BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21958_g1_i1 len=915 path=[3493:0-81 2321:82-119 3611:120-914]

Length=915
                                                                      Score     E

ref|XP_002516495.1|  phosphofructokinase, putative                      396   6e-132   Ricinus communis
ref|XP_008242459.1|  PREDICTED: 6-phosphofructokinase 6-like            385   1e-127   
gb|AIE47276.1|  phosphofructokinase                                     386   3e-127   
ref|XP_007012200.1|  Phosphofructokinase 3 isoform 2                    379   3e-127   
ref|XP_007203634.1|  hypothetical protein PRUPE_ppa003994mg             385   3e-127   
gb|KDO79935.1|  hypothetical protein CISIN_1g012056mg                   382   4e-127   
gb|AIE47270.1|  phosphofructokinase                                     383   4e-127   
gb|KDO79936.1|  hypothetical protein CISIN_1g012056mg                   382   5e-127   
ref|XP_009388583.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    385   6e-127   
gb|AIE47275.1|  phosphofructokinase                                     385   6e-127   
gb|KDO79934.1|  hypothetical protein CISIN_1g012056mg                   382   7e-127   
ref|XP_009388585.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    383   9e-127   
ref|XP_010086908.1|  6-phosphofructokinase 3                            382   1e-126   
ref|XP_006450746.1|  hypothetical protein CICLE_v10008181mg             382   1e-126   
gb|KHG01593.1|  6-phosphofructokinase 3 -like protein                   381   5e-126   
ref|XP_007012199.1|  Phosphofructokinase 3 isoform 1                    380   2e-125   
ref|XP_008387449.1|  PREDICTED: 6-phosphofructokinase 3-like            381   2e-125   
ref|XP_003526507.1|  PREDICTED: 6-phosphofructokinase 3-like            380   2e-125   
ref|XP_009613574.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   2e-125   
ref|XP_010267094.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   3e-125   
ref|XP_007024343.1|  6-phosphofructokinase 3                            380   3e-125   
ref|XP_011078226.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   3e-125   
ref|XP_009613573.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    380   4e-125   
ref|XP_003522720.1|  PREDICTED: 6-phosphofructokinase 3-like            379   5e-125   
gb|KHG00436.1|  6-phosphofructokinase 3 -like protein                   380   8e-125   
gb|KDP33769.1|  hypothetical protein JCGZ_07340                         380   8e-125   
ref|XP_007223382.1|  hypothetical protein PRUPE_ppa004610mg             378   9e-125   
ref|XP_007012967.1|  6-phosphofructokinase 3                            380   1e-124   
ref|XP_011093663.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   1e-124   
emb|CBI27972.3|  unnamed protein product                                377   1e-124   
gb|KCW79599.1|  hypothetical protein EUGRSUZ_C00956                     377   1e-124   
gb|KCW79598.1|  hypothetical protein EUGRSUZ_C00956                     376   1e-124   
ref|XP_010047648.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   1e-124   
ref|XP_002283274.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   2e-124   Vitis vinifera
ref|XP_002309528.2|  hypothetical protein POPTR_0006s25170g             376   2e-124   Populus trichocarpa [western balsam poplar]
gb|KEH36099.1|  6-phosphofructokinase                                   377   3e-124   
ref|XP_006354082.1|  PREDICTED: 6-phosphofructokinase 3-like            376   3e-124   
ref|XP_009763926.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    376   3e-124   
ref|XP_007215486.1|  hypothetical protein PRUPE_ppa003635mg             379   4e-124   
gb|KHG29071.1|  6-phosphofructokinase 3 -like protein                   377   4e-124   
ref|XP_009763925.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    377   5e-124   
ref|XP_010095449.1|  6-phosphofructokinase 3                            376   5e-124   
ref|XP_008228400.1|  PREDICTED: 6-phosphofructokinase 6-like            377   5e-124   
gb|KDO55888.1|  hypothetical protein CISIN_1g0098042mg                  369   6e-124   
ref|XP_010539385.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    375   7e-124   
ref|XP_002514189.1|  phosphofructokinase, putative                      380   7e-124   Ricinus communis
emb|CAN74837.1|  hypothetical protein VITISV_023326                     375   8e-124   Vitis vinifera
ref|XP_008798601.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    377   9e-124   
gb|AIU64848.1|  6-phosphofructokinase                                   376   1e-123   
ref|XP_002275308.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    375   1e-123   Vitis vinifera
ref|XP_009337916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    374   1e-123   
ref|XP_010244403.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    377   1e-123   
ref|XP_008794086.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    375   1e-123   
ref|XP_010545328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    374   2e-123   
ref|XP_010915352.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    376   2e-123   
ref|XP_004243602.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    374   2e-123   
ref|XP_010925504.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    374   2e-123   
ref|XP_006357682.1|  PREDICTED: 6-phosphofructokinase 3-like            374   2e-123   
ref|XP_008794084.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    376   3e-123   
gb|AIE47274.1|  phosphofructokinase                                     375   4e-123   
ref|XP_004243600.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    374   4e-123   
ref|XP_002515946.1|  phosphofructokinase, putative                      375   5e-123   Ricinus communis
ref|XP_010925503.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    375   9e-123   
ref|XP_010668810.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    373   1e-122   
ref|XP_008375837.1|  PREDICTED: 6-phosphofructokinase 6-like            372   2e-122   
gb|KDP34145.1|  hypothetical protein JCGZ_07716                         371   2e-122   
ref|XP_010051556.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    371   3e-122   
ref|XP_009337913.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    370   3e-122   
ref|XP_004517277.1|  PREDICTED: 6-phosphofructokinase 3-like            372   3e-122   
ref|XP_009344489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    373   4e-122   
ref|XP_008375839.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    371   4e-122   
ref|XP_010049142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    370   6e-122   
ref|XP_008348488.1|  PREDICTED: 6-phosphofructokinase 6-like            372   6e-122   
ref|XP_011019558.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    370   6e-122   
ref|XP_010049141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    371   8e-122   
ref|XP_004287498.1|  PREDICTED: 6-phosphofructokinase 3-like            371   8e-122   
ref|XP_011094240.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    370   8e-122   
gb|AFW80263.1|  hypothetical protein ZEAMMB73_064922                    367   9e-122   
ref|XP_010536840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   1e-121   
ref|XP_006451354.1|  hypothetical protein CICLE_v10007886mg             372   1e-121   
ref|XP_006475360.1|  PREDICTED: 6-phosphofructokinase 3-like            372   1e-121   
ref|XP_010526423.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   2e-121   
ref|XP_003516323.2|  PREDICTED: 6-phosphofructokinase 3-like            370   2e-121   
gb|KHN03217.1|  6-phosphofructokinase 3                                 370   2e-121   
ref|XP_009337914.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   2e-121   
ref|XP_009367416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   2e-121   
ref|XP_008450803.1|  PREDICTED: 6-phosphofructokinase 7-like            369   2e-121   
ref|NP_567742.1|  6-phosphofructokinase 3                               369   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867573.1|  phosphofructokinase family protein                 369   2e-121   
ref|XP_006285534.1|  hypothetical protein CARUB_v10006975mg             369   2e-121   
ref|XP_004135681.1|  PREDICTED: 6-phosphofructokinase 7-like            369   2e-121   
ref|XP_009337906.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    368   4e-121   
ref|XP_004238509.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   5e-121   
ref|XP_008375836.1|  PREDICTED: 6-phosphofructokinase 3-like            368   5e-121   
ref|XP_006413209.1|  hypothetical protein EUTSA_v10025029mg             368   7e-121   
ref|XP_010690141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    367   9e-121   
ref|XP_003620763.1|  6-phosphofructokinase                              368   1e-120   
gb|AFW80264.1|  hypothetical protein ZEAMMB73_064922                    366   2e-120   
ref|XP_003529065.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    368   2e-120   
gb|EYU30678.1|  hypothetical protein MIMGU_mgv1a005513mg                366   2e-120   
ref|XP_006371963.1|  phosphofructokinase family protein                 366   3e-120   
ref|XP_006280374.1|  hypothetical protein CARUB_v10026301mg             366   3e-120   
ref|XP_010438777.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    366   3e-120   
ref|XP_010541000.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    366   3e-120   
ref|XP_008799762.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    367   4e-120   
ref|XP_009409366.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    367   5e-120   
ref|XP_010451330.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    361   5e-120   
ref|XP_004513074.1|  PREDICTED: 6-phosphofructokinase 3-like            365   5e-120   
ref|XP_008654297.1|  PREDICTED: uncharacterized protein LOC100192...    367   6e-120   
ref|XP_010433524.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    365   6e-120   
ref|XP_006656646.1|  PREDICTED: 6-phosphofructokinase 3-like            367   7e-120   
ref|NP_001266546.1|  6-phosphofructokinase 2                            367   7e-120   
ref|XP_009758764.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    365   8e-120   
gb|KEH21328.1|  6-phosphofructokinase                                   361   8e-120   
ref|XP_007152950.1|  hypothetical protein PHAVU_004G173900g             366   9e-120   
ref|XP_004302844.1|  PREDICTED: 6-phosphofructokinase 3-like            365   1e-119   
ref|XP_009787997.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    355   1e-119   
gb|KFK27231.1|  hypothetical protein AALP_AA8G354500                    364   2e-119   
gb|AET05158.2|  6-phosphofructokinase                                   360   2e-119   
emb|CDY32873.1|  BnaC09g33200D                                          364   2e-119   
ref|XP_002457198.1|  hypothetical protein SORBIDRAFT_03g003140          365   2e-119   Sorghum bicolor [broomcorn]
ref|XP_002864472.1|  phosphofructokinase family protein                 364   2e-119   
ref|XP_010540999.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    366   2e-119   
ref|XP_009120176.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    364   2e-119   
ref|XP_003630681.1|  6-phosphofructokinase                              363   3e-119   
emb|CDX94352.1|  BnaC01g18320D                                          363   4e-119   
ref|XP_006342512.1|  PREDICTED: 6-phosphofructokinase 3-like            363   4e-119   
ref|XP_010447334.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   5e-119   
ref|XP_010443317.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    363   5e-119   
ref|XP_010924464.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    363   5e-119   
ref|XP_009603443.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    363   6e-119   
ref|XP_009142127.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    363   6e-119   
ref|XP_006465714.1|  PREDICTED: 6-phosphofructokinase 3-like            364   7e-119   
gb|EYU29302.1|  hypothetical protein MIMGU_mgv1a005820mg                362   7e-119   
ref|XP_011006431.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   7e-119   
ref|XP_010483140.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   8e-119   
ref|XP_011016327.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   1e-118   
gb|EMT19126.1|  6-phosphofructokinase 3                                 363   1e-118   
tpg|DAA53035.1|  TPA: hypothetical protein ZEAMMB73_174506              358   1e-118   
gb|EMS52572.1|  6-phosphofructokinase 3                                 363   1e-118   
ref|XP_006401301.1|  hypothetical protein EUTSA_v10013372mg             362   1e-118   
ref|XP_002309230.2|  hypothetical protein POPTR_0006s15730g             364   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011072633.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    360   2e-118   
ref|XP_009387228.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    363   2e-118   
ref|XP_004253102.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    361   2e-118   
ref|XP_009602786.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   2e-118   
ref|XP_010451175.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    360   2e-118   
gb|AGT16840.1|  6-phosphofructokinase                                   362   2e-118   
dbj|BAJ85701.1|  predicted protein                                      362   3e-118   
ref|XP_004964832.1|  PREDICTED: 6-phosphofructokinase 7-like            363   3e-118   
emb|CDP03227.1|  unnamed protein product                                361   3e-118   
ref|XP_006412865.1|  hypothetical protein EUTSA_v10024824mg             360   4e-118   
gb|KDO51846.1|  hypothetical protein CISIN_1g009394mg                   362   4e-118   
ref|XP_009128951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    360   5e-118   
emb|CDM81680.1|  unnamed protein product                                362   6e-118   
ref|XP_006426847.1|  hypothetical protein CICLE_v10025255mg             363   7e-118   
ref|XP_010432655.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    359   7e-118   
gb|AHB32113.1|  6-phosphofructokinase 3-like protein                    360   9e-118   
ref|XP_004968501.1|  PREDICTED: 6-phosphofructokinase 3-like            361   9e-118   
ref|XP_008648820.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   9e-118   
emb|CDY69051.1|  BnaAnng29210D                                          359   9e-118   
emb|CDX88580.1|  BnaA03g10690D                                          360   1e-117   
ref|NP_001042273.1|  Os01g0191700                                       361   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006355296.1|  PREDICTED: 6-phosphofructokinase 3-like            360   1e-117   
dbj|BAJ85856.1|  predicted protein                                      361   1e-117   
emb|CDY11911.1|  BnaC03g13370D                                          359   1e-117   
ref|XP_009395732.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    360   1e-117   
gb|EAZ10866.1|  hypothetical protein OsJ_00706                          360   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437847.1|  hypothetical protein SORBIDRAFT_10g003650          361   1e-117   Sorghum bicolor [broomcorn]
ref|XP_011007273.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   2e-117   
ref|XP_009132191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    359   2e-117   
ref|XP_006853746.1|  hypothetical protein AMTR_s00056p00183670          358   2e-117   
emb|CDX68896.1|  BnaC01g05570D                                          358   2e-117   
gb|KDP40841.1|  hypothetical protein JCGZ_24840                         360   3e-117   
ref|NP_001147976.1|  6-phosphofructokinase 2                            360   3e-117   Zea mays [maize]
ref|XP_004503509.1|  PREDICTED: 6-phosphofructokinase 3-like            358   3e-117   
ref|XP_006412426.1|  hypothetical protein EUTSA_v10025143mg             357   3e-117   
ref|XP_006412864.1|  hypothetical protein EUTSA_v10024824mg             360   3e-117   
ref|NP_001241814.1|  6-phosphofructokinase 2                            359   4e-117   
ref|XP_010914787.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    360   4e-117   
emb|CDY20715.1|  BnaA02g08550D                                          358   4e-117   
ref|XP_010447333.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    357   4e-117   
ref|XP_009126929.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    358   5e-117   
ref|XP_003564709.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    359   6e-117   
ref|XP_004245136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    358   6e-117   
emb|CDP08198.1|  unnamed protein product                                357   7e-117   
ref|XP_009125389.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    357   7e-117   
gb|EYU20400.1|  hypothetical protein MIMGU_mgv1a005493mg                356   1e-116   
ref|NP_568842.1|  6-phosphofructokinase 7                               356   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006643863.1|  PREDICTED: 6-phosphofructokinase 3-like            358   2e-116   
gb|KFK29896.1|  hypothetical protein AALP_AA7G192500                    355   2e-116   
gb|EYU20401.1|  hypothetical protein MIMGU_mgv1a005493mg                356   3e-116   
ref|NP_195010.1|  6-phosphofructokinase 6                               355   3e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14248.1|  unnamed protein product                                348   3e-116   
gb|AAM65566.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    355   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395051.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    357   3e-116   
ref|XP_009395050.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    357   4e-116   
ref|XP_010437846.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    354   4e-116   
tpg|DAA57728.1|  TPA: hypothetical protein ZEAMMB73_790705              352   6e-116   
ref|XP_003564328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    357   6e-116   
ref|XP_006285234.1|  hypothetical protein CARUB_v10006594mg             354   9e-116   
emb|CDX75291.1|  BnaA01g04110D                                          353   1e-115   
gb|ACL53548.1|  unknown                                                 355   2e-115   Zea mays [maize]
ref|XP_010526087.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    352   2e-115   
ref|XP_002867225.1|  phosphofructokinase family protein                 352   3e-115   
emb|CDY41800.1|  BnaC02g12110D                                          353   3e-115   
ref|XP_009337910.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    353   3e-115   
ref|NP_001151911.1|  6-phosphofructokinase                              355   3e-115   Zea mays [maize]
gb|AFW85828.1|  hypothetical protein ZEAMMB73_244047                    355   4e-115   
emb|CDY06829.1|  BnaC01g09280D                                          352   6e-115   
ref|XP_006583042.1|  PREDICTED: 6-phosphofructokinase 3-like            351   8e-115   
ref|XP_010047299.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    351   1e-114   
ref|XP_011081730.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    352   1e-114   
dbj|BAB09881.1|  pyrophosphate-dependent phosphofructo-1-kinase-l...    352   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010047298.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    351   2e-114   
dbj|BAK01448.1|  predicted protein                                      350   4e-114   
gb|KHN39263.1|  6-phosphofructokinase 3                                 350   4e-114   
ref|XP_007150587.1|  hypothetical protein PHAVU_005G165100g             350   4e-114   
ref|XP_010433122.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    349   6e-114   
ref|XP_002867420.1|  phosphofructokinase family protein                 349   9e-114   
ref|XP_002458460.1|  hypothetical protein SORBIDRAFT_03g034060          352   9e-114   Sorghum bicolor [broomcorn]
ref|XP_007137259.1|  hypothetical protein PHAVU_009G112400g             339   1e-113   
ref|NP_001147854.1|  6-phosphofructokinase                              352   1e-113   Zea mays [maize]
gb|ACR36601.1|  unknown                                                 352   1e-113   Zea mays [maize]
ref|XP_010438324.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    348   1e-113   
ref|XP_006283577.1|  hypothetical protein CARUB_v10004629mg             349   1e-113   
ref|NP_194651.1|  6-phosphofructokinase 1                               348   2e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91591.1|  pyrophosphate-dependent phosphofructo-1-kinase-li...    348   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433121.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    350   3e-113   
ref|XP_003543617.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    348   3e-113   
ref|XP_008447566.1|  PREDICTED: 6-phosphofructokinase 6-like            349   4e-113   
ref|XP_010438323.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    349   7e-113   
ref|XP_003568068.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    349   7e-113   
ref|XP_010447879.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    346   1e-112   
ref|XP_003546601.1|  PREDICTED: 6-phosphofructokinase 3 isoform X1      346   2e-112   
gb|EMT10635.1|  6-phosphofructokinase 3                                 349   2e-112   
ref|XP_010688378.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    345   4e-112   
ref|XP_008672829.1|  PREDICTED: 6-phosphofructokinase isoform X2        353   4e-112   
ref|XP_008672828.1|  PREDICTED: 6-phosphofructokinase isoform X1        353   4e-112   
ref|XP_004158491.1|  PREDICTED: 6-phosphofructokinase 3-like            346   5e-112   
ref|XP_004149188.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    346   5e-112   
ref|XP_009337911.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    345   6e-112   
gb|KDO40000.1|  hypothetical protein CISIN_1g0094442mg                  339   7e-112   
gb|KGN58020.1|  hypothetical protein Csa_3G435010                       346   7e-112   
ref|XP_010275416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    346   8e-112   
gb|KDO39999.1|  hypothetical protein CISIN_1g0094442mg                  339   1e-111   
ref|XP_007012201.1|  Phosphofructokinase 3 isoform 3                    344   1e-111   
gb|KCW90881.1|  hypothetical protein EUGRSUZ_A02923                     341   1e-111   
ref|XP_004309023.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    345   2e-111   
gb|KCW90882.1|  hypothetical protein EUGRSUZ_A02923                     341   2e-111   
ref|XP_007135617.1|  hypothetical protein PHAVU_010G143900g             345   3e-111   
ref|NP_001056090.1|  Os05g0524400                                       345   3e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64418.1|  hypothetical protein OsJ_19262                          345   3e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961440.1|  PREDICTED: 6-phosphofructokinase 7-like            345   4e-111   
dbj|BAD86939.1|  putative pyrophosphate-dependent phosphofructo-1...    345   4e-111   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17197.1|  unknown                                                 346   5e-111   Picea sitchensis
ref|XP_010062614.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    343   6e-111   
gb|KCW90880.1|  hypothetical protein EUGRSUZ_A02923                     342   8e-111   
gb|AFK34847.1|  unknown                                                 332   8e-111   
ref|XP_009337915.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    340   9e-111   
gb|KEH39542.1|  6-phosphofructokinase                                   338   9e-111   
ref|XP_003533035.1|  PREDICTED: 6-phosphofructokinase 3-like            341   9e-111   
ref|XP_002440110.1|  hypothetical protein SORBIDRAFT_09g026150          344   1e-110   Sorghum bicolor [broomcorn]
ref|XP_003597663.1|  6-phosphofructokinase                              340   2e-110   
gb|EEC79555.1|  hypothetical protein OsI_20679                          343   3e-110   Oryza sativa Indica Group [Indian rice]
gb|ABD96051.1|  putative phosphofructokinase                            341   3e-110   Spinacia oleracea
gb|KHN05322.1|  6-phosphofructokinase 3                                 339   4e-110   
ref|XP_008649908.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    343   4e-110   
gb|KCW90879.1|  hypothetical protein EUGRSUZ_A02923                     341   4e-110   
ref|XP_008375838.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    340   5e-110   
ref|XP_006654672.1|  PREDICTED: 6-phosphofructokinase 3-like            342   6e-110   
ref|XP_008375840.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    339   6e-110   
ref|XP_006421534.1|  hypothetical protein CICLE_v10004702mg             341   6e-110   
dbj|BAK02245.1|  predicted protein                                      342   8e-110   
ref|XP_006644676.1|  PREDICTED: 6-phosphofructokinase 7-like            342   8e-110   
gb|EAZ13474.1|  hypothetical protein OsJ_03390                          347   1e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006490011.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    340   2e-109   
ref|XP_003569758.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    347   2e-109   
gb|KHG19950.1|  6-phosphofructokinase 4, chloroplastic -like protein    339   2e-109   
ref|XP_007038279.1|  Phosphofructokinase 4                              339   3e-109   
gb|KHN40360.1|  6-phosphofructokinase 3                                 340   3e-109   
ref|XP_011091507.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    337   4e-109   
ref|XP_003524412.1|  PREDICTED: 6-phosphofructokinase 7-like            337   7e-109   
ref|XP_006837361.1|  hypothetical protein AMTR_s00111p00106690          338   2e-108   
gb|KHM99825.1|  6-phosphofructokinase 3                                 335   2e-108   
ref|XP_003532467.1|  PREDICTED: 6-phosphofructokinase 3-like            335   2e-108   
ref|XP_006394490.1|  hypothetical protein EUTSA_v10003971mg             337   2e-108   
ref|XP_002439415.1|  hypothetical protein SORBIDRAFT_09g006030          337   2e-108   
ref|XP_007160266.1|  hypothetical protein PHAVU_002G306800g             335   3e-108   
gb|AAT38069.1|  putative pyrophosphate-fructose-6-phosphate-1-pho...    337   3e-108   
ref|XP_004960908.1|  PREDICTED: 6-phosphofructokinase 3-like            337   3e-108   
gb|EAY96852.1|  hypothetical protein OsI_18773                          337   3e-108   
gb|KHN16662.1|  6-phosphofructokinase 3                                 335   3e-108   
ref|XP_011022362.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    335   6e-108   
ref|XP_006654136.1|  PREDICTED: 6-phosphofructokinase 3-like            336   8e-108   
ref|XP_006385829.1|  hypothetical protein POPTR_0003s15090g             335   9e-108   
gb|EMS48156.1|  6-phosphofructokinase 3                                 342   1e-107   
ref|XP_008649450.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    335   2e-107   
ref|NP_001148080.1|  6-phosphofructokinase 2                            335   2e-107   
gb|ACN34221.1|  unknown                                                 334   3e-107   
ref|XP_010662252.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    330   4e-107   
emb|CDY02131.1|  BnaA03g40360D                                          334   4e-107   
emb|CDY23054.1|  BnaC07g31330D                                          334   4e-107   
ref|XP_010662251.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    330   4e-107   
gb|AIE47272.1|  phosphofructokinase                                     333   4e-107   
ref|XP_009136495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    333   7e-107   
ref|XP_010443983.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    333   9e-107   
ref|XP_007144192.1|  hypothetical protein PHAVU_007G136000g             329   1e-106   
ref|XP_004146902.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    332   1e-106   
ref|XP_002511010.1|  phosphofructokinase, putative                      332   1e-106   
ref|NP_200966.2|  6-phosphofructokinase 4                               332   2e-106   
ref|NP_001032120.1|  6-phosphofructokinase 4                            332   2e-106   
gb|KFK27910.1|  hypothetical protein AALP_AA8G446100                    332   2e-106   
ref|XP_002864742.1|  phosphofructokinase family protein                 332   2e-106   
ref|XP_010457508.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    332   2e-106   
ref|XP_002282309.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    332   3e-106   
ref|XP_010546132.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    331   4e-106   
ref|XP_010546134.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    331   4e-106   
ref|XP_008351450.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    323   5e-106   
ref|XP_007144193.1|  hypothetical protein PHAVU_007G136000g             330   5e-106   
ref|XP_008453872.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    330   8e-106   
ref|XP_010483840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    330   1e-105   
gb|KDP22466.1|  hypothetical protein JCGZ_26297                         330   2e-105   
ref|XP_002463719.1|  hypothetical protein SORBIDRAFT_01g004810          330   2e-105   
ref|XP_004494953.1|  PREDICTED: 6-phosphofructokinase 3-like            330   4e-105   
ref|XP_011076434.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    328   6e-105   
gb|ACO35359.1|  phosphofructokinase                                     317   6e-105   
ref|XP_006412866.1|  hypothetical protein EUTSA_v10024824mg             324   1e-104   
gb|EYU20177.1|  hypothetical protein MIMGU_mgv1a004503mg                327   2e-104   
ref|XP_008375682.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    327   2e-104   
emb|CDP05378.1|  unnamed protein product                                326   5e-104   
ref|XP_007219544.1|  hypothetical protein PRUPE_ppa003986mg             325   8e-104   
ref|XP_008234443.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    325   1e-103   
ref|XP_003591658.1|  6-phosphofructokinase                              325   2e-103   
ref|XP_003536274.2|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    324   2e-103   
ref|XP_009362710.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    324   3e-103   
ref|XP_004496087.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    323   5e-103   
gb|KHN37911.1|  6-phosphofructokinase 4, chloroplastic                  323   6e-103   
gb|EAZ35851.1|  hypothetical protein OsJ_20149                          322   1e-102   
ref|XP_003566456.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    322   1e-102   
gb|EAY99719.1|  hypothetical protein OsI_21704                          322   1e-102   
dbj|BAD69330.1|  putative pyrophosphate-dependent phosphofructo-1...    322   2e-102   
ref|XP_009588737.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    322   2e-102   
ref|XP_006358222.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    322   2e-102   
ref|XP_004235183.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    320   2e-101   
ref|XP_009804348.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    319   3e-101   
ref|XP_006280423.1|  hypothetical protein CARUB_v10026356mg             317   3e-101   
ref|XP_003637099.1|  6-phosphofructokinase                              318   9e-101   
ref|XP_010668815.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    316   1e-100   
ref|XP_001770890.1|  predicted protein                                  315   4e-100   
ref|XP_002977595.1|  hypothetical protein SELMODRAFT_176350             314   1e-99    
gb|EPS73018.1|  hypothetical protein M569_01738                         310   1e-99    
ref|XP_002975191.1|  hypothetical protein SELMODRAFT_150344             314   1e-99    
gb|AFW75541.1|  hypothetical protein ZEAMMB73_660971                    314   1e-99    
gb|EEC71448.1|  hypothetical protein OsI_03669                          314   3e-98    
ref|XP_001766110.1|  predicted protein                                  308   8e-98    
ref|XP_001782327.1|  predicted protein                                  306   2e-96    
ref|XP_010094794.1|  6-phosphofructokinase 4                            298   7e-95    
gb|EMS54289.1|  6-phosphofructokinase 3                                 301   7e-95    
gb|AEQ94164.1|  6-phosphofructokinase                                   290   3e-93    
gb|KGN58018.1|  hypothetical protein Csa_3G434990                       293   4e-92    
ref|XP_004149187.1|  PREDICTED: 6-phosphofructokinase 3-like            294   7e-92    
ref|XP_001780597.1|  predicted protein                                  292   2e-91    
gb|KCW90883.1|  hypothetical protein EUGRSUZ_A02923                     290   2e-91    
ref|XP_008354543.1|  PREDICTED: 6-phosphofructokinase 3-like            291   2e-91    
emb|CAB38956.1|  pyrophosphate-dependent phosphofructo-1-kinase         287   2e-89    
ref|XP_001764541.1|  predicted protein                                  286   3e-89    
gb|ACN31923.1|  unknown                                                 287   5e-89    
ref|XP_010275417.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    286   7e-89    
ref|XP_008453875.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    278   2e-86    
ref|XP_006451355.1|  hypothetical protein CICLE_v10007886mg             278   2e-86    
ref|XP_006583562.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    276   7e-86    
ref|XP_008447679.1|  PREDICTED: 6-phosphofructokinase 6-like            270   9e-83    
gb|EPS62819.1|  hypothetical protein M569_11969                         258   3e-79    
gb|KCW90878.1|  hypothetical protein EUGRSUZ_A02923                     242   2e-72    
ref|XP_006451353.1|  hypothetical protein CICLE_v10007886mg             237   4e-70    
ref|XP_010096496.1|  6-phosphofructokinase 2                            233   5e-69    
ref|XP_004134815.1|  PREDICTED: 6-phosphofructokinase 2-like            232   9e-69    
ref|XP_008440953.1|  PREDICTED: 6-phosphofructokinase 2                 231   2e-68    
gb|KCW69691.1|  hypothetical protein EUGRSUZ_F03086                     229   7e-68    
ref|XP_002963124.1|  hypothetical protein SELMODRAFT_438337             229   1e-67    
ref|XP_002980196.1|  hypothetical protein SELMODRAFT_178124             228   6e-67    
gb|KDP35553.1|  hypothetical protein JCGZ_08991                         228   8e-67    
ref|XP_006373566.1|  hypothetical protein POPTR_0016s00450g             227   1e-66    
ref|XP_011040110.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    227   1e-66    
ref|XP_010246561.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    226   4e-66    
gb|EPS70355.1|  hypothetical protein M569_04403                         223   3e-65    
gb|EYU27630.1|  hypothetical protein MIMGU_mgv1a005772mg                223   5e-65    
ref|XP_010928044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    223   5e-65    
ref|XP_010098164.1|  6-phosphofructokinase 4                            219   2e-64    
gb|AGY61459.1|  phosphofructokinase 6                                   215   2e-64    
gb|AGY61460.1|  phosphofructokinase 6                                   214   2e-64    
ref|XP_009779364.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    220   3e-64    
gb|AIE47271.1|  phosphofructokinase                                     220   5e-64    
ref|XP_007026417.1|  Phosphofructokinase 2                              219   1e-63    
ref|XP_004293419.1|  PREDICTED: 6-phosphofructokinase 2-like            219   1e-63    
ref|XP_009617768.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    220   2e-63    
gb|KHG28031.1|  6-phosphofructokinase 2 -like protein                   219   2e-63    
emb|CDP04555.1|  unnamed protein product                                219   4e-63    
ref|XP_010052498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    217   1e-62    
ref|XP_002525025.1|  phosphofructokinase, putative                      218   2e-62    
ref|XP_004236642.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    215   2e-62    
ref|XP_006350241.1|  PREDICTED: 6-phosphofructokinase 2-like            214   5e-62    
ref|XP_008779034.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    214   8e-62    
ref|XP_003637592.1|  6-phosphofructokinase                              214   1e-61    
ref|XP_007154072.1|  hypothetical protein PHAVU_003G088700g             213   2e-61    
ref|XP_010942916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    213   5e-61    
ref|XP_008779196.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    212   6e-61    
ref|XP_008464192.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    207   6e-61    
ref|XP_003635479.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    211   1e-60    
ref|XP_006857658.1|  hypothetical protein AMTR_s00061p00151020          210   3e-60    
gb|KFK31346.1|  hypothetical protein AALP_AA6G100300                    209   4e-60    
ref|XP_004499341.1|  PREDICTED: 6-phosphofructokinase 2-like            208   1e-59    
ref|XP_006467226.1|  PREDICTED: 6-phosphofructokinase 2-like            208   2e-59    
ref|XP_006398483.1|  hypothetical protein EUTSA_v10000886mg             207   2e-59    
ref|XP_009418212.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    207   4e-59    
ref|XP_005702907.1|  6-phosphofructokinase                              207   7e-59    
emb|CDY17703.1|  BnaA06g35220D                                          206   8e-59    
ref|XP_009101383.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   8e-59    
gb|KDO78652.1|  hypothetical protein CISIN_1g042534mg                   205   2e-58    
gb|ABR17567.1|  unknown                                                 201   2e-58    
emb|CDX77799.1|  BnaC07g20530D                                          205   2e-58    
ref|XP_006584114.1|  PREDICTED: 6-phosphofructokinase 2-like            204   6e-58    
ref|XP_006449986.1|  hypothetical protein CICLE_v10015031mg             204   9e-58    
ref|XP_010426370.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   1e-57    
ref|XP_010503512.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   1e-57    
ref|XP_009401489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   1e-57    
ref|XP_010530089.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   3e-57    
ref|XP_010683074.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   3e-57    
ref|XP_006291021.1|  hypothetical protein CARUB_v10017134mg             202   4e-57    
ref|XP_010515191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   5e-57    
ref|XP_005537083.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    197   1e-54    
ref|XP_005710269.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    195   6e-54    
ref|NP_199592.1|  6-phosphofructokinase 2                               193   6e-54    
ref|XP_011096141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    190   4e-53    
ref|XP_005707027.1|  6-phosphofructokinase isoform 1                    192   6e-53    
ref|XP_005707028.1|  6-phosphofructokinase isoform 2                    192   7e-53    
ref|XP_004496088.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    188   4e-52    
ref|XP_009349890.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    188   2e-51    
dbj|BAK02022.1|  predicted protein                                      186   4e-51    
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2                 188   5e-51    
ref|XP_003579939.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    184   3e-50    
ref|XP_005536329.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    182   1e-49    
ref|XP_004975916.1|  PREDICTED: 6-phosphofructokinase 2-like            182   1e-49    
emb|CAH67040.1|  OSIGBa0124N08.2                                        182   1e-49    
ref|NP_001063482.1|  Os09g0479800                                       181   4e-49    
gb|EEE69916.1|  hypothetical protein OsJ_29767                          180   8e-49    
gb|ACN41013.1|  unknown                                                 179   1e-48    
emb|CDY32769.1|  BnaA10g10800D                                          177   1e-48    
gb|AFW80260.1|  hypothetical protein ZEAMMB73_064922                    174   9e-48    
ref|XP_008795495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    173   1e-47    
gb|EEC84763.1|  hypothetical protein OsI_31779                          182   1e-47    
ref|XP_002448010.1|  hypothetical protein SORBIDRAFT_06g019610          177   1e-47    
gb|AFW80261.1|  hypothetical protein ZEAMMB73_064922                    174   2e-47    
gb|EMS55719.1|  6-phosphofructokinase 3                                 166   3e-47    
ref|XP_010924465.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    173   4e-47    
ref|XP_006653509.1|  PREDICTED: 6-phosphofructokinase 2-like            173   5e-47    
ref|XP_008795493.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    173   5e-47    
ref|NP_001130878.1|  uncharacterized protein LOC100191982               175   7e-47    
ref|WP_013304604.1|  diphosphate--fructose-6-phosphate 1-phosphot...    174   9e-47    
ref|NP_001131170.1|  uncharacterized protein LOC100192478               170   2e-46    
ref|XP_003630682.1|  6-phosphofructokinase                              171   2e-46    
gb|EJK60281.1|  hypothetical protein THAOC_19395                        173   4e-46    
ref|WP_028975410.1|  diphosphate--fructose-6-phosphate 1-phosphot...    170   3e-45    
gb|EJY73029.1|  Phosphofructokinase family protein                      172   3e-45    
gb|KDO28337.1|  hypothetical protein SPRG_06576                         171   4e-45    
ref|XP_005838965.1|  hypothetical protein GUITHDRAFT_84956              169   5e-45    
ref|XP_009599322.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   5e-45    
ref|XP_004250136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   5e-45    
ref|XP_006353187.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   6e-45    
gb|EJK66263.1|  hypothetical protein THAOC_12829                        172   7e-45    
emb|CCI46577.1|  unnamed protein product                                170   7e-45    
emb|CDP01541.1|  unnamed protein product                                170   7e-45    
ref|XP_008620150.1|  hypothetical protein SDRG_15746                    169   1e-44    
gb|AIE16182.1|  chloroplast 6-phosphofructokinase 4                     169   1e-44    
ref|XP_009785216.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    169   2e-44    
emb|CBK23558.2|  unnamed protein product                                168   2e-44    
ref|XP_006346747.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    168   6e-44    
ref|WP_013967663.1|  diphosphate--fructose-6-phosphate 1-phosphot...    166   6e-44    
ref|NP_001053045.1|  Os04g0469500                                       167   7e-44    
ref|XP_011100012.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    167   7e-44    
ref|WP_015752539.1|  diphosphate--fructose-6-phosphate 1-phosphot...    166   7e-44    
emb|CDW89434.1|  6-phosphofructokinase 3-like                           168   8e-44    
ref|XP_010107299.1|  6-phosphofructokinase 5                            167   8e-44    
ref|WP_020473405.1|  diphosphate--fructose-6-phosphate 1-phosphot...    166   9e-44    
ref|XP_008864895.1|  hypothetical protein H310_02965                    167   1e-43    
ref|WP_037545925.1|  diphosphate--fructose-6-phosphate 1-phosphot...    166   1e-43    
gb|KHN20613.1|  6-phosphofructokinase 5, chloroplastic                  167   1e-43    
ref|WP_024266600.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    166   1e-43    
ref|XP_004236699.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    167   1e-43    
ref|WP_021329293.1|  phosphofructokinase                                166   1e-43    
ref|WP_020528022.1|  hypothetical protein                               165   1e-43    
ref|WP_021495388.1|  phosphofructokinase                                166   1e-43    
ref|XP_001444382.1|  hypothetical protein                               167   2e-43    
ref|WP_016521029.1|  hypothetical protein                               166   2e-43    
ref|WP_010039572.1|  diphosphate--fructose-6-phosphate 1-phosphot...    165   2e-43    
gb|ACU17995.1|  unknown                                                 157   2e-43    
ref|WP_013757650.1|  diphosphate--fructose-6-phosphate 1-phosphot...    165   2e-43    
emb|CCA20233.1|  unnamed protein product                                166   3e-43    
gb|AHH08694.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    164   3e-43    



>ref|XP_002516495.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF45836.1| phosphofructokinase, putative [Ricinus communis]
Length=485

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MG+    +Q ++MK VNG+ GY+LEDVPHL+DY+P+LPTYPNPLQDNP+YS VKQYFV+V
Sbjct  1    MGNADGNLQSQMMKIVNGEAGYLLEDVPHLTDYIPDLPTYPNPLQDNPAYSAVKQYFVNV  60

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTVAQK+VV KD PRGTHFRRAGPRQKVYFKSDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  61   DDTVAQKIVVHKDGPRGTHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCG  120

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LHHMYGV KV+GIDGGY+GFYSKN V LTPKVVNDIHKRGGTILGTSRGGHD  KIVD I
Sbjct  121  LHHMYGVTKVLGIDGGYRGFYSKNTVALTPKVVNDIHKRGGTILGTSRGGHDKSKIVDSI  180

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GA+VI+EEI+RRGL+VAVAGIPKTI
Sbjct  181  QDRGINQVYIIGGDGTQKGAAVIYEEIQRRGLKVAVAGIPKTI  223



>ref|XP_008242459.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=487

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -1

Query  648  VQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQK  469
            ++ K  K V GD GYVLEDVPH SDY+P+LPTYPNPLQDNP+YSVVKQYFV+VDDTVAQK
Sbjct  1    MEKKPQKVVVGDAGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQK  60

Query  468  VVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGV  289
            +VV  +SPRGTHFRRAGPRQKVYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGLHHMYGV
Sbjct  61   IVVHNNSPRGTHFRRAGPRQKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGV  120

Query  288  KKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQ  109
            KKV+GIDGGY+GFYS+N + LTPK VNDIHKRGGTILGTSRGGH+T KIVD IQDRGINQ
Sbjct  121  KKVLGIDGGYRGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHNTSKIVDSIQDRGINQ  180

Query  108  VYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            VYIIGGDGTQ+GASVI+EEIKRRGL+V VAGIPKTI
Sbjct  181  VYIIGGDGTQKGASVIYEEIKRRGLKVVVAGIPKTI  216



>gb|AIE47276.1| phosphofructokinase [Hevea brasiliensis]
Length=563

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNGD GYVLEDVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV VDDTV QK+VV KD
Sbjct  76   KIVNGDFGYVLEDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHVDDTVPQKIVVHKD  135

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCGLHHMYGVK+V+GI
Sbjct  136  GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLHHMYGVKRVLGI  195

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  196  DGGYRGFYARNTINLTPKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  255

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  256  DGTQKGASVIFEEIRRRGLKVAVAGIPKTI  285



>ref|XP_007012200.1| Phosphofructokinase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY29819.1| Phosphofructokinase 3 isoform 2, partial [Theobroma cacao]
Length=359

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  9    MKLVAGAAGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSVVKQYFVNEDDTVTQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV+K++G
Sbjct  69   DSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN V LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYAKNTVTLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTQRGAAVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_007203634.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
 gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
Length=536

 Score =   385 bits (990),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -1

Query  648  VQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQK  469
            ++ K  K V GD GYVLEDVPH SDY+P+LPTYPNPLQDNP+YSVVKQYFV+VDDTVAQK
Sbjct  50   MENKPHKVVVGDAGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQK  109

Query  468  VVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGV  289
            +VV  +SPRGTHFRRAGPRQKVYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGLHHMYGV
Sbjct  110  IVVHNNSPRGTHFRRAGPRQKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGV  169

Query  288  KKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQ  109
            KKV+GIDGGY+GFYS+N + LTPK VNDIHKRGGTILGTSRGGH+T KIVD IQDRGINQ
Sbjct  170  KKVLGIDGGYRGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHNTSKIVDSIQDRGINQ  229

Query  108  VYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            VYIIGGDGTQ+GASVI+EEIKRRGL+V VAGIPKTI
Sbjct  230  VYIIGGDGTQKGASVIYEEIKRRGLKVVVAGIPKTI  265



>gb|KDO79935.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=441

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K VNGD GYVLEDVPHL+DY+P+LPTYPNPLQ N +YSVVKQYFV+VDDTV+QK+VV K
Sbjct  9    LKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVSQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV K++G
Sbjct  69   DSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRQRGLKVAVAGIPKTI  219



>gb|AIE47270.1| phosphofructokinase [Hevea brasiliensis]
Length=475

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK  NGD GYVLEDVPHL+DY+P+LPTY NPLQDNPSYS VKQYFV++DDTV+QK+VV K
Sbjct  9    MKLANGDSGYVLEDVPHLTDYIPDLPTYTNPLQDNPSYSAVKQYFVNMDDTVSQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            + PRGTHFRRAGPRQKVYFKSDEV ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+G
Sbjct  69   NGPRGTHFRRAGPRQKVYFKSDEVYACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + +TPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTISMTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIQRRGLKVAVAGIPKTI  219



>gb|KDO79936.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=458

 Score =   382 bits (982),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K VNGD GYVLEDVPHL+DY+P+LPTYPNPLQ N +YSVVKQYFV+VDDTV+QK+VV K
Sbjct  9    LKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVSQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV K++G
Sbjct  69   DSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRQRGLKVAVAGIPKTI  219



>ref|XP_009388583.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/224 (82%), Positives = 206/224 (92%), Gaps = 3/224 (1%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            RMGSEG    PK+   V GD GYVLEDVPHL+DY+P+LPTYPNPLQ+NP+YSVVKQYFV+
Sbjct  50   RMGSEGKTAPPKV---VCGDAGYVLEDVPHLADYLPDLPTYPNPLQNNPAYSVVKQYFVN  106

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
             DDTVAQK+VV KDSPRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  107  ADDTVAQKIVVHKDSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVC  166

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL+ MYGV+K++GIDGGY+GFYS N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD 
Sbjct  167  GLYDMYGVRKIIGIDGGYRGFYSCNTIDLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDS  226

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            I+DRG+NQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  227  IEDRGVNQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  270



>gb|AIE47275.1| phosphofructokinase [Hevea brasiliensis]
Length=551

 Score =   385 bits (990),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNGD GYVLEDVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  64   KIVNGDYGYVLEDVPHLTDYLPDLPTYSNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+V+GI
Sbjct  124  SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  184  DGGYRGFYARNTISLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  244  DGTQKGASVIFEEIRRRGLKVAVAGIPKTI  273



>gb|KDO79934.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=472

 Score =   382 bits (982),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K VNGD GYVLEDVPHL+DY+P+LPTYPNPLQ N +YSVVKQYFV+VDDTV+QK+VV K
Sbjct  9    LKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVSQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV K++G
Sbjct  69   DSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRQRGLKVAVAGIPKTI  219



>ref|XP_009388585.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 205/223 (92%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGSEG    PK+   V GD GYVLEDVPHL+DY+P+LPTYPNPLQ+NP+YSVVKQYFV+ 
Sbjct  1    MGSEGKTAPPKV---VCGDAGYVLEDVPHLADYLPDLPTYPNPLQNNPAYSVVKQYFVNA  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTVAQK+VV KDSPRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVAQKIVVHKDSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L+ MYGV+K++GIDGGY+GFYS N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LYDMYGVRKIIGIDGGYRGFYSCNTIDLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            +DRG+NQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  178  EDRGVNQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  220



>ref|XP_010086908.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=485

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFVD DDT+ QK+VV K+
Sbjct  4    KIVTGEAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVDDDDTITQKIVVHKN  63

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            +PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGVK+V+GI
Sbjct  64   TPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVKRVLGI  123

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  124  DGGYRGFYAKNTISLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  183

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEE+KRRGL+VAVAGIPKTI
Sbjct  184  DGTQRGASVIFEEVKRRGLKVAVAGIPKTI  213



>ref|XP_006450746.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
 gb|ESR63986.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
Length=472

 Score =   382 bits (980),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K VNGD GYVLEDVPHL+DY+P+LPTYPNPLQ N +YSVVKQYFV+VDD+V+QK+VV K
Sbjct  9    LKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDSVSQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV K++G
Sbjct  69   DSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRQRGLKVAVAGIPKTI  219



>gb|KHG01593.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
 gb|KHG02572.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=490

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK   G+ GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YS VKQYFV+ DDTV QK+VV K
Sbjct  9    MKLATGEGGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSAVKQYFVNDDDTVTQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVKK++G
Sbjct  69   DSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYI+G
Sbjct  129  IDGGYRGFYSKNTITLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYILG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTQRGAAVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_007012199.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
 gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
Length=490

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  9    MKLVAGAAGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSVVKQYFVNEDDTVTQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV+K++G
Sbjct  69   DSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN V LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYAKNTVTLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTQRGAAVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_008387449.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
 ref|XP_008344002.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=538

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPH SDY+P+LPTYPNPLQDNP+YSVVKQYFV+VDDTVAQK+VV  +
Sbjct  57   KVVVGTGGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIVVHNN  116

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGLHHMYGVK+V+GI
Sbjct  117  SPRGTHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKRVLGI  176

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFYS+N + LTPK VNDIHKRGGTILGTSRGGH+T KIVD IQDRGINQVYIIGG
Sbjct  177  DGGYRGFYSRNTIPLTPKTVNDIHKRGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  236

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EEIKRRGL+VAVAGIPKTI
Sbjct  237  DGTQKGASVIYEEIKRRGLKVAVAGIPKTI  266



>ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN18140.1| 6-phosphofructokinase 3 [Glycine soja]
Length=507

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V+GD GY+LEDVPH +DY+PNLPTYPNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  10   MKIVHGDAGYILEDVPHFADYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYFKSDEV+ACIVTCGGLCPGLNTVIREIVCGL +MYGV KV+G
Sbjct  70   DSPRGVHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGLSYMYGVNKVLG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  130  IDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VI+EE++RRGL+VA+AGIPKTI
Sbjct  190  GDGTQRGATVIYEEVRRRGLKVAIAGIPKTI  220



>ref|XP_009613574.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009613575.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=491

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            Q +  K V GD GYVLEDVPHLSDY+PNLPTYPNP+QDNPSYSVVKQYFVD DDTVAQK+
Sbjct  8    QQQKQKIVTGDGGYVLEDVPHLSDYIPNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKI  67

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGPRQKVYF  ++V+ACIVTCGGLCPGLNTVIREIVCGL++MYGVK
Sbjct  68   VVHKNSPRGIHFRRAGPRQKVYFDPEDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVK  127

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +VMGIDGGY+GFYSKN++ LTPKVVNDIHKRGGTILGTSRGGH TKKIVD IQDR INQV
Sbjct  128  RVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQV  187

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGA+VIFEEI+RRGL V+VAGIPKTI
Sbjct  188  YIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTI  222



>ref|XP_010267094.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=490

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHLSDY+ NLPTYPNPLQDNP+YSVVKQYFV+VDDTVAQK+VV K 
Sbjct  10   KIVTGDAGYVLEDVPHLSDYISNLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIVVHKT  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG H RRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGVK+++GI
Sbjct  70   SPRGIHLRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  EGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EEIKRRGL+VAVAGIPKTI
Sbjct  190  DGTQKGASVIYEEIKRRGLKVAVAGIPKTI  219



>ref|XP_007024343.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY26965.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=534

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 205/223 (92%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MG      +PK+   V GD GYVLEDVPHLSDY+ +LPT+ NPLQDNP+YSVVKQYFV+V
Sbjct  52   MGDSTTITEPKI---VTGDCGYVLEDVPHLSDYIHDLPTHTNPLQDNPAYSVVKQYFVNV  108

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTVAQK+VV+KDSPRGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  109  DDTVAQKIVVQKDSPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  168

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L+HMYGV +V+GI+GGYKGFY++N V LTP+VVNDIHKRGGTILGTSRGG+DT KIVD I
Sbjct  169  LYHMYGVTRVLGIEGGYKGFYARNTVPLTPRVVNDIHKRGGTILGTSRGGNDTSKIVDSI  228

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEEIKRRGL+VAVAGIPKTI
Sbjct  229  QDRGINQVYIIGGDGTQKGASVIFEEIKRRGLKVAVAGIPKTI  271



>ref|XP_011078226.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=488

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GY LEDVPHLSDY+ +LPTYPNPLQDNP+YS V+QYFVD+DDTVAQK+VV KD
Sbjct  10   KIVTGEFGYTLEDVPHLSDYISHLPTYPNPLQDNPAYSAVRQYFVDLDDTVAQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRGTHFRRAGPRQ+VYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGLHHMYGVK+V+GI
Sbjct  70   MPRGTHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKRVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFYSKN + LTP  VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  130  NGGYRGFYSKNTIPLTPNTVNDIHKRGGTVLGTSRGGHDTKKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  190  DGTQKGAAVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_009613573.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=516

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            Q +  K V GD GYVLEDVPHLSDY+PNLPTYPNP+QDNPSYSVVKQYFVD DDTVAQK+
Sbjct  33   QQQKQKIVTGDGGYVLEDVPHLSDYIPNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKI  92

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGPRQKVYF  ++V+ACIVTCGGLCPGLNTVIREIVCGL++MYGVK
Sbjct  93   VVHKNSPRGIHFRRAGPRQKVYFDPEDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVK  152

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +VMGIDGGY+GFYSKN++ LTPKVVNDIHKRGGTILGTSRGGH TKKIVD IQDR INQV
Sbjct  153  RVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQV  212

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGA+VIFEEI+RRGL V+VAGIPKTI
Sbjct  213  YIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTI  247



>ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN10174.1| 6-phosphofructokinase 3 [Glycine soja]
Length=509

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V+GD GY+LEDVPH +DY+PNLPTYPNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  10   MKIVHGDAGYILEDVPHFTDYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYFKSDEV+ACIVTCGGLCPGLNTVIREIVCGL +MYGV KV+G
Sbjct  70   DSPRGIHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGLSYMYGVNKVLG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  130  IDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VI+EE++RRGL+VA+AGIPKTI
Sbjct  190  GDGTQRGATVIYEEVRRRGLKVAIAGIPKTI  220



>gb|KHG00436.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=541

 Score =   380 bits (975),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 199/225 (88%), Gaps = 2/225 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMK--TVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
            M S   A  P + K   V G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV
Sbjct  52   MDSSNSASSPDMQKPKIVTGPGGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFV  111

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
             VDDTV QK+VV KD PRG HFRRAGPRQ+VYF SDEV+ACIVTCGGLCPGLNTVIREIV
Sbjct  112  HVDDTVPQKIVVHKDGPRGVHFRRAGPRQRVYFDSDEVHACIVTCGGLCPGLNTVIREIV  171

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGL+HMYGVKKV+GIDGGY+GFY+KN VHL PKVVNDIHKRGGTILGTSRGGHDT KIVD
Sbjct  172  CGLYHMYGVKKVLGIDGGYRGFYAKNTVHLDPKVVNDIHKRGGTILGTSRGGHDTSKIVD  231

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGTQ GA+VIFEEI+RRGL+V+V GIPKTI
Sbjct  232  SIQDRGINQVYIIGGDGTQGGAAVIFEEIRRRGLKVSVVGIPKTI  276



>gb|KDP33769.1| hypothetical protein JCGZ_07340 [Jatropha curcas]
Length=558

 Score =   380 bits (976),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV VDDTV QK+VV KD
Sbjct  71   KIVTGDYGYVLEDVPHLTDYLPDLPTYSNPLQDNPAYSVVKQYFVHVDDTVPQKIVVHKD  130

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+++GI
Sbjct  131  SPRGIHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRILGI  190

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  191  DGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  250

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEE++RRGL+VAVAGIPKTI
Sbjct  251  DGTQKGASVIFEEVRRRGLKVAVAGIPKTI  280



>ref|XP_007223382.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
 ref|XP_008220132.1| PREDICTED: 6-phosphofructokinase 6 [Prunus mume]
 gb|EMJ24581.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
Length=500

 Score =   378 bits (970),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHL DY+ +LPTYPNPLQ NP+YSVVKQYFV+VDDTVAQK+VV  
Sbjct  18   MKVVKGDFGYVLEDVPHLCDYLSDLPTYPNPLQFNPAYSVVKQYFVNVDDTVAQKIVVHT  77

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+G
Sbjct  78   DSPRGTHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVNKVLG  137

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  138  IDGGYKGFYARNTIDLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  197

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V+VAGIPKTI
Sbjct  198  GDGTQKGAAVIYEEIRRRGLKVSVAGIPKTI  228



>ref|XP_007012967.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY30586.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=583

 Score =   380 bits (977),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVL+DVPHLSDY+ +LPTYPNPLQDNP+YSVVKQYFV VDD+V QKVVV KD
Sbjct  104  KVVTGPGGYVLQDVPHLSDYIADLPTYPNPLQDNPAYSVVKQYFVHVDDSVPQKVVVHKD  163

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIRE+VCGLHHMYGVKKV+GI
Sbjct  164  SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIRELVCGLHHMYGVKKVLGI  223

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L PKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  224  DGGYRGFYAKNTVQLNPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  283

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+V+VAGIPKTI
Sbjct  284  DGTQRGASVIFEEIRRRGLKVSVAGIPKTI  313



>ref|XP_011093663.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=531

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V    GYVLEDVPHLSDY+P+LPTYPNPLQD+P+YSVV++YFVDVDDTVAQK+VVRKD
Sbjct  53   KNVTSGFGYVLEDVPHLSDYIPDLPTYPNPLQDHPAYSVVRRYFVDVDDTVAQKIVVRKD  112

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VY++SD+V ACIVTCGGLCPGLNTVIREIVCGLHHMYGV  V+GI
Sbjct  113  SPRGAHFRRAGPRQRVYYESDDVRACIVTCGGLCPGLNTVIREIVCGLHHMYGVTSVVGI  172

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFYS+N + LTP  VNDIHKRGGTILGTSRGGH+TKKIVDCIQDRGINQVYIIGG
Sbjct  173  DGGYRGFYSRNTISLTPNTVNDIHKRGGTILGTSRGGHNTKKIVDCIQDRGINQVYIIGG  232

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEI+RRGL+VAV GIPKTI
Sbjct  233  DGTQKGASAIFEEIRRRGLKVAVVGIPKTI  262



>emb|CBI27972.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 204/223 (91%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MG+ G A QPK+   V GD GYVLEDVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV+ 
Sbjct  1    MGTFGNA-QPKI---VTGDAGYVLEDVPHLADYIPDLPTYHNPLQDNPAYSVVKQYFVND  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+VAQK+VV K SPRGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  57   DDSVAQKIVVHKSSPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L++MYGV +V+GI GGY+GFYS+N   LTPKVVNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LNYMYGVNRVLGIAGGYRGFYSRNTTSLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  219



>gb|KCW79599.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=487

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GY+LEDVPH SDY+PNLPTY NPLQDNPSYSVVKQYFV VDDTV QKVVV KD
Sbjct  5    KIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVHVDDTVPQKVVVHKD  64

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF++D+V ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+V+GI
Sbjct  65   SPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  124

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N V L PK+VNDIHKRGGTILGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  125  NGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQVYIIGG  184

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS+IFEE++RRGL+VAVAGIPKTI
Sbjct  185  DGTQRGASLIFEEVRRRGLKVAVAGIPKTI  214



>gb|KCW79598.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=457

 Score =   376 bits (966),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GY+LEDVPH SDY+PNLPTY NPLQDNPSYSVVKQYFV VDDTV QKVVV KD
Sbjct  5    KIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVHVDDTVPQKVVVHKD  64

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF++D+V ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+V+GI
Sbjct  65   SPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  124

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N V L PK+VNDIHKRGGTILGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  125  NGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQVYIIGG  184

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS+IFEE++RRGL+VAVAGIPKTI
Sbjct  185  DGTQRGASLIFEEVRRRGLKVAVAGIPKTI  214



>ref|XP_010047648.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW79597.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=544

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 201/222 (91%), Gaps = 1/222 (0%)
 Frame = -1

Query  666  GSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVD  487
            GS G +   K  K V GD GY+LEDVPH SDY+PNLPTY NPLQDNPSYSVVKQYFV VD
Sbjct  51   GSAGVSDMAK-KKIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVHVD  109

Query  486  DTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGL  307
            DTV QKVVV KDSPRG HFRRAGPRQ+VYF++D+V ACIVTCGGLCPGLNTVIREIVCGL
Sbjct  110  DTVPQKVVVHKDSPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVCGL  169

Query  306  HHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQ  127
            +HMYGVK+V+GI+GGY+GFY++N V L PK+VNDIHKRGGTILGTSRGGHDTKKIVD IQ
Sbjct  170  YHMYGVKRVLGINGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDSIQ  229

Query  126  DRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DRGINQVYIIGGDGTQRGAS+IFEE++RRGL+VAVAGIPKTI
Sbjct  230  DRGINQVYIIGGDGTQRGASLIFEEVRRRGLKVAVAGIPKTI  271



>ref|XP_002283274.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Vitis 
vinifera]
Length=539

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 204/223 (91%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MG+ G A QPK+   V GD GYVLEDVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV+ 
Sbjct  49   MGTFGNA-QPKI---VTGDAGYVLEDVPHLADYIPDLPTYHNPLQDNPAYSVVKQYFVND  104

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+VAQK+VV K SPRGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  105  DDSVAQKIVVHKSSPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  164

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L++MYGV +V+GI GGY+GFYS+N   LTPKVVNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  165  LNYMYGVNRVLGIAGGYRGFYSRNTTSLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSI  224

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  225  QDRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  267



>ref|XP_002309528.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
 gb|EEE93051.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
Length=466

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK VNG  GYVLEDVPHL+DY+P+LPTYPN LQDNP+Y+ VKQYFV+VDDTVAQ++VV  
Sbjct  7    MKIVNGVAGYVLEDVPHLTDYIPHLPTYPNQLQDNPAYAGVKQYFVNVDDTVAQRIVVHN  66

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
             SPRGTHFRRAGPRQKVYFKSDEV ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+G
Sbjct  67   SSPRGTHFRRAGPRQKVYFKSDEVRACIVTCGGLCPGLNTVIREIVCGLYHMYGVTKVLG  126

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN ++LTPKVV+DIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  127  IDGGYRGFYAKNTINLTPKVVDDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  186

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL VAVAGIPKTI
Sbjct  187  GDGTQKGAAVIYEEIRRRGLNVAVAGIPKTI  217



>gb|KEH36099.1| 6-phosphofructokinase [Medicago truncatula]
Length=519

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V+GD GY+LEDVPHLSDYVPNLPTYPNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  10   MKVVHGDAGYILEDVPHLSDYVPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQKVYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGV KV+G
Sbjct  70   DGPRGVHFRRAGPRQKVYFRSDDVIACIVTCGGLCPGLNTVIREIVCGLSYMYGVDKVLG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  130  IDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VI+EE++RRGL+VA+AGIPKTI
Sbjct  190  GDGTQRGAAVIYEEVRRRGLKVAIAGIPKTI  220



>ref|XP_006354082.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=468

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 200/225 (89%), Gaps = 2/225 (1%)
 Frame = -1

Query  669  MGS--EGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
            MGS  +  AV     K V GD+GYVLEDVPHLSDY+P+LPTYPNPL++NPSYSVV QYFV
Sbjct  1    MGSLVDSVAVHNLNKKIVMGDNGYVLEDVPHLSDYIPSLPTYPNPLKNNPSYSVVNQYFV  60

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
            D DDTVAQ +VVRK+SPRG HFRRAGP Q VYFKSD+VNACIVTCGGLCPGLNTVIREIV
Sbjct  61   DKDDTVAQNIVVRKNSPRGIHFRRAGPSQNVYFKSDDVNACIVTCGGLCPGLNTVIREIV  120

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGL+ MYGV++VMGIDGGY+GFYSKN + LTPKVVNDIHKRGGTILG+SRGGH TKKIVD
Sbjct  121  CGLYSMYGVRRVMGIDGGYQGFYSKNTIPLTPKVVNDIHKRGGTILGSSRGGHVTKKIVD  180

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGTQ+GASV+FEEI RRGL VAV GIPKTI
Sbjct  181  SIQDRGINQVYIIGGDGTQKGASVLFEEITRRGLNVAVVGIPKTI  225



>ref|XP_009763926.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009763927.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
Length=490

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVL+DVPHLSDY+ NLPTYPNP+QDNPSYSVVKQYFVD DDTVAQK+VV K+
Sbjct  12   KIVTGDGGYVLQDVPHLSDYISNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKIVVHKN  71

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF+ ++V+ACIVTCGGLCPGLNTVIREIVCGLH+MYGVK+VMGI
Sbjct  72   SPRGIHFRRAGPRQRVYFEPEDVHACIVTCGGLCPGLNTVIREIVCGLHYMYGVKRVMGI  131

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFYSKN++ LTPKVVNDIHKRGGTILGTSRGGH TKKIVD IQDR INQVYIIGG
Sbjct  132  DGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQVYIIGG  191

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA+VIFEEI+RRGL V+VAGIPKTI
Sbjct  192  DGTQRGAAVIFEEIRRRGLNVSVAGIPKTI  221



>ref|XP_007215486.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
 gb|EMJ16685.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
Length=560

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL DY+P+LPTYPNPLQDNPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  70   KIVPGEGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKD  129

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCGL+HMY VK+++GI
Sbjct  130  SPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLNHMYHVKRILGI  189

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVY+IGG
Sbjct  190  EGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVIGG  249

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  250  DGTQRGAAVIFEEIRRRGLKVAVAGIPKTI  279



>gb|KHG29071.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=528

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 197/215 (92%), Gaps = 3/215 (1%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            QPK+   VNG  GYVLEDVPHLSDY+P+LP Y NPLQDNP+YSVVKQYFV VDDTV QK+
Sbjct  83   QPKI---VNGPGGYVLEDVPHLSDYIPDLPVYSNPLQDNPAYSVVKQYFVHVDDTVPQKI  139

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGPRQK++F SD+V+ACIVTCGGLCPGLNTVIREIVCGL HMYGV+
Sbjct  140  VVHKNSPRGVHFRRAGPRQKIFFDSDDVHACIVTCGGLCPGLNTVIREIVCGLFHMYGVR  199

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            KV GIDGGY+GFY+KN VHL PKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQV
Sbjct  200  KVSGIDGGYRGFYAKNTVHLDPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQV  259

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGASVIFEEI+RRGL+V+VAGIPKTI
Sbjct  260  YIIGGDGTQRGASVIFEEIRRRGLKVSVAGIPKTI  294



>ref|XP_009763925.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Nicotiana sylvestris]
Length=515

 Score =   377 bits (967),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVL+DVPHLSDY+ NLPTYPNP+QDNPSYSVVKQYFVD DDTVAQK+VV K+
Sbjct  37   KIVTGDGGYVLQDVPHLSDYISNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKIVVHKN  96

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF+ ++V+ACIVTCGGLCPGLNTVIREIVCGLH+MYGVK+VMGI
Sbjct  97   SPRGIHFRRAGPRQRVYFEPEDVHACIVTCGGLCPGLNTVIREIVCGLHYMYGVKRVMGI  156

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFYSKN++ LTPKVVNDIHKRGGTILGTSRGGH TKKIVD IQDR INQVYIIGG
Sbjct  157  DGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQVYIIGG  216

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA+VIFEEI+RRGL V+VAGIPKTI
Sbjct  217  DGTQRGAAVIFEEIRRRGLNVSVAGIPKTI  246



>ref|XP_010095449.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=495

 Score =   376 bits (965),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK VNGD GYVLEDVPHL+DY+P+LPTYPNPL+ NP+YSVVKQYFV VDDTV QKVVV K
Sbjct  9    MKIVNGDAGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVHVDDTVPQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGV K++G
Sbjct  69   DGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYNMYGVNKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN V LTPKVVNDIHKRGGTILGTSRGG+DT KIVD I+DRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTVTLTPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIEDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+G +VIFEEI+RRGL+VAV GIPKTI
Sbjct  189  GDGTQKGVAVIFEEIRRRGLKVAVLGIPKTI  219



>ref|XP_008228400.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=532

 Score =   377 bits (968),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL DY+P+LPTYPNPLQ+NPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  66   KIVTGEGGYVLEDVPHLVDYIPDLPTYPNPLQNNPSYSVVKQYFVNADDTVAQKIVVHKD  125

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCGL+HMY VK+++GI
Sbjct  126  SPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLNHMYHVKRILGI  185

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N V LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVY+IGG
Sbjct  186  EGGYRGFYARNTVPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVIGG  245

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  246  DGTQKGAAVIFEEIRRRGLKVAVAGIPKTI  275



>gb|KDO55888.1| hypothetical protein CISIN_1g0098042mg, partial [Citrus sinensis]
Length=291

 Score =   369 bits (946),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  72   KIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  131

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV ACIVTCGGLCPGLNTVIREIV  L++MYGVK+V+GI
Sbjct  132  SPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGI  191

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  192  DGGYRGFYAKNTIALTPKGVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  251

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+V VAGIPKTI
Sbjct  252  DGTQKGASVIYEEVRRRGLKVVVAGIPKTI  281



>ref|XP_010539385.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=487

 Score =   375 bits (963),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 204/223 (91%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGS G + QPK++K   G DGY+LEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFVD 
Sbjct  1    MGSLG-STQPKIIK---GPDGYILEDVPHLTDYLPDLPTYPNPLQDNPAYSVVKQYFVDA  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QKVVV+ +SPRG HFRRAGPRQKV+F+SDEV+ACIVTCGGLCPGLNTVIRE+VCG
Sbjct  57   DDSVPQKVVVQHNSPRGVHFRRAGPRQKVHFESDEVHACIVTCGGLCPGLNTVIRELVCG  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L +MYGVKK++GIDGGY+GFY+KN + L+ K VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LSYMYGVKKILGIDGGYRGFYAKNTIPLSSKFVNDIHKRGGTILGTSRGGHDTTKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQRGAS+IFEEI+RRGL+VAV GIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQRGASIIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_002514189.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF48143.1| phosphofructokinase, putative [Ricinus communis]
Length=632

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFV  DD+V QK+VV KD
Sbjct  69   KIVTGEYGYVLEDVPHLTDYLPDLPTYPNPLQDNPAYSVVKQYFVHTDDSVPQKIVVHKD  128

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+V+GI
Sbjct  129  SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  188

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGYKGFY++N + L+PKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  189  DGGYKGFYARNTIPLSPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  248

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  249  DGTQKGASVIFEEIRRRGLKVAVAGIPKTI  278



>emb|CAN74837.1| hypothetical protein VITISV_023326 [Vitis vinifera]
Length=488

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + GD GYVLEDVPHL+DY+  LPTYPN LQ NP+YSVVKQYFV+VDD+VAQK+V  K+
Sbjct  11   KVITGDAGYVLEDVPHLTDYIQGLPTYPNQLQTNPAYSVVKQYFVNVDDSVAQKIVCHKN  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL HMYGV +++GI
Sbjct  71   SPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGYKGFYS+N + LTPKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYKGFYSRNTIPLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  191  DGTQKGASVIFEEIRRRGLKVAVAGIPKTI  220



>ref|XP_008798601.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=552

 Score =   377 bits (968),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 203/224 (91%), Gaps = 4/224 (2%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            +MGSE     PK+   V+G+ GYVLEDVPHL+DY PNLP+YPNPLQDNP+Y+VVKQYFV+
Sbjct  54   KMGSESKG-NPKI---VHGEAGYVLEDVPHLTDYFPNLPSYPNPLQDNPAYAVVKQYFVN  109

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
            VDDTVAQK+VV K  PRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  110  VDDTVAQKIVVHKTGPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVC  169

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL HMYGV K++GI+GGY+GFY++N V LTPK VNDIHKRGGTIL TSRGGHDT KIVD 
Sbjct  170  GLSHMYGVTKILGIEGGYRGFYARNTVTLTPKTVNDIHKRGGTILLTSRGGHDTSKIVDS  229

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  230  IQDRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  273



>gb|AIU64848.1| 6-phosphofructokinase [Prunus sibirica]
Length=532

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL DY+P+LPTYPNPLQ+NPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  66   KIVTGEGGYVLEDVPHLVDYIPDLPTYPNPLQNNPSYSVVKQYFVNADDTVAQKIVVHKD  125

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCGL HMY VK+++GI
Sbjct  126  SPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLTHMYHVKRILGI  185

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N V +TPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVY+IGG
Sbjct  186  EGGYRGFYARNTVPITPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVIGG  245

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  246  DGTQRGAAVIFEEIRRRGLKVAVAGIPKTI  275



>ref|XP_002275308.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 ref|XP_010648295.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 emb|CBI20597.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + GD GYVLEDVPHL+DY+  LPTYPN LQ NP+YSVVKQYFV+VDD+VAQK+V  K+
Sbjct  11   KVITGDAGYVLEDVPHLNDYIQGLPTYPNQLQTNPAYSVVKQYFVNVDDSVAQKIVCHKN  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL HMYGV +++GI
Sbjct  71   SPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGYKGFYS+N + LTPKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYKGFYSRNTIPLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  191  DGTQKGASVIFEEIRRRGLKVAVAGIPKTI  220



>ref|XP_009337916.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X5 [Pyrus x bretschneideri]
Length=481

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G  GYVLEDVPHL DY+P+LPTY NPLQDNPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  10   KMATGPCGYVLEDVPHLVDYIPDLPTYHNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S EV+ACIVTCGGLCPGLNTVIREIVCGL HMYGVK+++GI
Sbjct  70   SPRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  EGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_010244403.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=547

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 201/215 (93%), Gaps = 3/215 (1%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            QPK+   V G+ GYVLEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFVD+DDTV QK+
Sbjct  69   QPKI---VTGEFGYVLEDVPHLTDYIPDLPTYPNPLQDNPAYSVVKQYFVDMDDTVPQKI  125

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K SPRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGV 
Sbjct  126  VVHKTSPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVN  185

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +++GI+GGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQV
Sbjct  186  RILGIEGGYKGFYARNTISLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQV  245

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQ+GASVI+EE+KRRGL+VAVAGIPKTI
Sbjct  246  YIIGGDGTQKGASVIYEEVKRRGLKVAVAGIPKTI  280



>ref|XP_008794086.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008794087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 203/223 (91%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGSE     PK+   V+G+ GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YSVVKQ+FV+ 
Sbjct  1    MGSES-KTNPKI---VHGEAGYVLEDVPHLTDYIPDLPSYPNPLQDNPAYSVVKQFFVNR  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV QK+VV K SPRGTHFRR+GPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  57   DDTVKQKIVVHKTSPRGTHFRRSGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L HMYGV K++GI+GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LSHMYGVTKILGIEGGYRGFYARNTITLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  219



>ref|XP_010545328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=490

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 201/223 (90%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGS G + QPK++K   G  GYVLEDVPHL+DY+P+L TYPNPLQDNP+YSVVKQYFVD 
Sbjct  1    MGSLG-SSQPKIIK---GPAGYVLEDVPHLTDYLPDLHTYPNPLQDNPAYSVVKQYFVDA  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV QKVVV +DSPRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  57   DDTVPQKVVVHRDSPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCG  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L +MYGVKK++GIDGGY+GFY+KN V L  K VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LSYMYGVKKILGIDGGYRGFYAKNTVPLNSKFVNDIHKRGGTILGTSRGGHDTNKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQRGASVIFEE++RRGL+VAV GIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQRGASVIFEEVRRRGLKVAVVGIPKTI  219



>ref|XP_010915352.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=548

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V+G+ GYVLEDVPHL+DYVP+LP+YPNPLQDNP+Y+VVKQYFV++DDTVAQK+VV K 
Sbjct  64   KIVHGEVGYVLEDVPHLTDYVPDLPSYPNPLQDNPAYAVVKQYFVNLDDTVAQKIVVHKT  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL HMYGV K++GI
Sbjct  124  SPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLFHMYGVTKILGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + +TPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  184  EGGYRGFYARNTITMTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAG+PKTI
Sbjct  244  DGTQKGASVIFEEIQRRGLKVAVAGVPKTI  273



>ref|XP_004243602.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Solanum 
lycopersicum]
Length=490

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            Q +  K V GDDGYVLEDVPHLSDY+PNLPTY NPLQ NPSYSVVKQYFV+ DDTVA+KV
Sbjct  8    QQQKKKIVIGDDGYVLEDVPHLSDYIPNLPTYTNPLQHNPSYSVVKQYFVNEDDTVAEKV  67

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGP QKVYF+ D+V ACIVTCGGLCPGLNTVIREIVCGLH+MYGV 
Sbjct  68   VVHKNSPRGIHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVS  127

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +VMGIDGGY+GFYSKN + LTPKVVN+IHKRGGTILGTSRGGH TKKIVD IQDRGINQV
Sbjct  128  RVMGIDGGYRGFYSKNTIPLTPKVVNNIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQV  187

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGA+VIFEEI+RRGL VAVAGIPKTI
Sbjct  188  YIIGGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTI  222



>ref|XP_010925504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Elaeis guineensis]
Length=498

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTVAQK+VV K 
Sbjct  10   KIVYGEAGYVLEDVPHLTDYMPDLPTYPNPLQDNPAYSVVKQYFVNRDDTVAQKIVVHKT  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL HMYGV K++GI
Sbjct  70   SPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  EGGYRGFYARNTISLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS+IFEEI+RRGL+V VAGIPKTI
Sbjct  190  DGTQKGASMIFEEIQRRGLKVVVAGIPKTI  219



>ref|XP_006357682.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=504

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            Q +  K V GDDGYVLEDVPHLSDY+PNL TY NPLQ NPSYSVVKQYFVD DDTVA+KV
Sbjct  27   QQQKKKIVIGDDGYVLEDVPHLSDYIPNLSTYTNPLQHNPSYSVVKQYFVDEDDTVAEKV  86

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGP QKVYF+ D+V ACIVTCGGLCPGLNTVIREIVCGLH+MYGV 
Sbjct  87   VVHKNSPRGLHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVS  146

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +VMGIDGGY+GFYSKN + LTPKVVNDIHKRGGTILGTSRGGH TKKIVD IQDRGINQV
Sbjct  147  RVMGIDGGYRGFYSKNTIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQV  206

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGA+VIFEEI+RRGL VAVAGIPKTI
Sbjct  207  YIIGGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTI  241



>ref|XP_008794084.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=559

 Score =   376 bits (966),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 204/224 (91%), Gaps = 4/224 (2%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            +MGSE     PK+   V+G+ GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YSVVKQ+FV+
Sbjct  54   KMGSES-KTNPKI---VHGEAGYVLEDVPHLTDYIPDLPSYPNPLQDNPAYSVVKQFFVN  109

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
             DDTV QK+VV K SPRGTHFRR+GPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  110  RDDTVKQKIVVHKTSPRGTHFRRSGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVC  169

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL HMYGV K++GI+GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD 
Sbjct  170  GLSHMYGVTKILGIEGGYRGFYARNTITLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDS  229

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  230  IQDRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTI  273



>gb|AIE47274.1| phosphofructokinase [Hevea brasiliensis]
Length=545

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + GDDGYVLEDVPHL+D++ +LPTYPNPLQDNPSYSVVKQYFV+ DDTV QK+VV+KD
Sbjct  66   KIITGDDGYVLEDVPHLTDHISDLPTYPNPLQDNPSYSVVKQYFVNADDTVVQKIVVQKD  125

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCGL+HMYGV +V+GI
Sbjct  126  SLRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLYHMYGVNRVLGI  185

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N V L+PKVVNDIHKRGGTILGTSRGG+DT KIVD I+DRGINQVYIIGG
Sbjct  186  EGGYRGFYARNTVLLSPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIEDRGINQVYIIGG  245

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  246  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  275



>ref|XP_004243600.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Solanum 
lycopersicum]
Length=509

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            Q +  K V GDDGYVLEDVPHLSDY+PNLPTY NPLQ NPSYSVVKQYFV+ DDTVA+KV
Sbjct  27   QQQKKKIVIGDDGYVLEDVPHLSDYIPNLPTYTNPLQHNPSYSVVKQYFVNEDDTVAEKV  86

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRG HFRRAGP QKVYF+ D+V ACIVTCGGLCPGLNTVIREIVCGLH+MYGV 
Sbjct  87   VVHKNSPRGIHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVS  146

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +VMGIDGGY+GFYSKN + LTPKVVN+IHKRGGTILGTSRGGH TKKIVD IQDRGINQV
Sbjct  147  RVMGIDGGYRGFYSKNTIPLTPKVVNNIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQV  206

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQRGA+VIFEEI+RRGL VAVAGIPKTI
Sbjct  207  YIIGGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTI  241



>ref|XP_002515946.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF46366.1| phosphofructokinase, putative [Ricinus communis]
Length=543

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            KTV G  GYVLEDVPH +DY+ +LPTYPNPLQDNP+YSVVKQYFV+ DDTVAQK+VV+K+
Sbjct  69   KTVAGPAGYVLEDVPHFTDYISDLPTYPNPLQDNPAYSVVKQYFVNADDTVAQKIVVQKE  128

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIRE+VCGLH MYGV +++GI
Sbjct  129  SPRGTHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIRELVCGLHDMYGVNRILGI  188

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGG+DT KIVD IQDRGINQVYIIGG
Sbjct  189  EGGYKGFYARNTILLTPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIQDRGINQVYIIGG  248

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  249  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  278



>ref|XP_010925503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Elaeis guineensis]
Length=552

 Score =   375 bits (962),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTVAQK+VV K 
Sbjct  64   KIVYGEAGYVLEDVPHLTDYMPDLPTYPNPLQDNPAYSVVKQYFVNRDDTVAQKIVVHKT  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL HMYGV K++GI
Sbjct  124  SPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTKILGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  184  EGGYRGFYARNTISLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS+IFEEI+RRGL+V VAGIPKTI
Sbjct  244  DGTQKGASMIFEEIQRRGLKVVVAGIPKTI  273



>ref|XP_010668810.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=514

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G+ GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV  DDTV QKVVV K
Sbjct  45   MKIVKGEYGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHEDDTVVQKVVVHK  104

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF S EVNACIVTCGGLCPGLNTVIREIVC L+HMY V KV+G
Sbjct  105  DSPRGIHFRRAGPRQKVYFDSGEVNACIVTCGGLCPGLNTVIREIVCALYHMYDVDKVIG  164

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGYKGFY+KN V L PK VNDIHKRGGT++GTSRGGHDTKKIVD IQDRGINQVYIIG
Sbjct  165  IDGGYKGFYAKNTVKLDPKFVNDIHKRGGTVIGTSRGGHDTKKIVDSIQDRGINQVYIIG  224

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+ ++EEI+RRGL++AVAGIPKTI
Sbjct  225  GDGTQKGAAAVYEEIRRRGLKIAVAGIPKTI  255



>ref|XP_008375837.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=484

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G  GYVLEDVPHL DY+P+LPTY NPLQDNPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  10   KIATGPCGYVLEDVPHLVDYIPDLPTYHNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S EV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+++GI
Sbjct  70   SPRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLNHMYGVKRIIGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            + GY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  EVGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVAGIPKTI  219



>gb|KDP34145.1| hypothetical protein JCGZ_07716 [Jatropha curcas]
Length=478

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK +NG+ GYVLEDVPHL+DY+P+L TYPNPLQ NP+YS VKQYFVD+DDTV+QKVVV K
Sbjct  9    MKIINGEAGYVLEDVPHLTDYIPDLTTYPNPLQVNPAYSTVKQYFVDMDDTVSQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQ VYF+ D+V+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV+ V+G
Sbjct  69   DGPRGLHFRRAGPRQNVYFRPDDVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRNVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNTIPLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVAVAGIPKTI  219



>ref|XP_010051556.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW82287.1| hypothetical protein EUGRSUZ_C03703 [Eucalyptus grandis]
Length=486

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPH SDY+P+LPTY NPLQD+P+YSVVKQYFV  DDTV QK +  K+
Sbjct  7    KIVTGDAGYVLEDVPHFSDYIPDLPTYSNPLQDHPAYSVVKQYFVHDDDTVIQKPIAHKN  66

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKV+GI
Sbjct  67   GPRGLHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVLGI  126

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGYKGFYS+N V LTPKVVNDIHKRGGTILGT+RGGHDT KIVD IQDRGINQVYIIGG
Sbjct  127  DGGYKGFYSRNTVPLTPKVVNDIHKRGGTILGTTRGGHDTSKIVDSIQDRGINQVYIIGG  186

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEIKRRGL+VAVAGIPKTI
Sbjct  187  DGTQKGASFIFEEIKRRGLKVAVAGIPKTI  216



>ref|XP_009337913.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Pyrus x bretschneideri]
Length=471

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  VNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSP  445
              G  GYVLEDVP L DY+P+LPTYPNPLQ NPSYSVVKQYFV+ DDTVAQK+VV KDSP
Sbjct  2    ATGPCGYVLEDVPRLVDYIPDLPTYPNPLQGNPSYSVVKQYFVNADDTVAQKIVVHKDSP  61

Query  444  RGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDG  265
            RGTHFRR+GPRQKVYF+S EV+ACIVTCGGLCPGLNTVIREIVCGL HMYGVK+++GI+G
Sbjct  62   RGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIEG  121

Query  264  GYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDG  85
            GY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GGDG
Sbjct  122  GYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGDG  181

Query  84   TQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            TQRGASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  182  TQRGASVIFEEIRRRGLKVAVAGIPKTI  209



>ref|XP_004517277.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=517

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V+GD GY+LEDVPHLSDY+PNLPTYPNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  10   MKIVHGDAGYILEDVPHLSDYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRR GPRQKVYF+SD V ACIVTCGGLCPGLNTVIREIVC L +MYGV KV+G
Sbjct  70   DGPRGVHFRRGGPRQKVYFRSDNVLACIVTCGGLCPGLNTVIREIVCSLSYMYGVDKVLG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  130  IDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA+VI+EE++RRGL+VA+AGIPKTI
Sbjct  190  GDGTQRGAAVIYEEVRRRGLKVAIAGIPKTI  220



>ref|XP_009344489.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=540

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G  GYVLEDVPHL DY+P+LPTYPNPLQDNPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  62   KIATGPGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKD  121

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S++V+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+++GI
Sbjct  122  SPRGTHFRRSGPRQKVYFESNDVDACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRILGI  181

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGH T KIVD IQDRGINQVY+IGG
Sbjct  182  EGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHVTSKIVDSIQDRGINQVYVIGG  241

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+V VAGIPKTI
Sbjct  242  DGTQKGASVIFEEIRRRGLKVVVAGIPKTI  271



>ref|XP_008375839.1| PREDICTED: 6-phosphofructokinase 6-like isoform X2 [Malus domestica]
Length=488

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G  GYVLEDVPHL DY+P+LPTYPNPLQDNPSYSVVKQYFV+ DDTVAQK+VV KD
Sbjct  10   KIATGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S EV+ACIVTCGG+CPGLNTVIRE+VCGL+HMYGVKK++GI
Sbjct  70   SPRGTHFRRSGPRQKVYFESSEVHACIVTCGGICPGLNTVIRELVCGLNHMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQ+Y++GG
Sbjct  130  EGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQIYVLGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEE++RRGL+V VAGIP TI
Sbjct  190  DGTQKGASVIFEEVRRRGLKVVVAGIPNTI  219



>ref|XP_010049142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW81626.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=492

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHLSDY+ +LPTYPNPL+ NP+Y+VVKQYFV VDDTV QKVVV K
Sbjct  11   MKVVTGDAGYVLEDVPHLSDYIADLPTYPNPLRSNPAYAVVKQYFVHVDDTVPQKVVVHK  70

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQ+VYF++DEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGV K++G
Sbjct  71   DGPRGIHFRRAGPRQQVYFETDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVTKILG  130

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + L PKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  131  IDGGYRGFYSKNTITLNPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGINQVYIIG  190

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GASVI+EEI++RGL+VAVAGIPKTI
Sbjct  191  GDGTQKGASVIYEEIRQRGLKVAVAGIPKTI  221



>ref|XP_008348488.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=540

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K   G  GYVLEDVPHL DY+P+LPTYPNPLQDNPSYSVVKQYFV+ DDTVAQK+VV K
Sbjct  61   LKIATGPGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHK  120

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRR+GPRQKVYF+S++V+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV++++G
Sbjct  121  DSPRGTHFRRSGPRQKVYFESNDVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRRILG  180

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGH T KIVD IQDRGINQVY+IG
Sbjct  181  IEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHVTSKIVDSIQDRGINQVYVIG  240

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GASVIFEEI+RRGL+V VAGIPKTI
Sbjct  241  GDGTQKGASVIFEEIRRRGLKVVVAGIPKTI  271



>ref|XP_011019558.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Populus 
euphratica]
Length=480

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K VNG  GYVLEDVPHL+DY+P+LPTYPN LQDNP+Y+ VKQYFVDVDDTVAQK+VV  
Sbjct  7    IKIVNGVAGYVLEDVPHLTDYIPHLPTYPNQLQDNPAYAGVKQYFVDVDDTVAQKIVVHN  66

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            +SPRGTHFRRAGPRQKVYFKS +V ACIVTCGGLCPGLNTVIREIVCGL+H+YGV KV+G
Sbjct  67   NSPRGTHFRRAGPRQKVYFKSGDVRACIVTCGGLCPGLNTVIREIVCGLYHIYGVTKVLG  126

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN ++LTPKVV+DIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  127  IDGGYRGFYAKNTINLTPKVVDDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  186

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL VAVAGIPKTI
Sbjct  187  GDGTQKGAAVIYEEIRRRGLNVAVAGIPKTI  217



>ref|XP_010049141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW81625.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=510

 Score =   371 bits (952),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHLSDY+ +LPTYPNPL+ NP+Y+VVKQYFV VDDTV QKVVV K
Sbjct  11   MKVVTGDAGYVLEDVPHLSDYIADLPTYPNPLRSNPAYAVVKQYFVHVDDTVPQKVVVHK  70

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQ+VYF++DEV+ACIVTCGGLCPGLNTVIREIVCGL++MYGV K++G
Sbjct  71   DGPRGIHFRRAGPRQQVYFETDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVTKILG  130

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + L PKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  131  IDGGYRGFYSKNTITLNPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGINQVYIIG  190

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GASVI+EEI++RGL+VAVAGIPKTI
Sbjct  191  GDGTQKGASVIYEEIRQRGLKVAVAGIPKTI  221



>ref|XP_004287498.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   371 bits (953),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 202/224 (90%), Gaps = 2/224 (1%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            ++GS G  ++    K + GD+GYVLEDVPH SDY+PNLPTYPNPLQDNP+YSVVKQYFV+
Sbjct  37   KVGSSG--MENNKDKILVGDNGYVLEDVPHFSDYIPNLPTYPNPLQDNPAYSVVKQYFVN  94

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
            VDDTV QK++  K+SPRG HFRRAGPRQKVYF++++V+ACIVTCGGLCPGLNTVIREIVC
Sbjct  95   VDDTVTQKIIGHKNSPRGIHFRRAGPRQKVYFEAEDVHACIVTCGGLCPGLNTVIREIVC  154

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GLH+MYGVKKV GI GGYKGFYS+N++ LTPK VNDIHKRGGTILGTSRGGHD  KIVD 
Sbjct  155  GLHYMYGVKKVSGIIGGYKGFYSRNIIPLTPKSVNDIHKRGGTILGTSRGGHDKSKIVDS  214

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDRGINQVYIIGGDGTQ+GASVIFEEIKRRGL+V VAGIPKTI
Sbjct  215  IQDRGINQVYIIGGDGTQKGASVIFEEIKRRGLKVVVAGIPKTI  258



>ref|XP_011094240.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=489

 Score =   370 bits (950),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G+ GYVLEDVPHL+DY+P+LPTYPNPL+ NP+YSVVKQYFVD+DD+V QKVVV K
Sbjct  9    MKVVTGEYGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D+PRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  69   DTPRGVHFRRAGPRQKVYFASDEVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYAKNTITLTPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VIFEEI++RGL+VAVAGIPKTI
Sbjct  189  GDGTQKGAAVIFEEIRKRGLKVAVAGIPKTI  219



>gb|AFW80263.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
Length=420

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  47   KLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  106

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  107  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVSSVVGI  166

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  167  EGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  226

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  227  DGTQKGASVIYEEVRRRGLKCSVVGVPKTI  256



>ref|XP_010536840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Tarenaya hassleriana]
Length=474

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGS G + QPK++K   G  GYVLEDVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD 
Sbjct  1    MGSLG-SNQPKIVK---GTAGYVLEDVPHLVDYLPSLPTYPNPLQDNPAYSVVKQYFVDA  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QK+VV  DS RG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+VCG
Sbjct  57   DDSVPQKIVVHHDSARGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCG  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L +MYGVKK++GIDGGY+GFY+KN + L  K VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LSYMYGVKKILGIDGGYRGFYAKNTIPLNSKFVNDIHKRGGTILGTSRGGHDTTKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQRGASVIFEE++RRGL+V+V GIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQRGASVIFEEVRRRGLKVSVVGIPKTI  219



>ref|XP_006451354.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64594.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=561

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  70   KIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  129

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV ACIVTCGGLCPGLNTVIREIV  L++MYGVK+V+GI
Sbjct  130  SPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGI  189

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  190  DGGYRGFYAKNTIALTPKGVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  249

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+V VAGIPKTI
Sbjct  250  DGTQKGASVIYEEVRRRGLKVVVAGIPKTI  279



>ref|XP_006475360.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=561

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  70   KIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  129

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV ACIVTCGGLCPGLNTVIREIV  L++MYGVK+V+GI
Sbjct  130  SPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGI  189

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  190  DGGYRGFYAKNTIALTPKGVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  249

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+V VAGIPKTI
Sbjct  250  DGTQKGASVIYEEVRRRGLKVVVAGIPKTI  279



>ref|XP_010526423.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Tarenaya 
hassleriana]
Length=489

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K +NG  GYVLEDVPHLSDY+PNLPTYPNPLQDNPSYSVV+QYFVD DDT+ +K+VV  +
Sbjct  10   KIINGPAGYVLEDVPHLSDYIPNLPTYPNPLQDNPSYSVVRQYFVDEDDTIPEKIVVHPE  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            +PRGTHFRRAGPRQKVYF +D+V ACIVTCGGLCPGLNTVIREIVCGL +MYGV +++GI
Sbjct  70   TPRGTHFRRAGPRQKVYFAADDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVTRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L PKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLDPKVVNDIHKRGGTVLGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIF+EI+RRGL+VAVAGIPKTI
Sbjct  190  DGTQKGAAVIFQEIRRRGLKVAVAGIPKTI  219



>ref|XP_003516323.2| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=526

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = -1

Query  678  KFRMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYF  499
            +  M S     +PK+   V G  GY+LEDVPH +DY+PNLPTYPNPLQDNP+YSVVKQYF
Sbjct  27   RLAMASPANTSEPKI---VTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYF  83

Query  498  VDVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREI  319
            V VDD+V QKVVV KD  RG HFRRAGPRQKVYF++DEV A IVTCGGLCPGLNTVIRE+
Sbjct  84   VHVDDSVPQKVVVHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIREL  143

Query  318  VCGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIV  139
            VCGLHHMYGVKKV+GI+GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDTKKIV
Sbjct  144  VCGLHHMYGVKKVLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIV  203

Query  138  DCIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            D IQDRGINQVYIIGGDGTQ+GAS IFEE+++RGL+V+V GIPKTI
Sbjct  204  DSIQDRGINQVYIIGGDGTQKGASAIFEEVRKRGLKVSVVGIPKTI  249



>gb|KHN03217.1| 6-phosphofructokinase 3 [Glycine soja]
Length=525

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = -1

Query  678  KFRMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYF  499
            +  M S     +PK+   V G  GY+LEDVPH +DY+PNLPTYPNPLQDNP+YSVVKQYF
Sbjct  26   RLAMASPANTSEPKI---VTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYF  82

Query  498  VDVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREI  319
            V VDD+V QKVVV KD  RG HFRRAGPRQKVYF++DEV A IVTCGGLCPGLNTVIRE+
Sbjct  83   VHVDDSVPQKVVVHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIREL  142

Query  318  VCGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIV  139
            VCGLHHMYGVKKV+GI+GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDTKKIV
Sbjct  143  VCGLHHMYGVKKVLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIV  202

Query  138  DCIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            D IQDRGINQVYIIGGDGTQ+GAS IFEE+++RGL+V+V GIPKTI
Sbjct  203  DSIQDRGINQVYIIGGDGTQKGASAIFEEVRKRGLKVSVVGIPKTI  248



>ref|XP_009337914.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X3 [Pyrus x bretschneideri]
Length=471

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  VNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSP  445
              G  GYVLEDVP L DY+P+LPTYPNPLQ NPSYSVVKQYFV+ DDTV QK+VV KDSP
Sbjct  2    ATGPCGYVLEDVPRLVDYIPDLPTYPNPLQGNPSYSVVKQYFVNADDTVVQKIVVHKDSP  61

Query  444  RGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDG  265
            RGTHFRR+GPRQKVYF+S EV+ACIVTCGGLCPGLNTVIREIVCGL HMYGVK+++GI+G
Sbjct  62   RGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIEG  121

Query  264  GYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDG  85
            GY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GGDG
Sbjct  122  GYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGDG  181

Query  84   TQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            TQRGASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  182  TQRGASVIFEEIRRRGLKVAVAGIPKTI  209



>ref|XP_009367416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=494

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GY+LEDVPHLSDY+ +LPTYPNPL+ NP+YSVVKQYFV+VDDTVAQK+VV  
Sbjct  12   MKVVKGDFGYMLEDVPHLSDYLSDLPTYPNPLRFNPAYSVVKQYFVNVDDTVAQKIVVHT  71

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYF   EV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+G
Sbjct  72   DSPRGTHFRRAGPRQKVYFNPAEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSKVLG  131

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGYKGFY++N + LTPKVVNDIHKRGGTI+GTSRGGHDT KIVD IQDRGIN VYIIG
Sbjct  132  IDGGYKGFYARNTITLTPKVVNDIHKRGGTIIGTSRGGHDTAKIVDSIQDRGINHVYIIG  191

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V+VAGIPKTI
Sbjct  192  GDGTQKGAAVIYEEIRRRGLKVSVAGIPKTI  222



>ref|XP_008450803.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis melo]
Length=495

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M + G  +    +K V+GD GYVLEDVPH SDY+ +LPTY NPLQDNP+YSVVKQYFV V
Sbjct  1    MATTGNNIDSSKVKIVHGDGGYVLEDVPHFSDYISDLPTYANPLQDNPAYSVVKQYFVHV  60

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QKVVV K SPRG HFRRAGPRQ+VYF++DEV+ACIVTCGGLCPGLNTVIRE+VCG
Sbjct  61   DDSVPQKVVVHKSSPRGIHFRRAGPRQRVYFQADEVHACIVTCGGLCPGLNTVIRELVCG  120

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L++MYGVKKV+GI+GGY+GFYSKN +HLTPK VNDIHKRGGT++GTSRGGHDT KIVD I
Sbjct  121  LYNMYGVKKVLGIEGGYRGFYSKNTIHLTPKFVNDIHKRGGTVIGTSRGGHDTSKIVDSI  180

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GA+ I+EE++RRGL+V+V GIPKTI
Sbjct  181  QDRGINQVYIIGGDGTQKGAAAIYEEVRRRGLKVSVVGIPKTI  223



>ref|NP_567742.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
 sp|Q94AA4.1|PFKA3_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 3; Short=ATP-PFK 
3; Short=Phosphofructokinase 3; AltName: Full=Phosphohexokinase 
3 [Arabidopsis thaliana]
 gb|AAK83587.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AAL90928.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AEE85178.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
Length=489

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K +NG  GYVLEDVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVIGIPKTI  219



>ref|XP_002867573.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43832.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K +N   GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIINSSCGYVLEDVPHLSDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
 gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
Length=489

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K +NG  GYVLEDVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVIGIPKTI  219



>ref|XP_004135681.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 ref|XP_004158426.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 gb|KGN66195.1| hypothetical protein Csa_1G575110 [Cucumis sativus]
Length=492

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M + G  +     K V+GD GYVLEDVPH SDY+ +LPTY NPLQDNP+YSVVKQYFV V
Sbjct  1    MATTGNNIDSSKAKIVHGDGGYVLEDVPHFSDYISDLPTYANPLQDNPAYSVVKQYFVHV  60

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QKVVV K SPRG HFRRAGPRQ+VYF++DEV+ACIVTCGGLCPGLNTVIRE+VCG
Sbjct  61   DDSVPQKVVVHKSSPRGIHFRRAGPRQRVYFQADEVHACIVTCGGLCPGLNTVIRELVCG  120

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L++MYGVKKV+GI+GGY+GFYSKN +HLTPK VNDIHKRGGT++GTSRGGHDT KIVD I
Sbjct  121  LYNMYGVKKVLGIEGGYRGFYSKNTIHLTPKFVNDIHKRGGTVIGTSRGGHDTSKIVDSI  180

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GA+ I+EE++RRGL+V+V GIPKTI
Sbjct  181  QDRGINQVYIIGGDGTQKGAAAIYEEVRRRGLKVSVVGIPKTI  223



>ref|XP_009337906.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337907.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337917.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337918.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=484

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            KT  G  GYVL+DVPHL DY+P+L TYPNPLQDNPSYS VKQYFV+ DDTVAQK+VV KD
Sbjct  10   KTATGPSGYVLQDVPHLVDYIPDLQTYPNPLQDNPSYSGVKQYFVNADDTVAQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S EV+AC+VTCGGLCPGLNT IREIVCGL+HMYGVK+++GI
Sbjct  70   SPRGTHFRRSGPRQKVYFESSEVHACVVTCGGLCPGLNTAIREIVCGLNHMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY+GFY++N + LTP+VVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  VGGYRGFYARNTIPLTPEVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GTQRGAS+IFEEI+RRGL+VAVAGIPKTI
Sbjct  190  NGTQRGASLIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_004238509.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Solanum 
lycopersicum]
Length=499

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 195/225 (87%), Gaps = 2/225 (1%)
 Frame = -1

Query  669  MGS--EGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
            MGS  + FA+     K V GD+GYV EDVPHLSDY+P+LPTYPNPL+ NPSYSVV QYFV
Sbjct  1    MGSLVDSFALHNLNKKIVMGDNGYVFEDVPHLSDYIPSLPTYPNPLKKNPSYSVVNQYFV  60

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
            D DDTVAQ +VVRK+SPRG HFRRAGP Q VYFK+D+VNACIVTCGGLCPGLNTVIREIV
Sbjct  61   DEDDTVAQNIVVRKNSPRGIHFRRAGPSQDVYFKADDVNACIVTCGGLCPGLNTVIREIV  120

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGL+ MYGV +VMGIDGGY+GFYSKN + LTP VVNDIHKRGGTILG+SRGGH TKKIVD
Sbjct  121  CGLYSMYGVARVMGIDGGYRGFYSKNTIPLTPNVVNDIHKRGGTILGSSRGGHVTKKIVD  180

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGT +GAS+IFEEI RRGL V V GIPKTI
Sbjct  181  SIQDRGINQVYIIGGDGTLKGASLIFEEITRRGLNVVVVGIPKTI  225



>ref|XP_008375836.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=484

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            KT  G  GYVLEDVPHL DY+P+LPTYPNPLQDNPSYS VKQYFV+ DDTVAQK+V+ KD
Sbjct  10   KTXTGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSGVKQYFVNADDTVAQKIVIHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRR+GPRQKVYF+S EV+AC+VTCGGLCPGLNT IREIVCGL+HMYGVK+++GI
Sbjct  70   SPRGTHFRRSGPRQKVYFESSEVHACVVTCGGLCPGLNTAIREIVCGLNHMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY+ N + LT KVVNDIHK GGTILGTSRGGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  EGGYRGFYAANTIPLTAKVVNDIHKSGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GTQRGASVIFEEI+RRGL+VAVAGIPKT+
Sbjct  190  NGTQRGASVIFEEIRRRGLKVAVAGIPKTV  219



>ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
 gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
Length=489

 Score =   368 bits (944),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K +NG  GYVLEDVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  K VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKAVNDIHKRGGTILGTSRGGHDTVKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_010690141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   367 bits (941),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -1

Query  663  SEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDD  484
            SE   +QP ++K + G+ G+VLEDVPHLSDY+PNLPTYPNPL+DNPSYSVVKQ+FVD +D
Sbjct  4    SEDSIIQPVIVKIMEGEFGFVLEDVPHLSDYLPNLPTYPNPLEDNPSYSVVKQHFVDDED  63

Query  483  TVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLH  304
            TVAQ +VV +DSPRG HFRRAGPR++V F++DEV ACIVTCGGLCPGLNTV+REIVCGL+
Sbjct  64   TVAQTIVVHEDSPRGIHFRRAGPRKRVAFEADEVVACIVTCGGLCPGLNTVVREIVCGLY  123

Query  303  HMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQD  124
            HMYGV +V+GI+GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD I+D
Sbjct  124  HMYGVTRVLGIEGGYRGFYARNTISLTPKSVNDIHKRGGTILGTSRGGHDTTKIVDSIED  183

Query  123  RGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            RGINQVYIIGGDGTQRGAS IFEE++RRGL+V+V G+PKTI
Sbjct  184  RGINQVYIIGGDGTQRGASAIFEEVRRRGLKVSVIGVPKTI  224



>ref|XP_003620763.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES76981.1| 6-phosphofructokinase [Medicago truncatula]
Length=505

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  7    KVVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  66

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF+SDE+ A IVTCGGLCPGLNTVIRE+VC LHHMYGV +V+GI
Sbjct  67   SPRGVHFRRAGPRQKVYFESDEIQAAIVTCGGLCPGLNTVIRELVCSLHHMYGVTRVLGI  126

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTP  VN+IHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  127  EGGYRGFYARNTITLTPSSVNNIHKRGGTILGTSRGGHDTNKIVDSIQDRGINQVYIIGG  186

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEE++RRGL+ AV GIPKTI
Sbjct  187  DGTQRGASVIFEEVRRRGLKCAVVGIPKTI  216



>gb|AFW80264.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
Length=474

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  47   KLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  106

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  107  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVSSVVGI  166

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  167  EGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  226

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  227  DGTQKGASVIYEEVRRRGLKCSVVGVPKTI  256



>ref|XP_003529065.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
Length=536

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +DY+PNLPTYPNPLQDNP+YSVVKQYFV VDD+V QKVVV KD
Sbjct  50   KVVTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYFVHVDDSVPQKVVVHKD  109

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
              RG HFRRAGPRQKVYF++DEV A IVTCGGLCPGLNTVIRE+VCGLHHMYGVK+V+GI
Sbjct  110  GARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGLHHMYGVKRVLGI  169

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  170  NGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQDRGINQVYIIGG  229

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEE++RRGL+V+V GIPKTI
Sbjct  230  DGTQKGASAIFEEVRRRGLKVSVVGIPKTI  259



>gb|EYU30678.1| hypothetical protein MIMGU_mgv1a005513mg [Erythranthe guttata]
Length=481

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GY LEDVPHLSD++P+LPTYPNPLQDNP+YS V+QYFVD DDT+AQ +VV KD
Sbjct  10   KIVIGDFGYTLEDVPHLSDFIPDLPTYPNPLQDNPAYSAVRQYFVDYDDTIAQNIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            +PRG HFRRAGPRQ+VYF+SD+V+ACIVTCGGLCPGLNTVIREIVC L++MYGVK V+GI
Sbjct  70   TPRGIHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCSLNYMYGVKSVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGYKGFYSKN + LTPK VNDIHKRGGTILGTSRGG++TKKIVD IQDRGINQVYIIGG
Sbjct  130  HGGYKGFYSKNTISLTPKSVNDIHKRGGTILGTSRGGYETKKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIFEEIK+RGL+VAV GIPKTI
Sbjct  190  DGTQKGAAVIFEEIKKRGLKVAVVGIPKTI  219



>ref|XP_006371963.1| phosphofructokinase family protein [Populus trichocarpa]
 gb|ERP49760.1| phosphofructokinase family protein [Populus trichocarpa]
Length=492

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 196/223 (88%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G + Q    K + GD GY+L+DVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV V
Sbjct  1    MESNGISEQ----KIITGDSGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHV  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QK+VV KDSPRG HFRRAGPRQK+YF+ DEV ACIVTCGGLCPGLNTVIREIV  
Sbjct  57   DDSVPQKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYS  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L+HMYGV +V+GIDGGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIV  I
Sbjct  117  LYHMYGVTRVLGIDGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+V VAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQKGASVIFEEIRRRGLKVVVAGIPKTI  219



>ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
 gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
Length=487

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GYVL+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +KVVV KD
Sbjct  10   KIVNGPGGYVLQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVKK++GI
Sbjct  70   GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASV+FEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVLFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_010438777.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Camelina 
sativa]
Length=486

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVL+DVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIVEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVIGIPKTI  219



>ref|XP_010541000.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Tarenaya 
hassleriana]
Length=488

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFVD DDT+  K+VV  D
Sbjct  10   KIITGPAGYVLEDVPHLSDYIPSLPTYPNPLQDNPAYSVVKQYFVDEDDTIPHKIVVHPD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            +PRGTHFRRAGPRQ+VYF+ D+V ACIVTCGGLCPGLNTV REIVCGL +MYGVK+++GI
Sbjct  70   TPRGTHFRRAGPRQRVYFEPDDVLACIVTCGGLCPGLNTVTREIVCGLAYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L PKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVPLDPKVVNDIHKRGGTVLGTSRGGHDTAKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  190  DGTQKGAAVIFEEIRRRGLKVAVAGIPKTI  219



>ref|XP_008799762.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=538

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 4/224 (2%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            RMG EG   +P L K V G+ GY+LEDVPH +DY+P+LP +PNPLQDNPSYS V+QYFV+
Sbjct  55   RMGLEG---KPNL-KIVEGEGGYILEDVPHFTDYLPDLPNFPNPLQDNPSYSAVRQYFVN  110

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
            VDDTV QK+VV+K+SPRG HFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIRE+VC
Sbjct  111  VDDTVPQKIVVQKNSPRGLHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIRELVC  170

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL HMYGV +++GI+GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD 
Sbjct  171  GLSHMYGVSRILGIEGGYRGFYARNTIPLTPKFVNDIHKRGGTILGTSRGGHDTIKIVDN  230

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            I+DRG+NQVYIIGGDGTQ+GASVIFEEI+RRGLQVAV GIPKTI
Sbjct  231  IEDRGVNQVYIIGGDGTQKGASVIFEEIRRRGLQVAVVGIPKTI  274



>ref|XP_009409366.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 4/224 (2%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            +MGSE   + PK+     GD GYVLEDVPHL+DY+P+LPTYPNPLQDN +YSVVKQYFV+
Sbjct  54   KMGSEA-RLCPKIEY---GDGGYVLEDVPHLTDYLPDLPTYPNPLQDNTAYSVVKQYFVN  109

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
            +DDTVAQK+VV K+SPR THFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  110  LDDTVAQKIVVHKNSPRETHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVC  169

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL  MYGV K++GI+GGY+GFY++N + LT K VNDIHKRGGTILGTSRGGHDT KIVD 
Sbjct  170  GLSDMYGVTKILGIEGGYRGFYARNTISLTTKSVNDIHKRGGTILGTSRGGHDTIKIVDS  229

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDRGINQVYIIGGDGTQ+GAS IFEEI+RRGL+VA+AGIPKTI
Sbjct  230  IQDRGINQVYIIGGDGTQKGASAIFEEIQRRGLKVAIAGIPKTI  273



>ref|XP_010451330.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010451338.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like isoform 
X2 [Camelina sativa]
Length=360

 Score =   361 bits (926),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTY NPLQDNP+YSVVKQYFVD DD+V +KVVV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYTNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVKK++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_004513074.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=488

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K ++G  GYVLEDVPHLSDY+PNLPTYPNPLQ NP+YSVVKQYFV VDDTV QKVVV KD
Sbjct  7    KVISGPAGYVLEDVPHLSDYIPNLPTYPNPLQVNPAYSVVKQYFVHVDDTVPQKVVVHKD  66

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF+SDEV A IVTCGGLCPGLNTVIRE+VCGLHHMYGV +V+GI
Sbjct  67   SPRGVHFRRAGPRQKVYFESDEVQAAIVTCGGLCPGLNTVIRELVCGLHHMYGVTRVLGI  126

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTP  VN+IHKRGGT LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  127  EGGYRGFYARNTITLTPSSVNNIHKRGGTTLGTSRGGHDTNKIVDSIQDRGINQVYIIGG  186

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS IFEE++RRGL+ +V GIPKTI
Sbjct  187  DGTQRGASAIFEEVRRRGLKCSVVGIPKTI  216



>ref|XP_008654297.1| PREDICTED: uncharacterized protein LOC100192478 isoform X1 [Zea 
mays]
 gb|AFW80265.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  47   KLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  106

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  107  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVSSVVGI  166

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  167  EGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  226

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  227  DGTQKGASVIYEEVRRRGLKCSVVGVPKTI  256



>ref|XP_010433524.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Camelina sativa]
Length=488

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G  GYVL+DVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK+VV KD
Sbjct  10   KIIEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVIGIPKTI  219



>ref|XP_006656646.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=554

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 198/224 (88%), Gaps = 1/224 (0%)
 Frame = -1

Query  669  MGSEGFAVQPK-LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            + +EG A  PK  +K V GD GYVLEDVPH+SDY+P+LPTY NPLQDNP+YSVVKQYFV+
Sbjct  63   VAAEGDAAAPKPEVKLVTGDGGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVN  122

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
             DDTV QK ++ KD PRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  123  PDDTVCQKAIIHKDGPRGNHFRRAGPRQRVYFQSDEVSACIVTCGGLCPGLNTVIREIVC  182

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL+ MYGV +V+GI GGY+GFY+ N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD 
Sbjct  183  GLYDMYGVSRVLGIQGGYRGFYACNTIDLTPKSVNDIHKRGGTVLGTSRGGHDTTKIVDS  242

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDRGINQVY+IGGDGTQRGA VIFEE++RRGL+VAVAGIPKTI
Sbjct  243  IQDRGINQVYVIGGDGTQRGAGVIFEEVRRRGLKVAVAGIPKTI  286



>ref|NP_001266546.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG35405.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  47   KLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  106

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  107  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVSSVVGI  166

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  167  EGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  226

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  227  DGTQKGASVIYEEVRRRGLKCSVVGVPKTI  256



>ref|XP_009758764.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Nicotiana 
sylvestris]
Length=485

 Score =   365 bits (936),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHL+DY+P+LPTY NPL+ NP+YSVVKQYFVD+DDTV QKVV+ K
Sbjct  9    MKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVPQKVVIHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV G
Sbjct  69   DSPRGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVSKVFG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN++ LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNIITLTPKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVVVAGIPKTI  219



>gb|KEH21328.1| 6-phosphofructokinase [Medicago truncatula]
Length=375

 Score =   361 bits (926),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPHL+DY+P LPTY NPLQDNP+YSVVKQYFV +DD+V QK++  KD
Sbjct  10   KIVRGSAGYILEDVPHLTDYIPELPTYSNPLQDNPAYSVVKQYFVHIDDSVPQKIIANKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYFKSDEV A IVTCGGLCPGLNTVIRE+VCGL+HMYGVKKV+GI
Sbjct  70   SPRGIHFRRAGPRQKVYFKSDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMYGVKKVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGYKGFY+ N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  SGGYKGFYAHNTISLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA  IFEEI+ RGL+VAV GIPKTI
Sbjct  190  DGTQRGAYRIFEEIRNRGLKVAVVGIPKTI  219



>ref|XP_007152950.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
 gb|ESW24944.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
Length=531

 Score =   366 bits (940),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHL+DY PNLPTY NPLQDNP+YSVVKQYFV VDD+V QKVVV KD
Sbjct  50   KVVTGTAGYVLEDVPHLTDYFPNLPTYTNPLQDNPAYSVVKQYFVHVDDSVPQKVVVHKD  109

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
              RG HFRRAGPRQKVYF++DEV A IVTCGGLCPGLNTVIRE+VCGL+HMYGVKKV+GI
Sbjct  110  GARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGLNHMYGVKKVLGI  169

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  170  NGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQDRGINQVYIIGG  229

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEE++RRGL+V+V GIPKTI
Sbjct  230  DGTQKGASVIFEEVRRRGLKVSVVGIPKTI  259



>ref|XP_004302844.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=487

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 197/215 (92%), Gaps = 3/215 (1%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            QPK+   + G+ GYVLEDVPHLSDY+P+L TY NPLQDNPSYSVVKQYFV+VDD+VAQ +
Sbjct  8    QPKI---ITGEAGYVLEDVPHLSDYIPDLLTYSNPLQDNPSYSVVKQYFVNVDDSVAQTI  64

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV KDSPRGTHFRRAGPRQKVYF+ D+V+ACIVTCGGLCPGLNTVIREIVCGL++MYGV 
Sbjct  65   VVHKDSPRGTHFRRAGPRQKVYFEPDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVH  124

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +++GI+GGYKGFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQ R INQV
Sbjct  125  RILGIEGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQYRRINQV  184

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YI+GGDGTQ+GASVIFEE +RRGL+VAVAGIPKTI
Sbjct  185  YILGGDGTQKGASVIFEECRRRGLKVAVAGIPKTI  219



>ref|XP_009787997.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nicotiana 
sylvestris]
Length=233

 Score =   355 bits (911),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD+GYVLEDVPHL+DY+P+LPTY NPLQ NP+YSVVKQYFVD DDTV QK+VV K
Sbjct  9    MKVVEGDNGYVLEDVPHLTDYIPHLPTYDNPLQSNPAYSVVKQYFVDPDDTVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  69   DSPRGLHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVDKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY+KN ++LTPK+V+DIHKRGGTILGTSRGGHDT KIVD IQD GINQVYIIG
Sbjct  129  IEGGYRGFYAKNTINLTPKLVDDIHKRGGTILGTSRGGHDTTKIVDSIQDHGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVVVAGIPKTI  219



>gb|KFK27231.1| hypothetical protein AALP_AA8G354500 [Arabis alpina]
Length=489

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+V+ KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVIHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVKK++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>gb|AET05158.2| 6-phosphofructokinase [Medicago truncatula]
Length=384

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPHL+DY+P LPTY NPLQDNP+YSVVKQYFV +DD+V QK++  KD
Sbjct  10   KIVRGSAGYILEDVPHLTDYIPELPTYSNPLQDNPAYSVVKQYFVHIDDSVPQKIIANKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYFKSDEV A IVTCGGLCPGLNTVIRE+VCGL+HMYGVKKV+GI
Sbjct  70   SPRGIHFRRAGPRQKVYFKSDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMYGVKKVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGYKGFY+ N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  SGGYKGFYAHNTISLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA  IFEEI+ RGL+VAV GIPKTI
Sbjct  190  DGTQRGAYRIFEEIRNRGLKVAVVGIPKTI  219



>emb|CDY32873.1| BnaC09g33200D [Brassica napus]
Length=488

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_002457198.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
 gb|EES02318.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
Length=530

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  47   KLVGGDAGYVLEDVPHLTDYMPHLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  106

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  107  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGI  166

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  167  EGGYKGFYSKNTVPLTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  226

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V GIPKTI
Sbjct  227  DGTQKGASVIYEEVRRRGLKCSVVGIPKTI  256



>ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +KVVV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_010540999.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G  GYVLEDVPHLSDY+P+LPTYPNPLQDNP+YSVVKQYFVD DDT+  K+VV  D
Sbjct  77   KIITGPAGYVLEDVPHLSDYIPSLPTYPNPLQDNPAYSVVKQYFVDEDDTIPHKIVVHPD  136

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            +PRGTHFRRAGPRQ+VYF+ D+V ACIVTCGGLCPGLNTV REIVCGL +MYGVK+++GI
Sbjct  137  TPRGTHFRRAGPRQRVYFEPDDVLACIVTCGGLCPGLNTVTREIVCGLAYMYGVKRILGI  196

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN V L PKVVNDIHKRGGT+LGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  197  DGGYRGFYAKNTVPLDPKVVNDIHKRGGTVLGTSRGGHDTAKIVDSIQDRGINQVYIIGG  256

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  257  DGTQKGAAVIFEEIRRRGLKVAVAGIPKTI  286



>ref|XP_009120176.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Brassica rapa]
Length=488

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_003630681.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET05157.1| 6-phosphofructokinase [Medicago truncatula]
Length=475

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPHL+DY+P LPTY NPLQDNP+YSVVKQYFV +DD+V QK++  KD
Sbjct  10   KIVRGSAGYILEDVPHLTDYIPELPTYSNPLQDNPAYSVVKQYFVHIDDSVPQKIIANKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYFKSDEV A IVTCGGLCPGLNTVIRE+VCGL+HMYGVKKV+GI
Sbjct  70   SPRGIHFRRAGPRQKVYFKSDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMYGVKKVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGYKGFY+ N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  SGGYKGFYAHNTISLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA  IFEEI+ RGL+VAV GIPKTI
Sbjct  190  DGTQRGAYRIFEEIRNRGLKVAVVGIPKTI  219



>emb|CDX94352.1| BnaC01g18320D [Brassica napus]
 emb|CDX89351.1| BnaA01g15420D [Brassica napus]
Length=489

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G  GYVLEDVPHLSDY+P LPTY NPLQDNP+YSVVKQYFVD DDTV QK+VV KD
Sbjct  10   KIITGSCGYVLEDVPHLSDYLPALPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEE++RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEVRRRGLKVAVVGIPKTI  219



>ref|XP_006342512.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=485

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHL+DY+P+LPTY NPL+ NP+YSVVKQYFVD+DDTV QKVVV K
Sbjct  9    MKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVPQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV G
Sbjct  69   DSPRGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVFG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN+++LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDR INQVYIIG
Sbjct  129  IDGGYRGFYSKNIINLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDREINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVIVAGIPKTI  219



>ref|XP_010447334.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Camelina sativa]
Length=462

 Score =   362 bits (929),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 195/223 (87%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G   Q KL   V G  GYVLEDVPHLSDY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MASNGDDEQIKL---VEGPAGYVLEDVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDE  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV KDSPRGTHFRRAGPRQKVYFKS +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKSADVRACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  178  QDRGINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  220



>ref|XP_010443317.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Camelina 
sativa]
Length=485

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GYVL+DVPHL DY+P+LPTY NPLQDNP+YSVVKQYFVD DD+V +KVVV KD
Sbjct  10   KIVNGPGGYVLQDVPHLIDYLPDLPTYTNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVKK++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_010924464.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V GD GY+LEDVPH +DY+P+LPTY NPLQD+P+YSVV QYFVDVDDTV QK+VV K
Sbjct  10   LKVVKGDMGYILEDVPHFTDYLPDLPTYSNPLQDHPAYSVVTQYFVDVDDTVPQKIVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAG RQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL HMYGV +++G
Sbjct  70   DSPRGVHFRRAGARQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSHMYGVNRILG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY++N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD I+DRGINQVYIIG
Sbjct  130  IEGGYRGFYARNTMPLTPKFVNDIHKRGGTILGTSRGGHDTMKIVDNIEDRGINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  GDGTQRGASVIFEEIQRRGLKVAVVGIPKTI  220



>ref|XP_009603443.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Nicotiana tomentosiformis]
Length=485

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHL+DY+P+LPTY NPL+ NP+YSVVKQYFVD+DDTV QKVVV K
Sbjct  9    MKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVPQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DS RG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV G
Sbjct  69   DSARGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVSKVFG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN++ LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNIITLTPKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVVVAGIPKTI  219



>ref|XP_009142127.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Brassica rapa]
Length=490

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G  GYVLEDVPHLSDY+P LPTY NPLQDNP+YSVVKQYFVD DDTV QK+VV KD
Sbjct  10   KIITGSCGYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEE++RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEVRRRGLKVAVVGIPKTI  219



>ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=535

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G+ GYVLEDVPH SDY+ +LPTYPNPLQDNPSYSVVKQ+FVDVDD+VAQ +VV +D
Sbjct  64   KIITGEAGYVLEDVPHFSDYISDLPTYPNPLQDNPSYSVVKQHFVDVDDSVAQNIVVHQD  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRR GPR+KVYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGL++MYGV KV+GI
Sbjct  124  SPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHKVLGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK+VN IHKRGGTILGTSRGGHDT KIVD IQDRGINQVY++GG
Sbjct  184  EGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVLGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEI+RRGL+VAVAGIPKTI
Sbjct  244  DGTQKGASAIFEEIRRRGLKVAVAGIPKTI  273



>gb|EYU29302.1| hypothetical protein MIMGU_mgv1a005820mg [Erythranthe guttata]
Length=469

 Score =   362 bits (929),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 198/223 (89%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGSE    +   MK V G+ GYVL+DVPH SDY+P+LPTYPNPL+ NP+YSVVKQYFVD+
Sbjct  1    MGSE----RSYQMKVVTGEFGYVLQDVPHFSDYIPDLPTYPNPLRSNPAYSVVKQYFVDM  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V +K+VV KD+PRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  
Sbjct  57   DDSVPEKIVVHKDTPRGVHFRRAGPRQKVYFPSDEVHACIVTCGGLCPGLNTVIREIVHS  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L +MYGV KV+GIDGGY+GFY+KN + LTPK+VNDIHKRGGTILGTSRGGHDT KIVD I
Sbjct  117  LDYMYGVNKVLGIDGGYRGFYAKNTITLTPKIVNDIHKRGGTILGTSRGGHDTLKIVDSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGT +GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTLKGAAVIYEEIRKRGLKVAVAGIPKTI  219



>ref|XP_011006431.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=486

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 196/223 (88%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G + Q    K V GD GY+L+DVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV V
Sbjct  1    MESNGISEQ----KIVTGDFGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHV  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V +K+VV KDSPRG HFRRAGPRQK+YF+ DEV ACIVTCGGLCPGLNTVIREIV  
Sbjct  57   DDSVPEKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYS  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L+HMYGV +V+GIDGGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIV  I
Sbjct  117  LYHMYGVTRVLGIDGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEE++RRGL+V VAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQKGASVIFEEVRRRGLKVVVAGIPKTI  219



>ref|XP_010483140.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
 ref|XP_010483141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
Length=485

 Score =   362 bits (930),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTY NPLQDNP+YSVVKQYFVD DD+V +KVVV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYTNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVKK++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_011016327.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=484

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 196/223 (88%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G + Q    K V GD GY+L+DVPHL+DY+P+LPTY NPLQDNP+YSVVKQYFV V
Sbjct  1    MESNGISEQ----KIVTGDFGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHV  56

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V +K+VV KDSPRG HFRRAGPRQK+YF+ DEV ACIVTCGGLCPGLNTVIREIV  
Sbjct  57   DDSVPEKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYS  116

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L+HMYGV +V+GIDGGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIV  I
Sbjct  117  LYHMYGVTRVLGIDGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSI  176

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GASVIFEE++RRGL+V VAGIPKTI
Sbjct  177  QDRGINQVYIIGGDGTQKGASVIFEEVRRRGLKVVVAGIPKTI  219



>gb|EMT19126.1| 6-phosphofructokinase 3 [Aegilops tauschii]
Length=533

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 196/218 (90%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  43   WAMKKKL---VGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  99

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VVRK+S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  100  QKIVVRKNSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  159

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGI
Sbjct  160  GVTSVVGIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGI  219

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  220  NQVYIIGGDGTQQGASVIYEEVRRRGLKCAVVGVPKTI  257



>tpg|DAA53035.1| TPA: hypothetical protein ZEAMMB73_174506 [Zea mays]
Length=379

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  54   KLVGGDAGYVLEDVPHLTDYLPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  113

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  114  SARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGI  173

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTP+ VN IHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  174  EGGYKGFYSKNTVALTPRSVNGIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  233

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  234  DGTQKGASVIYEEVRRRGLKCAVVGVPKTI  263



>gb|EMS52572.1| 6-phosphofructokinase 3 [Triticum urartu]
Length=535

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 196/218 (90%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  45   WAMKKKL---VGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  101

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VVRK+S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  102  QKIVVRKNSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  161

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGI
Sbjct  162  GVTSVVGIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGI  221

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  222  NQVYIIGGDGTQQGASVIYEEVRRRGLKCAVVGVPKTI  259



>ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
 gb|ESQ42754.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
Length=490

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG   Y+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGDYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_002309230.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
 gb|EEE92753.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
Length=552

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = -1

Query  675  FRMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
            F M S   + +PK+   + GD GYVLEDVPH +DY+P+L TY NPLQDNP++ VVKQYFV
Sbjct  53   FAMASNDVS-KPKI---ITGDFGYVLEDVPHFTDYIPDLSTYSNPLQDNPAFCVVKQYFV  108

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
             VDD+V QK+VV KDSPRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV
Sbjct  109  HVDDSVPQKIVVHKDSPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIV  168

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
              L+HMYGV  V+GIDGGY+GFY++N + LTPKVVNDIHKRGGTILGTSRGGHDT KIVD
Sbjct  169  YSLYHMYGVTTVLGIDGGYRGFYARNTIALTPKVVNDIHKRGGTILGTSRGGHDTSKIVD  228

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGTQ+GASVIFEEI+RRGL+V VAGIPKTI
Sbjct  229  SIQDRGINQVYIIGGDGTQKGASVIFEEIRRRGLKVVVAGIPKTI  273



>ref|XP_011072633.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Sesamum indicum]
Length=457

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            KTV G+ GYVLEDVPHLSDY+P+LP Y NPLQDNPSYSVVKQYFV+ DD+V  K+VV KD
Sbjct  10   KTVAGEAGYVLEDVPHLSDYIPHLPAYLNPLQDNPSYSVVKQYFVNKDDSVTHKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKVYF+SDEV ACIVTCGGLCPG+NTVIRE+VCGLH+MYGV  V+GI
Sbjct  70   SPRGTHFRRAGPRQKVYFESDEVLACIVTCGGLCPGINTVIRELVCGLHYMYGVSSVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            + GY+GFYSKN + LTPKVV+DIHKRGG+I+GTSRGGHDT K+VD IQDRGINQVYIIGG
Sbjct  130  ESGYRGFYSKNTIPLTPKVVDDIHKRGGSIIGTSRGGHDTSKVVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA +IFEEI+RRGL+V+V GIPKTI
Sbjct  190  DGTQQGALLIFEEIRRRGLKVSVVGIPKTI  219



>ref|XP_009387228.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGSE  +     +K V G+ GYVLEDVPHL+DY+P+LP Y NPLQDNP+YSVVKQYFVD 
Sbjct  56   MGSEARSA----VKIVKGEFGYVLEDVPHLTDYLPDLPAYLNPLQDNPAYSVVKQYFVDH  111

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV++DSPRG HFRRAGPRQ+VYF+SD+V+ACIVTCGGLCPGLNTVIREIVCG
Sbjct  112  DDTVPEKIVVQRDSPRGLHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCG  171

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            L HMYGV K++GI+GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD I
Sbjct  172  LTHMYGVNKIIGIEGGYRGFYARNTIQLTPKSVNDIHKRGGTVLGTSRGGHDTLKIVDNI  231

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGTQ+GA+ IFEEI+RR L+V+VAGIPKTI
Sbjct  232  QDRGINQVYIIGGDGTQKGAAAIFEEIRRRRLKVSVAGIPKTI  274



>ref|XP_004253102.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Solanum 
lycopersicum]
Length=485

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD GYVLEDVPHL+DY+P+LPT+ NPL+ NP+YSVVKQYFVD+DDTV QKVVV K
Sbjct  9    MKVVKGDHGYVLEDVPHLTDYIPDLPTHDNPLRSNPAYSVVKQYFVDMDDTVPQKVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV G
Sbjct  69   DSPRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVSKVFG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN+++LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSKNIINLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RR L+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRDLKVIVAGIPKTI  219



>ref|XP_009602786.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Nicotiana tomentosiformis]
Length=500

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V GD+GYVLEDVPHL+DY+P+LPTY NPLQ NP+YSVVKQYFVD+DDTV QK+VV K
Sbjct  9    MKVVEGDNGYVLEDVPHLTDYIPHLPTYDNPLQSNPAYSVVKQYFVDMDDTVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  69   DSPRGLHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVDKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY+KN ++LTPK+V+DIHKRGGTILGTSRGGHDT KIVD IQD GINQVYIIG
Sbjct  129  IEGGYRGFYAKNTINLTPKLVDDIHKRGGTILGTSRGGHDTTKIVDSIQDHGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEIRRRGLKVVVAGIPKTI  219



>ref|XP_010451175.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Camelina sativa]
Length=456

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -1

Query  648  VQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQK  469
            V+    K + G  GYVL+DVPHLSDY+P LPTYPNPLQDNP+YSVVKQYFVD DD+V QK
Sbjct  4    VESSKPKIIEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQK  63

Query  468  VVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGV  289
            +VV KD PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGV
Sbjct  64   IVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGV  123

Query  288  KKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQ  109
            K+++GIDGGY+GFY+KN V L  KVVND HKRGGTI GTSRGGHDT KIVD IQDRGINQ
Sbjct  124  KRILGIDGGYRGFYAKNTVSLDSKVVNDSHKRGGTIPGTSRGGHDTTKIVDSIQDRGINQ  183

Query  108  VYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            VYIIGGDGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  184  VYIIGGDGTQRGASVIFEEIRRRGLKVAVIGIPKTI  219



>gb|AGT16840.1| 6-phosphofructokinase [Saccharum hybrid cultivar R570]
Length=498

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V+G+ GYVLEDVPH+SDY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  71   VKQVSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  130

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQ+VYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++G
Sbjct  131  DGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  190

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVY+IG
Sbjct  191  IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRGINQVYVIG  250

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  251  GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  281



>dbj|BAJ85701.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  43   WAMKKKL---VGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  99

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VVRK S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  100  QKIVVRKTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  159

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGI
Sbjct  160  GVTSVVGIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGI  219

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  220  NQVYIIGGDGTQQGASVIYEEVRRRGLKCAVVGVPKTI  257



>ref|XP_004964832.1| PREDICTED: 6-phosphofructokinase 7-like [Setaria italica]
Length=556

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V+G+ GYVLEDVPH+SDY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  73   VKLVSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  132

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQ+VYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++G
Sbjct  133  DGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  192

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVY+IG
Sbjct  193  IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDSIQDRGINQVYVIG  252

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  253  GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  283



>emb|CDP03227.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            QPK+   V G+ GYVLEDVPHLSDY+P+LPTY NPLQDNP+YS V+QYFV  DDTV QKV
Sbjct  8    QPKI---VTGEAGYVLEDVPHLSDYIPDLPTYTNPLQDNPAYSAVRQYFVHADDTVPQKV  64

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV    PRG HFRRAGPRQKV+F+SDEV+ACIVTCGGLCPGLNTVIREIVCGL +MYGV 
Sbjct  65   VVHATGPRGIHFRRAGPRQKVHFESDEVHACIVTCGGLCPGLNTVIREIVCGLKYMYGVN  124

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
            +V+GIDGGY+GFYS+N + LTPKVVNDIHKRGGT+LGTSRGGH TKKIVD IQDRGINQV
Sbjct  125  RVLGIDGGYRGFYSRNTISLTPKVVNDIHKRGGTVLGTSRGGHVTKKIVDSIQDRGINQV  184

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQ+GASVIFEEI++RGL+VAV G+PKTI
Sbjct  185  YIIGGDGTQKGASVIFEEIRKRGLKVAVVGVPKTI  219



>ref|XP_006412865.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54318.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=469

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPH SDY PN PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYVLEDVPHFSDYFPNAPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRRRGLKVAVAGIPKTI  220



>gb|KDO51846.1| hypothetical protein CISIN_1g009394mg [Citrus sinensis]
Length=535

 Score =   362 bits (929),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G+ GYVLEDVPH SDY+ +LPT+PNPLQDNPSYSVVKQ+FVDVDD+VAQ +VV +D
Sbjct  64   KIITGEAGYVLEDVPHFSDYISDLPTHPNPLQDNPSYSVVKQHFVDVDDSVAQNIVVHQD  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRR GPR+KVYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGL++MYGV KV+GI
Sbjct  124  SPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHKVLGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK+VN IHKRGGTILGTSRGGHDT KIVD IQDRGINQVY++GG
Sbjct  184  EGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVLGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEI+RRGL+VAVAGIPKTI
Sbjct  244  DGTQKGASAIFEEIRRRGLKVAVAGIPKTI  273



>ref|XP_009128951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 [Brassica rapa]
 emb|CDY48604.1| BnaA01g07610D [Brassica napus]
Length=473

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPH SDY+PN PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVKK++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSYMYGVKKILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + L  K VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  EGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+VIFEEI+RRGL+VAVAGIPKTI
Sbjct  191  DGSQKGAAVIFEEIRRRGLKVAVAGIPKTI  220



>emb|CDM81680.1| unnamed protein product [Triticum aestivum]
Length=534

 Score =   362 bits (928),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 196/218 (90%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  44   WAMKKKL---VGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  100

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VVRK+S RGTHFRRAGPRQ+VYF+ D+VNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  101  QKIVVRKNSARGTHFRRAGPRQRVYFQPDDVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  160

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGI
Sbjct  161  GVTSVVGIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGI  220

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  221  NQVYIIGGDGTQQGASVIYEEVRRRGLKCAVVGVPKTI  258



>ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
 gb|ESR40087.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
Length=576

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G+ GYVLEDVPH SDY+ +LPT+PNPLQDNPSYSVVKQ+FVDVDD+VAQ +VV +D
Sbjct  64   KIITGEAGYVLEDVPHFSDYISDLPTHPNPLQDNPSYSVVKQHFVDVDDSVAQNIVVHQD  123

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRR GPR+KVYF+SD+V+ACIVTCGGLCPGLNTVIREIVCGL++MYGV KV+GI
Sbjct  124  SPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHKVLGI  183

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTPK+VN IHKRGGTILGTSRGGHDT KIVD IQDRGINQVY++GG
Sbjct  184  EGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYVLGG  243

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEI+RRGL+VAVAGIPKTI
Sbjct  244  DGTQKGASAIFEEIRRRGLKVAVAGIPKTI  273



>ref|XP_010432655.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Camelina sativa]
Length=462

 Score =   359 bits (922),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 193/223 (87%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G   Q KL   V G  GYVLEDVPHLSDY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MASNGVDEQIKL---VEGPAGYVLEDVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDE  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  178  QDREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  220



>gb|AHB32113.1| 6-phosphofructokinase 3-like protein [Camellia sinensis]
 gb|AHE93342.1| phosphofructokinase [Camellia sinensis]
Length=495

 Score =   360 bits (924),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V+G  GYVLEDVPHL+DY+P+LPTYPNPL+ NP+YSVVKQYFV VDD+V QK+VV K
Sbjct  9    IKVVSGPAGYVLEDVPHLNDYIPDLPTYPNPLRSNPAYSVVKQYFVHVDDSVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            +SPRG HFRRAGPRQKVYF +DEV+ACIVTCGGLCPGLNTVIRE+VC L+HMYG  KV+G
Sbjct  69   ESPRGIHFRRAGPRQKVYFDADEVHACIVTCGGLCPGLNTVIRELVCSLYHMYGATKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYS+N + LTPKVVNDIHKRGGTI+GTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFYSRNSITLTPKVVNDIHKRGGTIIGTSRGGHDTSKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGT +GA+ IF+E++RRGL+VAV GIPKTI
Sbjct  189  GDGTLKGAAAIFQEVRRRGLKVAVVGIPKTI  219



>ref|XP_004968501.1| PREDICTED: 6-phosphofructokinase 3-like [Setaria italica]
Length=539

 Score =   361 bits (927),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   GD GYVLEDVPHL+DY+P LPT+PNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  51   KLAGGDAGYVLEDVPHLTDYLPELPTFPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  110

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTV+RE+VCGL+ MYGV  V+GI
Sbjct  111  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVVRELVCGLYDMYGVTSVVGI  170

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN + LTPK VNDIHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  171  EGGYKGFYSKNTIPLTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  230

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  231  DGTQKGASVIYEEVRRRGLKCSVVGVPKTI  260



>ref|XP_008648820.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Zea mays]
 gb|AFW75540.1| hypothetical protein ZEAMMB73_660971 [Zea mays]
Length=552

 Score =   362 bits (928),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
            ++K ++G+ GYVLEDVPH+SDY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV 
Sbjct  68   VVKLMSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVH  127

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            KD PRG HFRRAGPRQ+VYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++
Sbjct  128  KDGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKIL  187

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI GGY+GFY++N + LTPK+VNDIHKRGGT+LG+SRGGHDT KIVD IQDRGINQVY+I
Sbjct  188  GIQGGYRGFYARNTITLTPKIVNDIHKRGGTVLGSSRGGHDTVKIVDSIQDRGINQVYVI  247

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  248  GGDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  279



>emb|CDY69051.1| BnaAnng29210D, partial [Brassica napus]
Length=477

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  609  GYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGTHF  430
            GYVLEDVPHLSDY+P LPTY NPLQDNP+YSVVKQYFVD DDTV QK+VV KD PRG HF
Sbjct  2    GYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKDGPRGIHF  61

Query  429  RRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYKGF  250
            RRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L +MYGVK+++GIDGGY+GF
Sbjct  62   RRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGIDGGYRGF  121

Query  249  YSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQRGA  70
            Y++N V L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGGDGTQRGA
Sbjct  122  YARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGA  181

Query  69   SVIFEEIKRRGLQVAVAGIPKTI  1
            SVIFEE++RRGL+VAV GIPKTI
Sbjct  182  SVIFEEVRRRGLKVAVVGIPKTI  204



>emb|CDX88580.1| BnaA03g10690D [Brassica napus]
Length=485

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTY NPL+DNP+YSVVKQYFVD +DTV +K++V KD
Sbjct  5    KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L HMYGVK+++GI
Sbjct  65   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LT KVVNDIHKRGGTILGTSRGGHDTKKIVD IQ+RGINQVYIIGG
Sbjct  125  DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS IFEEI++RGL+VAV GIPKTI
Sbjct  185  DGTQRGASKIFEEIRKRGLKVAVVGIPKTI  214



>ref|NP_001042273.1| Os01g0191700 [Oryza sativa Japonica Group]
 dbj|BAD72228.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAD72231.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAF04187.1| Os01g0191700 [Oryza sativa Japonica Group]
 gb|EAY72859.1| hypothetical protein OsI_00730 [Oryza sativa Indica Group]
Length=531

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  40   WAMKKKL---VGGDAGYVLEDVPHLTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  96

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VV K S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  97   QKIVVHKTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  156

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGT+LGTSRGGHDT KIVD I+DRGI
Sbjct  157  GVTSVVGIEGGYKGFYSRNTVALTPKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGI  216

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  217  NQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTI  254



>ref|XP_006355296.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=493

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK VNGD GYVLEDVPHL+DY+PNLPTY NPL+ NP+YSVVKQYFVD+DDTV QK+VV K
Sbjct  9    MKVVNGDFGYVLEDVPHLTDYIPNLPTYDNPLRSNPAYSVVKQYFVDMDDTVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DS RG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  69   DSQRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVDKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY+KN ++LTPK+VNDIHKRGGTILGTSRGGHDTKKIVD IQD GINQVYIIG
Sbjct  129  IEGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTKKIVDSIQDHGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGT +GA +I+EEI+RRGL+V VAGIPKTI
Sbjct  189  GDGTLKGADIIYEEIRRRGLKVVVAGIPKTI  219



>dbj|BAJ85856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  43   WAMKKKL---VGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  99

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VVRK S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  100  QKIVVRKTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  159

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGI
Sbjct  160  GVTSVVGIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGI  219

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ AV G+PK I
Sbjct  220  NQVYIIGGDGTQQGASVIYEEVRRRGLKCAVVGVPKAI  257



>emb|CDY11911.1| BnaC03g13370D [Brassica napus]
Length=478

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTY NPL+DNP+YSVVKQYFVD +DTV +K++V KD
Sbjct  5    KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L HMYGVK+++GI
Sbjct  65   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LT KVVNDIHKRGGTILGTSRGGHDTKKIVD IQ+RGINQVYIIGG
Sbjct  125  DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS IFEEI++RGL+VAV GIPKTI
Sbjct  185  DGTQRGASKIFEEIRKRGLKVAVVGIPKTI  214



>ref|XP_009395732.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Musa acuminata subsp. malaccensis]
Length=522

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVLEDVPH +DY+P++PTYPNPLQDNP+YSVVK+YFV+ DDTV QK+VV+K+
Sbjct  63   KVVQGEFGYVLEDVPHFADYLPDVPTYPNPLQDNPAYSVVKKYFVNEDDTVPQKIVVQKN  122

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQ+VYF+ ++V ACIVTCGGLCPGLNTVIREIVCGL +MYGVKK++GI
Sbjct  123  SPRGIHFRRAGPRQRVYFEPEDVYACIVTCGGLCPGLNTVIREIVCGLSYMYGVKKIVGI  182

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY+GFYS+N + LTPK VNDIHKRGGTILGTSRGGHD  KIVD IQDRGINQVYIIGG
Sbjct  183  QGGYRGFYSRNTIPLTPKSVNDIHKRGGTILGTSRGGHDAIKIVDNIQDRGINQVYIIGG  242

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+VAVAGIPKTI
Sbjct  243  DGTQKGASVIFEEIQRRGLEVAVAGIPKTI  272



>gb|EAZ10866.1| hypothetical protein OsJ_00706 [Oryza sativa Japonica Group]
Length=503

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  654  FAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVA  475
            +A++ KL   V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV 
Sbjct  5    WAMKKKL---VGGDAGYVLEDVPHLTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVT  61

Query  474  QKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMY  295
            QK+VV K S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MY
Sbjct  62   QKIVVHKTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMY  121

Query  294  GVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGI  115
            GV  V+GI+GGYKGFYS+N V LTPK VNDIHKRGGT+LGTSRGGHDT KIVD I+DRGI
Sbjct  122  GVTSVVGIEGGYKGFYSRNTVALTPKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGI  181

Query  114  NQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            NQVYIIGGDGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  182  NQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTI  219



>ref|XP_002437847.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
 gb|EER89214.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
Length=539

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V+G+ GYVLEDVPH+SDY+P+LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV KD
Sbjct  70   KLVSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHKD  129

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQ+VYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++GI
Sbjct  130  GPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILGI  189

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVY+IGG
Sbjct  190  QGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRGINQVYVIGG  249

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  250  DGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  279



>ref|XP_011007273.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=566

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + GD GYVLEDVPH +DY+P+L TY NPLQDNP++SVVKQYFV VDD+V QK+VV KD
Sbjct  78   KIITGDFGYVLEDVPHFTDYIPDLSTYSNPLQDNPAFSVVKQYFVHVDDSVPQKIVVHKD  137

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  L+HMYGV  V+GI
Sbjct  138  SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVYSLYHMYGVTTVLGI  197

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N + LTPKVVNDIHKRGGTILGT+RGGHDT KIVD IQDRGINQVYIIGG
Sbjct  198  DGGYRGFYARNTIALTPKVVNDIHKRGGTILGTTRGGHDTSKIVDSIQDRGINQVYIIGG  257

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVIFEEI+RRGL+V VAG PKTI
Sbjct  258  DGTQKGASVIFEEIRRRGLKVVVAGSPKTI  287



>ref|XP_009132191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=485

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTY NPL+DNP+YSVVKQYFVD +DTV +K++V KD
Sbjct  5    KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIREIV  L HMYGVK+++GI
Sbjct  65   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + LT KVVNDIHKRGGTILGTSRGGHDTKKIVD IQ+RGINQVYIIGG
Sbjct  125  DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGAS IFEEI++RGL+VAV GIPKTI
Sbjct  185  DGTQRGASKIFEEIRKRGLKVAVIGIPKTI  214



>ref|XP_006853746.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
 gb|ERN15213.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
Length=480

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = -1

Query  645  QPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKV  466
            QPK+     G+ GYVLEDVPHL+DY+P+LPTY NPLQ NPSYSVV QYFV+VDDTV QK+
Sbjct  5    QPKIE---TGEGGYVLEDVPHLTDYIPHLPTYQNPLQHNPSYSVVTQYFVNVDDTVTQKI  61

Query  465  VVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVK  286
            VV K+SPRGTHFRRAGPR+KVYF+ DEV+ACIVTCGGLCPG+NTVIREIVCGL+HMYGV 
Sbjct  62   VVHKNSPRGTHFRRAGPREKVYFEPDEVSACIVTCGGLCPGVNTVIREIVCGLYHMYGVT  121

Query  285  KVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQV  106
             V+GI+ GYKGFYS+N + LTPK VNDIHKRGGTI+GTSRGGHDT KIVD IQDRGINQV
Sbjct  122  NVLGIEAGYKGFYSRNTIPLTPKFVNDIHKRGGTIIGTSRGGHDTSKIVDSIQDRGINQV  181

Query  105  YIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            YIIGGDGTQ+GA+ IFEEI +RG++VAVAGIPKTI
Sbjct  182  YIIGGDGTQKGAACIFEEILKRGIKVAVAGIPKTI  216



>emb|CDX68896.1| BnaC01g05570D [Brassica napus]
Length=463

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 194/223 (87%), Gaps = 2/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G  V  + MK V G  GYVLEDVPHLSDY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MDSNG--VDEQEMKLVQGAAGYVLEDVPHLSDYILDLPTYPNPLQSNPAYSVVRQYFVDE  58

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV QK+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  59   DDTVPQKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCG  118

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH+MYGV +V+G++ G+ GFYSKN V LTPK V+DIHKRGGT+LGTSRGGHDT KIVD I
Sbjct  119  LHYMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNI  178

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  179  QDREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  221



>gb|KDP40841.1| hypothetical protein JCGZ_24840 [Jatropha curcas]
Length=542

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K + G+ GYVLEDVPHL+DY+ +LPTYPNPLQDNPSYSVVKQYFV+ DDTVA+K+VV K+
Sbjct  67   KIIAGEAGYVLEDVPHLTDYISDLPTYPNPLQDNPSYSVVKQYFVNEDDTVAEKIVVHKE  126

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQKV+++SDEV+ACIVTCGGLCPGLNTVIRE+V GL++MYGV KV+GI
Sbjct  127  SPRGTHFRRAGPRQKVFYESDEVHACIVTCGGLCPGLNTVIRELVGGLYYMYGVNKVLGI  186

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFY++N + L+PKVVNDIHKRGGTILGTSRGG+DT KIVD IQDRGINQVYIIGG
Sbjct  187  EGGYKGFYARNTISLSPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIQDRGINQVYIIGG  246

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ GAS+IFEEI+RR L+V+V GIPKTI
Sbjct  247  DGTQNGASIIFEEIRRRALKVSVVGIPKTI  276



>ref|NP_001147976.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG29308.1| 6-phosphofructokinase 2 [Zea mays]
Length=525

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  51   KLVGGDAGYVLEDVPHLTDYLPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  110

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  111  SARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGI  170

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTP+ VN IHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  171  EGGYKGFYSKNTVALTPRSVNGIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  230

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  231  DGTQKGASVIYEEVRRRGLKCAVVGVPKTI  260



>ref|XP_004503509.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=479

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPHLSDY+P LP Y NPLQD+P+YSVVKQYFV +DD+V QK++  KD
Sbjct  10   KIVRGSAGYVLEDVPHLSDYIPELPAYSNPLQDHPAYSVVKQYFVHIDDSVPQKIIANKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+ DEV A IVTCGGLCPGLNTVIRE+VCGL+HMYGVKK++GI
Sbjct  70   SPRGTHFRRAGPRQRVYFEPDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMYGVKKILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGYKGFY+ N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  SGGYKGFYAHNTIPLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGA  IFEEI++RGL+VAV GIPKTI
Sbjct  190  DGTQRGAYRIFEEIRKRGLKVAVVGIPKTI  219



>ref|XP_006412426.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
 gb|ESQ53879.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
Length=462

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GYVLEDVPH SDY+ +LPTYPNPLQ NP+YSVV+QYFVD DDTV QK+VV K
Sbjct  10   MKLVEGAAGYVLEDVPHFSDYIHDLPTYPNPLQSNPAYSVVRQYFVDEDDTVPQKIVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D+PRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCGLH MYGV +V+G
Sbjct  70   DTPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            +D G++GFYSKN V LTPKVV+DIHKRGGTILGTSRGGH+T KIVD IQDR INQVYIIG
Sbjct  130  VDCGFRGFYSKNTVTLTPKVVSDIHKRGGTILGTSRGGHETSKIVDNIQDREINQVYIIG  189

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  190  GDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  220



>ref|XP_006412864.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54317.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=555

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPH SDY PN PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  97   KIVTGPAGYVLEDVPHFSDYFPNAPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPD  156

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  157  SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  216

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  217  DGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  276

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  277  DGSQKGAAAIFEEIRRRGLKVAVAGIPKTI  306



>ref|NP_001241814.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACN25788.1| unknown [Zea mays]
 tpg|DAA53036.1| TPA: 6-phosphofructokinase 2 [Zea mays]
Length=528

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  54   KLVGGDAGYVLEDVPHLTDYLPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVHKT  113

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+ DEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI
Sbjct  114  SARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGI  173

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYSKN V LTP+ VN IHKRGGT+LGTSRGGHDT KIVDC+QDRGINQVYIIGG
Sbjct  174  EGGYKGFYSKNTVALTPRSVNGIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYIIGG  233

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ AV G+PKTI
Sbjct  234  DGTQKGASVIYEEVRRRGLKCAVVGVPKTI  263



>ref|XP_010914787.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=538

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 199/225 (88%), Gaps = 6/225 (3%)
 Frame = -1

Query  672  RMGSEGFAVQPKL-MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
            RMG     ++PK   K V GD GY+LEDVPHL+DY+P+LP +PNPLQDNPSYS VKQYFV
Sbjct  55   RMG-----LEPKPDFKIVEGDYGYILEDVPHLTDYLPDLPNFPNPLQDNPSYSAVKQYFV  109

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
            + DDTV QK+VV+K++PRG HFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIRE+V
Sbjct  110  NADDTVPQKIVVQKNNPRGVHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIRELV  169

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGL  MYGV +++GI+GGY+GFY++N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD
Sbjct  170  CGLSDMYGVSRILGIEGGYRGFYARNTIPLTPKFVNDIHKRGGTVLGTSRGGHDTMKIVD  229

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRG+NQVYIIGGDGTQ+GA+VIFEEI+RRGL+VAV GIPKTI
Sbjct  230  NIQDRGVNQVYIIGGDGTQKGAAVIFEEIRRRGLEVAVVGIPKTI  274



>emb|CDY20715.1| BnaA02g08550D [Brassica napus]
Length=490

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDSDDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  L  MYGV +++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYGVNRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLESKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_010447333.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Camelina sativa]
Length=464

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 195/225 (87%), Gaps = 5/225 (2%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLP--TYPNPLQDNPSYSVVKQYFV  496
            M S G   Q KL   V G  GYVLEDVPHLSDY+ +LP  TYPNPLQ NP+YSVV+QYFV
Sbjct  1    MASNGDDEQIKL---VEGPAGYVLEDVPHLSDYIHDLPVLTYPNPLQSNPAYSVVRQYFV  57

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
            D DDTV +K+VV KDSPRGTHFRRAGPRQKVYFKS +V ACIVTCGGLCPGLNTVIREIV
Sbjct  58   DEDDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKSADVRACIVTCGGLCPGLNTVIREIV  117

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGLH MYGV +V+G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD
Sbjct  118  CGLHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVD  177

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  178  NIQDRGINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  222



>ref|XP_009126929.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=490

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDSDDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  L  MYGV +++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYGVNRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_003564709.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brachypodium 
distachyon]
Length=542

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K 
Sbjct  57   KLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKT  116

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL  MYGV  V+GI
Sbjct  117  SARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLCDMYGVTSVVGI  176

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGYKGFYS+N V LTPK VNDIHKRGGTILGTSRGGHDT KIVD +QDRGINQVYIIGG
Sbjct  177  EGGYKGFYSRNTVPLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYIIGG  236

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  237  DGTQQGASVIYEEVRRRGLKCSVVGVPKTI  266



>ref|XP_004245136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Solanum lycopersicum]
Length=500

 Score =   358 bits (919),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK VNGD GYVLEDVPHL+DY+PN+P + NPL+ NP+YSVVKQYFVD+DDTV QK+VV K
Sbjct  9    MKVVNGDFGYVLEDVPHLTDYIPNIPIFDNPLRSNPAYSVVKQYFVDMDDTVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DS RG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  69   DSQRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMYGVDKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY+KN ++LTPK+VNDIHKRGGTILGTSRGGHDTKKIVD IQD GINQVYIIG
Sbjct  129  IEGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTKKIVDSIQDHGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGT +GA++I+EEI+RRGL+VAVAGIPKTI
Sbjct  189  GDGTLKGAAIIYEEIRRRGLKVAVAGIPKTI  219



>emb|CDP08198.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GY+L+DVPHL+DY+P+LPT+PNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  1    MKVVAGPGGYILQDVPHLTDYIPDLPTHPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  60

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYFKSD+V+ACIVTCGGLCPGLNTVIREIV  L +MYGV KV+G
Sbjct  61   DSPRGIHFRRAGPRQKVYFKSDDVSACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  120

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  121  IDGGYRGFYSKNTIRLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  180

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+ I++E++ RGL+VAVAGIPKTI
Sbjct  181  GDGTQKGAAAIYKEVRSRGLKVAVAGIPKTI  211



>ref|XP_009125389.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brassica rapa]
Length=463

 Score =   357 bits (915),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 194/223 (87%), Gaps = 2/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G  V  + MK V G  GYVLEDVPHL+DY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MDSNG--VDEQEMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDE  58

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV QK+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  59   DDTVPQKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCG  118

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH+MYGV +V+G++ G+ GFYSKN V LTPK V+DIHKRGGT+LGTSRGGHDT KIVD I
Sbjct  119  LHYMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNI  178

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  179  QDREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  221



>gb|EYU20400.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G+ GY+L+DVPHL+DY+P+LPTYPNPL+ NP+YSVVKQYFVD+DD+V QK+VV +
Sbjct  1    MKVVTGEFGYILQDVPHLADYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKIVVHR  60

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D+PRG HFRRAGPRQKV F S+EVNACIVTCGGLCPGLNTVIREIV  L +MYGV +V+G
Sbjct  61   DTPRGVHFRRAGPRQKVCFASEEVNACIVTCGGLCPGLNTVIREIVHSLDYMYGVSEVLG  120

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPK V+DIHKRGGTI+GTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  121  IDGGYRGFYSKNTIPLTPKTVDDIHKRGGTIIGTSRGGHDTMKIVDSIQDRGINQVYIIG  180

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  181  GDGTQKGAAVIYEEIRKRGLKVAVAGIPKTI  211



>ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
 sp|Q9C5J7.1|PFKA7_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 7; Short=ATP-PFK 
7; Short=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 
7 [Arabidopsis thaliana]
 gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
Length=485

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFV  DD+V +KVVV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+V  L +MYGVK+++GI
Sbjct  70   GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTI+GTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLNSKVVNDIHKRGGTIIGTSRGGHDTNKIVDSIQDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RR L+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRRLKVAVVGIPKTI  219



>ref|XP_006643863.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=534

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  VNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSP  445
            V GD GYVLEDVPHL+DY+P LPTYPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K S 
Sbjct  48   VGGDGGYVLEDVPHLADYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSA  107

Query  444  RGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDG  265
            RGTHFRRAGPRQ+VYF+SDEVNA IVTCGGLCPGLNTVIRE+VCGL+ MYGV  V+GI+G
Sbjct  108  RGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGIEG  167

Query  264  GYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDG  85
            GYKGFYS+N + LTPK VNDIHKRGGTILGTSRGGHDT KIVD I+DR INQVYIIGGDG
Sbjct  168  GYKGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIKDRNINQVYIIGGDG  227

Query  84   TQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            TQ+GASVI+EE++RRGL+ +V G+PKTI
Sbjct  228  TQKGASVIYEEVRRRGLKCSVVGVPKTI  255



>gb|KFK29896.1| hypothetical protein AALP_AA7G192500 [Arabis alpina]
Length=460

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GYVLEDVPHLSDY+ +LPTYPNPLQ N +YSVV+QYFV  DDTV +K+VV K
Sbjct  8    MKLVEGTAGYVLEDVPHLSDYIHDLPTYPNPLQSNAAYSVVRQYFVHEDDTVMEKIVVHK  67

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCGLH MYGV +V+G
Sbjct  68   DSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIG  127

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            +D G++GFYSKN V LTPKVV+DIHKRGGTILGTSRGGHDT KIVD IQDR INQVYIIG
Sbjct  128  VDCGFRGFYSKNTVTLTPKVVSDIHKRGGTILGTSRGGHDTSKIVDNIQDREINQVYIIG  187

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  188  GDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  218



>gb|EYU20401.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G+ GY+L+DVPHL+DY+P+LPTYPNPL+ NP+YSVVKQYFVD+DD+V QK+VV +
Sbjct  1    MKVVTGEFGYILQDVPHLADYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKIVVHR  60

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D+PRG HFRRAGPRQKV F S+EVNACIVTCGGLCPGLNTVIREIV  L +MYGV +V+G
Sbjct  61   DTPRGVHFRRAGPRQKVCFASEEVNACIVTCGGLCPGLNTVIREIVHSLDYMYGVSEVLG  120

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN + LTPK V+DIHKRGGTI+GTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  121  IDGGYRGFYSKNTIPLTPKTVDDIHKRGGTIIGTSRGGHDTMKIVDSIQDRGINQVYIIG  180

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EEI++RGL+VAVAGIPKTI
Sbjct  181  GDGTQKGAAVIYEEIRKRGLKVAVAGIPKTI  211



>ref|NP_195010.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
 sp|Q9M076.1|PFKA6_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 6; Short=ATP-PFK 
6; Short=Phosphofructokinase 6; AltName: Full=Phosphohexokinase 
6 [Arabidopsis thaliana]
 emb|CAB80001.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAO64936.1| At4g32840 [Arabidopsis thaliana]
 dbj|BAE99473.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEE86125.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
Length=462

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G   Q KL   V G  GYVLEDVPHLSDY+ +LPTYPNPLQ N +YSVV+QYFVD 
Sbjct  1    MASNGVDEQIKL---VEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDE  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GA+ I++EI+RRGL+VAVAGIPKTI
Sbjct  178  QDREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTI  220



>emb|CDP14248.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M +E    +PKL   V GD GYVLEDVPHLSDY+P+L TY NPLQ++ +YSVVKQYFV+V
Sbjct  1    MSTENGCAEPKL---VTGDAGYVLEDVPHLSDYIPDLLTYTNPLQNHHAYSVVKQYFVNV  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V +K+VV + SPRGTHFRRAGPRQKV F+SDEV ACIVTCGGLCPGLNTVIRE+VCG
Sbjct  58   DDSVTKKIVVGRSSPRGTHFRRAGPRQKVCFESDEVLACIVTCGGLCPGLNTVIRELVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV  ++GI+ GYKGFYS+N + L PKVVNDIH+RGGTILGTSRGGH+T KIVD I
Sbjct  118  LHDMYGVNSILGIEDGYKGFYSRNTIPLRPKVVNDIHRRGGTILGTSRGGHNTSKIVDSI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDRGINQVYIIGGDGT +GA++IFEEI+RRGL+VAV GIPKTI
Sbjct  178  QDRGINQVYIIGGDGTHKGAAMIFEEIRRRGLKVAVVGIPKTI  220



>gb|AAM65566.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
Length=462

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G   Q KL   V G  GYVLEDVPHLSDY+ +LPTYPNPLQ N +YSVV+QYFVD 
Sbjct  1    MASNGVDEQIKL---VEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDE  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GA+ I++EI+RRGL+VAVAGIPKTI
Sbjct  178  QDREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTI  220



>ref|XP_009395051.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G+ GYVLEDVPHL+DY+ +LPTYPNP+++NP+YSVVKQ+FV+ DDTV +KVVV+K
Sbjct  68   IKIVKGEFGYVLEDVPHLTDYLADLPTYPNPIKENPAYSVVKQFFVNQDDTVPKKVVVQK  127

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SD+VNACIVTCGGLCPGLNTVIREI+CGL +MY V KV+G
Sbjct  128  DSPRGIHFRRAGPRQRVYFESDDVNACIVTCGGLCPGLNTVIREIICGLSYMYDVNKVLG  187

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY++N + LTPK VNDIHKRGGTIL TSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  188  IEGGYRGFYARNTIQLTPKSVNDIHKRGGTILSTSRGGHDTLKIVDNIQDRGINQVYIIG  247

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  248  GDGTQKGAAAIFEEIRRRRLKVAVAGIPKTI  278



>ref|XP_009395050.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G+ GYVLEDVPHL+DY+ +LPTYPNP+++NP+YSVVKQ+FV+ DDTV +KVVV+K
Sbjct  68   IKIVKGEFGYVLEDVPHLTDYLADLPTYPNPIKENPAYSVVKQFFVNQDDTVPKKVVVQK  127

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SD+VNACIVTCGGLCPGLNTVIREI+CGL +MY V KV+G
Sbjct  128  DSPRGIHFRRAGPRQRVYFESDDVNACIVTCGGLCPGLNTVIREIICGLSYMYDVNKVLG  187

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGY+GFY++N + LTPK VNDIHKRGGTIL TSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  188  IEGGYRGFYARNTIQLTPKSVNDIHKRGGTILSTSRGGHDTLKIVDNIQDRGINQVYIIG  247

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  248  GDGTQKGAAAIFEEIRRRRLKVAVAGIPKTI  278



>ref|XP_010437846.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Camelina 
sativa]
Length=462

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 191/223 (86%), Gaps = 3/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G   Q KL   V G  GYVLE VPHLSDY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MASNGVDEQIKL---VEGPAGYVLEGVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDE  57

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV +K+VV KDSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  58   DDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCG  117

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+D G++GFYSKN   LTPK V+DIHKRGGTILGTSRGGHDT KIVD I
Sbjct  118  LHFMYGVTEVIGVDCGFRGFYSKNTAALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNI  177

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  178  QDREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  220



>tpg|DAA57728.1| TPA: hypothetical protein ZEAMMB73_790705 [Zea mays]
Length=407

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  84   FVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  143

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+E  ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  144  KNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  203

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQV+II
Sbjct  204  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFII  263

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGLQVAVAGIPKTI
Sbjct  264  GGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTI  295



>ref|XP_003564328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Brachypodium 
distachyon]
Length=551

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 195/224 (87%), Gaps = 1/224 (0%)
 Frame = -1

Query  672  RMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVD  493
            R   +G A +P+  K V G+ GYVLEDVPHLSDY+P+LPTY NPLQDNP+YSVVKQYFV+
Sbjct  56   REAMDGTAAKPE-TKLVAGEAGYVLEDVPHLSDYLPDLPTYSNPLQDNPAYSVVKQYFVN  114

Query  492  VDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVC  313
             DDTV QK+VV K   RG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVC
Sbjct  115  PDDTVCQKIVVHKGGARGNHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVC  174

Query  312  GLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDC  133
            GL  MYGV K++GI GGY+GFY+ N ++LTPK VNDIHKRGGTILG+SRGGHDT KIVD 
Sbjct  175  GLSDMYGVTKILGIQGGYRGFYACNTINLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDS  234

Query  132  IQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IQDR INQVY+IGGDG+QRGA VIFEE++RRGL+VAVAGIPKTI
Sbjct  235  IQDRVINQVYVIGGDGSQRGARVIFEEVRRRGLKVAVAGIPKTI  278



>ref|XP_006285234.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
 gb|EOA18132.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
Length=473

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  PN PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  12   KIVTGPAGYILEDVPHFTDDFPNAPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  71

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  72   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  131

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGH+T KIVD IQDRGINQVYIIGG
Sbjct  132  DGGYRGFYARNTIHLDIKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  191

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  192  DGSQKGAAAIFEEIRRRGLKVAVAGIPKTI  221



>emb|CDX75291.1| BnaA01g04110D [Brassica napus]
Length=463

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 193/223 (87%), Gaps = 2/223 (1%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            M S G  V  + MK V G  GYVLEDVPHL+DY+ +LPTYPNPLQ NP+YSVV+QYFVD 
Sbjct  1    MDSNG--VDEQEMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDE  58

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DDTV QK+VV K SPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  59   DDTVPQKIVVHKGSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCG  118

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH+MYGV +V+G++ G+ GFYSKN V LTPK V+DIHKRGGT+LGTSRGGHDT KIVD I
Sbjct  119  LHYMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNI  178

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+GAS I++EI+RRGL+VAVAGIPKTI
Sbjct  179  QDREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTI  221



>gb|ACL53548.1| unknown [Zea mays]
 gb|ACN28560.1| unknown [Zea mays]
 gb|AFW85827.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G+ GYVLEDVPH+SDY+P+LPTY NPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  68   VKLVPGEAGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  127

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQKVYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++G
Sbjct  128  DGPRGNHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  187

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDR INQVY+IG
Sbjct  188  IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRDINQVYVIG  247

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  248  GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  278



>ref|XP_010526087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Tarenaya hassleriana]
Length=459

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = -1

Query  669  MGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDV  490
            MGS    V  + MK V G  GYVLEDVPHLSDY+ +LP YPNPL+ NP+YSVV+QYFV  
Sbjct  1    MGSNSNGVNAQ-MKLVEGSAGYVLEDVPHLSDYISDLPIYPNPLRSNPAYSVVRQYFVHD  59

Query  489  DDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCG  310
            DD+V QKVVV KD+PRG HFRRAGPRQKVYFK D+V ACIVTCGGLCPGLNTVIREIVCG
Sbjct  60   DDSVPQKVVVHKDTPRGIHFRRAGPRQKVYFKPDDVRACIVTCGGLCPGLNTVIREIVCG  119

Query  309  LHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCI  130
            LH MYGV +V+G+DGGY+GFYSKN V LTPK V+DIHKRGGT+LGTSRGGHDT KIVD I
Sbjct  120  LHFMYGVTEVIGVDGGYRGFYSKNTVTLTPKSVSDIHKRGGTVLGTSRGGHDTIKIVDNI  179

Query  129  QDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            QDR INQVYIIGGDGTQ+G + ++EEI+RRGL+V +AGIPKTI
Sbjct  180  QDREINQVYIIGGDGTQKGVAAMYEEIRRRGLKVVIAGIPKTI  222



>ref|XP_002867225.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43484.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G  GYVLEDVPHLSDY+ +LPTYPNPLQ N +YSVV+QYFVD DDTV +K+VV K
Sbjct  9    IKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDEDDTVQEKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCGLH MYGV +V+G
Sbjct  69   DSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            +D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD I+DR INQVYIIG
Sbjct  129  VDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIEDREINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GAS I++EI+RRGL+V+VAGIPKTI
Sbjct  189  GDGTQKGASAIYKEIRRRGLKVSVAGIPKTI  219



>emb|CDY41800.1| BnaC02g12110D [Brassica napus]
Length=485

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFVD DD+V +K+VV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF SDEV+ACIVTCGGLCPGLNTVIREIV  L  MY V +++GI
Sbjct  70   GPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYSVNRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY+KN + L  KVVNDIHKRGGTILGTSRGGHDT KIVD I DRGINQVYIIGG
Sbjct  130  DGGYRGFYAKNTIPLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSILDRGINQVYIIGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+VAV GIPKTI
Sbjct  190  DGTQRGASVIFEEIRRRGLKVAVVGIPKTI  219



>ref|XP_009337910.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Pyrus 
x bretschneideri]
Length=474

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G  GYVLEDVPHL DY+P+LPTYPNPLQDNPSYSVVKQYFV+VDDTVA+K+VV+K+
Sbjct  10   KMATGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNVDDTVAEKIVVQKE  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRGTHFRR+GPRQKVYF+S++V+ACIVTCGGLCPGLNTVIREIVCGL+HMYGVK+++GI
Sbjct  70   DPRGTHFRRSGPRQKVYFESNDVHACIVTCGGLCPGLNTVIREIVCGLNHMYGVKRILGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + LTP VVNDIHKRGGTIL TSR G +T KIVD IQ RGINQVY++GG
Sbjct  130  EGGYRGFYARNTIPLTPLVVNDIHKRGGTILRTSRDGRNTSKIVDSIQYRGINQVYVLGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GAS IFEEI+RRGL+VAVAGIP TI
Sbjct  190  DGTQKGASAIFEEIRRRGLKVAVAGIPNTI  219



>ref|NP_001151911.1| 6-phosphofructokinase [Zea mays]
 gb|ACG44918.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G+ GYVLEDVPH+SDY+P+LPTY NPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  68   VKLVPGEAGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  127

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQKVYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++G
Sbjct  128  DGPRGNHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  187

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDR INQVY+IG
Sbjct  188  IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRDINQVYVIG  247

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  248  GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  278



>gb|AFW85828.1| hypothetical protein ZEAMMB73_244047 [Zea mays]
 gb|AFW85829.1| hypothetical protein ZEAMMB73_244047 [Zea mays]
Length=566

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V G+ GYVLEDVPH+SDY+P+LPTY NPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  68   VKLVPGEAGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  127

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            D PRG HFRRAGPRQKVYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++G
Sbjct  128  DGPRGNHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  187

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQDR INQVY+IG
Sbjct  188  IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRDINQVYVIG  247

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQRGA VIFEE++RRGL+V+VAGIPKTI
Sbjct  248  GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTI  278



>emb|CDY06829.1| BnaC01g09280D [Brassica napus]
Length=479

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 188/216 (87%), Gaps = 6/216 (3%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GYVLEDVPH SDY+PN PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVKK++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSYMYGVKKILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            +GGY+GFY++N + L  K VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  EGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFE------EIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFE      EI+RRGL+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEARAQNFEIRRRGLKVAVAGIPKTI  226



>ref|XP_006583042.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=464

 Score =   351 bits (901),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 193/210 (92%), Gaps = 2/210 (1%)
 Frame = -1

Query  624  VNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSP  445
            + G  GYVLEDVPHLSDY+P+L TYPNPLQDNPSYSVVK++ VDVDDT+AQKVVV K+SP
Sbjct  9    ITGHAGYVLEDVPHLSDYIPHLTTYPNPLQDNPSYSVVKEHSVDVDDTIAQKVVVHKNSP  68

Query  444  RGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDG  265
            R THFRRAGPRQKVYF+S++V ACIVTCGGLCPG+NTVIREIVCGL+HMYGV KV+GI+G
Sbjct  69   RETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVHKVLGIEG  128

Query  264  GYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSR--GGHDTKKIVDCIQDRGINQVYIIGG  91
            GY+GFYS N + LTPKVVNDIHKRGGTILGTS+  GG+DT KIVD IQDRGINQVYI+GG
Sbjct  129  GYRGFYSCNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQDRGINQVYILGG  188

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+V+V GIP+++
Sbjct  189  DGTQRGASVIFEEIRRRGLKVSVVGIPESV  218



>ref|XP_010047299.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X2 [Eucalyptus 
grandis]
Length=464

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
             K + GD GYVLEDVPHLSDY+ ++ TYPNPLQ +P+YSVVKQYFV+VD +VAQ VVV K
Sbjct  9    FKVIKGDAGYVLEDVPHLSDYIADISTYPNPLQSHPAYSVVKQYFVNVDASVAQTVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
             S RG HFRRAGPRQ+VYFKSDEV ACIVTCGGLCPG+NTVIRE+VCGL+HMYGV KV+G
Sbjct  69   SSQRGIHFRRAGPRQRVYFKSDEVRACIVTCGGLCPGVNTVIRELVCGLYHMYGVSKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGYKGFYS++ + L+PKVVN+IHKRGGTILGTSRGG+D KKIVD IQDRGINQVYIIG
Sbjct  129  IEGGYKGFYSRDFIDLSPKVVNNIHKRGGTILGTSRGGYDNKKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDG Q+GA ++ EE++RRGL+VAVAGIPKTI
Sbjct  189  GDGAQKGAELVCEEVRRRGLKVAVAGIPKTI  219



>ref|XP_011081730.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=496

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK + GD GYVL+DVPHL+DY+PNLPTYPNPL+ NP+YSVVKQYFVD+DD+V QK+VV K
Sbjct  9    MKVITGDSGYVLQDVPHLTDYIPNLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DS RG HFRRAGPRQ+VYF  +EV+ACIVTCGGLCPGLNTVIREIV  L +MYG  +V+G
Sbjct  69   DSQRGVHFRRAGPRQRVYFAPEEVHACIVTCGGLCPGLNTVIREIVHSLDYMYGATRVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GF++KN + LTPK V+ IHKRGGTILGTSRGGHDTKKIVD IQDRGINQVYIIG
Sbjct  129  IDGGYRGFFAKNTIPLTPKGVDHIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDGTQ+GA+VI+EE+++RGL+V VAGIPKTI
Sbjct  189  GDGTQKGAAVIYEEVRKRGLKVVVAGIPKTI  219



>dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=488

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 189/213 (89%), Gaps = 3/213 (1%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K VNG  GY+L+DVPHL DY+P+LPTYPNPLQDNP+YSVVKQYFV  DD+V +KVVV KD
Sbjct  10   KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKD  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQKVYF+SDEV+ACIVTCGGLCPGLNTVIRE+V  L +MYGVK+++GI
Sbjct  70   GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGI  129

Query  270  D---GGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYI  100
            D   GGY+GFY+KN + L  KVVNDIHKRGGTI+GTSRGGHDT KIVD IQDRGINQVYI
Sbjct  130  DVSLGGYRGFYAKNTIPLNSKVVNDIHKRGGTIIGTSRGGHDTNKIVDSIQDRGINQVYI  189

Query  99   IGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IGGDGTQRGASVIFEEI+RR L+VAV GIPKTI
Sbjct  190  IGGDGTQRGASVIFEEIRRRRLKVAVVGIPKTI  222



>ref|XP_010047298.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79181.1| hypothetical protein EUGRSUZ_C00617 [Eucalyptus grandis]
Length=486

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
             K + GD GYVLEDVPHLSDY+ ++ TYPNPLQ +P+YSVVKQYFV+VD +VAQ VVV K
Sbjct  9    FKVIKGDAGYVLEDVPHLSDYIADISTYPNPLQSHPAYSVVKQYFVNVDASVAQTVVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
             S RG HFRRAGPRQ+VYFKSDEV ACIVTCGGLCPG+NTVIRE+VCGL+HMYGV KV+G
Sbjct  69   SSQRGIHFRRAGPRQRVYFKSDEVRACIVTCGGLCPGVNTVIRELVCGLYHMYGVSKVLG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            I+GGYKGFYS++ + L+PKVVN+IHKRGGTILGTSRGG+D KKIVD IQDRGINQVYIIG
Sbjct  129  IEGGYKGFYSRDFIDLSPKVVNNIHKRGGTILGTSRGGYDNKKIVDSIQDRGINQVYIIG  188

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GDG Q+GA ++ EE++RRGL+VAVAGIPKTI
Sbjct  189  GDGAQKGAELVCEEVRRRGLKVAVAGIPKTI  219



>dbj|BAK01448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   G+ GYVL+DVPH+SDY+P+LPTYPNPLQDN +YSVVKQYFV+ DDTV QK+VV KD
Sbjct  12   KLAAGEAGYVLDDVPHVSDYLPDLPTYPNPLQDNTAYSVVKQYFVNPDDTVCQKIVVHKD  71

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRRAGPRQ+VYF+ DEV+ACIVTCGGLCPGLNTVIREIVCGL  MYGV K++GI
Sbjct  72   GPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILGI  131

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY+GFY++N + LTPK VNDIHKRGGTILG+SRGGHDT KIVD IQ RGINQVY+IGG
Sbjct  132  QGGYRGFYARNTIDLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDSIQYRGINQVYVIGG  191

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+QRGA VIFEE+++RGL+VAVAGIPKTI
Sbjct  192  DGSQRGAGVIFEEVRKRGLKVAVAGIPKTI  221



>gb|KHN39263.1| 6-phosphofructokinase 3 [Glycine soja]
Length=464

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -1

Query  624  VNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSP  445
            + G  GYVLEDVPHLSDY+P+L TYPNPLQDNPSYSVVK++ VDVDDT+AQK +V K+SP
Sbjct  9    ITGHAGYVLEDVPHLSDYIPHLTTYPNPLQDNPSYSVVKEHSVDVDDTIAQKAIVHKNSP  68

Query  444  RGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDG  265
            R THFRRAGPRQKVYF+S++V ACIVTCGGLCPG+NTVIREIVCGL+HMYGV KV+GI+G
Sbjct  69   RETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVHKVLGIEG  128

Query  264  GYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSR--GGHDTKKIVDCIQDRGINQVYIIGG  91
            GY+GFYS N + LTPKVVNDIHKRGGTILGTS+  GG+DT KIVD IQDRGINQVYI+GG
Sbjct  129  GYRGFYSCNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQDRGINQVYILGG  188

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQRGASVIFEEI+RRGL+V+V GIP+++
Sbjct  189  DGTQRGASVIFEEIRRRGLKVSVVGIPESV  218



>ref|XP_007150587.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150588.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150589.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22581.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22582.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22583.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
Length=474

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
            ++ +     G+VLEDVPHLSDY+P+LPTYP+PLQDNPSYSVV QY+V+VDDTVAQ+++V 
Sbjct  1    MLDSTTAASGFVLEDVPHLSDYIPHLPTYPDPLQDNPSYSVVAQYYVNVDDTVAQQIIVH  60

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGP QKVYF S+EV AC+VTCGGLCPGLNTVIREIVCGL+HMYGV KV+
Sbjct  61   KNSPRGAHFRRAGPAQKVYFDSEEVYACVVTCGGLCPGLNTVIREIVCGLYHMYGVHKVL  120

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI+GGY GFYS+N V LTPKVVNDIHKRGGTILGTS GGHDT KIVD I+DRGINQVYI+
Sbjct  121  GIEGGYPGFYSRNTVPLTPKVVNDIHKRGGTILGTSYGGHDTSKIVDSIEDRGINQVYIL  180

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GG GTQ  A++IFEE++RRGL+VAV GIPKTI
Sbjct  181  GGYGTQYEAAMIFEEVRRRGLKVAVVGIPKTI  212



>ref|XP_010433122.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433123.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
Length=472

 Score =   349 bits (896),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL    VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRRRKLKVAVAGIPKTI  220



>ref|XP_002867420.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43679.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   349 bits (895),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYILEDVPHFTDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDLKTVNDIHRTGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IF+EI++RGL+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFKEIRKRGLKVAVAGIPKTI  220



>ref|XP_002458460.1| hypothetical protein SORBIDRAFT_03g034060 [Sorghum bicolor]
 gb|EES03580.1| hypothetical protein SORBIDRAFT_03g034060 [Sorghum bicolor]
Length=561

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  88   FVKIEEGDFGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  147

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+EV ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  148  KNSPRGVHFRRAGPRQRVYFESEEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  207

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQVYII
Sbjct  208  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYII  267

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGL VAVAGIPKTI
Sbjct  268  GGDGTQKGAYEIYKEIRRRGLHVAVAGIPKTI  299



>ref|XP_007137259.1| hypothetical protein PHAVU_009G112400g [Phaseolus vulgaris]
 gb|ESW09253.1| hypothetical protein PHAVU_009G112400g [Phaseolus vulgaris]
Length=210

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            +K V+GD GY+LEDVPH +DY+ NLPTYPNPL+ NP+YSVVKQYFV +DDTV QKVVV K
Sbjct  10   LKIVHGDAGYILEDVPHFTDYILNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  69

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQKVYFKSD+V+ACIVTCGGLCPGLNTVIREIVCGL +MYGV KV+G
Sbjct  70   DSPRGVHFRRAGPRQKVYFKSDDVHACIVTCGGLCPGLNTVIREIVCGLSYMYGVNKVLG  129

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFYSKN ++LTPKVVNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYIIG
Sbjct  130  IDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQVYIIG  189

Query  93   GDGTQRGASVIFE  55
            GDGTQRGA+VI+E
Sbjct  190  GDGTQRGAAVIYE  202



>ref|NP_001147854.1| 6-phosphofructokinase [Zea mays]
 gb|ACG28906.1| 6-phosphofructokinase [Zea mays]
 gb|ACN34492.1| unknown [Zea mays]
 tpg|DAA57729.1| TPA: 6-phosphofructokinase [Zea mays]
Length=564

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  84   FVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  143

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+E  ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  144  KNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  203

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQV+II
Sbjct  204  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFII  263

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGLQVAVAGIPKTI
Sbjct  264  GGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTI  295



>gb|ACR36601.1| unknown [Zea mays]
Length=564

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  84   FVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  143

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+E  ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  144  KNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  203

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQV+II
Sbjct  204  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFII  263

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGLQVAVAGIPKTI
Sbjct  264  GGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTI  295



>ref|XP_010438324.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010438325.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  +
Sbjct  11   KIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPN  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL    VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRRRKLKVAVAGIPKTI  220



>ref|XP_006283577.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
 gb|EOA16475.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
Length=502

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = -1

Query  639  KLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVV  460
            +++K V G  GYVLEDVPHLSDY+ +L TYPNPLQ NP+YSVV+QYFV  DDTV +K+VV
Sbjct  56   EVIKLVEGPAGYVLEDVPHLSDYIHDLTTYPNPLQANPAYSVVRQYFVHEDDTVQEKIVV  115

Query  459  RKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKV  280
              DSPRGTHFRRAGPRQKVYFK  +V ACIVTCGGLCPGLNTVIREIVCGLH MYGV +V
Sbjct  116  HMDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEV  175

Query  279  MGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYI  100
            +G+D G++GFYSKN V LTPK V+DIHKRGGTILGTSRGGHDT KIVD IQDR INQVYI
Sbjct  176  IGVDCGFRGFYSKNTVSLTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQDREINQVYI  235

Query  99   IGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            IGGDGTQ+GA+ I++EI+RRGL+VAVAGIPKTI
Sbjct  236  IGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTI  268



>ref|NP_194651.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
 sp|Q9M0F9.1|PFKA1_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 1; Short=ATP-PFK 
1; Short=Phosphofructokinase 1; AltName: Full=Phosphohexokinase 
1 [Arabidopsis thaliana]
 emb|CAB79680.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
 gb|AAU90083.1| At4g29220 [Arabidopsis thaliana]
 gb|AEE85604.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
Length=473

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH SD  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGH+T KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI++R L+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRKRKLKVAVAGIPKTI  220



>gb|AAM91591.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=473

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH SD  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL  K VNDIH+ GGTILGTSRGGH+T KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI++R L+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRKRKLKVAVAGIPKTI  220



>ref|XP_010433121.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Camelina 
sativa]
Length=549

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  88   KIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPD  147

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  148  SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  207

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL    VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  208  DGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  267

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  268  DGSQKGAAAIFEEIRRRKLKVAVAGIPKTI  297



>ref|XP_003543617.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
 ref|XP_006595112.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
 ref|XP_006595113.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Glycine max]
 gb|KHN30018.1| 6-phosphofructokinase 3 [Glycine soja]
Length=481

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K      G+VLEDVPHLSDY+P L TYP+PLQDNPSYSVV QY+V+VDDT+AQ++VV K+
Sbjct  10   KITTAASGFVLEDVPHLSDYIPLLQTYPDPLQDNPSYSVVAQYYVNVDDTIAQQIVVHKN  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGP QKVYF S+EV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+GI
Sbjct  70   SPRGTHFRRAGPAQKVYFDSEEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVHKVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY GFYS+N V LTPKVVNDIHKRGG+ILGTS GGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  QGGYPGFYSRNTVPLTPKVVNDIHKRGGSILGTSYGGHDTSKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             GTQ  A++IFEE++RRGL+VAV GIPKTI
Sbjct  190  YGTQYEAAMIFEEVRRRGLKVAVVGIPKTI  219



>ref|XP_008447566.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=530

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  618  GDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRG  439
            GD  YVLEDVPHL+DY+P+LP   NPLQD+P+YS VKQYFV+VDD VAQ VVV  +SPRG
Sbjct  54   GDYHYVLEDVPHLTDYLPDLPANLNPLQDHPAYSAVKQYFVNVDDAVAQNVVVHNNSPRG  113

Query  438  THFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGY  259
            THFRRAGPRQKV+F+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+GI+GGY
Sbjct  114  THFRRAGPRQKVFFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVHKVVGIEGGY  173

Query  258  KGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQ  79
            +GFY++N + LTPK VN+IHKRGGTILGTSRGGH+T KIVD IQ RGINQVYI+GGDGTQ
Sbjct  174  RGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  233

Query  78   RGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  234  KGAAAIFEEIRRRGLKVAVAGIPKTI  259



>ref|XP_010438323.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X1 [Camelina sativa]
Length=547

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  GY+LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  +
Sbjct  86   KIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPN  145

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF+SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  146  SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  205

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL    VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  206  DGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  265

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  266  DGSQKGAAAIFEEIRRRKLKVAVAGIPKTI  295



>ref|XP_003568068.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Brachypodium 
distachyon]
Length=553

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K   GD GYVL+DVPHL+DY+P++PTYPNPLQD+P+YS VKQYFV+ DDTV QKVVV+K+
Sbjct  68   KISEGDFGYVLDDVPHLADYLPDIPTYPNPLQDHPAYSTVKQYFVNEDDTVPQKVVVQKN  127

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            S RG HFRRAGPRQ+VYF+SDEV ACIVTCGGLCPGLNTVIRE+VCGL HMY V K+ GI
Sbjct  128  SRRGVHFRRAGPRQRVYFESDEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNKIYGI  187

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
              GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQVYIIGG
Sbjct  188  QNGYKGFYSSNYLAVTPKTVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIGG  247

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GA  I++EI++RGL+VAVAG+PKTI
Sbjct  248  DGTQKGAYEIYKEIRKRGLKVAVAGVPKTI  277



>ref|XP_010447879.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
 ref|XP_010447880.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
Length=472

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G  G +LEDVPH +D  P+ PTYPNPLQDN +YSVVKQYFVD DDTV QK+VV  D
Sbjct  11   KIVTGSAGSILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPD  70

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGPRQ+VYF SD+V ACIVTCGGLCPGLNTVIREIVCGL +MYGVK+++GI
Sbjct  71   SPRGTHFRRAGPRQRVYFNSDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  130

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            DGGY+GFY++N +HL    VNDIH+ GGTILGTSRGGHDT KIVD IQDRGINQVYIIGG
Sbjct  131  DGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  190

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DG+Q+GA+ IFEEI+RR L+VAVAGIPKTI
Sbjct  191  DGSQKGAAAIFEEIRRRKLKVAVAGIPKTI  220



>ref|XP_003546601.1| PREDICTED: 6-phosphofructokinase 3 isoform X1 [Glycine max]
 ref|XP_006597174.1| PREDICTED: 6-phosphofructokinase 3 isoform X2 [Glycine max]
 ref|XP_006597175.1| PREDICTED: 6-phosphofructokinase 3 isoform X3 [Glycine max]
 ref|XP_006597176.1| PREDICTED: 6-phosphofructokinase 3 isoform X4 [Glycine max]
 ref|XP_006597177.1| PREDICTED: 6-phosphofructokinase 3 isoform X5 [Glycine max]
 gb|KHN32659.1| 6-phosphofructokinase 3 [Glycine soja]
Length=481

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K      G+VLEDVPHLS Y+P+L TYP+PLQDNPSYSVV QY+V+VDDT+AQ++VV K+
Sbjct  10   KITTAASGFVLEDVPHLSAYIPHLQTYPDPLQDNPSYSVVAQYYVNVDDTIAQQIVVHKN  69

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
            SPRGTHFRRAGP QKVYF S+EV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV KV+GI
Sbjct  70   SPRGTHFRRAGPAQKVYFDSEEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVHKVLGI  129

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
             GGY GFYS+N V LTPKVVNDIHKRGG+ILGTS GGHDT KIVD IQDRGINQVYI+GG
Sbjct  130  QGGYPGFYSRNTVPLTPKVVNDIHKRGGSILGTSYGGHDTSKIVDSIQDRGINQVYILGG  189

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             GTQ  A++IFEE++RRGL+VAV GIPKTI
Sbjct  190  YGTQYEAAMIFEEVRRRGLKVAVVGIPKTI  219



>gb|EMT10635.1| 6-phosphofructokinase 3 [Aegilops tauschii]
Length=569

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 188/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  675  FRMGSEGFAVQPKLMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFV  496
             R  S         +K   GD GYVL+DVPHL+DY+P++PTYPNPLQD+P+YS VKQYFV
Sbjct  69   LRNASHASLTDAAYVKISEGDFGYVLDDVPHLADYIPDVPTYPNPLQDHPAYSTVKQYFV  128

Query  495  DVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIV  316
            D DDTV QKVVV+K+S RG HFRRAGPRQ+V F+SDEV ACIV+CGGLCPGLNTVIRE+V
Sbjct  129  DEDDTVPQKVVVQKNSRRGVHFRRAGPRQRVNFESDEVKACIVSCGGLCPGLNTVIRELV  188

Query  315  CGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVD  136
            CGL HMY V  + GI  GYKGFYS N V +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD
Sbjct  189  CGLAHMYNVNNIFGIQNGYKGFYSSNYVAITPKTVNDIHKRGGTVLGTSRGGHDTKKIVD  248

Query  135  CIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             IQDRGINQVYIIGGDGTQ+GA  I++EI++RGL+VAVAG+PKTI
Sbjct  249  NIQDRGINQVYIIGGDGTQKGAYEIYKEIRKRGLKVAVAGVPKTI  293



>ref|XP_010688378.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  KTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKD  451
            K V G+ GYVL+DVPHLSDY+ NLPTYPNPLQDNPSYSVVKQYFVD DDTV QK V  K+
Sbjct  4    KIVTGEGGYVLDDVPHLSDYLTNLPTYPNPLQDNPSYSVVKQYFVDFDDTVVQKAVQHKN  63

Query  450  SPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGI  271
             PRG HFRR GPRQKVY+KSDEV ACIVTCGGLCPGLNTVIRE+VCGL +MYGVK ++GI
Sbjct  64   GPRGIHFRRQGPRQKVYYKSDEVTACIVTCGGLCPGLNTVIRELVCGLDYMYGVKNILGI  123

Query  270  DGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGG  91
            + GYKGFY++N + LTPK V+ IHKRGGTILGTSRGG+ T KIVD IQDRGINQVYIIGG
Sbjct  124  ECGYKGFYARNTIPLTPKTVDSIHKRGGTILGTSRGGYVTSKIVDSIQDRGINQVYIIGG  183

Query  90   DGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            DGTQ+GASVI++E+++RGL+V+V GIPKTI
Sbjct  184  DGTQKGASVIYQEVRKRGLKVSVVGIPKTI  213



>ref|XP_008672829.1| PREDICTED: 6-phosphofructokinase isoform X2 [Zea mays]
Length=764

 Score =   353 bits (907),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  84   FVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  143

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+E  ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  144  KNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  203

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQV+II
Sbjct  204  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFII  263

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGLQVAVAGIPKTI
Sbjct  264  GGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTI  295



>ref|XP_008672828.1| PREDICTED: 6-phosphofructokinase isoform X1 [Zea mays]
Length=765

 Score =   353 bits (907),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  636  LMKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVR  457
             +K   GD GYVL+DVPHL+DY+P+LPT+PNPLQD+P+YS VKQYFV+ DDTV +KVVV+
Sbjct  84   FVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQ  143

Query  456  KDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVM  277
            K+SPRG HFRRAGPRQ+VYF+S+E  ACIVTCGGLCPGLNTVIRE+VCGL HMY V  V 
Sbjct  144  KNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVF  203

Query  276  GIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYII  97
            GI  GYKGFYS N + +TPK VNDIHKRGGT+LGTSRGGHDTKKIVD IQDRGINQV+II
Sbjct  204  GIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFII  263

Query  96   GGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
            GGDGTQ+GA  I++EI+RRGLQVAVAGIPKTI
Sbjct  264  GGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTI  295



>ref|XP_004158491.1| PREDICTED: 6-phosphofructokinase 3-like [Cucumis sativus]
Length=511

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  618  GDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRG  439
            GD  YVLEDVPHL+DY+P+LP   NPLQDNP+YS  KQYFV+VDD VAQ VVV  +SPRG
Sbjct  35   GDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNSPRG  94

Query  438  THFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGY  259
            THFRRAGPRQKV F+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+ MYGV +V+GI+GGY
Sbjct  95   THFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIEGGY  154

Query  258  KGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQ  79
            KGFY++N + LTPK VN+IHKRGGTILGTSRGGH+T KIVD IQ RGINQVYI+GGDGTQ
Sbjct  155  KGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  214

Query  78   RGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  215  KGAAAIFEEIRRRGLKVAVAGIPKTI  240



>ref|XP_004149188.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 7-like 
[Cucumis sativus]
Length=512

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  618  GDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRG  439
            GD  YVLEDVPHL+DY+P+LP   NPLQDNP+YS  KQYFV+VDD VAQ VVV  +SPRG
Sbjct  35   GDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNSPRG  94

Query  438  THFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGY  259
            THFRRAGPRQKV F+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+ MYGV +V+GI+GGY
Sbjct  95   THFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIEGGY  154

Query  258  KGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQ  79
            KGFY++N + LTPK VN+IHKRGGTILGTSRGGH+T KIVD IQ RGINQVYI+GGDGTQ
Sbjct  155  KGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  214

Query  78   RGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  215  KGAAAIFEEIRRRGLKVAVAGIPKTI  240



>ref|XP_009337911.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=484

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -1

Query  573  YVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFK  394
            ++ N+ TYPNPLQ NPSYSVVKQYFV+ DDTVAQK+VV KDSPRGTHFRR+GPRQKVYF+
Sbjct  32   FLMNIYTYPNPLQGNPSYSVVKQYFVNADDTVAQKIVVHKDSPRGTHFRRSGPRQKVYFE  91

Query  393  SDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKV  214
            S EV+ACIVTCGGLCPGLNTVIREIVCGL HMYGVK+++GI+GGY+GFY++N + LTPKV
Sbjct  92   SSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIEGGYRGFYARNTIPLTPKV  151

Query  213  VNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGL  34
            VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQVYI+GGDGTQRGASVIFEEI+RRGL
Sbjct  152  VNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGDGTQRGASVIFEEIRRRGL  211

Query  33   QVAVAGIPKTI  1
            +VAVAGIPKTI
Sbjct  212  KVAVAGIPKTI  222



>gb|KDO40000.1| hypothetical protein CISIN_1g0094442mg, partial [Citrus sinensis]
 gb|KDO40001.1| hypothetical protein CISIN_1g0094442mg, partial [Citrus sinensis]
 gb|KDO40002.1| hypothetical protein CISIN_1g0094442mg, partial [Citrus sinensis]
Length=334

 Score =   339 bits (870),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 201/239 (84%), Gaps = 13/239 (5%)
 Frame = -1

Query  678  KFRMGSEGFAVQPKL----------MKTVNG---DDGYVLEDVPHLSDYVPNLPTYPNPL  538
            KF   S  F ++P +          +++ N    +DG+VLEDVPHL++++P+LP+YPNPL
Sbjct  34   KFNFDSRNFEIKPLVSRQNRPVVVAVRSSNQKVHNDGFVLEDVPHLTNFLPDLPSYPNPL  93

Query  537  QDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCG  358
            + + +Y+VVKQ FV  +D VAQ +V++KDSPRG HFRRAGPR+KVYFKSDEV ACIVTCG
Sbjct  94   KKSQAYAVVKQTFVSPEDAVAQNIVIQKDSPRGVHFRRAGPREKVYFKSDEVRACIVTCG  153

Query  357  GLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTIL  178
            GLCPG+NTVIREIVCGL +MYGV +++GI+GGY+GFYSKN + L+PKVVNDIHKRGGTIL
Sbjct  154  GLCPGINTVIREIVCGLSYMYGVDEILGIEGGYRGFYSKNTLTLSPKVVNDIHKRGGTIL  213

Query  177  GTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             TSRGGHDT KIVD I+DRGINQVYIIGGDGTQ+GA++I++E+++RGLQVAVAGIPKTI
Sbjct  214  RTSRGGHDTNKIVDNIEDRGINQVYIIGGDGTQKGAALIYKEVEKRGLQVAVAGIPKTI  272



>gb|KGN58020.1| hypothetical protein Csa_3G435010 [Cucumis sativus]
Length=529

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  618  GDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRG  439
            GD  YVLEDVPHL+DY+P+LP   NPLQDNP+YS  KQYFV+VDD VAQ VVV  +SPRG
Sbjct  53   GDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNSPRG  112

Query  438  THFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGY  259
            THFRRAGPRQKV F+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+ MYGV +V+GI+GGY
Sbjct  113  THFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIEGGY  172

Query  258  KGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQ  79
            KGFY++N + LTPK VN+IHKRGGTILGTSRGGH+T KIVD IQ RGINQVYI+GGDGTQ
Sbjct  173  KGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  232

Query  78   RGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GA+ IFEEI+RRGL+VAVAGIPKTI
Sbjct  233  KGAAAIFEEIRRRGLKVAVAGIPKTI  258



>ref|XP_010275416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   346 bits (887),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  618  GDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRG  439
            GD G+VLEDVPHL+D++P+LP YPNPLQ + +Y++VKQ FV  +D VA+K+VV+K+SPRG
Sbjct  69   GDGGFVLEDVPHLTDFLPDLPAYPNPLQKSTAYAIVKQNFVSTEDVVAKKIVVQKNSPRG  128

Query  438  THFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGY  259
             HFRRAGP++KVYF+SDEV ACIVTCGGLCPG+NTVIREIVCGL++MYGV+ ++GI+GGY
Sbjct  129  VHFRRAGPQEKVYFESDEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVEDILGIEGGY  188

Query  258  KGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQ  79
            KGFYSKN   LTPKVVNDIHKRGGT L TSRGGHDTKKIVD IQDRGINQVYIIGGDGTQ
Sbjct  189  KGFYSKNTTTLTPKVVNDIHKRGGTFLRTSRGGHDTKKIVDSIQDRGINQVYIIGGDGTQ  248

Query  78   RGASVIFEEIKRRGLQVAVAGIPKTI  1
            +GA+ IF+E+++RGL+VAVAGIPKTI
Sbjct  249  KGAAAIFKEVEKRGLKVAVAGIPKTI  274



>gb|KDO39999.1| hypothetical protein CISIN_1g0094442mg [Citrus sinensis]
Length=337

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 201/239 (84%), Gaps = 13/239 (5%)
 Frame = -1

Query  678  KFRMGSEGFAVQPKL----------MKTVNG---DDGYVLEDVPHLSDYVPNLPTYPNPL  538
            KF   S  F ++P +          +++ N    +DG+VLEDVPHL++++P+LP+YPNPL
Sbjct  34   KFNFDSRNFEIKPLVSRQNRPVVVAVRSSNQKVHNDGFVLEDVPHLTNFLPDLPSYPNPL  93

Query  537  QDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGTHFRRAGPRQKVYFKSDEVNACIVTCG  358
            + + +Y+VVKQ FV  +D VAQ +V++KDSPRG HFRRAGPR+KVYFKSDEV ACIVTCG
Sbjct  94   KKSQAYAVVKQTFVSPEDAVAQNIVIQKDSPRGVHFRRAGPREKVYFKSDEVRACIVTCG  153

Query  357  GLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYKGFYSKNLVHLTPKVVNDIHKRGGTIL  178
            GLCPG+NTVIREIVCGL +MYGV +++GI+GGY+GFYSKN + L+PKVVNDIHKRGGTIL
Sbjct  154  GLCPGINTVIREIVCGLSYMYGVDEILGIEGGYRGFYSKNTLTLSPKVVNDIHKRGGTIL  213

Query  177  GTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
             TSRGGHDT KIVD I+DRGINQVYIIGGDGTQ+GA++I++E+++RGLQVAVAGIPKTI
Sbjct  214  RTSRGGHDTNKIVDNIEDRGINQVYIIGGDGTQKGAALIYKEVEKRGLQVAVAGIPKTI  272



>ref|XP_007012201.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
 gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
Length=479

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 185/211 (88%), Gaps = 11/211 (5%)
 Frame = -1

Query  633  MKTVNGDDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRK  454
            MK V G  GYVLEDVPHL+DY+P+LP+YPNPLQDNP+YSVVKQYFV+ DDTV QK+VV K
Sbjct  9    MKLVAGAAGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSVVKQYFVNEDDTVTQKIVVHK  68

Query  453  DSPRGTHFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMG  274
            DSPRG HFRRAGPRQ+VYF+SDEV+ACIVTCGGLCPGLNTVIREIVCGL+HMYGV+K++G
Sbjct  69   DSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRKILG  128

Query  273  IDGGYKGFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIG  94
            IDGGY+GFY+KN V LTPK VNDIHKRGGTILGTSRGGHDT KIVD IQDRGINQV    
Sbjct  129  IDGGYRGFYAKNTVTLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVL---  185

Query  93   GDGTQRGASVIFEEIKRRGLQVAVAGIPKTI  1
                     +IF+EI+RRGL+VAVAGIPKTI
Sbjct  186  --------HLIFQEIRRRGLKVAVAGIPKTI  208



>gb|KCW90881.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=401

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  DDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGT  436
            DDG+VLEDVPHL++++P+LP+YPNPL  + +Y++VKQ FV  +D VA+K+VVRKDSPRG 
Sbjct  56   DDGFVLEDVPHLTNFIPDLPSYPNPLHKSQAYAIVKQTFVSPEDVVAEKIVVRKDSPRGV  115

Query  435  HFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYK  256
            HFRRAGPR+KVYFKS+EV AC+VTCGGLCPG+NTVIREIVCGL++MYGV  ++GI+GGY+
Sbjct  116  HFRRAGPREKVYFKSEEVRACVVTCGGLCPGINTVIREIVCGLNYMYGVDDILGIEGGYR  175

Query  255  GFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQR  76
            GFYSKN   LTPKVVNDIHKRGGT L TSRGGHDT+KIVD IQDRGINQVYIIGGDGTQ+
Sbjct  176  GFYSKNTSQLTPKVVNDIHKRGGTFLRTSRGGHDTQKIVDNIQDRGINQVYIIGGDGTQK  235

Query  75   GASVIFEEIKRRGLQVAVAGIPKTI  1
            GA++I++E+++RGLQVAVAGIPKTI
Sbjct  236  GAALIYQEVEKRGLQVAVAGIPKTI  260



>ref|XP_004309023.1| PREDICTED: 6-phosphofructokinase 4, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=526

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  DDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGT  436
            DDG+VLEDVPHL+D++PNLP+YPNPLQ + +Y+VVKQ FV   D VAQKVVV+ DSPRG 
Sbjct  67   DDGFVLEDVPHLTDFLPNLPSYPNPLQQSQAYAVVKQTFVSPADAVAQKVVVQADSPRGV  126

Query  435  HFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYK  256
            HFRRAGPR+KVYFKS+EV ACIVTCGGLCPG+NTVIREIVCGL++MYGV+ ++GI+GGY+
Sbjct  127  HFRRAGPREKVYFKSEEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVEDILGIEGGYR  186

Query  255  GFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQR  76
            GFYSKN + L PKVVNDIHK+GGT L TSRGGHDT KIVD IQDRGINQVYIIGGDGTQ+
Sbjct  187  GFYSKNTLKLNPKVVNDIHKKGGTFLRTSRGGHDTNKIVDNIQDRGINQVYIIGGDGTQK  246

Query  75   GASVIFEEIKRRGLQVAVAGIPKTI  1
            GA++I++E+++RGLQVAVAG+PKTI
Sbjct  247  GAALIYKEVEKRGLQVAVAGVPKTI  271



>gb|KCW90882.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=416

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  DDGYVLEDVPHLSDYVPNLPTYPNPLQDNPSYSVVKQYFVDVDDTVAQKVVVRKDSPRGT  436
            DDG+VLEDVPHL++++P+LP+YPNPL  + +Y++VKQ FV  +D VA+K+VVRKDSPRG 
Sbjct  56   DDGFVLEDVPHLTNFIPDLPSYPNPLHKSQAYAIVKQTFVSPEDVVAEKIVVRKDSPRGV  115

Query  435  HFRRAGPRQKVYFKSDEVNACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVMGIDGGYK  256
            HFRRAGPR+KVYFKS+EV AC+VTCGGLCPG+NTVIREIVCGL++MYGV  ++GI+GGY+
Sbjct  116  HFRRAGPREKVYFKSEEVRACVVTCGGLCPGINTVIREIVCGLNYMYGVDDILGIEGGYR  175

Query  255  GFYSKNLVHLTPKVVNDIHKRGGTILGTSRGGHDTKKIVDCIQDRGINQVYIIGGDGTQR  76
            GFYSKN   LTPKVVNDIHKRGGT L TSRGGHDT+KIVD IQDRGINQVYIIGGDGTQ+
Sbjct  176  GFYSKNTSQLTPKVVNDIHKRGGTFLRTSRGGHDTQKIVDNIQDRGINQVYIIGGDGTQK  235

Query  75   GASVIFEEIKRRGLQVAVAGIPKTI  1
            GA++I++E+++RGLQVAVAGIPKTI
Sbjct  236  GAALIYQEVEKRGLQVAVAGIPKTI  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1957071984678