFALAHLNLSDLLPLT  496

Query  408  FLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
             LGV+LG ++  SRNLLAP+LLH LWN    + L+
Sbjct  497  MLGVVLGVVYSHSRNLLAPILLHSLWNTGSLVTLL  531



>ref|WP_012626968.1| abortive infection protein [Cyanothece sp. PCC 7425]
 ref|YP_002482238.1| abortive infection protein [Cyanothece sp. PCC 7425]
 gb|ACL43877.1| Abortive infection protein [Cyanothece sp. PCC 7425]
Length=538

 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  567  LVSICAPIWEEIIFRGFLLPSLTRYMPVWGSILLSSIAFALAHFSLQRMLPLVFLGVLLG  388
            +V+  AP++EE +FRGF L SLTRY+P WG+I LS + FA+AH SL  +LPL  LG++LG
Sbjct  444  MVAGLAPLFEETLFRGFFLTSLTRYLPAWGAIALSGVVFAIAHLSLAEILPLTVLGMMLG  503

Query  387  TIFVRSRNLLAPMLLHGLWN  328
             +++RSRNLLA MLLH LWN
Sbjct  504  YVYLRSRNLLASMLLHSLWN  523



>ref|WP_015167154.1| metal-dependent membrane protease [Synechococcus sp. PCC 7502]
 ref|YP_007104630.1| metal-dependent membrane protease [Synechococcus sp. PCC 7502]
 gb|AFY72495.1| putative metal-dependent membrane protease [Synechococcus sp. 
PCC 7502]
Length=512

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 109/221 (49%), Gaps = 54/221 (24%)
 Frame = -2

Query  849  DSTMDSKD--------YCAGMA----ILHRRLAKFFPLPS----------NWFKFSLGGK  736
            DST +S+D        Y A MA    I    L  F PLP+          NW ++ LGG 
Sbjct  300  DSTWNSRDRAIFILIPYVASMAPMLLIFRGALRDFLPLPNYLFQLKLKTWNWLRWGLGG-  358

Query  735  WHFDVGLCCVMFPLINRLSQVNLNLFPFL----PSTPVTVSNVGQSIVVRDPVAMTLYAI  568
                        P+I  +S +N  L        P  P+ V +       ++ +A  L  +
Sbjct  359  -------YIAAIPVILAVSALNQRLLDGQGGGNPLLPILVQD-------QNSIAKLLLWM  404

Query  567  LVSICAPIWEEIIFRGFLLPSL---------TRY----MPVWGSILLSSIAFALAHFSLQ  427
             V+I AP +EE++FRGFLLPSL          R+    +  W  I  S + FA+AH +L 
Sbjct  405  TVAIAAPFFEELLFRGFLLPSLISALVSVLGQRFKSPSLATWLGIFFSGLGFAIAHLNLG  464

Query  426  RMLPLVFLGVLLGTIFVRSRNLLAPMLLHGLWNAYVFLDLM  304
             +LPL  LG++LG I+VRS+NLLAPML+H LWN+  F  L+
Sbjct  465  DILPLTALGMMLGFIYVRSQNLLAPMLMHSLWNSGTFFTLL  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3392847999056