BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21940_g1_i2 len=2332 path=[404:0-401 806:402-433 3290:434-878
3734:879-1248 4104:1249-2331]

Length=2332
                                                                      Score     E

ref|XP_011083744.1|  PREDICTED: probable vacuolar amino acid tran...    398   1e-127   
ref|XP_007047037.1|  PQ-loop repeat family protein / transmembran...    386   3e-123   
emb|CDP07574.1|  unnamed protein product                                385   7e-123   
ref|XP_007047040.1|  PQ-loop repeat family protein / transmembran...    380   4e-121   
ref|XP_009374215.1|  PREDICTED: probable vacuolar amino acid tran...    377   1e-119   
ref|XP_004300590.1|  PREDICTED: uncharacterized protein LOC101293205    372   2e-117   
ref|XP_007047042.1|  PQ-loop repeat family protein / transmembran...    371   2e-117   
ref|XP_002274448.2|  PREDICTED: probable vacuolar amino acid tran...    371   3e-117   Vitis vinifera
ref|XP_008338172.1|  PREDICTED: lysosomal amino acid transporter ...    371   3e-117   
emb|CDP02413.1|  unnamed protein product                                370   5e-117   
gb|KDP31815.1|  hypothetical protein JCGZ_12276                         369   2e-116   
ref|XP_010649200.1|  PREDICTED: probable vacuolar amino acid tran...    369   2e-116   
ref|XP_008338915.1|  PREDICTED: lysosomal amino acid transporter ...    368   4e-116   
ref|NP_568009.5|  PQ-loop repeat family protein / transmembrane f...    368   7e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548371.1|  PREDICTED: probable vacuolar amino acid tran...    368   9e-116   
ref|XP_009379174.1|  PREDICTED: probable vacuolar amino acid tran...    364   1e-114   
ref|XP_011025699.1|  PREDICTED: lysosomal amino acid transporter ...    363   2e-114   
ref|XP_009141493.1|  PREDICTED: probable vacuolar amino acid tran...    362   2e-113   
gb|KHN36154.1|  Protein RTC2                                            361   2e-113   
ref|XP_003517255.1|  PREDICTED: lysosomal amino acid transporter ...    361   2e-113   
emb|CDX75602.1|  BnaA01g01000D                                          361   2e-113   
ref|XP_011099275.1|  PREDICTED: probable vacuolar amino acid tran...    361   2e-113   
ref|XP_009379175.1|  PREDICTED: probable vacuolar amino acid tran...    358   2e-112   
ref|XP_002533273.1|  conserved hypothetical protein                     358   2e-112   Ricinus communis
ref|XP_006411956.1|  hypothetical protein EUTSA_v10025420mg             358   3e-112   
ref|XP_006380747.1|  PQ-loop repeat family protein                      358   3e-112   
ref|XP_010029841.1|  PREDICTED: probable vacuolar amino acid tran...    356   2e-111   
ref|XP_009764841.1|  PREDICTED: lysosomal amino acid transporter ...    353   2e-110   
ref|XP_010432125.1|  PREDICTED: probable vacuolar amino acid tran...    353   5e-110   
ref|XP_007204395.1|  hypothetical protein PRUPE_ppa007096mg             352   6e-110   
ref|XP_007156890.1|  hypothetical protein PHAVU_002G025900g             352   8e-110   
ref|XP_008241616.1|  PREDICTED: probable vacuolar amino acid tran...    352   8e-110   
ref|XP_010254969.1|  PREDICTED: probable vacuolar amino acid tran...    352   9e-110   
ref|XP_010029840.1|  PREDICTED: probable vacuolar amino acid tran...    351   1e-109   
ref|XP_009621506.1|  PREDICTED: uncharacterized protein LOC104113...    351   2e-109   
ref|XP_006283881.1|  hypothetical protein CARUB_v10004998mg             351   2e-109   
ref|XP_003611897.1|  Membrane protein, putative                         350   3e-109   
ref|XP_010680925.1|  PREDICTED: uncharacterized protein LOC104895967    350   3e-109   
gb|KFK30302.1|  hypothetical protein AALP_AA7G244100                    350   5e-109   
ref|XP_010029842.1|  PREDICTED: probable vacuolar amino acid tran...    348   6e-109   
ref|XP_011025700.1|  PREDICTED: probable vacuolar amino acid tran...    349   8e-109   
ref|XP_010446736.1|  PREDICTED: probable vacuolar amino acid tran...    349   8e-109   
gb|ACJ84546.1|  unknown                                                 349   9e-109   Medicago truncatula
ref|XP_006425752.1|  hypothetical protein CICLE_v10025820mg             349   1e-108   
ref|XP_010437297.1|  PREDICTED: probable vacuolar amino acid tran...    349   1e-108   
ref|XP_006590674.1|  PREDICTED: probable vacuolar amino acid tran...    348   2e-108   
dbj|BAH56966.1|  AT4G36850                                              348   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233648.1|  PREDICTED: probable vacuolar amino acid tran...    347   4e-108   
ref|XP_010254970.1|  PREDICTED: probable vacuolar amino acid tran...    347   4e-108   
ref|XP_010254971.1|  PREDICTED: probable vacuolar amino acid tran...    346   1e-107   
ref|XP_003611896.1|  Membrane protein, putative                         345   3e-107   
ref|XP_006380745.1|  hypothetical protein POPTR_0007s12260g             344   7e-107   
ref|XP_006338274.1|  PREDICTED: seven transmembrane protein 1-like      343   1e-106   
ref|XP_008457880.1|  PREDICTED: probable vacuolar amino acid tran...    342   3e-106   
ref|XP_010254972.1|  PREDICTED: probable vacuolar amino acid tran...    341   6e-106   
ref|XP_002866989.1|  hypothetical protein ARALYDRAFT_490949             340   2e-105   
ref|XP_007156011.1|  hypothetical protein PHAVU_003G251100g             339   4e-105   
ref|XP_003547999.1|  PREDICTED: uncharacterized protein LOC100787660    337   2e-104   
ref|XP_010664648.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    329   2e-103   
ref|XP_010437298.1|  PREDICTED: probable vacuolar amino acid tran...    335   3e-103   
ref|XP_007047041.1|  PQ-loop repeat family protein / transmembran...    329   6e-102   
gb|AET03980.2|  PQ-loop protein/transmembrane family protein            329   3e-101   
ref|XP_008790228.1|  PREDICTED: probable vacuolar amino acid tran...    328   9e-101   
ref|XP_010936127.1|  PREDICTED: probable vacuolar amino acid tran...    328   1e-100   
ref|XP_010246977.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    321   3e-100   
emb|CAB16817.1|  putative protein                                       326   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004164469.1|  PREDICTED: uncharacterized membrane protein ...    325   1e-99    
ref|XP_011074485.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    318   3e-99    
ref|XP_004148435.1|  PREDICTED: uncharacterized membrane protein ...    323   4e-99    
emb|CDP07570.1|  unnamed protein product                                320   1e-98    
gb|EPS64486.1|  hypothetical protein M569_10295                         321   2e-98    
ref|XP_004512003.1|  PREDICTED: seven transmembrane protein 1-like      322   2e-98    
ref|XP_010099350.1|  hypothetical protein L484_009167                   323   2e-98    
gb|KDP38460.1|  hypothetical protein JCGZ_04385                         311   2e-96    
ref|XP_010246981.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    310   3e-96    
ref|XP_007047045.1|  PQ-loop repeat family protein / transmembran...    313   8e-96    
ref|NP_001240922.1|  uncharacterized protein LOC100789634               313   2e-95    
gb|KHN00567.1|  Putative membrane protein                               311   9e-95    
gb|EPS64909.1|  hypothetical protein M569_09870                         311   1e-94    
ref|XP_003629504.1|  Membrane protein, putative                         311   2e-94    
gb|EYU44309.1|  hypothetical protein MIMGU_mgv1a009599mg                309   3e-94    
ref|XP_009419331.1|  PREDICTED: probable vacuolar amino acid tran...    311   3e-94    
ref|XP_009396455.1|  PREDICTED: probable vacuolar amino acid tran...    311   5e-94    
ref|XP_007047039.1|  PQ-loop repeat family protein / transmembran...    307   7e-94    
ref|XP_007047038.1|  PQ-loop repeat family protein / transmembran...    305   3e-93    
gb|KHN42018.1|  Putative membrane protein                               307   4e-93    
ref|XP_007047043.1|  PQ-loop repeat family protein / transmembran...    305   4e-93    
ref|XP_009764843.1|  PREDICTED: lysosomal amino acid transporter ...    305   7e-93    
ref|XP_002302470.1|  zinc finger family protein                         301   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_011017289.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    300   2e-92    
ref|XP_010254967.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    300   2e-92    
ref|XP_009621507.1|  PREDICTED: probable vacuolar amino acid tran...    303   6e-92    
gb|EYU45103.1|  hypothetical protein MIMGU_mgv1a017749mg                301   9e-92    
ref|XP_006434924.1|  hypothetical protein CICLE_v10002367mg             297   4e-91    
ref|XP_006473447.1|  PREDICTED: RING finger protein 5-like isofor...    295   2e-90    
ref|XP_006375056.1|  zinc finger family protein                         293   8e-90    
ref|XP_011031310.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      293   1e-89    
ref|XP_009397741.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    292   2e-89    
ref|XP_002510337.1|  rnf5, putative                                     292   2e-89    Ricinus communis
ref|XP_009396615.1|  PREDICTED: lysosomal amino acid transporter ...    298   3e-89    
ref|XP_003528194.1|  PREDICTED: RING finger protein 5 isoform 2         292   3e-89    
gb|KCW56810.1|  hypothetical protein EUGRSUZ_I02478                     296   4e-89    
gb|AFK34238.1|  unknown                                                 290   2e-88    
ref|XP_010941935.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5        289   4e-88    
gb|ACU16582.1|  unknown                                                 289   6e-88    Glycine max [soybeans]
ref|XP_007047044.1|  PQ-loop repeat family protein / transmembran...    291   7e-88    
ref|XP_010099355.1|  RING finger protein 5                              288   9e-88    
ref|XP_004499119.1|  PREDICTED: RING finger protein 5-like              288   1e-87    
ref|XP_007047047.1|  PQ-loop repeat family protein / transmembran...    289   3e-87    
ref|XP_010941973.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    286   3e-87    
ref|XP_007202536.1|  hypothetical protein PRUPE_ppa011052mg             286   6e-87    
ref|XP_010106044.1|  RING finger protein 5                              284   3e-86    
ref|XP_008241618.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    283   6e-86    
ref|XP_008796996.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      283   1e-85    
gb|KDP31813.1|  hypothetical protein JCGZ_12274                         282   2e-85    
ref|XP_010030885.1|  PREDICTED: probable vacuolar amino acid tran...    286   3e-85    
ref|XP_004300592.1|  PREDICTED: uncharacterized protein LOC101293...    280   9e-85    
ref|XP_009388941.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    278   4e-84    
ref|XP_008338171.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    278   6e-84    
gb|KCW56813.1|  hypothetical protein EUGRSUZ_I02478                     280   2e-83    
ref|XP_010029839.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      276   2e-83    
ref|XP_007047035.1|  RING/U-box superfamily protein                     276   3e-83    
ref|XP_008377351.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    276   3e-83    
ref|XP_006856132.1|  hypothetical protein AMTR_s00059p00157160          280   9e-83    
ref|XP_006380746.1|  hypothetical protein POPTR_0007s12260g             276   4e-82    
ref|XP_009364327.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    273   6e-82    
ref|XP_007136566.1|  hypothetical protein PHAVU_009G055700g             272   1e-81    
ref|XP_009374217.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    271   2e-81    
ref|XP_006416519.1|  hypothetical protein EUTSA_v10008430mg             272   5e-81    
ref|XP_009365614.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      271   5e-81    
gb|AFK65745.1|  C3HC4 transcription factor                              270   6e-81    
ref|XP_008377250.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    270   8e-81    
ref|XP_004291908.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1-...    270   1e-80    
ref|XP_006383256.1|  hypothetical protein POPTR_0005s12910g             268   4e-80    
gb|KHG07638.1|  RING finger 5                                           267   6e-80    
ref|XP_006573604.1|  PREDICTED: RING finger protein 5-like              267   8e-80    
gb|KEH40088.1|  zinc finger, C3HC4 type (RING finger) protein           267   9e-80    
ref|XP_011025702.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    266   2e-79    
gb|KCW56814.1|  hypothetical protein EUGRSUZ_I02478                     267   1e-78    
gb|AGV54634.1|  vulgaris E3 ubiquitin-protein ligase RMA1 isoform 1     264   1e-78    
ref|XP_003523865.1|  PREDICTED: RING finger protein 5-like isoform 1    264   1e-78    
ref|XP_007156892.1|  hypothetical protein PHAVU_002G026100g             263   2e-78    
ref|XP_006590675.1|  PREDICTED: RING finger protein 5-like              263   4e-78    
ref|XP_010533245.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    261   8e-78    
gb|KHG15330.1|  RING finger 5                                           262   1e-77    
ref|XP_008444676.1|  PREDICTED: RING finger protein 5                   261   1e-77    
ref|XP_004152714.1|  PREDICTED: RING finger protein 5-like              261   2e-77    
gb|ACU19464.1|  unknown                                                 260   3e-77    Glycine max [soybeans]
ref|XP_010432126.1|  PREDICTED: uncharacterized protein LOC104716...    262   7e-77    
ref|XP_008808880.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    259   1e-76    
gb|AES94854.2|  PQ-loop protein/transmembrane family protein            260   3e-76    
ref|XP_002893041.1|  zinc finger family protein                         257   3e-76    
ref|XP_006425746.1|  hypothetical protein CICLE_v10026329mg             257   4e-76    
ref|XP_006425744.1|  hypothetical protein CICLE_v10026329mg             256   8e-76    
ref|XP_006425748.1|  hypothetical protein CICLE_v10026329mg             256   2e-75    
ref|XP_006304178.1|  hypothetical protein CARUB_v10010212mg             255   2e-75    
gb|KDO79459.1|  hypothetical protein CISIN_1g027504mg                   254   3e-75    
ref|XP_002269155.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      254   4e-75    Vitis vinifera
ref|XP_010498345.1|  PREDICTED: RING finger protein 5-like              253   1e-74    
ref|XP_006344828.1|  PREDICTED: RING finger protein 5-like              252   2e-74    
ref|XP_010254973.1|  PREDICTED: probable vacuolar amino acid tran...    255   3e-74    
ref|NP_564078.1|  RING/U-box superfamily protein                        252   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440158.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      252   3e-74    
ref|XP_009762480.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    251   4e-74    
ref|XP_010526737.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    251   6e-74    
ref|XP_010026147.1|  PREDICTED: RING finger protein 5                   251   8e-74    
ref|XP_002310781.1|  hypothetical protein POPTR_0007s12280g             250   2e-73    Populus trichocarpa [western balsam poplar]
ref|XP_007223183.1|  hypothetical protein PRUPE_ppa009193mg             253   2e-73    
ref|XP_009621500.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    249   4e-73    
ref|XP_006338276.1|  PREDICTED: RING finger protein 5-like              249   4e-73    
ref|XP_007017451.1|  RING/U-box superfamily protein                     251   4e-73    
ref|XP_009623673.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    249   5e-73    
ref|XP_004233408.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    248   6e-73    
ref|XP_010459594.1|  PREDICTED: RING finger protein 5-like              249   6e-73    
ref|XP_009149406.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      248   6e-73    
ref|XP_008338889.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    248   6e-73    
ref|XP_007047046.1|  PQ-loop repeat family protein / transmembran...    249   1e-72    
ref|XP_010526738.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    248   2e-72    
ref|XP_004232094.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      247   2e-72    
ref|XP_010531190.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    247   2e-72    
ref|XP_009762035.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    246   4e-72    
emb|CDY71750.1|  BnaCnng74270D                                          245   1e-71    
ref|XP_004141954.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1H...    245   2e-71    
gb|KHG22269.1|  RING finger 5                                           244   2e-71    
ref|XP_002284651.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5        243   6e-71    Vitis vinifera
gb|ACU22874.1|  unknown                                                 242   7e-71    Glycine max [soybeans]
emb|CAJ13712.1|  putative zinc finger protein                           243   7e-71    Capsicum chinense [bonnet pepper]
gb|ACN63363.1|  RING zinc finger protein 1                              243   8e-71    Capsicum annuum
ref|XP_010477138.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    243   1e-70    
ref|XP_009381286.1|  PREDICTED: RING finger protein 5-like              242   1e-70    
ref|XP_010429331.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    240   1e-69    
ref|XP_006856127.1|  hypothetical protein AMTR_s00059p00153580          239   1e-69    
emb|CAN72794.1|  hypothetical protein VITISV_007472                     240   2e-69    Vitis vinifera
ref|XP_002283534.1|  PREDICTED: RING finger protein 5 isoform X2        236   5e-69    Vitis vinifera
ref|XP_010023553.1|  PREDICTED: lysosomal amino acid transporter ...    244   1e-68    
tpg|DAA57466.1|  TPA: putative RING zinc finger domain superfamil...    237   1e-68    
gb|ACR37583.1|  unknown                                                 238   1e-68    Zea mays [maize]
gb|ABK21979.1|  unknown                                                 237   2e-68    Picea sitchensis
ref|XP_008240655.1|  PREDICTED: uncharacterized protein LOC103339...    242   3e-68    
ref|XP_006404861.1|  hypothetical protein EUTSA_v10000313mg             236   3e-68    
ref|XP_004970087.1|  PREDICTED: RING finger protein 5-like              236   3e-68    
gb|ACN35007.1|  unknown                                                 235   5e-68    Zea mays [maize]
ref|NP_001152268.1|  LOC100285907                                       236   5e-68    Zea mays [maize]
gb|AFW84960.1|  putative RING zinc finger domain superfamily protein    236   7e-68    
ref|XP_010680923.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    235   8e-68    
gb|KCW56809.1|  hypothetical protein EUGRSUZ_I02478                     236   9e-68    
ref|XP_011040657.1|  PREDICTED: lysosomal amino acid transporter 1      241   1e-67    
gb|ACG36773.1|  RING finger protein 5                                   234   2e-67    Zea mays [maize]
ref|XP_002322574.2|  hypothetical protein POPTR_0016s02400g             239   2e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006644765.1|  PREDICTED: RING finger protein 5-like              233   4e-67    
ref|XP_006294956.1|  hypothetical protein CARUB_v10024012mg             233   4e-67    
ref|XP_008240654.1|  PREDICTED: uncharacterized protein LOC103339...    239   4e-67    
ref|XP_006644034.1|  PREDICTED: uncharacterized protein LOC102703908    239   5e-67    
emb|CDX89598.1|  BnaC04g36170D                                          232   1e-66    
gb|EAY75948.1|  hypothetical protein OsI_03866                          231   1e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_002533271.1|  rnf5, putative                                     232   1e-66    Ricinus communis
ref|XP_004967745.1|  PREDICTED: lysosomal amino acid transporter ...    238   2e-66    
ref|XP_011010093.1|  PREDICTED: uncharacterized protein LOC105115030    238   2e-66    
ref|XP_010251611.1|  PREDICTED: probable vacuolar amino acid tran...    238   2e-66    
ref|XP_011041299.1|  PREDICTED: uncharacterized protein LOC105137299    237   3e-66    
ref|XP_008443167.1|  PREDICTED: uncharacterized protein LOC103486...    237   3e-66    
ref|NP_001289001.1|  E3 ubiquitin-protein ligase RNF185                 230   3e-66    
ref|XP_002880526.1|  zinc finger family protein                         230   4e-66    
ref|XP_001753587.1|  predicted protein                                  236   4e-66    
ref|NP_001044354.2|  Os01g0766200                                       230   5e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004136760.1|  PREDICTED: uncharacterized protein LOC101209754    236   6e-66    
ref|XP_009379177.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    229   7e-66    
ref|XP_009407106.1|  PREDICTED: uncharacterized protein LOC103989888    236   7e-66    
ref|XP_004163970.1|  PREDICTED: uncharacterized protein LOC101227133    236   7e-66    
ref|XP_010251610.1|  PREDICTED: probable vacuolar amino acid tran...    236   8e-66    
gb|EEE55436.1|  hypothetical protein OsJ_03576                          231   9e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003611911.1|  RING finger protein                                229   9e-66    
ref|XP_010525450.1|  PREDICTED: uncharacterized protein LOC104803245    235   1e-65    
gb|AFK39005.1|  unknown                                                 230   2e-65    
ref|XP_006365504.1|  PREDICTED: RING finger protein 5-like isofor...    228   3e-65    
gb|KDO64268.1|  hypothetical protein CISIN_1g015046mg                   234   3e-65    
ref|XP_002457622.1|  hypothetical protein SORBIDRAFT_03g010545          234   3e-65    Sorghum bicolor [broomcorn]
ref|XP_008660226.1|  PREDICTED: RING finger protein 5-like              228   4e-65    
ref|XP_006365505.1|  PREDICTED: RING finger protein 5-like isofor...    226   4e-65    
ref|XP_007028338.1|  PQ-loop repeat family protein / transmembran...    233   6e-65    
ref|XP_006481307.1|  PREDICTED: uncharacterized protein LOC102608...    233   9e-65    
ref|XP_006836191.1|  hypothetical protein AMTR_s00101p00071870          232   1e-64    
ref|NP_001159199.1|  hypothetical protein                               232   2e-64    Zea mays [maize]
ref|XP_010653691.1|  PREDICTED: uncharacterized protein LOC100853498    232   2e-64    
ref|XP_004230857.1|  PREDICTED: RING finger protein 5-like              224   3e-64    
ref|XP_002442611.1|  hypothetical protein SORBIDRAFT_08g022940          225   4e-64    Sorghum bicolor [broomcorn]
ref|XP_010251613.1|  PREDICTED: probable vacuolar amino acid tran...    230   5e-64    
emb|CDM82719.1|  unnamed protein product                                230   8e-64    
gb|ACG49102.1|  PQ loop repeat family protein                           230   1e-63    Zea mays [maize]
gb|AGT17302.1|  RING finger protein                                     224   1e-63    
ref|XP_010908655.1|  PREDICTED: uncharacterized protein LOC105034983    230   2e-63    
gb|AAM62942.1|  putative RING zinc finger protein                       223   2e-63    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141539.1|  PQ loop repeat family protein                      229   2e-63    Zea mays [maize]
ref|XP_009802684.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    222   2e-63    
ref|XP_007028339.1|  PQ-loop repeat family protein / transmembran...    228   3e-63    
emb|CDM84329.1|  unnamed protein product                                222   3e-63    
ref|XP_010251612.1|  PREDICTED: probable vacuolar amino acid tran...    228   3e-63    
ref|NP_001042681.1|  Os01g0266800                                       229   3e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010678217.1|  PREDICTED: uncharacterized protein LOC104893...    228   3e-63    
ref|NP_179958.1|  RING/U-box superfamily protein                        222   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008443168.1|  PREDICTED: uncharacterized protein LOC103486...    228   4e-63    
ref|XP_006429714.1|  hypothetical protein CICLE_v10011933mg             226   1e-62    
ref|XP_009419694.1|  PREDICTED: uncharacterized protein LOC103999622    226   2e-62    
ref|XP_002985826.1|  hypothetical protein SELMODRAFT_123042             225   3e-62    
gb|KCW56808.1|  hypothetical protein EUGRSUZ_I02477                     218   3e-62    
ref|XP_002984766.1|  hypothetical protein SELMODRAFT_121256             225   4e-62    
ref|XP_003566800.1|  PREDICTED: uncharacterized protein LOC100836633    226   4e-62    
gb|KGN59379.1|  hypothetical protein Csa_3G815430                       226   7e-62    
ref|XP_009605023.1|  PREDICTED: RING finger protein 5-like              218   9e-62    
ref|XP_011069980.1|  PREDICTED: uncharacterized protein LOC105155744    224   1e-61    
ref|XP_006664238.1|  PREDICTED: RING finger protein 5-like              218   2e-61    
dbj|BAJ97228.1|  predicted protein                                      217   2e-61    
ref|XP_004963315.1|  PREDICTED: RING finger protein 5-like isofor...    217   3e-61    
ref|XP_008654590.1|  PREDICTED: PQ loop repeat family protein iso...    228   3e-61    
ref|XP_004963314.1|  PREDICTED: RING finger protein 5-like isofor...    218   4e-61    
gb|EMT06384.1|  RING finger protein 185                                 218   4e-61    
ref|XP_010517585.1|  PREDICTED: uncharacterized protein LOC104793012    221   4e-61    
ref|XP_010236967.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    216   6e-61    
emb|CDP02411.1|  unnamed protein product                                216   6e-61    
dbj|BAJ89688.1|  predicted protein                                      214   2e-60    
ref|NP_001067361.1|  Os12g0636000                                       214   3e-60    
gb|AFW79602.1|  hypothetical protein ZEAMMB73_686781                    219   6e-60    
gb|EEE53669.1|  hypothetical protein OsJ_36994                          216   6e-60    
ref|XP_010508772.1|  PREDICTED: uncharacterized protein LOC104785289    218   7e-60    
gb|EMS64801.1|  RING finger protein 5                                   213   1e-59    
emb|CDY53677.1|  BnaC04g52270D                                          217   2e-59    
dbj|BAJ92450.1|  predicted protein                                      218   2e-59    
gb|EPS68366.1|  zinc finger family protein                              209   2e-59    
ref|XP_010505867.1|  PREDICTED: uncharacterized protein LOC104782594    216   2e-59    
ref|XP_009631768.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    211   2e-59    
ref|XP_008806620.1|  PREDICTED: uncharacterized protein LOC103719251    216   3e-59    
gb|EEC69739.1|  hypothetical protein OsI_39260                          213   5e-59    
ref|XP_008386922.1|  PREDICTED: uncharacterized protein LOC103449379    216   7e-59    
emb|CDO97087.1|  unnamed protein product                                209   1e-58    
dbj|BAK03368.1|  predicted protein                                      215   2e-58    
ref|XP_002881756.1|  PQ-loop repeat family protein                      214   2e-58    
ref|XP_002466675.1|  hypothetical protein SORBIDRAFT_01g012070          209   3e-58    
ref|XP_010472373.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    208   3e-58    
ref|XP_009142719.1|  PREDICTED: uncharacterized protein LOC103866528    213   6e-58    
ref|XP_008654591.1|  PREDICTED: PQ loop repeat family protein iso...    218   6e-58    
ref|XP_011088340.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    207   7e-58    
ref|XP_010023561.1|  PREDICTED: seven transmembrane protein 1-like      212   8e-58    
ref|XP_004248724.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    207   1e-57    
ref|XP_009796038.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    206   1e-57    
ref|XP_004248721.1|  PREDICTED: RING finger protein 5-like isofor...    207   1e-57    
gb|KCW56812.1|  hypothetical protein EUGRSUZ_I02478                     209   2e-57    
ref|XP_007028336.1|  PQ-loop repeat family protein / transmembran...    221   3e-57    
ref|XP_010231607.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    206   3e-57    
ref|XP_006380748.1|  hypothetical protein POPTR_0007s12260g             208   3e-57    
ref|NP_850340.1|  PQ-loop repeat family protein / transmembrane f...    210   4e-57    
ref|XP_006349609.1|  PREDICTED: RING finger protein 5-like isofor...    205   4e-57    
ref|XP_006425753.1|  hypothetical protein CICLE_v10025820mg             207   7e-57    
ref|NP_001137076.1|  uncharacterized LOC100217249                       204   8e-57    
ref|XP_004982184.1|  PREDICTED: RING finger protein 5-like              203   2e-56    
ref|XP_002867890.1|  PQ-loop repeat family protein                      205   3e-56    
gb|ACG35689.1|  RING finger protein 5                                   202   4e-56    
ref|NP_001050892.1|  Os03g0678400                                       202   7e-56    
ref|XP_009365377.1|  PREDICTED: uncharacterized protein LOC103955225    207   9e-56    
ref|XP_004489634.1|  PREDICTED: uncharacterized protein LOC101513...    206   1e-55    
ref|XP_009353181.1|  PREDICTED: probable vacuolar amino acid tran...    206   3e-55    
gb|EAY91374.1|  hypothetical protein OsI_12994                          200   3e-55    
ref|XP_003520461.1|  PREDICTED: probable vacuolar amino acid tran...    205   4e-55    
ref|XP_003569895.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    199   6e-55    
ref|XP_007028337.1|  PQ-loop repeat family protein / transmembran...    205   8e-55    
gb|KDO79457.1|  hypothetical protein CISIN_1g045038mg                   201   1e-54    
tpg|DAA47675.1|  TPA: putative RING zinc finger domain superfamil...    199   1e-54    
ref|NP_001150153.1|  RING finger protein 5                              199   1e-54    
gb|AFK47806.1|  unknown                                                 204   1e-54    
ref|XP_007161921.1|  hypothetical protein PHAVU_001G108900g             203   2e-54    
ref|XP_010417122.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    197   2e-54    
ref|XP_006282771.1|  hypothetical protein CARUB_v10006199mg             199   3e-54    
gb|ACG28469.1|  RING finger protein 5                                   197   4e-54    
ref|NP_001131836.1|  uncharacterized protein LOC100193211               196   6e-54    
dbj|BAJ90881.1|  predicted protein                                      196   1e-53    
ref|NP_193743.1|  PQ-loop repeat family protein / transmembrane f...    197   2e-53    
ref|XP_008681127.1|  PREDICTED: uncharacterized protein LOC100193...    197   3e-53    
ref|XP_009788748.1|  PREDICTED: probable vacuolar amino acid tran...    199   4e-53    
ref|XP_003618917.1|  PQ-loop repeat-containing protein                  201   4e-53    
ref|XP_001773606.1|  predicted protein                                  194   4e-53    
gb|ACG30558.1|  RING finger protein 5                                   194   6e-53    
ref|XP_003624846.1|  Membrane protein, putative                         199   8e-53    
gb|EMT05165.1|  E3 ubiquitin-protein ligase RNF5                        194   1e-52    
ref|XP_006650405.1|  PREDICTED: RING finger protein 5-like              193   1e-52    
gb|EEE54293.1|  hypothetical protein OsJ_01221                          199   1e-52    
gb|AES81064.2|  PQ-loop protein/transmembrane family protein            196   2e-52    
gb|EEC70372.1|  hypothetical protein OsI_01310                          197   4e-52    
gb|EMS46731.1|  RING finger protein 5                                   191   9e-52    
ref|XP_002458554.1|  hypothetical protein SORBIDRAFT_03g035620          188   1e-51    
ref|XP_011099277.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5-...    189   2e-51    
ref|XP_010111305.1|  hypothetical protein L484_027959                   193   4e-51    
gb|AES75135.2|  PQ-loop protein/transmembrane family protein            194   4e-51    
ref|XP_006304177.1|  hypothetical protein CARUB_v10010212mg             186   2e-50    
gb|KHN10879.1|  Putative membrane protein                               191   2e-50    
gb|EYU35636.1|  hypothetical protein MIMGU_mgv1a008531mg                187   5e-49    
ref|XP_011085546.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5        179   8e-48    
ref|XP_003611898.1|  Membrane protein, putative                         177   1e-47    
gb|EPS60159.1|  hypothetical protein M569_14647                         176   1e-47    
gb|KCW89961.1|  hypothetical protein EUGRSUZ_A02167                     175   3e-45    
emb|CBI17578.3|  unnamed protein product                                170   3e-45    
gb|KFK36620.1|  hypothetical protein AALP_AA4G147300                    175   3e-45    
gb|EPS61623.1|  hypothetical protein M569_13172                         170   1e-44    
gb|KHG16759.1|  Protein RTC2                                            170   1e-43    
gb|KCW89962.1|  hypothetical protein EUGRSUZ_A02168                     165   3e-41    
ref|XP_009406592.1|  PREDICTED: uncharacterized protein LOC103989470    156   2e-39    
gb|ABR13292.1|  putative PQ-loop repeat family protein                  151   2e-39    
emb|CBI19639.3|  unnamed protein product                                152   3e-39    
ref|XP_006294592.1|  hypothetical protein CARUB_v10023627mg             158   4e-39    
emb|CBI32879.3|  unnamed protein product                                157   7e-38    
ref|XP_006301765.1|  hypothetical protein CARUB_v10022226mg             145   1e-36    
ref|XP_010678218.1|  PREDICTED: uncharacterized protein LOC104893...    150   2e-36    
ref|XP_010419207.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1H...    144   6e-36    
ref|NP_177636.1|  RING/U-box domain-containing protein                  142   2e-35    
ref|XP_002889004.1|  zinc finger family protein                         141   4e-35    
ref|XP_010428497.1|  PREDICTED: RING finger protein 5                   140   5e-35    
ref|XP_010451342.1|  PREDICTED: probable vacuolar amino acid tran...    145   8e-35    
ref|XP_006390364.1|  hypothetical protein EUTSA_v10019588mg             137   7e-34    
ref|XP_009419036.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    139   7e-33    
ref|XP_004344135.1|  zinc finger domain containing protein              137   7e-33    
emb|CDX73130.1|  BnaC06g35780D                                          134   8e-33    
ref|XP_002520588.1|  conserved hypothetical protein                     137   6e-32    
ref|XP_006411368.1|  hypothetical protein EUTSA_v10017959mg             138   8e-32    
ref|XP_002990681.1|  hypothetical protein SELMODRAFT_49525              127   7e-31    
emb|CDY64475.1|  BnaAnng19380D                                          127   2e-30    
ref|XP_002963699.1|  hypothetical protein SELMODRAFT_69516              126   5e-30    
ref|XP_005852253.1|  hypothetical protein CHLNCDRAFT_33679              129   5e-30    
gb|ADE76676.1|  unknown                                                 126   1e-29    
ref|XP_010531580.1|  PREDICTED: probable vacuolar amino acid tran...    127   2e-29    
ref|XP_009106155.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1H1      124   3e-29    
ref|XP_005648708.1|  ring finger protein 5                              125   4e-29    
ref|XP_002530725.1|  rnf5, putative                                     128   3e-28    
ref|XP_008902895.1|  hypothetical protein PPTG_09629                    123   4e-28    
gb|ETK91037.1|  hypothetical protein L915_05313                         122   5e-28    
ref|XP_006827769.1|  hypothetical protein AMTR_s00009p00264430          122   7e-28    
gb|KDP24641.1|  hypothetical protein JCGZ_25557                         127   7e-28    
ref|XP_006854131.1|  hypothetical protein AMTR_s00048p00164020          127   1e-27    
gb|EMT15707.1|  hypothetical protein F775_07524                         123   2e-27    
gb|AFW79603.1|  hypothetical protein ZEAMMB73_686781                    124   2e-27    
gb|KFM25009.1|  E3 ubiquitin-protein ligase                             120   3e-27    
gb|EMS56021.1|  hypothetical protein TRIUR3_23354                       122   3e-27    
ref|XP_004249180.1|  PREDICTED: uncharacterized protein LOC101255151    125   4e-27    
ref|XP_006362213.1|  PREDICTED: uncharacterized protein LOC102600219    125   4e-27    
gb|ESA10301.1|  hypothetical protein GLOINDRAFT_197951                  122   4e-27    
gb|KDP24049.1|  hypothetical protein JCGZ_26733                         121   5e-27    
ref|XP_010323737.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1H1      121   5e-27    
gb|KHG00315.1|  E3 ubiquitin-protein ligase RMA3 -like protein          121   5e-27    
gb|EWM24656.1|  ring finger protein                                     123   6e-27    
ref|NP_001155711.1|  ring finger protein 5-like                         119   8e-27    
emb|CDP10157.1|  unnamed protein product                                122   8e-27    
ref|XP_006429895.1|  hypothetical protein CICLE_v10011813mg             124   8e-27    
gb|EFA78502.1|  hypothetical protein PPL_09154                          121   9e-27    
ref|XP_002416664.1|  E3 ubiquitin ligase, putative                      119   1e-26    
gb|KDO33170.1|  hypothetical protein SPRG_01982                         118   1e-26    
ref|XP_010265974.1|  PREDICTED: uncharacterized protein LOC104603612    123   1e-26    
ref|XP_011078819.1|  PREDICTED: uncharacterized protein LOC105162488    123   2e-26    
ref|NP_001240122.1|  uncharacterized protein LOC100811099               123   2e-26    
dbj|GAM21617.1|  hypothetical protein SAMD00019534_047920               119   2e-26    
ref|XP_009399440.1|  PREDICTED: uncharacterized protein LOC103983853    124   2e-26    
ref|NP_001156217.1|  ring finger protein 5-like                         118   2e-26    
ref|XP_009757319.1|  PREDICTED: RING finger protein 219-like            122   2e-26    
ref|XP_010257488.1|  PREDICTED: uncharacterized protein LOC104597...    122   3e-26    
ref|XP_010257487.1|  PREDICTED: uncharacterized protein LOC104597...    122   4e-26    
gb|EMT00069.1|  RING finger protein 5                                   120   5e-26    
ref|XP_008798015.1|  PREDICTED: uncharacterized protein LOC103713033    124   5e-26    
ref|XP_003142492.1|  hypothetical protein LOAG_06910                    117   5e-26    
ref|XP_008471918.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    118   5e-26    
ref|XP_010422456.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1-...    118   5e-26    
ref|XP_009611857.1|  PREDICTED: uncharacterized protein LOC104105304    121   5e-26    
ref|XP_010257486.1|  PREDICTED: uncharacterized protein LOC104597...    123   6e-26    
ref|XP_005704949.1|  E3 ubiquitin-protein ligase RNF5                   118   7e-26    
gb|EFO21580.2|  hypothetical protein LOAG_06910                         116   7e-26    
gb|KFM80680.1|  E3 ubiquitin-protein ligase RNF185                      116   7e-26    
ref|XP_004983512.1|  PREDICTED: uncharacterized protein LOC101753381    121   8e-26    
ref|XP_002279934.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD3       120   8e-26    
ref|XP_003568260.1|  PREDICTED: uncharacterized protein LOC100827774    122   8e-26    
ref|XP_006358981.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    118   9e-26    
ref|XP_010111371.1|  E3 ubiquitin-protein ligase RMA3                   120   9e-26    
ref|XP_009821658.1|  hypothetical protein H257_00605                    116   1e-25    
ref|XP_008612458.1|  hypothetical protein SDRG_08354                    115   1e-25    
gb|EYU43563.1|  hypothetical protein MIMGU_mgv11b024317mg               112   1e-25    
ref|XP_002605626.1|  hypothetical protein BRAFLDRAFT_141138             115   1e-25    
ref|XP_008360556.1|  PREDICTED: probable vacuolar amino acid tran...    118   1e-25    
emb|CDQ04429.1|  Protein Bm2250, isoform b                              115   1e-25    
gb|EFX65759.1|  hypothetical protein DAPPUDRAFT_65278                   115   1e-25    
ref|XP_010455886.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1        117   2e-25    
ref|XP_011005282.1|  PREDICTED: uncharacterized ATP-dependent hel...    120   2e-25    
gb|EPS65092.1|  hypothetical protein M569_09690                         114   2e-25    
ref|XP_003062860.1|  histone ubiquitination protein                     117   2e-25    
ref|XP_004309470.1|  PREDICTED: uncharacterized protein LOC101307075    119   2e-25    
ref|XP_010748712.1|  PREDICTED: E3 ubiquitin-protein ligase RNF185      115   2e-25    
ref|XP_001902780.1|  Hypothetical RING finger protein C16C10.7 in...    114   3e-25    
gb|ABD28651.2|  Cystinosin/ERS1p repeat                                 118   3e-25    
emb|CDJ95427.1|  Zinc finger domain containing protein                  115   3e-25    
ref|XP_010933375.1|  PREDICTED: uncharacterized protein LOC105053788    121   3e-25    
ref|XP_002309298.1|  zinc finger family protein                         119   3e-25    
ref|XP_002957324.1|  hypothetical protein VOLCADRAFT_34979              112   3e-25    
ref|XP_006388579.1|  hypothetical protein POPTR_0149s00210g             118   3e-25    
ref|XP_010431117.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1-...    116   3e-25    
emb|CAJ81763.1|  ring finger protein 125                                114   3e-25    
ref|XP_010036495.1|  PREDICTED: uncharacterized protein LOC104425499    119   3e-25    
ref|XP_008810454.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    116   3e-25    
emb|CEF63956.1|  E3 ubiquitin-protein ligase RNF185                     114   3e-25    
ref|XP_010556835.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1-...    115   3e-25    
ref|XP_638242.1|  hypothetical protein DDB_G0285333                     117   3e-25    
ref|XP_011039462.1|  PREDICTED: uncharacterized protein LOC105136018    119   4e-25    
ref|NP_001088405.1|  ring finger protein 185                            114   4e-25    
ref|NP_001130302.1|  putative RING/U-box superfamily protein isof...    119   4e-25    
gb|EJW85466.1|  ring finger protein 5                                   114   4e-25    
gb|KHG11817.1|  E3 ubiquitin-protein ligase RMA1H1                      119   4e-25    
ref|XP_002464857.1|  hypothetical protein SORBIDRAFT_01g027700          119   4e-25    
ref|XP_010556834.1|  PREDICTED: E3 ubiquitin-protein ligase RMA1-...    116   4e-25    
ref|XP_002322728.2|  zinc finger family protein                         119   4e-25    
ref|XP_004251855.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    115   5e-25    
ref|XP_003521219.1|  PREDICTED: uncharacterized protein LOC100782...    119   5e-25    
ref|XP_008443034.1|  PREDICTED: uncharacterized protein LOC103486753    118   5e-25    
ref|XP_002509009.1|  histone ubiquitination protein group a             115   5e-25    
ref|NP_192260.1|  E3 ubiquitin-protein ligase RMA1                      115   5e-25    
sp|Q6R567.1|RMA1_CAPAN  RecName: Full=E3 ubiquitin-protein ligase...    115   5e-25    
ref|XP_009402952.1|  PREDICTED: uncharacterized protein LOC103986631    120   5e-25    
ref|XP_008471920.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...    114   6e-25    
ref|XP_002439942.1|  hypothetical protein SORBIDRAFT_09g023070          119   6e-25    
ref|XP_007909346.1|  PREDICTED: E3 ubiquitin-protein ligase RNF5        114   6e-25    
ref|XP_006644948.1|  PREDICTED: uncharacterized protein LOC102716267    119   6e-25    
gb|KHJ84465.1|  zinc finger, C3HC4 type                                 110   7e-25    
ref|XP_007029018.1|  RING/U-box superfamily protein isoform 1           118   7e-25    
ref|NP_497830.1|  Protein RNF-5                                         115   7e-25    
ref|XP_007162336.1|  hypothetical protein PHAVU_001G143400g             118   8e-25    
emb|CBJ31812.1|  conserved unknown protein                              112   8e-25    
ref|XP_006655398.1|  PREDICTED: uncharacterized protein LOC102717994    119   8e-25    
dbj|BAK05957.1|  predicted protein                                      118   8e-25    
dbj|BAK02515.1|  predicted protein                                      118   9e-25    
ref|XP_008367312.1|  PREDICTED: uncharacterized protein LOC103430943    117   9e-25    
ref|XP_003099499.1|  CRE-RNF-5 protein                                  115   9e-25    
ref|XP_002427042.1|  RING finger protein, putative                      113   9e-25    
gb|KHN74265.1|  RING finger protein 5                                   113   9e-25    
gb|EMS59673.1|  RING finger protein 5                                   118   9e-25    
ref|XP_004141226.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    115   1e-24    
ref|XP_004251854.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    115   1e-24    
ref|XP_007204689.1|  hypothetical protein PRUPE_ppa007787mg             117   1e-24    
ref|XP_004172618.1|  PREDICTED: E3 ubiquitin-protein ligase RMA3-...    115   1e-24    
gb|EPS69988.1|  hypothetical protein M569_04776                         110   1e-24    



>ref|XP_011083744.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Sesamum 
indicum]
Length=381

 Score =   398 bits (1022),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 230/372 (62%), Positives = 282/372 (76%), Gaps = 14/372 (4%)
 Frame = -1

Query  2284  GGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKN  2105
             GG++LSYC VERK C+ W+ + FKDCLCNLND+ISF +GI SL+CW VAEIPQI+TNF +
Sbjct  3     GGLKLSYCRVERKPCMRWIEEVFKDCLCNLNDQISFALGIASLVCWSVAEIPQIITNFTS  62

Query  2104  KSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFL  1925
             KS++GVSLAFL TWI+GDVFNLVGC+LEPATLPTQF+TALLYT  T++L LQ +YY+HF 
Sbjct  63    KSATGVSLAFLSTWIIGDVFNLVGCILEPATLPTQFYTALLYTTVTIILALQCVYYNHFR  122

Query  1924  PWWKCRDKNTILVKDNEREALKQRSRHHRTAPA---VEVPCQTHYYFTSARTLASSDTP-  1757
              WWK   K   +VK+ E E L+++  H  TA     +EVP +  +YF SAR+LA SDTP 
Sbjct  123   QWWKRSQKEANMVKE-ETEPLQRKLHHGGTASTNAPIEVPRRRDFYFMSARSLAGSDTPP  181

Query  1756  TYCYIMARSGPPALQYDADSSSEDETV-----PLSSSQKPVSQPRSIPRataygtflaaa  1592
             T CYI ARSGPPAL + + SSS+++       P   S K  +QPR IPR   YGTF+AA 
Sbjct  182   TQCYIKARSGPPALDHHSHSSSDEDDDNESIFPPPPSNKTATQPRQIPRQVKYGTFVAAT  241

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
             A+ P   ++L    +     + LLQEHEF  +  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  242   ANLPRLSEAL----RRALVAQPLLQEHEFSENAYGQWLGWLMAAIYMGGRIPQIWLNIKR  297

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMFVF L+ANATY GSILVR+ EW  +KANMPWLLDA+ CV LDLFIILQY+
Sbjct  298   GSVEGLNPLMFVFALVANATYTGSILVRNAEWRMIKANMPWLLDAIVCVGLDLFIILQYI  357

Query  1231  YYTHKKIKKRQQ  1196
             +Y + K+KKR++
Sbjct  358   FYKYVKLKKREE  369



>ref|XP_007047037.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 1 [Theobroma cacao]
 gb|EOX91194.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 1 [Theobroma cacao]
Length=381

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 269/356 (76%), Gaps = 8/356 (2%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  124   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  183

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+S  +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  184   RVAKSGPSAMELDSDSSSEDEAAPVSF-KKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  242

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNP  1388
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGLNP
Sbjct  243   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNP  301

Query  1387  LMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             LMF+F LIANATYV SILVR+TEWE +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  302   LMFIFALIANATYVASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKY  357



>emb|CDP07574.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   385 bits (990),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 240/377 (64%), Positives = 282/377 (75%), Gaps = 18/377 (5%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFK  2108
             M  ++LSYC V +K CV WV KYFKDCLCNL DEISF  GI SL+CW VAEIPQI+TNFK
Sbjct  1     MKPLKLSYCSVGQKPCVRWVEKYFKDCLCNLKDEISFAFGIASLVCWAVAEIPQIITNFK  60

Query  2107  NKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHF  1928
             +KS+ GVSLAF+ TWI+GDVFNLVGC+LEPATLPTQF+TA+LY ATT+VL LQ IYYDH 
Sbjct  61    SKSADGVSLAFISTWIVGDVFNLVGCILEPATLPTQFYTAVLYAATTLVLALQCIYYDHI  120

Query  1927  LPWWKCRDKNTILVKD-NEREALKQR-----SRHHRTAPAVEVPCQ--THYYFTSARTLA  1772
             +  WK R   T + KD NER ALKQ      SR  R AP +EVP      ++F SAR+LA
Sbjct  121   IRLWKGR--KTKVNKDYNERSALKQNLHDRSSRDRRNAP-IEVPRPRWRDFHFRSARSLA  177

Query  1771  SSDT-PTYCYIMARSGPPALQYD-ADSSSEDETVPLSSSQKPVSQPRSIPRataygtfla  1598
              SDT P   YI  +SGPPAL++    SS ++E +P    Q+PVSQPR IP    YGTFLA
Sbjct  178   GSDTPPIQSYIKPKSGPPALEHQSESSSEDEEAIPPEFYQRPVSQPRLIPGPVGYGTFLA  237

Query  1597  aaAHFPVGGKSLIMEAQTKFAGRRLLQE-HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN  1421
              +A+ P G K+    +Q  F GRRLL+E +E      GQWLGWLMAAIYMGGR+PQIWLN
Sbjct  238   VSAYIPRGSKA----SQLYFVGRRLLEEKYELHGRAYGQWLGWLMAAIYMGGRIPQIWLN  293

Query  1420  IKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIIL  1241
             IKRGSVEGLNPLMF+F LIANA YVGSILVRS+EWEK++ NMPWLLDAV CV LDLFIIL
Sbjct  294   IKRGSVEGLNPLMFLFALIANAAYVGSILVRSSEWEKIQPNMPWLLDAVVCVALDLFIIL  353

Query  1240  QYLYYTHKKIKKRQQTQ  1190
             QY++Y   K KK Q+++
Sbjct  354   QYIFYRFIKRKKSQRSE  370



>ref|XP_007047040.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 4 [Theobroma cacao]
 gb|EOX91197.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 4 [Theobroma cacao]
Length=369

 Score =   380 bits (977),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 258/356 (72%), Gaps = 20/356 (6%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TAL             IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALT------------IYYDNVYRWWKC  111

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  112   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  171

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+S  +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  172   RVAKSGPSAMELDSDSSSEDEAAPVSF-KKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  230

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNP  1388
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGLNP
Sbjct  231   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNP  289

Query  1387  LMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             LMF+F LIANATYV SILVR+TEWE +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  290   LMFIFALIANATYVASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKY  345



>ref|XP_009374215.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Pyrus 
x bretschneideri]
Length=382

 Score =   377 bits (969),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 268/360 (74%), Gaps = 13/360 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K C  WV KYFKDCLCNLND+ISFV G+ISL+CWGVAE+PQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCARWVQKYFKDCLCNLNDDISFVFGLISLVCWGVAEVPQIITNFHTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFLCTW+ GDVFNL+GC LEPATLPTQ +TALLYTA+T+VLVLQ++YYD+   WWK
Sbjct  63    GVSLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTALLYTASTIVLVLQSVYYDYIYTWWK  122

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPT  1754
             CR+   I  +  + E  K+          + +P  +        +Y+TSAR+LA S TP 
Sbjct  123   CRN---ITARQKDEEENKKPLNPKLADSGIPIPSASPKATPRREFYYTSARSLAGSGTPP  179

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
             +   M  ARSGP A+  D+DSSSEDE+ P++S++  ++QPR IPR   YGTFLA + + P
Sbjct  180   FRSYMRAARSGPSAMTIDSDSSSEDESAPVTSNKNSLTQPRPIPRLAGYGTFLATSLNLP  239

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
                K L  +      GR+LLQEH  + S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  240   SQTKGL-AQVYLGVTGRKLLQEHSVEHSTFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVE  298

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF LIAN TYVGSILVR+T+W+ +KANMPWLLDA  CV LDLFIILQY+YY H
Sbjct  299   GLNPLMFVFALIANVTYVGSILVRTTKWDSIKANMPWLLDAAVCVALDLFIILQYIYYKH  358



>ref|XP_004300590.1| PREDICTED: uncharacterized protein LOC101293205 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   372 bits (955),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 216/361 (60%), Positives = 262/361 (73%), Gaps = 10/361 (3%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV ERK CV WV KYFKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNF+ KSS 
Sbjct  3     LSYCVAERKPCVRWVEKYFKDCLCNLGDDFSFGFGLVSLVCWGVAEIPQIITNFQTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TA+LYT +T+VLVLQ IYYDHF  WWK
Sbjct  63    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAVLYTISTIVLVLQTIYYDHFYTWWK  122

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPT  1754
             C   +      +E E  ++          + +P  +        +Y+TSAR++A S TP 
Sbjct  123   CGKVSVNQATQDEEEDYRKPLNPKSIDSGIPIPTASIKAAPRREFYYTSARSMAGSGTPP  182

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQK-PVSQPRSIPRataygtflaaaAHF  1583
             +   M  A+SGP  ++ ++DSSSEDE+ P++S +    SQPR IPR+  YG FLA + + 
Sbjct  183   FRTYMRVAKSGPSTMEVESDSSSEDESAPVTSKKSVRTSQPRPIPRSVGYGAFLATSLNL  242

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P   K +         GR+LLQEH  + SV GQWLGWLMAAIYMGGR+PQIWLNIKRGSV
Sbjct  243   PFRSKGMTQVLYMGITGRKLLQEHSVEHSVFGQWLGWLMAAIYMGGRLPQIWLNIKRGSV  302

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EGLNPLMFVF L+AN TYV SILVR+ EW+ +KANMPWLLDA  CV LDLFIILQY+YY 
Sbjct  303   EGLNPLMFVFALVANVTYVASILVRTIEWDSIKANMPWLLDAAVCVALDLFIILQYMYYR  362

Query  1222  H  1220
             H
Sbjct  363   H  363



>ref|XP_007047042.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 6 [Theobroma cacao]
 gb|EOX91199.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 6 [Theobroma cacao]
Length=372

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 259/356 (73%), Gaps = 17/356 (5%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATL T          +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLYT---------TSTLVLVLQTIYYDNVYRWWKC  114

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  115   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  174

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+S  +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  175   RVAKSGPSAMELDSDSSSEDEAAPVSF-KKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  233

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNP  1388
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGLNP
Sbjct  234   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNP  292

Query  1387  LMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             LMF+F LIANATYV SILVR+TEWE +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  293   LMFIFALIANATYVASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKY  348



>ref|XP_002274448.2| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Vitis vinifera]
 emb|CBI17580.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   371 bits (953),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 224/361 (62%), Positives = 271/361 (75%), Gaps = 10/361 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYC+ E+K CVGWV+KYF DCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCIKEKKPCVGWVDKYFGDCLCSLRDEFSFGFGLISLVCWGVAEIPQIITNFRTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TWI GDVFNLVGC+LEPATLPTQ++TALLYT +TVVLVLQ++YYD   PWWK 
Sbjct  64    VSLAFLLTWIAGDVFNLVGCLLEPATLPTQYYTALLYTTSTVVLVLQSVYYDDIYPWWKY  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-----HYYFTSARTLASSDTPTY-C  1748
                N+  V + ER+ LK ++      P    P +       YY+TSAR+LA S TP +  
Sbjct  124   GQINSNQVVEEERKPLKPKA-GGSGIPIPNTPVKAGSTLRDYYYTSARSLAGSTTPPFRS  182

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+  ARSGP  +  D DSSS+D+T  ++S  K VS+P+ IPR+  YG +LA + + P   
Sbjct  183   YLRTARSGPSTVGLDNDSSSDDDTTHVAS-HKTVSKPKPIPRSAGYGAYLATSVNLPRQS  241

Query  1570  KSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLN  1391
             K++ ME    F GR+LL E   ++S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVEGLN
Sbjct  242   KAM-MEVSLGFTGRKLLHESGMENSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLN  300

Query  1390  PLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKI  1211
             PLMFVF LIAN TYV SILVR+TEWEK+KANMPWLLDA  CV+LDLFIILQY+YY + + 
Sbjct  301   PLMFVFALIANVTYVASILVRTTEWEKIKANMPWLLDAAVCVMLDLFIILQYIYYKYLRK  360

Query  1210  K  1208
             K
Sbjct  361   K  361



>ref|XP_008338172.1| PREDICTED: lysosomal amino acid transporter 1-like [Malus domestica]
Length=382

 Score =   371 bits (953),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 266/360 (74%), Gaps = 13/360 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K C  W+ KYFKDCLCNLND+ISFV G+ISL+CWGVAE+PQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCSRWIQKYFKDCLCNLNDDISFVFGLISLVCWGVAEVPQIITNFXTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFLCTW+ GDVFNL+GC LEPATLPTQ +TALLYTA+TVVLVLQ++YYD+   WWK
Sbjct  63    GVSLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTALLYTASTVVLVLQSVYYDYIYTWWK  122

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPT  1754
             CR+   I  +  + E  K+          + +P  +        +Y+TSAR+LA S TP 
Sbjct  123   CRN---ITARQKDEEENKKPLNPKLADSGIPIPSXSXKATPKREFYYTSARSLAGSGTPP  179

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
             +   M  ARSGP A+  D+DSSSEDE+ P++S++  V+QPR IPR   YGTFLA + + P
Sbjct  180   FRTYMRAARSGPSAMTIDSDSSSEDESAPVTSNKNSVTQPRPIPRLAGYGTFLATSLNLP  239

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
                K L  +      GR+LLQEH  + S  GQ LGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  240   SQTKGL-AQVYLGVTGRKLLQEHSVEHSTFGQGLGWLMAAIYMGGRLPQIWLNIKRGSVE  298

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF LIAN TYVGSILVR T+W+ ++ANMPWLLDA  CV LDLFIILQY+YY H
Sbjct  299   GLNPLMFVFALIANVTYVGSILVRXTKWDSIQANMPWLLDAAVCVALDLFIILQYIYYKH  358



>emb|CDP02413.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   370 bits (951),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 214/372 (58%), Positives = 271/372 (73%), Gaps = 26/372 (7%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
              +SYCV E+K CVGWVN+YFKDCLCN  D++SF +G++SL+CWGVAEIPQIVTNF+ KSS
Sbjct  8     SISYCVKEQKPCVGWVNRYFKDCLCNFRDDLSFALGLVSLVCWGVAEIPQIVTNFRTKSS  67

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              G+S  FL TW+ GD+FNL GC+LEPATLPTQF+TALLY+ TTV+LVLQ++YYDH   WW
Sbjct  68    HGISPLFLFTWVAGDIFNLFGCLLEPATLPTQFYTALLYSTTTVLLVLQSLYYDHIYGWW  127

Query  1915  KCRDKNTI--------LVKDNEREALKQRSRHHRTA--------PAVEVPCQTHYYFTSA  1784
             K R  +T         L  ++ ++ L+   +  R+          A + P +  YY+TSA
Sbjct  128   KSRRNSTSSQEVPYIQLSHEDLKKPLRPHKQRQRSTDSGIPIPTAATKTPQRRDYYYTSA  187

Query  1783  RTLASSDTPTYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg  1610
             R+LA S TP     +   RSGP A+  +  SSSEDE  P +S  +P+     +PR+  YG
Sbjct  188   RSLAGSATPPIRSSIWPVRSGPSAIGLEDGSSSEDEASPTTS--RPI-----LPRSAGYG  240

Query  1609  tflaaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQI  1430
              F+A +   P   K++ M+A   F+GR+LLQEH   S+  GQWLGW+MAAIYMGGR+PQI
Sbjct  241   AFVATSMSMPPQTKAM-MQASIGFSGRKLLQEHGMGSNAVGQWLGWMMAAIYMGGRLPQI  299

Query  1429  WLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLF  1250
             WLNIKRGSVEGLNPLMF+F LIANA YVGSILVR+TEW+K+KANMPWLLDAVACV+LDLF
Sbjct  300   WLNIKRGSVEGLNPLMFIFALIANAAYVGSILVRNTEWDKIKANMPWLLDAVACVLLDLF  359

Query  1249  IILQYLYYTHKK  1214
             IILQY+YY + +
Sbjct  360   IILQYVYYKYLR  371



>gb|KDP31815.1| hypothetical protein JCGZ_12276 [Jatropha curcas]
Length=381

 Score =   369 bits (947),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 219/365 (60%), Positives = 262/365 (72%), Gaps = 10/365 (3%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV E+K CV WV KYFKDCLCNL DE SF  G ISLICWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKEQKPCVRWVEKYFKDCLCNLKDEFSFGFGFISLICWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSL FL TW+ GDVFNLVGC+LEPATLPTQF+TA+LYT +T+VLVLQ +YYDH   W
Sbjct  61    SHGVSLIFLLTWVAGDVFNLVGCLLEPATLPTQFYTAILYTTSTIVLVLQGLYYDHIYRW  120

Query  1918  WKCRDKNTILVKDNEREALKQRSRHHRTAP----AVEVPCQTHYYFTSARTLASSDTPTY  1751
             WKC+  +     +++++ LKQ        P    +     +  YY+TSAR++A S TP +
Sbjct  121   WKCQKIDDNQQVEDDKKPLKQNKSGDSGIPIPNASRTATPRREYYYTSARSMAGSGTPPF  180

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
                +  ARSGP A+  D +SSS+DE   +S   K VSQPR IPR+  YGTFLA + + P 
Sbjct  181   RGYLRAARSGPSAMGLDNESSSDDEASTVSV--KSVSQPRPIPRSVGYGTFLATSVNLPR  238

Query  1576  GGKSLIMEAQTKFAGRRLLQEHE-FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
               K+L   A T    RRLL E    + S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  239   QSKALTY-AYTGITSRRLLHEGSGMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVE  297

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF L AN TYV SI+VR+TEW+ +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  298   GLNPLMFVFALAANLTYVLSIVVRTTEWDSIKANMPWLLDAAVCVALDLFIILQYIYYRY  357

Query  1219  KKIKK  1205
                K+
Sbjct  358   MHQKR  362



>ref|XP_010649200.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Vitis vinifera]
Length=382

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 225/362 (62%), Positives = 272/362 (75%), Gaps = 11/362 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYC+ E+K CVGWV+KYF DCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCIKEKKPCVGWVDKYFGDCLCSLRDEFSFGFGLISLVCWGVAEIPQIITNFRTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TWI GDVFNLVGC+LEPATLPTQ++TALLYT +TVVLVLQ++YYD   PWWK 
Sbjct  64    VSLAFLLTWIAGDVFNLVGCLLEPATLPTQYYTALLYTTSTVVLVLQSVYYDDIYPWWKY  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-----HYYFTSARTLASSDTPTY-C  1748
                N+  V + ER+ LK ++      P    P +       YY+TSAR+LA S TP +  
Sbjct  124   GQINSNQVVEEERKPLKPKA-GGSGIPIPNTPVKAGSTLRDYYYTSARSLAGSTTPPFRS  182

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+  ARSGP  +  D DSSS+D+T  ++S  K VS+P+ IPR+  YG +LA + + P   
Sbjct  183   YLRTARSGPSTVGLDNDSSSDDDTTHVAS-HKTVSKPKPIPRSAGYGAYLATSVNLPRQS  241

Query  1570  KSLIMEAQTKFAGRRLL-QEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
             K++ ME    F GR+LL QE   ++S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVEGL
Sbjct  242   KAM-MEVSLGFTGRKLLHQESGMENSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGL  300

Query  1393  NPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             NPLMFVF LIAN TYV SILVR+TEWEK+KANMPWLLDA  CV+LDLFIILQY+YY + +
Sbjct  301   NPLMFVFALIANVTYVASILVRTTEWEKIKANMPWLLDAAVCVMLDLFIILQYIYYKYLR  360

Query  1213  IK  1208
              K
Sbjct  361   KK  362



>ref|XP_008338915.1| PREDICTED: lysosomal amino acid transporter 1-like [Malus domestica]
Length=376

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 223/362 (62%), Positives = 268/362 (74%), Gaps = 13/362 (4%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + LSYCV E K CV WV KYFKDCLCNLND+ISF  G+ISL+CWGVAEIPQI+TNF  KS
Sbjct  1     MTLSYCVAENKPCVRWVQKYFKDCLCNLNDDISFASGLISLVCWGVAEIPQIITNFHTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFLCTW+ GDVFNL+GC LEPATLPTQ +TALLYTA+T+VLVLQ++YYD+   W
Sbjct  61    SHGVSLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTALLYTASTIVLVLQSVYYDYIYAW  120

Query  1918  WKCRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDT  1760
             WKCR+   I  +  + E  K+         ++ +P  +        +Y+TSAR++A S T
Sbjct  121   WKCRN---ITPRQKDEEENKKPLNPKLADSSIPIPTASPKATPKREFYYTSARSMAGSGT  177

Query  1759  PTYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +   M  ARSGP A+  D+DSSSEDE+ P++S++  V+Q RSIPR   YGTFLA + +
Sbjct  178   PPFRTYMRAARSGPSAMTIDSDSSSEDESAPVTSNKNSVTQSRSIPRLVGYGTFLATSLN  237

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P   K L  +      GR+LLQEH  + S  GQWLGWLMAAIYMGGR+PQI LNIKRGS
Sbjct  238   LPSQTKGL-AQVYLGVTGRKLLQEHSVEHSALGQWLGWLMAAIYMGGRLPQICLNIKRGS  296

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMFVF LIAN TYVGSILVR+T+W+ + ANM WLLDA  CVVLDLFIILQY+YY
Sbjct  297   VEGLNPLMFVFALIANVTYVGSILVRTTDWDNITANMSWLLDAAVCVVLDLFIILQYIYY  356

Query  1225  TH  1220
              H
Sbjct  357   KH  358



>ref|NP_568009.5| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
 gb|AAK76703.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86709.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
Length=392

 Score =   368 bits (944),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 215/378 (57%), Positives = 276/378 (73%), Gaps = 18/378 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             V L YC+ E+K CV WV  YF DCLCNLND++SF +GI SL+CWGVAEIPQ++TNF+ KS
Sbjct  2     VSLGYCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKS  61

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S+GVSL+FL  W+ GD+FNLVGC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +
Sbjct  62    SNGVSLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--Y  119

Query  1918  WKCRDKNTILVKDNEREALKQRSRHHRT-APAVEVPCQTH-------YYFTSARTLASSD  1763
               CR + T + + +E +  K+  +  +T   A+ +P  ++       +Y+TSAR+LA S 
Sbjct  120   KLCRHRRTKICQKDEEDEEKRPLKPPKTMGSAISIPGGSYKDSSRREFYYTSARSLAGSG  179

Query  1762  TP---TYCYIMARSGPPALQYDADSSSEDETVPLSS----SQKPVSQPRSIPRataygtf  1604
             TP   T  + +A+SGP AL  D D SS DE   +S+    + K +++PR IPR   +GTF
Sbjct  180   TPPLRTSYFRVAKSGPSALAIDNDGSSSDEDETMSTCPVITAKTITKPRPIPRQAGFGTF  239

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+A  P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWL
Sbjct  240   LAASASLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWL  298

Query  1423  NIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFII  1244
             NIKRGSVEGLNPLMF+F L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFII
Sbjct  299   NIKRGSVEGLNPLMFIFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFII  358

Query  1243  LQYLYYTHKKIKKRQQTQ  1190
             LQY+YY + +IK  +  +
Sbjct  359   LQYIYYKYCRIKSLESRE  376



>ref|XP_010548371.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Tarenaya 
hassleriana]
Length=396

 Score =   368 bits (944),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 220/375 (59%), Positives = 268/375 (71%), Gaps = 17/375 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YCV E+K CV WV KYF DCLC LND++SF +GI+SL+CW VAEIPQI TNF+ KSS GV
Sbjct  10    YCVKEKKRCVEWVEKYFGDCLCTLNDDVSFSLGIVSLVCWAVAEIPQIFTNFRTKSSHGV  69

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNL+GC+LEPATLPTQF+TALLYT +TVVLVLQ+IYYDH     K R
Sbjct  70    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTALLYTVSTVVLVLQSIYYDHIYRLCK-R  128

Query  1906  DKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDTPTY-  1751
              +  +L KD   +  K     + T   + +P  +H       YYFTSAR+LA S TP + 
Sbjct  129   RRTKVLPKDVGDDEDKPLKPQNTTDAGIPIPRGSHKASPRTEYYFTSARSLAGSGTPPFR  188

Query  1750  --CYIMARSGPPALQYDADSSSEDETVPLSSS-----QKPVSQPRSIPRataygtflaaa  1592
                +  A+SGP A+  D+ SSS+DE     ++      K ++QPR IPR   YGTFLAA+
Sbjct  189   SSYFRAAKSGPSAMAIDSGSSSDDEEDTARNTINVVTTKSITQPRPIPRPAGYGTFLAAS  248

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
              + P   K L M+A T  + RRLLQE   + SV GQ LGWLMAAIYMGGR+PQIWLNIKR
Sbjct  249   VNLPFQAKGL-MDAYTTTSARRLLQERVMEHSVVGQCLGWLMAAIYMGGRIPQIWLNIKR  307

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMFVF LIAN TYVGSILVR+T+W+ +KAN+PWLLDAV CV LDLFIILQY+
Sbjct  308   GSVEGLNPLMFVFALIANVTYVGSILVRTTKWDSIKANLPWLLDAVVCVALDLFIILQYI  367

Query  1231  YYTHKKIKKRQQTQS  1187
             YY H + K ++  Q 
Sbjct  368   YYRHLRKKDQRLDQD  382



>ref|XP_009379174.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Pyrus x bretschneideri]
Length=376

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 269/360 (75%), Gaps = 13/360 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K CV WV KYFKDCLCNL+D+ISF +G+ISL+CWGVAEIPQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCVRWVQKYFKDCLCNLSDDISFALGLISLVCWGVAEIPQIITNFHTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFLCTW+ GDVFNL+GC LEPATLPTQ +TALLYTA+TVVLVLQ++YYD+   WWK
Sbjct  63    GVSLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTALLYTASTVVLVLQSVYYDYIYAWWK  122

Query  1912  CRDKNTILVKDNEREALKQRSRHHR-------TAPAVEVPCQTHYYFTSARTLASSDTPT  1754
             C  +N    + +E E +K  +           TA     P +  +Y+TSAR++A S TP 
Sbjct  123   C--QNFKARQKDEEENIKPLNPKLADLGIPIPTASPKATP-KREFYYTSARSMAGSGTPP  179

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
             +   M  ARSGP A+  D+DSSSEDE+  ++S++  V+QPR IPR+  YGTFLA + + P
Sbjct  180   FRTYMRAARSGPSAMIMDSDSSSEDESALVTSNKNSVTQPRPIPRSVGYGTFLATSFNLP  239

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
                K L  +      GR+LLQEH  + S  GQWLGWLMA IYMGGR+PQIWLNIKRGSVE
Sbjct  240   SQTKGL-AQVYLGVTGRKLLQEHSVEHSALGQWLGWLMAGIYMGGRLPQIWLNIKRGSVE  298

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF LIAN TYVGSILVR+TEW+ +KANM WLLDA  CVVLDLFIILQY+YY H
Sbjct  299   GLNPLMFVFALIANVTYVGSILVRTTEWDNIKANMSWLLDAAVCVVLDLFIILQYIYYKH  358



>ref|XP_011025699.1| PREDICTED: lysosomal amino acid transporter 1 isoform X1 [Populus 
euphratica]
Length=384

 Score =   363 bits (933),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 263/360 (73%), Gaps = 8/360 (2%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV ERK CV WV KYFKDCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKERKPCVRWVEKYFKDCLCSLKDEFSFAFGLISLVCWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFL TW+ GD+FNLVGC+LEPATLPTQ++TA+LYT +TVVLVLQ +YYDH   W
Sbjct  61    SHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAVLYTTSTVVLVLQGLYYDHVYRW  120

Query  1918  WKCRDKNTILVKDNEREALKQRS--RHHRTAPAV--EVPCQTHYYFTSARTLASSDTPTY  1751
              +CR        D++++ LK +S  R   + P        +  +Y+ SAR+LA S+TP +
Sbjct  121   CRCRKTKDNQQVDDDQDPLKPKSADRSGISIPKASPRATSRRDFYYMSARSLAGSNTPPF  180

Query  1750  -CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
               Y+  A+SGP A+  D +SSS+DE     S    VSQPR IPR+  YGTFLA + + P+
Sbjct  181   RSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPL  240

Query  1576  GGKSLIMEAQTKFAGRRLLQEHE-FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
               K+L  +A   + GRRLL E    D S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  241   QSKALT-QAYIGYTGRRLLHEGGGMDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVE  299

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF L+AN TYV SI+VR+TEW+ +K NMPWLLDA  CV LD FIILQY+YY +
Sbjct  300   GLNPLMFVFALVANLTYVLSIVVRTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  359



>ref|XP_009141493.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Brassica 
rapa]
Length=393

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 269/364 (74%), Gaps = 19/364 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+K CV WV +YF DCLCNLNDE+SF +GI+SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDEVSFALGIVSLICWGVAEIPQIITNFRTKSSHGV  65

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNL+GC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +  C 
Sbjct  66    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--YRLCT  123

Query  1906  DKNT-ILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDTP--  1757
                T I  KD E E  K  +       A+ +P +++       +Y+TSAR+LA S TP  
Sbjct  124   HGRTKICQKDEEDEEKKPLNPPKTMGSAISIPGESYKASPRKEFYYTSARSLAGSGTPPL  183

Query  1756  -TYCYIMARSGPPALQYDADSSS-EDE---TVPLSSSQKPVSQPRSIPRataygtflaaa  1592
              T  + +A+SGP A+  D+ SSS EDE   T+P+ ++ K ++QPR IPR   +GTFLAA+
Sbjct  184   RTSYFRVAKSGPSAMTIDSGSSSDEDETMSTLPVVTA-KTITQPRPIPRQAGFGTFLAAS  242

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
                P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  243   VSLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKR  301

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F L+ANATYVGSILVR+ EW+ +KAN+PWLLDA+ CV+LDLFIILQY+
Sbjct  302   GSVEGLNPLMFIFALVANATYVGSILVRTIEWDSIKANLPWLLDAIVCVLLDLFIILQYI  361

Query  1231  YYTH  1220
             YY +
Sbjct  362   YYKY  365



>gb|KHN36154.1| Protein RTC2 [Glycine soja]
Length=385

 Score =   361 bits (927),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 269/366 (73%), Gaps = 16/366 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV KY  DCLCNL D+ISF  G ISL+CWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCVKESKPCVGWVEKYLDDCLCNLKDKISFGFGFISLVCWGVAEIPQIITNFRAKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW+ GD+FNL+GC LEPATLPTQ++TALLYT TT+VLVLQ+ YYD+   W K 
Sbjct  64    VSLAFLLTWVAGDIFNLLGCHLEPATLPTQYYTALLYTITTIVLVLQSFYYDYIYKWGKP  123

Query  1909  RDKNTI--LVKDNEREALKQRSRHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPTY  1751
               K  I    ++ E++ L+Q+       P       E P +  YY+ SAR+LA++DTP +
Sbjct  124   LRKINIDEAHEEEEKKPLRQKPGRDSGIPIQNDGPKETP-RRDYYYRSARSLAANDTPPF  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                +  A+S P A++ + DSSS+DE  PLSS+ KPV+QPR IPR+      TFLAA+ + 
Sbjct  183   GTYLRAAKSVPSAMEMNNDSSSDDEAPPLSST-KPVTQPRPIPRSVPTSYGTFLAASMNL  241

Query  1582  PVGGKSLIMEAQTKFAGRRLL-QEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
             P  G +L ME   +F GR+LL QEH   S++ GQWLGWLMA IYMGGR+PQIWLNIKRGS
Sbjct  242   PRQGNAL-MEGYKRFNGRKLLSQEHNMHSAL-GQWLGWLMAVIYMGGRLPQIWLNIKRGS  299

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMF+F LIANATYVGSILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY  Y
Sbjct  300   VEGLNPLMFIFALIANATYVGSILVRTIEWESIRANMPWLLDAIVCVALDLFIILQYANY  359

Query  1225  THKKIK  1208
              + + K
Sbjct  360   RYVRKK  365



>ref|XP_003517255.1| PREDICTED: lysosomal amino acid transporter 1-like [Glycine max]
Length=385

 Score =   361 bits (927),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 269/366 (73%), Gaps = 16/366 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV KY  DCLCNL D+ISF  G ISL+CWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCVKESKPCVGWVEKYLDDCLCNLKDKISFGFGFISLVCWGVAEIPQIITNFRAKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW+ GD+FNL+GC LEPATLPTQ++TALLYT TT+VLVLQ+ YYD+   W K 
Sbjct  64    VSLAFLLTWVAGDIFNLLGCHLEPATLPTQYYTALLYTITTIVLVLQSFYYDYIYKWGKP  123

Query  1909  RDKNTI--LVKDNEREALKQRSRHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPTY  1751
               K  I    ++ E++ L+Q+       P       E P +  YY+ SAR+LA++DTP +
Sbjct  124   LRKINIDEAHEEEEKKPLRQKPGRDSGIPIQNDGPKETP-RRDYYYRSARSLAANDTPPF  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                +  A+S P A++ + DSSS+DE  PLSS+ KPV+QPR IPR+      TFLAA+ + 
Sbjct  183   GTYLRAAKSVPSAMEMNNDSSSDDEAPPLSST-KPVTQPRPIPRSVPASYGTFLAASMNL  241

Query  1582  PVGGKSLIMEAQTKFAGRRLL-QEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
             P  G +L ME   +F GR+LL QEH   S++ GQWLGWLMA IYMGGR+PQIWLNIKRGS
Sbjct  242   PRQGNAL-MEGYKRFNGRKLLSQEHNMHSAL-GQWLGWLMAVIYMGGRLPQIWLNIKRGS  299

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMF+F LIANATYVGSILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY  Y
Sbjct  300   VEGLNPLMFIFALIANATYVGSILVRTIEWESIRANMPWLLDAIVCVALDLFIILQYANY  359

Query  1225  THKKIK  1208
              + + K
Sbjct  360   RYVRKK  365



>emb|CDX75602.1| BnaA01g01000D [Brassica napus]
Length=393

 Score =   361 bits (927),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 269/364 (74%), Gaps = 19/364 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+K CV WV +YF DCLCNLNDE+SF +GI+SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDEVSFALGIVSLICWGVAEIPQIITNFRTKSSHGV  65

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNL+GC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +  C 
Sbjct  66    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--YRLCT  123

Query  1906  DKNT-ILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDTP--  1757
                T I  KD E E  K  +       A+ +P +++       +Y+TSAR+LA S TP  
Sbjct  124   HGRTKICQKDEEDEEKKPLNPPKTMGSAISIPGESYKASPRKEFYYTSARSLAGSGTPPL  183

Query  1756  -TYCYIMARSGPPALQYDADSSS-EDE---TVPLSSSQKPVSQPRSIPRataygtflaaa  1592
              T  + +A+SGP A+  D+ SSS EDE   T+P+ ++ K ++QPR IPR   +GTFLAA+
Sbjct  184   RTSYFRVAKSGPSAMTIDSGSSSDEDETMSTLPVVTA-KTITQPRPIPRQAGFGTFLAAS  242

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
                P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  243   VSLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKR  301

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F L+ANATYVGSILVR+ EW+ +KAN+PWLLDA+ CV+LDLFIILQY+
Sbjct  302   GSVEGLNPLMFIFALVANATYVGSILVRTIEWDSIKANLPWLLDAIVCVLLDLFIILQYI  361

Query  1231  YYTH  1220
             YY +
Sbjct  362   YYKY  365



>ref|XP_011099275.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Sesamum 
indicum]
Length=390

 Score =   361 bits (927),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 218/372 (59%), Positives = 271/372 (73%), Gaps = 20/372 (5%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E+K C+GW +KYFKDCLCN+ DE+SF  G++SL+CWGVAEIPQI+TNF+ KS  
Sbjct  9     LSYCVKEQKPCIGWADKYFKDCLCNVKDELSFGFGLVSLVCWGVAEIPQIITNFRTKSGH  68

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             G+SL FL TWI GD+FNLVGC+LEPATLPTQF+TA+LYT TTVVLVLQ+IYYD+   W  
Sbjct  69    GISLLFLLTWIAGDIFNLVGCLLEPATLPTQFYTAVLYTTTTVVLVLQSIYYDYVRKWRN  128

Query  1912  CRDKNTILVKDNEREALKQRSRHHR-TAPAVEVPCQTH--------YYFTSARTLASSDT  1760
               +K +    D E E LK+  +  +    A+ +P  T         YY+TSAR++A S T
Sbjct  129   GEEKES----DQEVEDLKKPLKTPQPIDSAIPIPNGTRRATSRREAYYYTSARSMAGSTT  184

Query  1759  PTYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P     +   +SGP A+  D +SSS+DE  P  S Q  VS+P+ IPR+  YG FLA + +
Sbjct  185   PPIQSYLWPVKSGPSAVGIDNNSSSDDEDNPTPSRQS-VSKPKPIPRSAGYGAFLATSIN  243

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P   K+L M+A     GR+LLQEH  + SV GQWLGW+MAAIYMGGR+PQIWLNI+RG+
Sbjct  244   MPRETKAL-MQAYVGLTGRKLLQEHGSE-SVYGQWLGWMMAAIYMGGRLPQIWLNIRRGN  301

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMF+F L ANATYV SILVRST W+K+KANMPWLLDA+ CV+LDLFIILQY+YY
Sbjct  302   VEGLNPLMFIFALAANATYVASILVRSTAWDKIKANMPWLLDAMGCVLLDLFIILQYVYY  361

Query  1225  T--HKKIKKRQQ  1196
                HK  +  +Q
Sbjct  362   RYFHKGSRGSRQ  373



>ref|XP_009379175.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Pyrus x bretschneideri]
Length=364

 Score =   358 bits (918),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 254/360 (71%), Gaps = 25/360 (7%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K CV WV KYFKDCLCNL+D+ISF +G+ISL+CWGVAEIPQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCVRWVQKYFKDCLCNLSDDISFALGLISLVCWGVAEIPQIITNFHTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFLCTW+ GDVFNL+GC LEPATLPTQ +               ++YYD+   WWK
Sbjct  63    GVSLAFLCTWVAGDVFNLLGCFLEPATLPTQLY------------TALSVYYDYIYAWWK  110

Query  1912  CRDKNTILVKDNEREALKQRSRHHR-------TAPAVEVPCQTHYYFTSARTLASSDTPT  1754
             C  +N    + +E E +K  +           TA     P +  +Y+TSAR++A S TP 
Sbjct  111   C--QNFKARQKDEEENIKPLNPKLADLGIPIPTASPKATP-KREFYYTSARSMAGSGTPP  167

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
             +   M  ARSGP A+  D+DSSSEDE+  ++S++  V+QPR IPR+  YGTFLA + + P
Sbjct  168   FRTYMRAARSGPSAMIMDSDSSSEDESALVTSNKNSVTQPRPIPRSVGYGTFLATSFNLP  227

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
                K L  +      GR+LLQEH  + S  GQWLGWLMA IYMGGR+PQIWLNIKRGSVE
Sbjct  228   SQTKGL-AQVYLGVTGRKLLQEHSVEHSALGQWLGWLMAGIYMGGRLPQIWLNIKRGSVE  286

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF LIAN TYVGSILVR+TEW+ +KANM WLLDA  CVVLDLFIILQY+YY H
Sbjct  287   GLNPLMFVFALIANVTYVGSILVRTTEWDNIKANMSWLLDAAVCVVLDLFIILQYIYYKH  346



>ref|XP_002533273.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29105.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   358 bits (919),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 214/376 (57%), Positives = 271/376 (72%), Gaps = 22/376 (6%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV E+K CV WV +YFKDCLC+L DE+SF  G +SL+ WGVAE+PQI+TNF+ KS
Sbjct  1     MSLAYCVKEQKPCVRWVERYFKDCLCSLKDELSFGFGFVSLVSWGVAEVPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ +YYD+   W
Sbjct  61    SHGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTIVLVLQGLYYDYIYRW  120

Query  1918  WKCRDKNTILVKDNEREALKQR---------SRHHRTAPAVEVPCQTHYYFTSARTLASS  1766
             WK +        ++E++ LK +         +   R+ P  E      YY+TSAR++ASS
Sbjct  121   WKGQKNEVNQQVEDEKKPLKPKLGDSGIPIPNASTRSTPRRE------YYYTSARSMASS  174

Query  1765  DTPTY-CYI-MARSGPPALQYDAD-SSSEDETVPLSSSQKPVSQPRSIPRataygtflaa  1595
              TP +  Y+  A+SGP A+ +D + SSS+DE  P+S++   VSQPR IPR+  YGTFLA 
Sbjct  175   GTPPFRGYLRTAKSGPSAMGFDHESSSSDDEAAPVSAAS--VSQPRPIPRSAGYGTFLAT  232

Query  1594  aAHFPVGGKSLIMEAQTKFAGRRLLQEHE-FDSSVAGQWLGWLMAAIYMGGRVPQIWLNI  1418
             + + P+  K+L  +A      RRLL E    + S  GQWLGWLMAAIYMGGR+PQIWLNI
Sbjct  233   SLNLPLQSKALT-DAYIGVTSRRLLHEGSGMEHSAFGQWLGWLMAAIYMGGRIPQIWLNI  291

Query  1417  KRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQ  1238
             KRGSVEGLNPLMF+F L+AN TYV SI+VR+TEWE +KANMPWLLDA  CV LD FIILQ
Sbjct  292   KRGSVEGLNPLMFIFALVANLTYVLSIVVRTTEWESIKANMPWLLDAAVCVALDFFIILQ  351

Query  1237  YLYYTHKKIKKRQQTQ  1190
             Y+YY + + KK +  +
Sbjct  352   YVYYRYFREKKMRHGE  367



>ref|XP_006411956.1| hypothetical protein EUTSA_v10025420mg [Eutrema salsugineum]
 gb|ESQ53409.1| hypothetical protein EUTSA_v10025420mg [Eutrema salsugineum]
Length=391

 Score =   358 bits (920),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 213/377 (56%), Positives = 270/377 (72%), Gaps = 17/377 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             V   YC+ E+K CV WV +YF DCLCNLND++SF +GI SLICW VAEIPQI+TNF+ KS
Sbjct  2     VYAGYCLKEKKTCVRWVERYFDDCLCNLNDDVSFALGIASLICWAVAEIPQIITNFRTKS  61

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSL+FL  W+ GD+FNL+GC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +
Sbjct  62    SHGVSLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--Y  119

Query  1918  WKC-RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSD  1763
               C   ++ I  K+ E E  +          A+ +P +++       +Y+TSAR+LA S 
Sbjct  120   RLCTHGRSKICPKEEEDEEKRPLKPPKTMGSAISIPGESYKASPRKEFYYTSARSLAGSG  179

Query  1762  TP---TYCYIMARSGPPALQYDADSSS-EDETVPL--SSSQKPVSQPRSIPRataygtfl  1601
             TP   T  + +A+SGP A+  D+ SSS EDET+    + + K ++QPR IPR   +GTFL
Sbjct  180   TPPLRTSYFRVAKSGPSAMTIDSGSSSDEDETMSTLPAVTAKAITQPRPIPRQAGFGTFL  239

Query  1600  aaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN  1421
             AA+   P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLN
Sbjct  240   AASVSLPLQAKSL-AEKYAHASSRRLLNERRVEHSALGQWLGWLMAAIYMGGRIPQIWLN  298

Query  1420  IKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIIL  1241
             IKRGSVEGLNPLMF+F L+ANATYVGSILVR+TEWE +K N+PWLLDA+ CVVLDLFIIL
Sbjct  299   IKRGSVEGLNPLMFIFALVANATYVGSILVRTTEWENIKPNLPWLLDAIVCVVLDLFIIL  358

Query  1240  QYLYYTHKKIKKRQQTQ  1190
             QY+YY + + K  +  +
Sbjct  359   QYIYYKYCRTKNVKMEE  375



>ref|XP_006380747.1| PQ-loop repeat family protein [Populus trichocarpa]
 gb|ERP58544.1| PQ-loop repeat family protein [Populus trichocarpa]
Length=384

 Score =   358 bits (919),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 213/360 (59%), Positives = 262/360 (73%), Gaps = 8/360 (2%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV E+K CV WV KYFKDCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFL TW+ GD+FNLVGC+LEPATLPTQ++TA+LYT +TVVLVLQ +YYDH   W
Sbjct  61    SHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAVLYTTSTVVLVLQGLYYDHVYRW  120

Query  1918  WKCRDKNTILVKDNEREALKQRS--RHHRTAPAV--EVPCQTHYYFTSARTLASSDTPTY  1751
              +CR        D++++ LK +S  R   + P        +  +Y+ SAR+LA S+TP +
Sbjct  121   CRCRKTKDNQQVDDDQDPLKPKSADRSGISIPKASPRATPRRDFYYMSARSLAGSNTPPF  180

Query  1750  -CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
               Y+  A+SGP A+  D +SSS+DE     S    VSQPR IPR+  YGTFLA + + P+
Sbjct  181   RSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPL  240

Query  1576  GGKSLIMEAQTKFAGRRLLQE-HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
               K+L  +A   + GRRLL E    D S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  241   QSKAL-TQAYIGYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVE  299

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF L+AN TYV SI+ R+TEW+ +K NMPWLLDA  CV LD FIILQY+YY +
Sbjct  300   GLNPLMFVFALVANLTYVLSIVARTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  359



>ref|XP_010029841.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Eucalyptus grandis]
 gb|KCW56811.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=387

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 268/362 (74%), Gaps = 13/362 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P+  KS   EA    + R+LLQE   + SV GQWLGWLMAAIYMGGR+PQIWLNIKRGS
Sbjct  243   LPLQNKSF-TEAHVVLSTRKLLQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGS  301

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMF+F L+AN TYVGSILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY+YY
Sbjct  302   VEGLNPLMFIFALVANVTYVGSILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIYY  361

Query  1225  TH  1220
              +
Sbjct  362   RY  363



>ref|XP_009764841.1| PREDICTED: lysosomal amino acid transporter 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=388

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 273/378 (72%), Gaps = 26/378 (7%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
              ++YCV E+K C+GWVN+YFKDCLCNL+DE SF  G++SL CW VAEIPQI+TNF+ KSS
Sbjct  12    SIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLSCWAVAEIPQIITNFRTKSS  71

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              GVSL FL  W+ GD+FNL GC+LEPATLPTQ +TA+LYT TT++LVLQ++YYD+F   W
Sbjct  72    HGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAVLYTTTTIILVLQSLYYDYFYRCW  131

Query  1915  KCRDKNTILVKDNEREALKQRSRHHR-TAPAVEVPC--------QTHYYFTSARTLASSD  1763
             K RD ++      E E +K+  R  + T   + +P         +  +YFTSAR+LA S 
Sbjct  132   KQRDDDS----GQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASRRMDFYFTSARSLAGSA  187

Query  1762  TPTYCYIM--ARSGPPALQYDADSSSEDETV--PLSSSQKPVSQPRSIPRataygtflaa  1595
             TP +   +    SGP A+  + + SS+++TV  PL+ S   VSQP+ IPR+  YG FLA 
Sbjct  188   TPPFRSNLRPIASGPSAVGLNHNYSSDEDTVDAPLNIS---VSQPKPIPRSAGYGAFLAT  244

Query  1594  aAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIK  1415
             ++  P   K+LI+     F GR+LLQEH  + S  GQ LGW+MAA+YMGGR+PQIWLNIK
Sbjct  245   SSGMPHQTKALIV----GFGGRKLLQEHGTEHSALGQVLGWMMAAVYMGGRLPQIWLNIK  300

Query  1414  RGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQY  1235
             RG+VEGLNPLMFVF LIAN TYVGSIL+RSTEW K+KANMPWLLDAV CVVLDLFIILQY
Sbjct  301   RGNVEGLNPLMFVFALIANVTYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQY  360

Query  1234  LYYTHKKIKKRQQTQS*R  1181
             +YY  K  +K+  T + R
Sbjct  361   VYY--KYFRKQSSTSNGR  376



>ref|XP_010432125.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Camelina sativa]
Length=392

 Score =   353 bits (905),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 268/363 (74%), Gaps = 17/363 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+KACV WV +YF DCLCN+ND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATLPTQ +TALLYT +TVVLV+Q IYYD+   +  CR
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTALLYTVSTVVLVIQTIYYDYI--YRLCR  125

Query  1906  DKNTILVKDNEREALKQRSRHHRT-APAVEVPCQTH-------YYFTSARTLASSDTP--  1757
                T + + +E +  K+  +  +T   A+ +P  ++       +Y+TSAR+LA S TP  
Sbjct  126   HGRTKICQTDEEDEEKRPLKPPKTTGSAISIPRGSYKDSPRREFYYTSARSLAGSGTPPS  185

Query  1756  -TYCYIMARSGPPALQYDADSSS-EDETVPLSS--SQKPVSQPRSIPRataygtflaaaA  1589
              +  + +A+SGP AL  +  SSS EDET+      + K ++QPR IPR   +GTFLAA+A
Sbjct  186   RSSYFRVAKSGPSALAIENGSSSDEDETMSTCPVIATKTITQPRPIPRPAGFGTFLAASA  245

Query  1588  HFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
               P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG
Sbjct  246   SLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRG  304

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEG+NPLMFVF L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+Y
Sbjct  305   SVEGMNPLMFVFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIY  364

Query  1228  YTH  1220
             Y +
Sbjct  365   YKY  367



>ref|XP_007204395.1| hypothetical protein PRUPE_ppa007096mg [Prunus persica]
 gb|EMJ05594.1| hypothetical protein PRUPE_ppa007096mg [Prunus persica]
Length=382

 Score =   352 bits (903),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 216/364 (59%), Positives = 264/364 (73%), Gaps = 11/364 (3%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K C  WV KYFKDCLCNLND+ISF  G++SL+CWGVAEIPQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCDRWVEKYFKDCLCNLNDDISFAFGLVSLVCWGVAEIPQIITNFHTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNL+GC+LEPATLPTQ +TALLYT +T+VLVLQ++YYD+   W K
Sbjct  63    GVSLAFLLTWVAGDVFNLMGCLLEPATLPTQLYTALLYTTSTIVLVLQSVYYDYIYTWCK  122

Query  1912  C-RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT---HYYFTSARTLASSDTPTYCY  1745
             C +  +T  V +  +  L  +            P  T    +Y+TSAR+LA S TP +  
Sbjct  123   CGKVTSTEEVDEENKRPLNPKLADSGIPIPTASPKPTPRKEFYYTSARSLAGSGTPPFRT  182

Query  1744  IM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVG  1574
              M  A+SGP  +   +DSSSEDE+ P++S +  V+QPR IPR+ A     LA + + P  
Sbjct  183   YMRAAKSGPSTMALYSDSSSEDESAPVTS-KTSVTQPRPIPRSVASYGTFLATSLNLPSQ  241

Query  1573  GKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
              K+L  +      GR+LLQEH  + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGL
Sbjct  242   TKALT-QVYIGITGRKLLQEHSMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGTVEGL  300

Query  1393  NPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             NPLMFVF L+AN TYVGSI+VR+TEW+ +KANMPWLLDAV CV LDLFIILQY+YY H  
Sbjct  301   NPLMFVFALVANVTYVGSIVVRTTEWDSIKANMPWLLDAVVCVGLDLFIILQYIYYKH--  358

Query  1213  IKKR  1202
             ++KR
Sbjct  359   LRKR  362



>ref|XP_007156890.1| hypothetical protein PHAVU_002G025900g [Phaseolus vulgaris]
 gb|ESW28884.1| hypothetical protein PHAVU_002G025900g [Phaseolus vulgaris]
Length=383

 Score =   352 bits (902),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 258/364 (71%), Gaps = 10/364 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV  YF+DCLC+L DEISF +G  SLICWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCVKETKPCVGWVQHYFQDCLCDLKDEISFALGFTSLICWGVAEIPQIITNFRAKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK-  1913
             VSLAFL TW+ GD+FNLVGCV+EPATLPTQ++TALLYT TT+VLVLQ +YYD+   W K 
Sbjct  64    VSLAFLLTWVAGDIFNLVGCVMEPATLPTQYYTALLYTITTIVLVLQTLYYDYIYKWGKH  123

Query  1912  CRDKNTILVKDNEREALKQR-SRHHRTAPAVEVPCQT---HYYFTSARTLASSDTPTYCY  1745
              R  N    ++ E++ L+ +       A   + P  T    YY+ SAR+LA++  P   Y
Sbjct  124   HRKTNMDEAQEEEKKPLRPKPGPQSGIAIPNDEPKATPRREYYYRSARSLAANTPPFGTY  183

Query  1744  I-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV--G  1574
             +  A+S P A++ + DSSS+DE  P  SS KPV+QPR IPR+         AA   +   
Sbjct  184   LRAAKSVPSAMEMNNDSSSDDEP-PQLSSTKPVTQPRPIPRSVPASYGTFLAASMNLLRQ  242

Query  1573  GKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
             G +L  E   +F GR+LL + +   S  GQWLGW MA IYMGGR+PQIWLNIKRGSVEGL
Sbjct  243   GNAL-KEGYIRFNGRKLLVQEQNMHSALGQWLGWFMAVIYMGGRLPQIWLNIKRGSVEGL  301

Query  1393  NPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             NPLMF+F LIANATYVGSILVR+TEWE ++ANMPWLLDAV CV LDLFIILQY  Y + +
Sbjct  302   NPLMFLFALIANATYVGSILVRTTEWESIRANMPWLLDAVGCVALDLFIILQYANYRYIR  361

Query  1213  IKKR  1202
              K R
Sbjct  362   KKAR  365



>ref|XP_008241616.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Prunus 
mume]
Length=382

 Score =   352 bits (902),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 266/368 (72%), Gaps = 19/368 (5%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             LSYCV E K C  WV KYFKDCLCNLND+ISF  G++SL+CWGVAEIPQI+TNF  KSS 
Sbjct  3     LSYCVAENKPCDRWVEKYFKDCLCNLNDDISFAFGLVSLVCWGVAEIPQIITNFHTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNL+GC+LEPATLPTQ +TALLYT +T+VLVLQ++YYD+   W K
Sbjct  63    GVSLAFLLTWVAGDVFNLMGCLLEPATLPTQLYTALLYTTSTIVLVLQSVYYDYIYTWCK  122

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAPA-VEVPCQT-------HYYFTSARTLASSDTP  1757
             C         D E     +R  + + A + + +P  +        +Y+TSAR+LA S TP
Sbjct  123   CGKVTATQEVDEE----NKRPLNPKLADSGIPIPSASPKPTPRKEFYYTSARSLAGSGTP  178

Query  1756  TYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAH  1586
              +   M  A+SGP  +   +DSSSEDE+ P+SS +  V+QPR IPR+ A     LA + +
Sbjct  179   PFRTYMRAAKSGPSTMALYSDSSSEDESAPVSS-KTSVTQPRPIPRSVAGYGTFLATSLN  237

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P   K+L  +      GR+LLQEH  + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+
Sbjct  238   LPSQTKALT-QVYIGITGRKLLQEHSMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGT  296

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMFVF L+AN TYVGSI+VR+TEW+ +KANMPWLLDAV CV LDLFIILQY+YY
Sbjct  297   VEGLNPLMFVFALVANVTYVGSIVVRTTEWDSIKANMPWLLDAVVCVGLDLFIILQYVYY  356

Query  1225  THKKIKKR  1202
              H  ++KR
Sbjct  357   KH--LRKR  362



>ref|XP_010254969.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Nelumbo nucifera]
Length=380

 Score =   352 bits (902),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 263/367 (72%), Gaps = 13/367 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YC  ++K CVGWV  YFKDCLCNL+DEISF  G  SLICWGVAEIPQI+TNF  KS  G
Sbjct  8     AYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSGQG  67

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW++GDVFNLVGC+LEPATLPTQF+TA+LYT TTVVLVLQ +YYD    WWK 
Sbjct  68    VSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAVLYTVTTVVLVLQCLYYDRICLWWKS  127

Query  1909  RDKNTILVKDNEREALKQRSRHH-----RTAPAVEVPCQTHYYFTSARTLASSDTPTY-C  1748
             + K + ++ D E + L  +          + P    P +  YY TSAR+LASS TPT   
Sbjct  128   KGKQSYVMVDEETKPLNSKLLDTSVPIPSSGPQEASPSRDLYY-TSARSLASSSTPTLGS  186

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+ ++RSGP A++  +D SSEDE  P+   +K  SQP+  P +  YG FL A+A+ P   
Sbjct  187   YLGISRSGPSAVEEQSD-SSEDEAFPV-YDKKSSSQPKRTPPSVGYGAFLGASANLPFRS  244

Query  1570  KSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLN  1391
              +L ME      GRR L E E  ++V G  LGWLMAAIYMGGR+PQI+LNI+RGSVEGLN
Sbjct  245   MAL-MEGYLASTGRR-LHETEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLN  302

Query  1390  PLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKI  1211
             PLMF+F LIAN TYVGSILVRSTEW ++KANMPWL DA+ CV LDLFII+QY+YY   + 
Sbjct  303   PLMFIFALIANVTYVGSILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQ-  361

Query  1210  KKRQQTQ  1190
             K+R  +Q
Sbjct  362   KRRASSQ  368



>ref|XP_010029840.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Eucalyptus grandis]
Length=388

 Score =   351 bits (901),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 218/363 (60%), Positives = 268/363 (74%), Gaps = 14/363 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQ-EHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
              P+  KS   EA    + R+LLQ E   + SV GQWLGWLMAAIYMGGR+PQIWLNIKRG
Sbjct  243   LPLQNKSF-TEAHVVLSTRKLLQQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRG  301

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNPLMF+F L+AN TYVGSILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY+Y
Sbjct  302   SVEGLNPLMFIFALVANVTYVGSILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIY  361

Query  1228  YTH  1220
             Y +
Sbjct  362   YRY  364



>ref|XP_009621506.1| PREDICTED: uncharacterized protein LOC104113113 isoform X1 [Nicotiana 
tomentosiformis]
Length=388

 Score =   351 bits (901),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 270/375 (72%), Gaps = 22/375 (6%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YCV E+K C+GWVN+YFKDCLCNL+DE SF  G++SL CW VAE+PQI+TNF+ KSS 
Sbjct  13    IAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLFCWAVAEVPQIITNFRTKSSH  72

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSL FL  W+ GD+FNL GC+LEPATLPTQ +TA+LYT TT++LVLQ++YYD+F   WK
Sbjct  73    GVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAVLYTTTTIILVLQSLYYDYFYRCWK  132

Query  1912  CRDKNTILVKDNEREALKQRSRHHR-TAPAVEVPC--------QTHYYFTSARTLASSDT  1760
              RD ++      E E +K+  R  + T   + +P         +  +YFTSAR+LA S T
Sbjct  133   HRDDDS----GQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASRRMDFYFTSARSLAGSAT  188

Query  1759  PTYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +   +    SGP A+  + + SS+++TV  +     VSQP+ IPR+  YG FLA ++ 
Sbjct  189   PPFRSNLRPIASGPSAVGLNHNYSSDEDTVD-APQNISVSQPKPIPRSAGYGAFLATSSG  247

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P   K+LI+     F GR+LLQEH  + S  GQ LGW+MAA+YMGGR+PQIWLNIKRG+
Sbjct  248   LPHQTKALIV----GFGGRKLLQEHGTEHSAVGQVLGWMMAAVYMGGRLPQIWLNIKRGN  303

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMFVF LIAN +YVGSIL+RSTEW K+KANMPWLLDAV CVVLDLFIILQY+YY
Sbjct  304   VEGLNPLMFVFALIANVSYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQYVYY  363

Query  1225  THKKIKKRQQTQS*R  1181
               K  +K+  T + R
Sbjct  364   --KYFRKQSSTSNDR  376



>ref|XP_006283881.1| hypothetical protein CARUB_v10004998mg [Capsella rubella]
 gb|EOA16779.1| hypothetical protein CARUB_v10004998mg [Capsella rubella]
Length=392

 Score =   351 bits (901),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 209/368 (57%), Positives = 266/368 (72%), Gaps = 18/368 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+K CV WV +YF DCLCNLND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  6     YCLKEKKPCVRWVERYFDDCLCNLNDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  65

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATLPTQ +TALLYT +TVVLV+Q IYYD+   +  CR
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTALLYTVSTVVLVIQTIYYDYI--YKLCR  123

Query  1906  DKNTILVKDNEREALKQRSRHHRT-APAVEVP-------CQTHYYFTSARTLASSDTPTY  1751
                T + + +E +  K+     +T   A+ +P        +  +Y+TSAR+LA S TP  
Sbjct  124   HGRTKICQQDEEDDEKRPLNPPKTMGSAISIPRGSFKDSPRREFYYTSARSLAGSGTPPL  183

Query  1750  ---CYIMARSGPPALQYDADSSSEDETVPLSS----SQKPVSQPRSIPRataygtflaaa  1592
                 + +A+SGP A+    + SS DE   +S+    + K ++QPR+IPR   +GTFLAA+
Sbjct  184   RPSYFRVAKSGPSAMAIIDNGSSSDEDETMSTCPAITAKTITQPRAIPRQAGFGTFLAAS  243

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
             A  P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  244   ASLPLQAKSL-AEKYAHSSSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKR  302

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMFVF L+AN TYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+
Sbjct  303   GSVEGLNPLMFVFALVANVTYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYI  362

Query  1231  YYTHKKIK  1208
             YY +++ +
Sbjct  363   YYKYRRTE  370



>ref|XP_003611897.1| Membrane protein, putative [Medicago truncatula]
 gb|AES94855.1| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=380

 Score =   350 bits (899),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 210/370 (57%), Positives = 255/370 (69%), Gaps = 28/370 (8%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             ++ SYCV E K CVGWV  YF DCLCN+ND ISF  G ISLICWGVAEIPQI+TNF+ KS
Sbjct  1     MQTSYCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVS+ FL TW+ GD+FNLVGC+LEPATLPTQ++TALLYT TT+VLV+Q+ YYD+   W
Sbjct  61    SHGVSIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTALLYTITTIVLVVQSFYYDYIYKW  120

Query  1918  WKCRDK-NTILVKDNEREALKQRSR----------HHRTAPAVEVPCQTHYYFTSARTLA  1772
              K R K N     + E++ LK + R           HR  P  E      YY+ SAR+LA
Sbjct  121   CKRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE------YYYGSARSLA  174

Query  1771  SSDTP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-  1604
              + TP   TY  + A+SGP A+  + DSSS+DE     +   P +QPR IPR+       
Sbjct  175   GNVTPPSRTYMRV-AKSGPSAMGLNEDSSSDDE-----AHSVPATQPRQIPRSAGSYGTF  228

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+ + P    +L +      +GR+LL +     S  GQWLGWLMAAIY GGR+PQIWL
Sbjct  229   LAASINLPHQSNALKV-GYIALSGRKLLSQEHVTHSALGQWLGWLMAAIYTGGRIPQIWL  287

Query  1423  NIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFII  1244
             NIKRGSVEGLNP MF+F LIANATYVGSILVR+TEWE +KANMPWLLDA+ CV LDLFII
Sbjct  288   NIKRGSVEGLNPFMFIFALIANATYVGSILVRTTEWESIKANMPWLLDAIVCVALDLFII  347

Query  1243  LQYLYYTHKK  1214
             LQY+ Y + +
Sbjct  348   LQYINYRYHR  357



>ref|XP_010680925.1| PREDICTED: uncharacterized protein LOC104895967 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score =   350 bits (899),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 251/369 (68%), Gaps = 10/369 (3%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
             ++SYC  E+K C  W NKYFKDCLCNL D  SF  GI+SL+ WGVAE+PQI+TNF+ KSS
Sbjct  13    KVSYCWREKKPCAWWANKYFKDCLCNLRDHFSFAFGIVSLLAWGVAEVPQIITNFRTKSS  72

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              GVSL FL  W  GD+FNLVGC+LEPATLPTQ +TA LYT +T+VLVLQ++YYD+F  W 
Sbjct  73    HGVSLLFLLGWFFGDIFNLVGCLLEPATLPTQLYTAFLYTTSTIVLVLQSVYYDYFYQWL  132

Query  1915  KCRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT--HYYFTSARTLASSDTP---TY  1751
             KCR        + E++ L  +       P    P +     Y+TSAR+LA S TP   +Y
Sbjct  133   KCRHNGVHEEVEEEKKPLNPKPTDQTGIPIPSAPVRAPIRRYYTSARSLAGSGTPPFRSY  192

Query  1750  CYIMARSGPPALQYDADSSSEDET---VPLSSSQKPVSQPRSIPR-ataygtflaaaAHF  1583
                  RSGP AL     SSS+DE    +P+ + +   S PR IPR A       A + + 
Sbjct  193   LTTGPRSGPSALVRGYHSSSDDEETNPIPIPAKRGTASLPRQIPRPAARGAMVAAVSVNL  252

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+GG +L +EA   F GRR+L EH  + S  GQWLGWLMAAIYMGGR+PQI  NIKRGSV
Sbjct  253   PIGGNAL-LEAYKGFTGRRMLSEHGSEHSAVGQWLGWLMAAIYMGGRIPQIIWNIKRGSV  311

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EGLNPLMF+F LIAN  YVGSI+VR TE  ++KANMPWLLDAV CVVLDLFII+QY+YY 
Sbjct  312   EGLNPLMFIFALIANVAYVGSIVVRRTELAEIKANMPWLLDAVVCVVLDLFIIMQYVYYK  371

Query  1222  HKKIKKRQQ  1196
             H + +  ++
Sbjct  372   HMRKRNTRE  380



>gb|KFK30302.1| hypothetical protein AALP_AA7G244100 [Arabis alpina]
Length=390

 Score =   350 bits (897),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 263/374 (70%), Gaps = 20/374 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E K CV WV +YF DCLCNLND++SF +GI  +ICW VAE+PQI+TNF+ KSS GV
Sbjct  6     YCLKENKPCVRWVERYFDDCLCNLNDDVSFALGIAGIICWTVAEVPQIITNFRTKSSHGV  65

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL FL  W+ GD+FNL+GC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+F   ++  
Sbjct  66    SLYFLLAWVAGDIFNLIGCILEPATLPTQFYTALLYTVSTVVLVIQTIYYDYFYKLYR-H  124

Query  1906  DKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDTP---  1757
              +  +  K+ E E  +          A+ +P +++       +Y+TSAR+LA S TP   
Sbjct  125   GRTKVSQKEEEDEKKRPLQPPKTMGSAISIPGESYKSSHRKEFYYTSARSLAGSSTPPLR  184

Query  1756  TYCYIMARSGPPALQYDADSSSEDETVPLSSSQ-----KPVSQPRSIPRataygtflaaa  1592
             +  + +A+SGP A+     SS EDET+   SSQ     K ++QPR IPR   +GTFLA +
Sbjct  185   SSYFRVAKSGPSAMAIYGSSSDEDETM---SSQPVVTVKTITQPRPIPRQAGFGTFLATS  241

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
                P+  KSL  E     + RRLL E   + S  GQ LGWLMAAIYMGGR+PQIWLNIKR
Sbjct  242   VTLPLQAKSL-AEKYANASSRRLLNERIIEHSALGQRLGWLMAAIYMGGRIPQIWLNIKR  300

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F L+ANATYVGSILVR+TEW+ +K N+PWLLD++ CVVLDLFIILQY+
Sbjct  301   GSVEGLNPLMFIFALLANATYVGSILVRTTEWDNIKPNLPWLLDSIVCVVLDLFIILQYI  360

Query  1231  YYTHKKIKKRQQTQ  1190
             YY + + K  ++ +
Sbjct  361   YYKYGRTKSLEREE  374



>ref|XP_010029842.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X3 [Eucalyptus grandis]
Length=361

 Score =   348 bits (894),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 266/360 (74%), Gaps = 14/360 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHHR---------TAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQ-EHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
              P+  KS   EA    + R+LLQ E   + SV GQWLGWLMAAIYMGGR+PQIWLNIKRG
Sbjct  243   LPLQNKSF-TEAHVVLSTRKLLQQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRG  301

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNPLMF+F L+AN TYVGSILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY+Y
Sbjct  302   SVEGLNPLMFIFALVANVTYVGSILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIY  361



>ref|XP_011025700.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 isoform 
X2 [Populus euphratica]
Length=375

 Score =   349 bits (895),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 208/360 (58%), Positives = 253/360 (70%), Gaps = 17/360 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV ERK CV WV KYFKDCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKERKPCVRWVEKYFKDCLCSLKDEFSFAFGLISLVCWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFL TW+ GD+FNLVGC+LEPATL T          +TVVLVLQ +YYDH   W
Sbjct  61    SHGVSLAFLLTWVAGDIFNLVGCLLEPATLYTT---------STVVLVLQGLYYDHVYRW  111

Query  1918  WKCRDKNTILVKDNEREALKQRS--RHHRTAPAV--EVPCQTHYYFTSARTLASSDTPTY  1751
              +CR        D++++ LK +S  R   + P        +  +Y+ SAR+LA S+TP +
Sbjct  112   CRCRKTKDNQQVDDDQDPLKPKSADRSGISIPKASPRATSRRDFYYMSARSLAGSNTPPF  171

Query  1750  -CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
               Y+  A+SGP A+  D +SSS+DE     S    VSQPR IPR+  YGTFLA + + P+
Sbjct  172   RSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPL  231

Query  1576  GGKSLIMEAQTKFAGRRLLQEHE-FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
               K+L  +A   + GRRLL E    D S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  232   QSKALT-QAYIGYTGRRLLHEGGGMDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVE  290

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF L+AN TYV SI+VR+TEW+ +K NMPWLLDA  CV LD FIILQY+YY +
Sbjct  291   GLNPLMFVFALVANLTYVLSIVVRTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  350



>ref|XP_010446736.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Camelina 
sativa]
Length=390

 Score =   349 bits (896),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 272/372 (73%), Gaps = 19/372 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+KACV WV +YF DCLCN+ND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATLPTQ +TALLYT +TVVLV+Q IYYD+   +  CR
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTALLYTVSTVVLVIQTIYYDYI--YRLCR  125

Query  1906  DKNTILVKDNEREALKQRSRHHR-TAPAVEVPCQTH-------YYFTSARTLASSDTP--  1757
                T + + +E +  K+  +  + T  A+ +P  ++       +Y+TSAR+LA S TP  
Sbjct  126   HGRTKICQTDEEDEEKRPLKPPKATGSAISIPRGSYKDSPRREFYYTSARSLAGSGTPPL  185

Query  1756  -TYCYIMARSGPPALQYD-ADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHF  1583
              +  + +A+SGP AL  +   SS EDET+  +     ++QPR+IPR   +GTFLAA+A  
Sbjct  186   RSSYFRVAKSGPSALAIENVYSSDEDETMS-TCPVITITQPRAIPRPAGFGTFLAASASL  244

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSV
Sbjct  245   PLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSV  303

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EG+NPLMFVF L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+YY 
Sbjct  304   EGMNPLMFVFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYK  363

Query  1222  H---KKIKKRQQ  1196
             +   + IK  ++
Sbjct  364   YCRSQSIKTEEE  375



>gb|ACJ84546.1| unknown [Medicago truncatula]
 gb|AFK47718.1| unknown [Medicago truncatula]
Length=380

 Score =   349 bits (895),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 255/370 (69%), Gaps = 28/370 (8%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             ++ SYCV E K CVGWV  YF DCLCN+ND ISF  G ISLICWGVAEIPQI+TNF+ KS
Sbjct  1     MQTSYCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVS+ FL TW+ GD+FNLVGC+LEPA LPTQ++TALLYT TT+VLV+Q++YYD+   W
Sbjct  61    SHGVSIVFLLTWVAGDIFNLVGCLLEPAMLPTQYYTALLYTITTIVLVVQSLYYDYIYKW  120

Query  1918  WKCRDK-NTILVKDNEREALKQRSR----------HHRTAPAVEVPCQTHYYFTSARTLA  1772
              K R K N     + E++ LK + R           HR  P  E      YY+ SAR+LA
Sbjct  121   CKRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE------YYYGSARSLA  174

Query  1771  SSDTP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-  1604
              + TP   TY  + A+SGP A+  + DSSS+DE     +   P +QPR IPR+       
Sbjct  175   GNVTPPSRTYMRV-AKSGPSAMGLNEDSSSDDE-----AHSVPATQPRQIPRSAGSYGTF  228

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+ + P    +L +      +GR+LL +     S  GQWLGWLMAAIY GGR+PQIWL
Sbjct  229   LAASINLPHQSNALKV-GYIALSGRKLLSQEHVTHSALGQWLGWLMAAIYTGGRIPQIWL  287

Query  1423  NIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFII  1244
             NIKRGSVEGLNP MF+F LIANATYVGSILVR+TEWE +KANMPWLLDA+ CV LDLFII
Sbjct  288   NIKRGSVEGLNPFMFIFALIANATYVGSILVRTTEWESIKANMPWLLDAIVCVALDLFII  347

Query  1243  LQYLYYTHKK  1214
             LQY+ Y + +
Sbjct  348   LQYINYRYHR  357



>ref|XP_006425752.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
 ref|XP_006466709.1| PREDICTED: probable vacuolar amino acid transporter YPQ1-like 
[Citrus sinensis]
 gb|ESR38992.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
Length=388

 Score =   349 bits (895),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 214/366 (58%), Positives = 259/366 (71%), Gaps = 10/366 (3%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
              ++YCV ERK CVGW+ +YFKDCLCN+ DE SF  G+ SL+CWGVAEIPQI+TNF+ KSS
Sbjct  3     SINYCVKERKGCVGWIERYFKDCLCNVKDEFSFGFGLSSLVCWGVAEIPQIITNFRTKSS  62

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              GVSL FL TW+ GD+FNL GC+LEPATLPTQF+TALLYT +TVVLVLQ +YYDH     
Sbjct  63    HGVSLLFLLTWVAGDIFNLTGCLLEPATLPTQFYTALLYTISTVVLVLQGVYYDHIFKRL  122

Query  1915  KCRDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDTPTYCY  1745
             K R       ++ E++ L  +S          +V+   +  YY+TSAR+LASS TP +  
Sbjct  123   KGRHTKATRREEEEKKPLAPKSGDAAIPIPKASVKSSPRREYYYTSARSLASSGTPPFRT  182

Query  1744  IM--ARSGPPALQYDADSSSEDETVPL-----SSSQKPVSQPRSIPRataygtflaaaAH  1586
              +  A+SGP AL  D DSSS+DE         SS   P SQPR IPR+  YGTFLAA+ +
Sbjct  183   FLRAAQSGPSALGLDNDSSSDDEAAAAAPTLSSSGNPPTSQPRPIPRSAGYGTFLAASVN  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P    +L       F  R LL  +  + S  GQWLGWLMAAIYMGGR+PQIWLNIKRGS
Sbjct  243   LPFQSNALAGAMAAGFHSRTLLNGNNMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGS  302

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMFVF L+AN TYV SI+VR+TEWE +KANMPWLLDA+ CV+LDLFIILQY+YY
Sbjct  303   VEGLNPLMFVFALVANVTYVLSIVVRTTEWESIKANMPWLLDAIVCVLLDLFIILQYIYY  362

Query  1225  THKKIK  1208
              + + K
Sbjct  363   RYFRKK  368



>ref|XP_010437297.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Camelina sativa]
Length=390

 Score =   349 bits (895),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 206/361 (57%), Positives = 262/361 (73%), Gaps = 15/361 (4%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+KACV WV +YF DCLCN+ND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATLPTQ +TALLYT +TVVLV+Q IYYD+   +  CR
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTALLYTVSTVVLVIQTIYYDYI--YKLCR  125

Query  1906  DKNTILVKDNEREALKQRSRH--HRTAPAVEVPCQTH-------YYFTSARTLASSDTP-  1757
                T +    + E  ++R       T  A+ +P  ++       +Y+TSAR+LA S TP 
Sbjct  126   HGRTKICTQTDEEDEEKRPLKLPKTTGSAISIPRGSYKDSPRKEFYYTSARSLAGSGTPP  185

Query  1756  --TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHF  1583
               +  + +A+SGP AL  +  SSS+++    +     ++QPR IPR   +GTFLAA+A  
Sbjct  186   LRSSYFRVAKSGPSALAIENGSSSDEDETMSTCPVITITQPRPIPRPAGFGTFLAASASL  245

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+V
Sbjct  246   PLQAKSL-AEKYAHASSRRLLNEKIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGNV  304

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EG+NPLMFVF L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+YY 
Sbjct  305   EGMNPLMFVFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYK  364

Query  1222  H  1220
             +
Sbjct  365   Y  365



>ref|XP_006590674.1| PREDICTED: probable vacuolar amino acid transporter YPQ2-like 
[Glycine max]
Length=381

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 225/363 (62%), Positives = 266/363 (73%), Gaps = 15/363 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV KY  DCLCNL DEISF  G ISLICWGVAEIPQI+TNF+ KSS G
Sbjct  6     SYCVKESKPCVGWVEKYLGDCLCNLKDEISFGFGFISLICWGVAEIPQIITNFRAKSSHG  65

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW+ GD+FNLVGC LEPATLPTQ++TALLYT TT+VLVLQ+ YYD+   W K 
Sbjct  66    VSLAFLLTWVAGDIFNLVGCHLEPATLPTQYYTALLYTITTIVLVLQSFYYDYIYKWGKR  125

Query  1909  RDK-NTI-LVKDNEREALKQR-SRHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPT  1754
               K NT    K+ E++ L+ +  R H   P       E P +  YY+ SAR+LA++DTP 
Sbjct  126   HGKINTDEAYKEEEKKPLRPKPGRDHSGIPIQNDGPKETP-RRDYYYRSARSLAANDTPP  184

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRa--taygtflaaaAH  1586
             +   +  A+S P A+  + DSSS+D+     SS+KPV+QPR IPR+    YGTFL A+ +
Sbjct  185   FGTYLRAAKSVPSAIVMNDDSSSDDDEAHPLSSKKPVTQPRPIPRSVPATYGTFLVASMN  244

Query  1585  FPVGGKSLIMEAQTKFAGRR-LLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
             FP  G +L ME   +F GR+ LLQEH    +  GQWLGWLMA IYMGGR+PQIWLNIKRG
Sbjct  245   FPRQGNAL-MEGYNRFNGRKLLLQEHNSMHTALGQWLGWLMAVIYMGGRLPQIWLNIKRG  303

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
              VEGLNPLMFVF LIANATYVGSILVR+TEWE ++ANMPWLLDA+ CV LDLFIILQY  
Sbjct  304   GVEGLNPLMFVFALIANATYVGSILVRTTEWESIRANMPWLLDAIVCVALDLFIILQYAN  363

Query  1228  YTH  1220
             Y +
Sbjct  364   YRY  366



>dbj|BAH56966.1| AT4G36850 [Arabidopsis thaliana]
Length=376

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 246/345 (71%), Gaps = 18/345 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             V L YC+ E+K CV WV  YF DCLCNLND++SF +GI SL+CWGVAEIPQ++TNF+ KS
Sbjct  2     VSLGYCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKS  61

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S+GVSL+FL  W+ GD+FNLVGC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +
Sbjct  62    SNGVSLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--Y  119

Query  1918  WKCRDKNT-ILVKDNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSD  1763
               CR + T I  KD E E  +          A+ +P  ++       +Y+TSAR+LA S 
Sbjct  120   KLCRHRRTKICQKDEEGEEKRPLKPPKTMGSAISIPGGSYKDSSRREFYYTSARSLAGSG  179

Query  1762  TP---TYCYIMARSGPPALQYDADSSSEDETVPLSS----SQKPVSQPRSIPRataygtf  1604
             TP   T  + +A+SGP AL  D D SS DE   +S+    + K +++PR IPR   +GTF
Sbjct  180   TPPLRTSYFRVAKSGPSALAIDNDGSSSDEDETMSTCPVITAKTITKPRPIPRQAGFGTF  239

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+A  P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWL
Sbjct  240   LAASASLPLQTKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWL  298

Query  1423  NIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPW  1289
             NIKRGSVEGLNPLMF+F L+ANATYVGSILVR+TEW+ +K N+PW
Sbjct  299   NIKRGSVEGLNPLMFIFALVANATYVGSILVRTTEWDNIKPNLPW  343



>ref|XP_004233648.1| PREDICTED: probable vacuolar amino acid transporter YPQ2 [Solanum 
lycopersicum]
Length=389

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 220/375 (59%), Positives = 270/375 (72%), Gaps = 20/375 (5%)
 Frame = -1

Query  2311  LRTLVFINMGGVELSYCVVERKACV-GWVNKYFKDCLCNLNDEISFVVGIISLICWGVAE  2135
             ++ L+ +      ++YCV E K CV GWVN YFKDCLCN+ DE SF  G +SLICW VAE
Sbjct  1     MKVLMLLRQQQNSIAYCVKENKPCVVGWVNLYFKDCLCNVRDEFSFGFGFVSLICWAVAE  60

Query  2134  IPQIVTNFKNKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlv  1955
             IPQIVTNF+ KSSSGVSL FL  W++GDVFNL GC+LE ATLPTQ +TA+LYTATT++LV
Sbjct  61    IPQIVTNFRTKSSSGVSLLFLLGWVVGDVFNLTGCLLESATLPTQLYTAVLYTATTIILV  120

Query  1954  lqAIYYDHFLPWWKCRDKNTILVKDNEREALKQRSRHHRTAPA-VEVPCQT-----HYYF  1793
             LQ +YYD+F   WK R +N     + E E LK+  R  +T  + + +PC++      +YF
Sbjct  121   LQILYYDYFYKCWK-RSENETRQLEVE-EVLKKPLRPQKTTDSGIPIPCRSASRPMDFYF  178

Query  1792  TSARTLASSDTPTYCYIM--ARSGPPALQYDADSSSEDETV--PLSSSQKPVSQPRSIPR  1625
              SAR+LA S TP +   +    S P A+  + + SS+D+TV  PLS S   VSQP+ IPR
Sbjct  179   MSARSLAGSSTPPFRSNLRPIASEPSAVGLNHNYSSDDDTVDAPLSIS---VSQPKPIPR  235

Query  1624  ataygtflaaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGG  1445
             +  YG FLA A+  P   K+LI+     F GR+LLQEH  + S  GQ LGW+MAA+YMGG
Sbjct  236   SAGYGAFLATASGMPHQTKALIV----GFGGRKLLQEHGTEHSALGQCLGWMMAAVYMGG  291

Query  1444  RVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacv  1265
             R+PQIWLNIKRGSVEGLNP MFVF LIAN TYVGSIL+RSTEW K+KANMPWLLDAV CV
Sbjct  292   RIPQIWLNIKRGSVEGLNPFMFVFALIANITYVGSILLRSTEWSKIKANMPWLLDAVVCV  351

Query  1264  vldLFIILQYLYYTH  1220
             VLDLFIILQY+YY +
Sbjct  352   VLDLFIILQYVYYKY  366



>ref|XP_010254970.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Nelumbo nucifera]
Length=378

 Score =   347 bits (890),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 262/367 (71%), Gaps = 15/367 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YC  ++K CVGWV  YFKDCLCNL+DEISF  G  SLICWGVAEIPQI+TNF  KS  G
Sbjct  8     AYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSGQG  67

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW++GDVFNLVGC+LEPATLPTQF+TA+LYT TTVVLVLQ +YYD    WWK 
Sbjct  68    VSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAVLYTVTTVVLVLQCLYYDRICLWWKS  127

Query  1909  RDKNTILVKDNEREALKQRSRHH-----RTAPAVEVPCQTHYYFTSARTLASSDTPTY-C  1748
             + K + +  D E + L  +          + P    P +  YY TSAR+LASS TPT   
Sbjct  128   KGKQSYV--DEETKPLNSKLLDTSVPIPSSGPQEASPSRDLYY-TSARSLASSSTPTLGS  184

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+ ++RSGP A++  +D SSEDE  P+   +K  SQP+  P +  YG FL A+A+ P   
Sbjct  185   YLGISRSGPSAVEEQSD-SSEDEAFPV-YDKKSSSQPKRTPPSVGYGAFLGASANLPFRS  242

Query  1570  KSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLN  1391
              +L ME      GRR L E E  ++V G  LGWLMAAIYMGGR+PQI+LNI+RGSVEGLN
Sbjct  243   MAL-MEGYLASTGRR-LHETEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLN  300

Query  1390  PLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKI  1211
             PLMF+F LIAN TYVGSILVRSTEW ++KANMPWL DA+ CV LDLFII+QY+YY   + 
Sbjct  301   PLMFIFALIANVTYVGSILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQ-  359

Query  1210  KKRQQTQ  1190
             K+R  +Q
Sbjct  360   KRRASSQ  366



>ref|XP_010254971.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X3 [Nelumbo nucifera]
Length=368

 Score =   346 bits (887),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 249/367 (68%), Gaps = 25/367 (7%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YC  ++K CVGWV  YFKDCLCNL+DEISF  G  SLICWGVAEIPQI+TNF  KS  G
Sbjct  8     AYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSGQG  67

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW++GDVFNLVGC+LEPATLPTQF+                +YYD    WWK 
Sbjct  68    VSLAFLLTWVVGDVFNLVGCLLEPATLPTQFY------------TAVCLYYDRICLWWKS  115

Query  1909  RDKNTILVKDNEREALKQRSRHH-----RTAPAVEVPCQTHYYFTSARTLASSDTPTY-C  1748
             + K + ++ D E + L  +          + P    P +  YY TSAR+LASS TPT   
Sbjct  116   KGKQSYVMVDEETKPLNSKLLDTSVPIPSSGPQEASPSRDLYY-TSARSLASSSTPTLGS  174

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+ ++RSGP A++  +D SSEDE  P+   +K  SQP+  P +  YG FL A+A+ P   
Sbjct  175   YLGISRSGPSAVEEQSD-SSEDEAFPV-YDKKSSSQPKRTPPSVGYGAFLGASANLPFRS  232

Query  1570  KSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLN  1391
              +L ME      GRR L E E  ++V G  LGWLMAAIYMGGR+PQI+LNI+RGSVEGLN
Sbjct  233   MAL-MEGYLASTGRR-LHETEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLN  290

Query  1390  PLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKI  1211
             PLMF+F LIAN TYVGSILVRSTEW ++KANMPWL DA+ CV LDLFII+QY+YY   + 
Sbjct  291   PLMFIFALIANVTYVGSILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQ-  349

Query  1210  KKRQQTQ  1190
             K+R  +Q
Sbjct  350   KRRASSQ  356



>ref|XP_003611896.1| Membrane protein, putative [Medicago truncatula]
Length=382

 Score =   345 bits (885),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 210/372 (56%), Positives = 255/372 (69%), Gaps = 30/372 (8%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             ++ SYCV E K CVGWV  YF DCLCN+ND ISF  G ISLICWGVAEIPQI+TNF+ KS
Sbjct  1     MQTSYCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVS+ FL TW+ GD+FNLVGC+LEPATLPTQ++TALLYT TT+VLV+Q+ YYD+   W
Sbjct  61    SHGVSIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTALLYTITTIVLVVQSFYYDYIYKW  120

Query  1918  WKCRDK-NTILVKDNEREALKQRSR----------HHRTAPAVEVPCQTHYYFTSARTLA  1772
              K R K N     + E++ LK + R           HR  P  E      YY+ SAR+LA
Sbjct  121   CKRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE------YYYGSARSLA  174

Query  1771  SSDTP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-  1604
              + TP   TY  + A+SGP A+  + DSSS+DE     +   P +QPR IPR+       
Sbjct  175   GNVTPPSRTYMRV-AKSGPSAMGLNEDSSSDDE-----AHSVPATQPRQIPRSAGSYGTF  228

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+ + P    +L +      +GR+LL +     S  GQWLGWLMAAIY GGR+PQIWL
Sbjct  229   LAASINLPHQSNALKV-GYIALSGRKLLSQEHVTHSALGQWLGWLMAAIYTGGRIPQIWL  287

Query  1423  N--IKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLF  1250
             N  IKRGSVEGLNP MF+F LIANATYVGSILVR+TEWE +KANMPWLLDA+ CV LDLF
Sbjct  288   NVRIKRGSVEGLNPFMFIFALIANATYVGSILVRTTEWESIKANMPWLLDAIVCVALDLF  347

Query  1249  IILQYLYYTHKK  1214
             IILQY+ Y + +
Sbjct  348   IILQYINYRYHR  359



>ref|XP_006380745.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
 gb|ERP58542.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
Length=375

 Score =   344 bits (882),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 252/360 (70%), Gaps = 17/360 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV E+K CV WV KYFKDCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFL TW+ GD+FNLVGC+LEPATL T          +TVVLVLQ +YYDH   W
Sbjct  61    SHGVSLAFLLTWVAGDIFNLVGCLLEPATLYTT---------STVVLVLQGLYYDHVYRW  111

Query  1918  WKCRDKNTILVKDNEREALKQRS--RHHRTAPAV--EVPCQTHYYFTSARTLASSDTPTY  1751
              +CR        D++++ LK +S  R   + P        +  +Y+ SAR+LA S+TP +
Sbjct  112   CRCRKTKDNQQVDDDQDPLKPKSADRSGISIPKASPRATPRRDFYYMSARSLAGSNTPPF  171

Query  1750  -CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
               Y+  A+SGP A+  D +SSS+DE     S    VSQPR IPR+  YGTFLA + + P+
Sbjct  172   RSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPL  231

Query  1576  GGKSLIMEAQTKFAGRRLLQE-HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
               K+L  +A   + GRRLL E    D S  GQWLGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  232   QSKAL-TQAYIGYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVE  290

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             GLNPLMFVF L+AN TYV SI+ R+TEW+ +K NMPWLLDA  CV LD FIILQY+YY +
Sbjct  291   GLNPLMFVFALVANLTYVLSIVARTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  350



>ref|XP_006338274.1| PREDICTED: seven transmembrane protein 1-like [Solanum tuberosum]
Length=390

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 217/389 (56%), Positives = 272/389 (70%), Gaps = 23/389 (6%)
 Frame = -1

Query  2311  LRTLVFINMGGVELSYCVVERKACV-GWVNKYFKDCLCNLNDEISFVVGIISLICWGVAE  2135
             ++ L+ +      ++YCV E K CV GWVN YFKDCLCN+ DE SF  G +SLICW VAE
Sbjct  1     MKVLMLLRQQQNSIAYCVKENKPCVVGWVNLYFKDCLCNVRDEFSFGFGFVSLICWAVAE  60

Query  2134  IPQIVTNFKNKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlv  1955
             IPQIVTNF+ KSS GVSL FL  W++GDVFNL GC+LEPATLPTQ +TA+LYT TT++LV
Sbjct  61    IPQIVTNFRTKSSHGVSLVFLLGWVIGDVFNLTGCLLEPATLPTQLYTAVLYTGTTIILV  120

Query  1954  lqAIYYDHFLPWWKCRDKNTILVKDNEREALKQRSRHHRTAPA-VEVPCQT-----HYYF  1793
             LQ +YYD+F   WK  +  T  ++    E LK+  R  +T  + + +P ++      +YF
Sbjct  121   LQILYYDYFYKCWKRSENETGQLE--VEEVLKKPLRPQKTTDSGIPIPSRSASRPMDFYF  178

Query  1792  TSARTLASSDTPTYCYIM--ARSGPPALQYDA-DSSSEDETV--PLSSSQKPVSQPRSIP  1628
              SAR+LA S TP +   +    S P A++ +  D SS+D+TV  PL+ S   VSQP+ IP
Sbjct  179   MSARSLAGSSTPPFRSNLRPIASDPSAVRLNNHDYSSDDDTVDAPLNIS---VSQPKPIP  235

Query  1627  RataygtflaaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMG  1448
             R+  YG F A  +  P   K+L++     F GR+LLQEH  + S  GQ LGW+MAA+YMG
Sbjct  236   RSAGYGAFFATVSGMPHQTKALLV----GFGGRKLLQEHGTEHSALGQCLGWMMAAVYMG  291

Query  1447  GRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavac  1268
             GR+PQIWLNIKRGSVEGLNP MFVF LIAN TYVGSIL+RSTEW K+KANMPWLLDAV C
Sbjct  292   GRIPQIWLNIKRGSVEGLNPFMFVFALIANVTYVGSILLRSTEWSKIKANMPWLLDAVVC  351

Query  1267  vvldLFIILQYLYYTHKKIKKRQQTQS*R  1181
             VVLDLFIILQY+YY  K ++K   T + R
Sbjct  352   VVLDLFIILQYVYY--KYVRKNPSTSNGR  378



>ref|XP_008457880.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Cucumis 
melo]
 ref|XP_008457881.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Cucumis 
melo]
Length=381

 Score =   342 bits (877),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 262/367 (71%), Gaps = 18/367 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YCV E+K CVGWV  YFKDCLCNL D++SF  G++SL+CWG+AEIPQIVTNF+ KSS GV
Sbjct  5     YCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSSHGV  64

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL FL TW+ GDVFNLVGC+LEPATLPTQ +TALLYT  T+VLVLQ++YYD+   W  C 
Sbjct  65    SLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTALLYTVNTIVLVLQSVYYDYVTKW--CI  122

Query  1906  DKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPTYC  1748
             D+ +   +  E E    +         + +P  +        +Y+TSAR+LA SDTP + 
Sbjct  123   DRKSKSDQTVEEEKTPLKGNKGVGYAGIPIPKASPKPTPRREFYYTSARSLAGSDTPPFR  182

Query  1747  YI--MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVG  1574
                 + +SGP AL  D+ SS E+       S   V+QPR IPR+  YGTFLAA+A+ P  
Sbjct  183   AFLRLPKSGPSALGNDSSSSDEESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLPFQ  242

Query  1573  GKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
              K         F+GR+LLQEH   S   GQ LGWLMAAIYMGGR+PQIWLNIKRGSVEGL
Sbjct  243   SKGF----SDGFSGRKLLQEHSSHSGF-GQLLGWLMAAIYMGGRLPQIWLNIKRGSVEGL  297

Query  1393  NPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             NPLMFVF LIANATYV SI+VRSTEWE +KANMPWLLDAV CV+LDLFIILQY+YY  ++
Sbjct  298   NPLMFVFALIANATYVASIVVRSTEWENIKANMPWLLDAVVCVLLDLFIILQYIYY--RR  355

Query  1213  IKKRQQT  1193
              ++++Q+
Sbjct  356   FRRKRQS  362



>ref|XP_010254972.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X4 [Nelumbo nucifera]
Length=366

 Score =   341 bits (874),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 248/367 (68%), Gaps = 27/367 (7%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YC  ++K CVGWV  YFKDCLCNL+DEISF  G  SLICWGVAEIPQI+TNF  KS  G
Sbjct  8     AYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSGQG  67

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW++GDVFNLVGC+LEPATLPTQF+                +YYD    WWK 
Sbjct  68    VSLAFLLTWVVGDVFNLVGCLLEPATLPTQFY------------TAVCLYYDRICLWWKS  115

Query  1909  RDKNTILVKDNEREALKQRSRHH-----RTAPAVEVPCQTHYYFTSARTLASSDTPTY-C  1748
             + K + +  D E + L  +          + P    P +  YY TSAR+LASS TPT   
Sbjct  116   KGKQSYV--DEETKPLNSKLLDTSVPIPSSGPQEASPSRDLYY-TSARSLASSSTPTLGS  172

Query  1747  YI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGG  1571
             Y+ ++RSGP A++  +D SSEDE  P+   +K  SQP+  P +  YG FL A+A+ P   
Sbjct  173   YLGISRSGPSAVEEQSD-SSEDEAFPV-YDKKSSSQPKRTPPSVGYGAFLGASANLPFRS  230

Query  1570  KSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLN  1391
              +L ME      GRR L E E  ++V G  LGWLMAAIYMGGR+PQI+LNI+RGSVEGLN
Sbjct  231   MAL-MEGYLASTGRR-LHETEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLN  288

Query  1390  PLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKI  1211
             PLMF+F LIAN TYVGSILVRSTEW ++KANMPWL DA+ CV LDLFII+QY+YY   + 
Sbjct  289   PLMFIFALIANVTYVGSILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQ-  347

Query  1210  KKRQQTQ  1190
             K+R  +Q
Sbjct  348   KRRASSQ  354



>ref|XP_002866989.1| hypothetical protein ARALYDRAFT_490949 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43248.1| hypothetical protein ARALYDRAFT_490949 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   340 bits (872),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 208/374 (56%), Positives = 265/374 (71%), Gaps = 27/374 (7%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             V L YC+ E+K CV WV +YF DCLCNLND++SF +GI SL+CWGVAEIPQI+TNF+ KS
Sbjct  2     VSLGYCLKEKKTCVRWVERYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQIITNFRTKS  61

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSL+FL  W+ GD+FNLVGC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +
Sbjct  62    SHGVSLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--Y  119

Query  1918  WKCRDKNTILVKDNEREALKQRSRHHRT-APAVEVPCQTH-------YYFTSARTLASSD  1763
               CR   T +    E +  K+  +  +T   A+ +P  ++       +Y+TSAR+LA S 
Sbjct  120   KLCRHGRTKICPKEEEDEEKRPLKPPKTMGSAISIPGGSYKDSPRREFYYTSARSLAGSG  179

Query  1762  TP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaa  1592
             TP   T  + +A+SGP AL  D  SSSE++    + S  P            +GTFLAA+
Sbjct  180   TPPLRTSYFRVAKSGPSALAIDNGSSSEEDE---AMSTCPAG----------FGTFLAAS  226

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
             A  P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  227   ASLPLQAKSL-AENYWHASSRRLLNERRVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKR  285

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+
Sbjct  286   GSVEGLNPLMFIFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYI  345

Query  1231  YYTHKKIKKRQQTQ  1190
             YY + +++  ++ +
Sbjct  346   YYKYCRMQSLERKE  359



>ref|XP_007156011.1| hypothetical protein PHAVU_003G251100g [Phaseolus vulgaris]
 gb|ESW28005.1| hypothetical protein PHAVU_003G251100g [Phaseolus vulgaris]
Length=380

 Score =   339 bits (870),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 210/369 (57%), Positives = 264/369 (72%), Gaps = 16/369 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV ERKACV WV KYFKDCLCN+ DEISF +G+ISL+ WGVAEIPQI+T F+ K S G
Sbjct  4     SYCVEERKACVRWVEKYFKDCLCNMKDEISFSLGLISLVFWGVAEIPQIITIFRTKKSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GD+ NL GC+LEPATLPTQ++TALLYT TT+VL+L  IYYD+   W+K 
Sbjct  64    VSLLFLLTWVAGDICNLTGCLLEPATLPTQYYTALLYTITTIVLLLLIIYYDYISNWYKL  123

Query  1909  RDK-NTILVKDNEREALKQRSRHHRTAPAV------EVPCQTHYYFTSARTLASSDTPTY  1751
             R K N    ++ ER+ LK     + +   +       VP Q  Y++ SAR+LA S TP +
Sbjct  124   RQKVNHKRDEEEERKQLKPPKPTYESGIPIPNGTLKAVPRQ-EYFYMSARSLAGSGTPPW  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                M  A+SGP A++   DSSSED+    + S+ P ++ R IPR       TFLAAA + 
Sbjct  183   GTYMRAAKSGPSAMESIHDSSSEDDETYPAFSKNPPTKARPIPRPAVGSYGTFLAAAVNL  242

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+   +L  E   +F GR+LLQE+E  S+  GQ LGWLMAAIY+ GR+PQIWLNIKRGSV
Sbjct  243   PLKANAL-REGYIRFGGRKLLQEYETHSTF-GQGLGWLMAAIYISGRIPQIWLNIKRGSV  300

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EGL+P MF+F L+AN TYVGSILVR+TE+E +KANMPWLLDAV CV LDLFIILQY+YY 
Sbjct  301   EGLSPFMFIFALVANVTYVGSILVRTTEFESIKANMPWLLDAVLCVALDLFIILQYIYYR  360

Query  1222  HKKIKKRQQ  1196
             +  + +R++
Sbjct  361   Y--LPRREE  367



>ref|XP_003547999.1| PREDICTED: uncharacterized protein LOC100787660 [Glycine max]
 gb|KHN44508.1| Putative membrane protein [Glycine soja]
Length=379

 Score =   337 bits (865),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 210/359 (58%), Positives = 254/359 (71%), Gaps = 15/359 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV ERK CV WV KYFKDCLCNL DEISF  G+ SL+ WGVAEIPQI+T F+ K S G
Sbjct  4     SYCVKERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GD+ NL GC+LEPATLPTQ++TALLYT TT+VL+L  +YYD+   W+K 
Sbjct  64    VSLVFLLTWVAGDICNLTGCILEPATLPTQYYTALLYTITTIVLLLLIVYYDYISRWYKH  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPTY  1751
             R K   L +D+E E    +     +   + +P  T        +Y+ SAR+LA S TP +
Sbjct  124   RQKVN-LKRDHEEEKKPLKPPKPTSKSGIPIPNGTPKAAPRQEHYYMSARSLAGSGTPPW  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                M  A+SGP A++   DSSS++E  P +SS    +Q   IPR+ A    TFLAAA + 
Sbjct  183   GTYMGAAKSGPAAMESINDSSSDNEAPP-ASSNNSATQAMPIPRSVAGSYGTFLAAAVNL  241

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+ G +L  E    F GR+LLQE+E  S+  GQWLGWLMAAIY+ GRVPQIWLNIKRGSV
Sbjct  242   PLRGNAL-REGYIGFGGRKLLQEYETHSTF-GQWLGWLMAAIYISGRVPQIWLNIKRGSV  299

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             EGLNP MFVF L+AN TYVGSILVR+TEWE++KANMPWLLDAV CV LD FII QY+YY
Sbjct  300   EGLNPFMFVFALVANVTYVGSILVRTTEWERIKANMPWLLDAVICVALDFFIISQYIYY  358



>ref|XP_010664648.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Vitis 
vinifera]
 ref|XP_010664649.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Vitis 
vinifera]
 emb|CAN79067.1| hypothetical protein VITISV_043720 [Vitis vinifera]
Length=232

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/235 (79%), Positives = 205/235 (87%), Gaps = 4/235 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ST+R P SPS SS+NG+N  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MTSGFGE-STSRPPQSPSFSSNNGSNS-DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALVEEEKLVPLYGRGK STDPRSKSIPG+ IP+RPTGQRPET A
Sbjct  59   KWLHIHSHSQECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGINIPNRPTGQRPET-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPDAN F QHGFGF GG GGF PMATARFGNFT SAA GGLFPSLFN+Q++G+P++  Y
Sbjct  118  PPPDANHFMQHGFGFMGGLGGFAPMATARFGNFTLSAAFGGLFPSLFNLQVHGFPDATMY  177

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQH-TNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ N+FHGGHAHGFPQH   Q QQAD  LK LFL IG+ VI+ALIW+
Sbjct  178  GPAAGFPYGFSNSFHGGHAHGFPQHPPTQGQQADYYLKMLFLMIGVFVIIALIWS  232



>ref|XP_010437298.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Camelina sativa]
Length=381

 Score =   335 bits (858),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 198/361 (55%), Positives = 253/361 (70%), Gaps = 24/361 (7%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+KACV WV +YF DCLCN+ND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATL T          +TVVLV+Q IYYD+   +  CR
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLYT---------VSTVVLVIQTIYYDYI--YKLCR  116

Query  1906  DKNTILVKDNEREALKQRSRH--HRTAPAVEVPCQTH-------YYFTSARTLASSDTP-  1757
                T +    + E  ++R       T  A+ +P  ++       +Y+TSAR+LA S TP 
Sbjct  117   HGRTKICTQTDEEDEEKRPLKLPKTTGSAISIPRGSYKDSPRKEFYYTSARSLAGSGTPP  176

Query  1756  --TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHF  1583
               +  + +A+SGP AL  +  SSS+++    +     ++QPR IPR   +GTFLAA+A  
Sbjct  177   LRSSYFRVAKSGPSALAIENGSSSDEDETMSTCPVITITQPRPIPRPAGFGTFLAASASL  236

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+V
Sbjct  237   PLQAKSL-AEKYAHASSRRLLNEKIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGNV  295

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EG+NPLMFVF L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+YY 
Sbjct  296   EGMNPLMFVFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYK  355

Query  1222  H  1220
             +
Sbjct  356   Y  356



>ref|XP_007047041.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 5 [Theobroma cacao]
 gb|EOX91198.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 5 [Theobroma cacao]
Length=331

 Score =   329 bits (844),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 236/351 (67%), Gaps = 48/351 (14%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTHYYFTSARTLASSDTPTYCYIMARS  1730
             R   T  + ++E++ LK                                        A S
Sbjct  124   RRIKTDNMVEDEKKPLKPGK-------------------------------------ADS  146

Query  1729  GPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGKSLIME  1553
             G P  +    ++   E+          +QPR IPRA A     LAA+ + P+G K+  ME
Sbjct  147   GIPIPKPSPKANPRGES---------GTQPRPIPRAAASYGTFLAASVNLPLGSKAW-ME  196

Query  1552  AQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVF  1373
             A+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGLNPLMF+F
Sbjct  197   ARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIF  256

Query  1372  VLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
              LIANATYV SILVR+TEWE +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  257   ALIANATYVASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKY  307



>gb|AET03980.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=374

 Score =   329 bits (844),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 202/363 (56%), Positives = 257/363 (71%), Gaps = 19/363 (5%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CV WV  YFKDCLCNL D+ISF +G++SL+ WGVAEIPQI+T F+NKSS G
Sbjct  4     SYCVKENKECVKWVETYFKDCLCNLRDDISFSLGLMSLVSWGVAEIPQIITIFRNKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             +SLAFL TW+ GD+ NLVGC+LEPATLPTQF+TALLY +TT++L+LQ +YYDH L W  C
Sbjct  64    ISLAFLLTWVAGDICNLVGCLLEPATLPTQFYTALLYASTTIILLLQIVYYDHILRW--C  121

Query  1909  RDKNTILVK-DNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDT-P  1757
             + +  +  K DNE E      +  +    + +P  T        YY+ SAR+LA S T P
Sbjct  122   KHRQNVKSKLDNEEEKRPLNPKPSQVYSGIAIPNGTQKEAARGEYYYMSARSLAGSATPP  181

Query  1756  TYCYI-MARSGPPALQYDADSSSEDETVPLS---SSQKPVSQPRSIPRataygtflaaaA  1589
             ++ ++  A+SGP AL++  DSS +DE   ++   S+ KP S PRS+     YGTFLA A 
Sbjct  182   SFTHLRAAKSGPSALEFIHDSSDDDEASQVTSNISTTKPWSIPRSVD--GRYGTFLATAI  239

Query  1588  HFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
             + P+ G S+       F G +LL+E+E  S+  GQ+LGW+MAAIY   R+PQIWLNIKRG
Sbjct  240   NLPLKGNSM-RYGYIGFTGIKLLKENEVHSTY-GQYLGWIMAAIYTCSRIPQIWLNIKRG  297

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNP MFVF LIAN +YVGSILVR+TE+E +KAN+PWLLDA  CV LD FII QY+Y
Sbjct  298   SVEGLNPFMFVFALIANTSYVGSILVRTTEFESIKANLPWLLDATVCVALDFFIISQYIY  357

Query  1228  YTH  1220
             Y +
Sbjct  358   YRY  360



>ref|XP_008790228.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Phoenix 
dactylifera]
 ref|XP_008790229.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Phoenix 
dactylifera]
Length=393

 Score =   328 bits (842),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 206/371 (56%), Positives = 263/371 (71%), Gaps = 17/371 (5%)
 Frame = -1

Query  2263  CVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVS  2084
             C  E+KACVGW+ KYFKDC+C+L+ EISF +G+ISLICWG+AEIPQIVTNF+ KS  GVS
Sbjct  10    CAEEKKACVGWIEKYFKDCVCSLSGEISFGLGLISLICWGIAEIPQIVTNFQTKSCHGVS  69

Query  2083  LAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRD  1904
             L  + TW++GD+FNL GC+LEP TLPTQF+TALLYTATTVVL+LQ +YYD++L WWK + 
Sbjct  70    LGLILTWVIGDIFNLAGCLLEPVTLPTQFYTALLYTATTVVLLLQTLYYDYWLRWWKSKV  129

Query  1903  KNTILVKDNEREALKQR-----SRHHRTAPAVEVPCQTHYYFTSARTLASSDTPTY--CY  1745
               +I+  + ER+ L  +     SR   T  +     +   Y+ SAR+LASS TP Y   Y
Sbjct  130   VESIVEVEEERKPLNPKLDDDSSRPIPTTASDRASPRIDLYYRSARSLASSGTPPYGSSY  189

Query  1744  I-MARSGPPALQYDADSSSEDETVPLSSSQKPV-SQPRSI-PRataygtflaaaAHFPVG  1574
             +  ARSGP       DSSSEDE  P   S+  V ++P+ I  R+  YG  +  +  FP  
Sbjct  190   LGTARSGPSGSALH-DSSSEDEASPAHDSRHRVAAKPKQIVSRSVGYGAIIIGSTGFPFQ  248

Query  1573  GKSLIMEAQTKFAGRRLLQEHE---FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
              +++ ME     AGRR+LQE      D S  G  LGW+MAA+YMGGR+PQI+LNIKRGSV
Sbjct  249   SRAM-MEKYMGLAGRRMLQEERVKTLDGSPYGLLLGWIMAAVYMGGRLPQIYLNIKRGSV  307

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYT  1223
             EGLNPLMF+F LIANATYVGSILVRS EWE++KAN PWLLDA+ CV+LDLFI++Q+ YY 
Sbjct  308   EGLNPLMFMFALIANATYVGSILVRSVEWERIKANAPWLLDAIICVLLDLFIMIQFTYY-  366

Query  1222  HKKIKKRQQTQ  1190
              K + +R+  +
Sbjct  367   -KCMHRRESHE  376



>ref|XP_010936127.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Elaeis 
guineensis]
 ref|XP_010936129.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Elaeis 
guineensis]
Length=393

 Score =   328 bits (841),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 202/376 (54%), Positives = 263/376 (70%), Gaps = 15/376 (4%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
             E + C   +KACVGW+ KYFKDC+C+L+ E+SF +G+ISLICWG+AEIPQI+TNF+ KS 
Sbjct  6     EWASCAEAKKACVGWIEKYFKDCVCSLSGEVSFGLGLISLICWGIAEIPQIITNFQTKSG  65

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              GVSL  + TW++GD+FNLVGC+LEP TLPTQF+TALLYTATTVVL+LQ +YYD++L W 
Sbjct  66    HGVSLGLILTWVIGDIFNLVGCLLEPVTLPTQFYTALLYTATTVVLLLQTLYYDYWLRWR  125

Query  1915  KCRDKNTILVKDNEREALK-----QRSRHHRTAPAVEVPCQTHYYFTSARTLASSDTPTY  1751
             K +D  + +  + ER+ L        SR   T  +V    +   Y+ SAR+LASS TP Y
Sbjct  126   KSKDVESTVEVEEERKPLNPTLDDDPSRPIPTTASVLASPRIDLYYMSARSLASSGTPPY  185

Query  1750  --CYI-MARSGPPALQYDADSSSEDETVPLSSSQ-KPVSQP-RSIPRataygtflaaaAH  1586
                Y+  ARSGP       DSSSEDE  P    + +  ++P R + R+  YGT +  +  
Sbjct  186   GSSYLGTARSGPSGSPLH-DSSSEDEASPTQDQRHRAAAKPKRMVSRSIGYGTVILGSTG  244

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHE---FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIK  1415
              P   +++ ME     AGRR+LQE     FD S  G  LGW+MAAIYMGGR+PQI+LNIK
Sbjct  245   LPFQSRAM-MEKHFSLAGRRILQEERMKTFDGSSYGLLLGWIMAAIYMGGRLPQIYLNIK  303

Query  1414  RGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQY  1235
             RGSVEGLNPLMF+F LIANATYVGSILVRS EWE+++AN PWLLDA+ CV+LDLFI+ Q+
Sbjct  304   RGSVEGLNPLMFMFALIANATYVGSILVRSVEWERIRANAPWLLDAIVCVLLDLFIVTQF  363

Query  1234  LYYTHKKIKKRQQTQS  1187
              YY +   ++ ++ + 
Sbjct  364   TYYKYMHRRESREEEG  379



>ref|XP_010246977.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246978.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246979.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246980.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X1 [Nelumbo 
nucifera]
Length=226

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 193/234 (82%), Gaps = 8/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST+R P S S S S  N   DAGNFECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-STSRPPQSXSCSGSGSN---DAGNFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALV+EEKLVPLYGRGK  TDPRSKSIPG+ IP+RP GQRPET A
Sbjct  57   KWLHIHSHSQECPVCKALVQEEKLVPLYGRGKTPTDPRSKSIPGINIPNRPAGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N FPQH     G  GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P++  Y
Sbjct  116  PPPDTNHFPQH---GFGFMGGFPPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ N+FHGGHAHGFPQ T Q QQADS LK L L +G+ VI+ALIW+
Sbjct  173  GAAAGFPYGFSNSFHGGHAHGFPQPTTQGQQADSYLKTLLLMVGLFVIIALIWS  226



>emb|CAB16817.1| putative protein [Arabidopsis thaliana]
 emb|CAB80351.1| putative protein [Arabidopsis thaliana]
Length=374

 Score =   326 bits (835),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 261/374 (70%), Gaps = 28/374 (7%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             V L YC+ E+K CV WV  YF DCLCNLND++SF +GI SL+CWGVAEIPQ++TNF+ KS
Sbjct  2     VSLGYCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKS  61

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S+GVSL+FL  W+ GD+FNLVGC+LEPATLPTQF+TALLYT +TVVLV+Q IYYD+   +
Sbjct  62    SNGVSLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYI--Y  119

Query  1918  WKCRDKNTILVKDNEREALKQRSRHHRT-APAVEVPCQTH-------YYFTSARTLASSD  1763
               CR + T + + +E +  K+  +  +T   A+ +P  ++       +Y+TSAR+LA S 
Sbjct  120   KLCRHRRTKICQKDEEDEEKRPLKPPKTMGSAISIPGGSYKDSSRREFYYTSARSLAGSG  179

Query  1762  TP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaa  1592
             TP   T  + +A+SG    Q          +  +   +  + Q R       +GTFLAA+
Sbjct  180   TPPLRTSYFRVAKSGLRLWQ----------STMMVRHRTKMRQCRR----AGFGTFLAAS  225

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
             A  P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLNIKR
Sbjct  226   ASLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKR  284

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F L+ANATYVGSILVR+TEW+ +K N+PWLLDA+ CVVLDLFIILQY+
Sbjct  285   GSVEGLNPLMFIFALVANATYVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYI  344

Query  1231  YYTHKKIKKRQQTQ  1190
             YY + +IK  +  +
Sbjct  345   YYKYCRIKSLESRE  358



>ref|XP_004164469.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis 
sativus]
Length=381

 Score =   325 bits (832),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 246/351 (70%), Gaps = 16/351 (5%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YCV E+K CVGWV  YFKDCLCNL D++SF  G++SL+CWG+AEIPQIVTNF+ KSS GV
Sbjct  5     YCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSSHGV  64

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL FL TW+ GDVFNLVGC+LEPATLPTQ +TALLYT  T+VLVLQ++YYD+      C 
Sbjct  65    SLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTALLYTVNTIVLVLQSVYYDYVTKC--CI  122

Query  1906  DKNTILVKDNEREALKQRSRHHRTAPAVEVPCQT-------HYYFTSARTLASSDTPTYC  1748
             D+        E E    +         + +P  T        +Y+TSAR+LA SDTP + 
Sbjct  123   DRKAKSDHTGEEEKTPLKGNKGVGYVGIPIPKATPKPTPRREFYYTSARSLAGSDTPPFR  182

Query  1747  YI--MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVG  1574
                 + +SGP AL  D+ SS ++       S   V+QPR IPR+  YGTFLAA+A+ P  
Sbjct  183   AFLRLPKSGPSALGNDSSSSDDESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLPFQ  242

Query  1573  GKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
              K         F+GR+LLQEH   S   GQ LGWLMAAIYMGGR+PQIWLNIKRGSVEGL
Sbjct  243   TKGF----SDGFSGRKLLQEHSSHSGF-GQLLGWLMAAIYMGGRLPQIWLNIKRGSVEGL  297

Query  1393  NPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIIL  1241
             NPLMFVF LIANATYV SI+VRSTEWE +KANMPWLLDAV CV+LDLFIIL
Sbjct  298   NPLMFVFALIANATYVASIVVRSTEWESIKANMPWLLDAVVCVLLDLFIIL  348



>ref|XP_011074485.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Sesamum indicum]
 ref|XP_011074486.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Sesamum indicum]
 ref|XP_011074488.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Sesamum indicum]
Length=238

 Score =   318 bits (816),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 194/241 (80%), Gaps = 10/241 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST+R  P     SS+ NN SDAGNFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-STSR-QPPSPFCSSSSNNNSDAGNFECNICLDLAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKAL+EEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPET A
Sbjct  59   KWLHIHSHSQECPVCKALIEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPET-A  117

Query  529  PPPD----ANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNG  687
            PPPD    ANAF Q      G  G FGGF P ATA FGNFT SAA+GGLFPS FNIQ++G
Sbjct  118  PPPDPNANANAFAQQGYGFMGGFGPFGGFAPAATAGFGNFTLSAALGGLFPSFFNIQVHG  177

Query  688  YPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            +PN   YG   GFP+ Y NTFHGGHAH F Q  NQQQQADS LK+L L IG++V+L LIW
Sbjct  178  FPNPNLYGPGPGFPYRYSNTFHGGHAHAFHQRGNQQQQADSTLKFLLLVIGLSVLLTLIW  237

Query  868  N  870
            +
Sbjct  238  S  238



>ref|XP_004148435.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis 
sativus]
 gb|KGN62067.1| hypothetical protein Csa_2G295430 [Cucumis sativus]
Length=381

 Score =   323 bits (829),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 209/353 (59%), Positives = 250/353 (71%), Gaps = 20/353 (6%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YCV E+K CVGWV  YFKDCLCNL D++SF  G++SL+CWG+AEIPQIVTNF+ KSS GV
Sbjct  5     YCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSSHGV  64

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL FL TW+ GDVFNLVGC+LEPATLPTQ +TALLYT  T+VLVLQ++YYD+      C 
Sbjct  65    SLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTALLYTVNTIVLVLQSVYYDYVTKC--CI  122

Query  1906  DKNTILVKDNEREALKQRSRHHRTAPAVEVPC---------QTHYYFTSARTLASSDTPT  1754
             D+      D+  E  K   + ++    V +P          +  +Y+TSAR+LA SDTP 
Sbjct  123   DRKA--KSDHTGEEEKTPLKGNKGVGYVGIPIPKASPKPTPRREFYYTSARSLAGSDTPP  180

Query  1753  YCYI--MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
             +     + +SGP AL  D+ SS ++       S   V+QPR IPR+  YGTFLAA+A+ P
Sbjct  181   FRAFLRLPKSGPSALGNDSSSSDDESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLP  240

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
                K         F+GR+LLQEH   S   GQ LGWLMAAIYMGGR+PQIWLNIKRGSVE
Sbjct  241   FQTKGF----SDGFSGRKLLQEHSSHSGF-GQLLGWLMAAIYMGGRLPQIWLNIKRGSVE  295

Query  1399  GLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIIL  1241
             GLNPLMFVF LIANATYV SI+VRSTEWE +KANMPWLLDAV CV+LDLFIIL
Sbjct  296   GLNPLMFVFALIANATYVASIVVRSTEWESIKANMPWLLDAVVCVLLDLFIIL  348



>emb|CDP07570.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   320 bits (821),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 204/237 (86%), Gaps = 3/237 (1%)
 Frame = +1

Query  166  NMASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCL  345
             MASGFGE ST+RAP SP  S +  NN  DAGNFECNICFDLAQ+PI+TLCGHLFCWPCL
Sbjct  95   EMASGFGE-STSRAPLSPFCSGNTSNNSGDAGNFECNICFDLAQEPIITLCGHLFCWPCL  153

Query  346  YKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETA  525
            YKWLHIHS SKECPVCKA++EEEKLVPLYGRGK+STDPRSKSIPG+EIPHRP GQRPETA
Sbjct  154  YKWLHIHSLSKECPVCKAVIEEEKLVPLYGRGKSSTDPRSKSIPGVEIPHRPAGQRPETA  213

Query  526  -APPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
              PPPD+NAF QHGFGFTGGFGGF PMATARFGNFT SAA GGL PSLFNIQ++G+P++ 
Sbjct  214  PPPPPDSNAFAQHGFGFTGGFGGFAPMATARFGNFTLSAAFGGLIPSLFNIQVHGFPDAN  273

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTN-QQQQADSNLKWLFLFIGITVILALIWN  870
             YG + GFP+G+ NTFHGGH HGFPQ T+ QQQQAD  LK L L IGI VILALIW+
Sbjct  274  MYGAAGGFPYGFSNTFHGGHIHGFPQRTSQQQQQADFTLKLLSLIIGIAVILALIWS  330



>gb|EPS64486.1| hypothetical protein M569_10295, partial [Genlisea aurea]
Length=358

 Score =   321 bits (823),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 250/373 (67%), Gaps = 26/373 (7%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             ++LSYC  ERK CV +V + F DCLCN+ DEISF  G+  L+ W VAEIPQIVTNF NKS
Sbjct  1     MKLSYCSTERKPCVRFVERVFGDCLCNVRDEISFGFGLFGLVLWAVAEIPQIVTNFFNKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             + GVSLAFL TWI+GDVFN+VGC+LEPATLPTQ++TA LYT  + VL LQ +YY+HF+ W
Sbjct  61    ADGVSLAFLSTWIIGDVFNIVGCILEPATLPTQYYTAWLYTIVSSVLALQCVYYNHFVKW  120

Query  1918  WKCRD---KNTILVKDNEREALKQR---SRHHRTAPAVEVPCQTHYYFTSARTLASSDT-  1760
             W+      KN +    +E E L+ +      H     ++VP +  +YF SAR+L  S+T 
Sbjct  121   WRFSSTVGKNNV----DETEPLRPKFDLGVAHSKRALMDVPHRREFYFMSARSLVGSNTP  176

Query  1759  PTYCYIMARSGPPALQYDADSSSE--DETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P   Y+  RSGPP L++ ADSS E  D   P   +    S+P  IPR   YGT  AAAA+
Sbjct  177   PKQYYVRPRSGPPTLEHLADSSEEEDDGISPRPVAGNSFSRPLPIPRPVKYGTLAAAAAN  236

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P  G+++  E   K              SV GQWLGWLMA  YMGGR+PQIWLN+KRGS
Sbjct  237   LPRLGQAVSGETLEK-------------RSVTGQWLGWLMAVTYMGGRIPQIWLNMKRGS  283

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
             VEGLNPLMF+  L+AN TYV SILVR+ +WE ++ N+PWLLDAV CV+LDLFII+Q ++Y
Sbjct  284   VEGLNPLMFLLALMANVTYVLSILVRNCKWEVIQNNLPWLLDAVVCVLLDLFIIIQCIFY  343

Query  1225  THKKIKKRQQTQS  1187
              + K K+R + + 
Sbjct  344   NYVKGKRRDEEED  356



>ref|XP_004512003.1| PREDICTED: seven transmembrane protein 1-like [Cicer arietinum]
Length=382

 Score =   322 bits (825),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 258/367 (70%), Gaps = 25/367 (7%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV KYF DCLCN  D+ISF  G ISLICWGVAEIPQI TNF+ KSS G
Sbjct  4     SYCVKENKPCVGWVLKYFSDCLCNSKDDISFFFGFISLICWGVAEIPQIFTNFRAKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VS+ FL TW+ GD+FNL+GC+LEPATLPTQ++TALLYT TT+VLVLQ+ YYD+    +KC
Sbjct  64    VSILFLLTWVAGDIFNLIGCLLEPATLPTQYYTALLYTITTIVLVLQSFYYDYI---YKC  120

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVE--VPCQT---------HYYFTSARTLASSD  1763
              ++     K N  EAL++  +  +   A E  +P ++          YY+ SAR+LA + 
Sbjct  121   CNRRQ---KINIEEALEEEKKPLKPKQASESGIPIRSAKNRVIPRAEYYYGSARSLAGNV  177

Query  1762  TP--TYCYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laa  1595
             TP  +  Y+ +A+SGP A++ + D SS  +     +   P SQPR IPR+T      LAA
Sbjct  178   TPPSSRSYMRVAKSGPSAMRLNQDDSSSSDD---EAHPPPSSQPRQIPRSTGSYGTFLAA  234

Query  1594  aAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIK  1415
             + + P+ G +L +   T  +G +LL + +   SV GQWLGWLMAAIY GGR+PQIWLNIK
Sbjct  235   SLNLPMQGNALKLGILT-LSGTKLLSQEQVTHSVLGQWLGWLMAAIYTGGRIPQIWLNIK  293

Query  1414  RGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQY  1235
             RGSVEGLNP MF+F LIAN+ YVGSI+VR+TEWE +KANMPWLLDA+ CV LDLFII QY
Sbjct  294   RGSVEGLNPFMFIFALIANSAYVGSIVVRTTEWESIKANMPWLLDAIVCVALDLFIISQY  353

Query  1234  LYYTHKK  1214
             + Y +++
Sbjct  354   INYRYRQ  360



>ref|XP_010099350.1| hypothetical protein L484_009167 [Morus notabilis]
 gb|EXB77871.1| hypothetical protein L484_009167 [Morus notabilis]
Length=408

 Score =   323 bits (827),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 259/391 (66%), Gaps = 53/391 (14%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             +SYCV E KACVGWV KYF+DCLCNL DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  3     VSYCVEENKACVGWVEKYFQDCLCNLKDEFSFAFGLISLVCWGVAEIPQIITNFRTKSSH  62

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPAT-------------------LPTQFFtallytat  1970
             GVSLAFL TW+ GDVFNLVGC+LEPAT                   LPTQ++TALLYT +
Sbjct  63    GVSLAFLLTWVAGDVFNLVGCLLEPATVSIAIFVVQKMTRDYWFALLPTQYYTALLYTTS  122

Query  1969  tvvlvlqAIYYDHFLPWWKCRDKNTILVKDNEREALKQRSRHHRTAPAVE--VPC-----  1811
             TVVLVLQ+IYYDH   W  C+ + T   +  E +   QR   + + PA E  +P      
Sbjct  123   TVVLVLQSIYYDHIYRW--CKRRKTTTKQSTEED---QRKPLNNSKPADESGIPIPRPST  177

Query  1810  -------QTHYYFTSARTLASSDTPTY-CYI-MARSGPPALQYDADSSSEDE-TVPLSSS  1661
                    +  +Y+TSAR+LA S TP +  Y+  ARSGP A+  ++DSSS+DE TVPL S+
Sbjct  178   KASSGTPRREFYYTSARSLAGSGTPPFRTYLRAARSGPSAMAIESDSSSDDEATVPLRSN  237

Query  1660  QKPVSQPRSIPRataygtf-laaaAHFPVGGKSLIMEAQTKFAGRRLL--QEHEFDSSVA  1490
              K  +QPR IP++  Y    LAA+ + P+   SL  +     A R+LL  Q    + +V 
Sbjct  238   -KSTTQPRPIPKSAGYYGTFLAASVNLPLKSNSLT-QVYMGVAARKLLLQQSGGENHTVY  295

Query  1489  GQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEK  1310
             GQWLGW+MAAIYMGGR+PQIWLN       GLNPLMF+F LIAN TYVGSILVRSTEWE+
Sbjct  296   GQWLGWMMAAIYMGGRLPQIWLN-------GLNPLMFIFALIANVTYVGSILVRSTEWER  348

Query  1309  MKANMPWlldavacvvldLFIILQYLYYTHK  1217
              KANMPWLLDAV CV LD F    Y+ +T K
Sbjct  349   TKANMPWLLDAVVCVALDSFAECGYVRFTVK  379



>gb|KDP38460.1| hypothetical protein JCGZ_04385 [Jatropha curcas]
Length=229

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 195/234 (83%), Gaps = 5/234 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFG+ ST+R P +PS SS++ N   DAGNFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGQ-STSRPPQNPSFSSNSSNG--DAGNFECNICLDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS SKECPVCKALVEE+KLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHFHSQSKECPVCKALVEEDKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F QHGFGF GG GGF PMATARFGNFT SAA GGL PSLFN+Q++G+ ++  Y
Sbjct  117  PPPEPNHFAQHGFGFMGGLGGFAPMATARFGNFTLSAAFGGLIPSLFNLQVHGFHDTGMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G++AGFP+GY N+FHGGHAHG+PQH  Q QQ D  LK L LFIG  V+LALIW 
Sbjct  177  GSAAGFPYGYSNSFHGGHAHGYPQHQGQGQQ-DYYLKRLLLFIGFCVLLALIWQ  229



>ref|XP_010246981.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246982.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 isoform X2 [Nelumbo 
nucifera]
Length=226

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 187/232 (81%), Gaps = 8/232 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST+R P S S S S  N   DAGNFECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-STSRPPQSXSCSGSGSN---DAGNFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALV+EEKLVPLYGRGK  TDPRSKSIPG+ IP+RP GQRPET A
Sbjct  57   KWLHIHSHSQECPVCKALVQEEKLVPLYGRGKTPTDPRSKSIPGINIPNRPAGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N FPQH     G  GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P++  Y
Sbjct  116  PPPDTNHFPQH---GFGFMGGFPPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
            G +AGFP+G+ N+FHGGHAHGFPQ T Q QQADS LK L L  G+  I  LI
Sbjct  173  GAAAGFPYGFSNSFHGGHAHGFPQPTTQGQQADSYLKTLLLMQGLLSIETLI  224



>ref|XP_007047045.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 9 [Theobroma cacao]
 gb|EOX91202.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 9 [Theobroma cacao]
Length=322

 Score =   313 bits (801),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 226/351 (64%), Gaps = 57/351 (16%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATL T          +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLYT---------TSTLVLVLQTIYYDNVYRWWKC  114

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTHYYFTSARTLASSDTPTYCYIMARS  1730
             R   T  + ++E++ LK                                        A S
Sbjct  115   RRIKTDNMVEDEKKPLKPGK-------------------------------------ADS  137

Query  1729  GPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGKSLIME  1553
             G P  +    ++   E+          +QPR IPRA A     LAA+ + P+G K+  ME
Sbjct  138   GIPIPKPSPKANPRGESG---------TQPRPIPRAAASYGTFLAASVNLPLGSKAW-ME  187

Query  1552  AQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVF  1373
             A+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VEGLNPLMF+F
Sbjct  188   ARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIF  247

Query  1372  VLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
              LIANATYV SILVR+TEWE +KANMPWLLDA  CV LDLFIILQY+YY +
Sbjct  248   ALIANATYVASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKY  298



>ref|NP_001240922.1| uncharacterized protein LOC100789634 [Glycine max]
 gb|ACU24122.1| unknown [Glycine max]
Length=379

 Score =   313 bits (803),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 247/355 (70%), Gaps = 15/355 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV ERK CV WV KYFKDCLCNL DEISF  G+ SL+ WGVAEIPQI+T F+ K S G
Sbjct  4     SYCVNERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GD+ NL GC+LEPATLPTQ++TALLYT TT+VL+L  +YYD+   W+K 
Sbjct  64    VSLVFLLTWVAGDICNLTGCILEPATLPTQYYTALLYTITTIVLLLLIVYYDYISRWYKH  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPC-------QTHYYFTSARTLASSDTPTY  1751
             R K   LV+D+E E    +         + +P        +  YY+ SAR+LA S TP +
Sbjct  124   RQKVN-LVRDHEEEKKPLKPPKPTNKSGIPIPNGSPKAAPRQEYYYMSARSLAGSGTPPW  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                M  A+SGP A++   D SS D+  P +SS    SQ   IPR+ A    TFLAAA + 
Sbjct  183   GIYMRAAKSGPSAIE-SIDDSSSDDEAPPASSNNSASQAMPIPRSVAGSYGTFLAAAVNL  241

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+ G +L  +    + GR+LLQE+E  S+  GQWLGWLMAAIY+ GRVPQIWLNIKR SV
Sbjct  242   PLKGNAL-RQGYIGYGGRKLLQEYEKHSTF-GQWLGWLMAAIYISGRVPQIWLNIKRSSV  299

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQ  1238
             EGLNP MFVF L+AN TYVGSILVR+TEWE +KANMPWLLDAV CV LD+FII Q
Sbjct  300   EGLNPFMFVFALVANVTYVGSILVRTTEWESIKANMPWLLDAVICVALDIFIISQ  354



>gb|KHN00567.1| Putative membrane protein [Glycine soja]
Length=357

 Score =   311 bits (798),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 233/338 (69%), Gaps = 15/338 (4%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV ERK CV WV KYFKDCLCNL DEISF  G+ SL+ WGVAEIPQI+T F+ K S G
Sbjct  4     SYCVNERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GD+ NL GC+LEPATLPTQ++TALLYT TT+VL+L  +YYD+   W+K 
Sbjct  64    VSLVFLLTWVAGDICNLTGCILEPATLPTQYYTALLYTITTIVLLLLIVYYDYISRWYKH  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPC-------QTHYYFTSARTLASSDTPTY  1751
             R K   LV+D+E E    +         + +P        +  YY+ SAR+LA S TP +
Sbjct  124   RQKVN-LVRDHEEEKKPLKPPKPTNKSGIPIPNGSPKAAPRQEYYYMSARSLAGSGTPPW  182

Query  1750  CYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg--tflaaaAHF  1583
                M  A+SGP A++   D SS D+  P +SS    SQ   IPR+ A    TFLAAA + 
Sbjct  183   GIYMRAAKSGPSAIE-SIDDSSSDDEAPPASSNNSASQAMPIPRSVAGSYGTFLAAAVNL  241

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P+ G +L  +    + GR+LLQE+E  S+  GQWLGWLMAAIY+ GRVPQIWLNIKR SV
Sbjct  242   PLKGNAL-RQGYIGYGGRKLLQEYEKHSTF-GQWLGWLMAAIYISGRVPQIWLNIKRSSV  299

Query  1402  EGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPW  1289
             EGLNP MFVF L+AN TYVGSILVR+TEWE +KANMPW
Sbjct  300   EGLNPFMFVFALVANVTYVGSILVRTTEWESIKANMPW  337



>gb|EPS64909.1| hypothetical protein M569_09870, partial [Genlisea aurea]
Length=361

 Score =   311 bits (796),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 258/368 (70%), Gaps = 18/368 (5%)
 Frame = -1

Query  2278  VELSYCVVERKACV-GWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNK  2102
             +  SYCV E K C+ GWV+ YFKDCLCN  DE SF +GI+SL+ WGVAEIPQI++NFK +
Sbjct  1     ISSSYCVREMKPCIIGWVDTYFKDCLCNGRDEASFGLGILSLLLWGVAEIPQILSNFKAE  60

Query  2101  SSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLP  1922
             SS G+SLAFL  W+LGDVFNL+GC+LEPATLPTQ +TA+LYT TT +LV+Q++YYD+F  
Sbjct  61    SSHGISLAFLIAWVLGDVFNLLGCILEPATLPTQLYTAVLYTTTTSILVMQSLYYDYFRK  120

Query  1921  WWKCRDKNTILVKDNEREALKQRSRHHRTAP--AVEVPCQTHYYFTSARTLASSDTPTYC  1748
              +  R++ +    +  +  LK     H+ A   A+E+P +  YY+ SAR++A S TP + 
Sbjct  121   LFPIREQESQQEVEELKRPLKS----HKPAADSAIEIPRKEAYYYASARSMAGSFTPPFR  176

Query  1747  YIM--ARSGPPALQYDADSSSEDETVPLSS------SQKPVSQPRSIPRataygtflaaa  1592
               +   RSGP  +    DSSS+D+            S+   S+P+ IPR+ A G F+ ++
Sbjct  177   SYLWPVRSGPSTVGLRNDSSSDDDDDGGDDRAVEIPSRATASRPKPIPRSAAMGAFVGSS  236

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
                P  GK+  +     F  R+LLQEH   SSV GQWLGW+MA IYMGGR+PQI+LNIKR
Sbjct  237   MSMP--GKTKALMYAVGFTTRKLLQEHG-SSSVTGQWLGWMMAVIYMGGRLPQIYLNIKR  293

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             G+VEGLNPLMF+F + AN+TYV SI+VR+ +WEK+KAN+PWLLDAV CV+LDL II QY+
Sbjct  294   GNVEGLNPLMFIFAVSANSTYVASIVVRTIDWEKIKANLPWLLDAVVCVLLDLSIITQYV  353

Query  1231  YYTHKKIK  1208
             YY H + K
Sbjct  354   YYKHIRGK  361



>ref|XP_003629504.1| Membrane protein, putative [Medicago truncatula]
Length=372

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 249/363 (69%), Gaps = 21/363 (6%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CV WV  YFKDCLCNL D+ISF +G++SL+ WGVAEIPQI+T F+NKSS G
Sbjct  4     SYCVKENKECVKWVETYFKDCLCNLRDDISFSLGLMSLVSWGVAEIPQIITIFRNKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             +SLAFL TW+ GD+ NLVGC+LEPAT+        LY +TT++L+LQ +YYDH L W  C
Sbjct  64    ISLAFLLTWVAGDICNLVGCLLEPATVSES--EPNLYASTTIILLLQIVYYDHILRW--C  119

Query  1909  RDKNTILVK-DNEREALKQRSRHHRTAPAVEVPCQTH-------YYFTSARTLASSDT-P  1757
             + +  +  K DNE E      +  +    + +P  T        YY+ SAR+LA S T P
Sbjct  120   KHRQNVKSKLDNEEEKRPLNPKPSQVYSGIAIPNGTQKEAARGEYYYMSARSLAGSATPP  179

Query  1756  TYCYI-MARSGPPALQYDADSSSEDETVPLS---SSQKPVSQPRSIPRataygtflaaaA  1589
             ++ ++  A+SGP AL++  DSS +DE   ++   S+ KP S PRS+     YGTFLA A 
Sbjct  180   SFTHLRAAKSGPSALEFIHDSSDDDEASQVTSNISTTKPWSIPRSVD--GRYGTFLATAI  237

Query  1588  HFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
             + P+ G S+       F G +LL+E+E  S+  GQ+LGW+MAAIY   R+PQIWLNIKRG
Sbjct  238   NLPLKGNSM-RYGYIGFTGIKLLKENEVHSTY-GQYLGWIMAAIYTCSRIPQIWLNIKRG  295

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNP MFVF LIAN +YVGSILVR+TE+E +KAN+PWLLDA  CV LD FII QY+Y
Sbjct  296   SVEGLNPFMFVFALIANTSYVGSILVRTTEFESIKANLPWLLDATVCVALDFFIISQYIY  355

Query  1228  YTH  1220
             Y +
Sbjct  356   YRY  358



>gb|EYU44309.1| hypothetical protein MIMGU_mgv1a009599mg [Erythranthe guttata]
Length=337

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 232/334 (69%), Gaps = 18/334 (5%)
 Frame = -1

Query  2284  GGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKN  2105
              G  LSYC  ERKAC+ W +KYFKDCLCN  DE+SF  G+ISL+CWGVAEIPQIVTNF+ 
Sbjct  6     AGNSLSYCAKERKACINWADKYFKDCLCNTRDELSFGFGLISLVCWGVAEIPQIVTNFRT  65

Query  2104  KSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFL  1925
             KS  G+SLAFL TWI GD+FNLVGC+LEPATLPTQ +TA+LYT +TVVLV+Q+IYYD+F 
Sbjct  66    KSGHGISLAFLLTWIAGDIFNLVGCLLEPATLPTQLYTAVLYTTSTVVLVIQSIYYDYFR  125

Query  1924  PWWKC--RDKNTILVKDNEREALKQRSRHHRTAPAVEVP--------CQTHYYFTSARTL  1775
               W+      +   V+D +R  ++ +   +    A+ +P         +  YY+TSAR++
Sbjct  126   NKWRNIHHKHSNQEVEDMKRPLMRPQ---NPIDSAIAIPNGAQRATSTREAYYYTSARSM  182

Query  1774  ASSDTPTYCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtfl  1601
             A S TP     +   +SGP A+  D +SSS+DE+ P+   +  +S+P+ IP++  YG FL
Sbjct  183   AGSTTPPMRSYLWPVKSGPSAIGLDNNSSSDDESNPI-PPRNSISRPKPIPKSVGYGAFL  241

Query  1600  aaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN  1421
             A + + P   ++L+ +      GR+LLQEH  + SV GQWLGW+MAAIYMGGR+PQIWLN
Sbjct  242   ATSMNMPRESRALV-QVYVGLTGRKLLQEHGSE-SVYGQWLGWMMAAIYMGGRLPQIWLN  299

Query  1420  IKRGSVEGLNPLMFVFVLIANATYVGSILVRSTE  1319
             IKRG VEGLNPLMF+F L+ANATYV   +  S +
Sbjct  300   IKRGGVEGLNPLMFIFALLANATYVARYIFSSEK  333



>ref|XP_009419331.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   311 bits (797),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 247/361 (68%), Gaps = 11/361 (3%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + ++ C  ++KACVGW+NKYF DC+CNL+ EISF +G+ISL CWG+AEIPQ++TNF+ KS
Sbjct  5     LAMASCSEKQKACVGWINKYFDDCVCNLSGEISFGLGMISLFCWGMAEIPQLITNFQTKS  64

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
               GVSLA L TW++GDVFNLVGC+LEP TLPTQF+TALLYT+TTVVLVLQ +YYD+ L W
Sbjct  65    GHGVSLALLLTWVIGDVFNLVGCLLEPVTLPTQFYTALLYTSTTVVLVLQTLYYDYGLRW  124

Query  1918  WKCRDKNTILVKDNEREALKQR----SRHHRTAPAVEVPCQTHYYFTSARTLASSDTPT-  1754
             WK    +  L +++  + L  +    SR   T        +T  Y+TSAR+LASS TP+ 
Sbjct  125   WKSICFDAPLEEEDNGQPLNPKVEDLSRPIPTTAVANASRRTDVYYTSARSLASSGTPSC  184

Query  1753  --YCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
                 Y+  RSGP       DSSSEDE  P         +  +  R+ +YGTF+A     P
Sbjct  185   GGTSYLGVRSGPSEGLAFHDSSSEDEGSPAHHHGAAARKKTTFSRSVSYGTFVAGFIGLP  244

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHE---FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
                K+   E     + RR LQ+ E    + +  G  LGW+MAAIYMGGR+PQI+LN+KRG
Sbjct  245   YQTKAF-REMTIISSERRTLQDSEVKSLEGNFYGLLLGWIMAAIYMGGRLPQIYLNMKRG  303

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNPLMF+F L ANATYVGSILVRS EWEK+  N PWLLDA+ C++LDL I+LQ+ Y
Sbjct  304   SVEGLNPLMFMFALAANATYVGSILVRSVEWEKVGPNAPWLLDAIVCILLDLLIMLQFAY  363

Query  1228  Y  1226
             Y
Sbjct  364   Y  364



>ref|XP_009396455.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   311 bits (796),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 260/374 (70%), Gaps = 19/374 (5%)
 Frame = -1

Query  2263  CVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVS  2084
             C  E KACVGW+ +YF DC+C+ +  +SF +G+ISL+CWG+AEIPQI+TNF +KS  GVS
Sbjct  10    CGEEEKACVGWIKRYFNDCVCSPSGVLSFGLGMISLLCWGIAEIPQIITNFHSKSGHGVS  69

Query  2083  LAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRD  1904
              AFL TW++GD+FNLVGC+LEP TLPTQ +TALLYTATTVVLVLQ +YYD+++ WWK R 
Sbjct  70    FAFLLTWVIGDIFNLVGCLLEPVTLPTQLYTALLYTATTVVLVLQTLYYDYWVRWWKKRG  129

Query  1903  KNTIL-VKDNEREALKQRSRH-HRTAPAVEVPCQT----HYYFTSARTLASSDTP----T  1754
                 L V++   + L  ++    R  P +    +T      Y+TSAR+LASS TP    +
Sbjct  130   LEAPLEVEEGSCKRLNPKNEDLSRPLPTLTASRRTSSRVDVYYTSARSLASSGTPPCRSS  189

Query  1753  YCYIM-ARSGPPALQYDADSSSEDETVPLSSSQKP-VSQPRS-IPRataygtflaaaAHF  1583
             Y  ++ ARSGP A  Y   S S++E  P   S+   VS P+  + R+ +YGTF A AA  
Sbjct  190   YLGVVPARSGPSASGYMESSGSDEEGSPRHQSRSSGVSNPKKVVSRSVSYGTFAAGAASL  249

Query  1582  PVGGKSLIMEAQTKFAGRRLLQE---HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKR  1412
             P   K+L ME QT  A  R +QE      + +  G  LGW+MAAIY GGR+PQI+LNIKR
Sbjct  250   PFQTKAL-MEVQTGLAVGRTVQEGGIRSLEGNTYGLLLGWIMAAIYTGGRLPQIYLNIKR  308

Query  1411  GSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYL  1232
             GSVEGLNPLMF+F LIANATYVGSIL RS EWE++KAN PWLLDA+ CV+LDLFII+Q++
Sbjct  309   GSVEGLNPLMFLFALIANATYVGSILSRSVEWERIKANAPWLLDAIVCVLLDLFIIIQFV  368

Query  1231  YY--THKKIKKRQQ  1196
             YY   HK++   + 
Sbjct  369   YYKLVHKRMANNED  382



>ref|XP_007047039.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 3 [Theobroma cacao]
 gb|EOX91196.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 3 [Theobroma cacao]
Length=307

 Score =   307 bits (786),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 217/298 (73%), Gaps = 8/298 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  124   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  183

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+ S +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  184   RVAKSGPSAMELDSDSSSEDEAAPV-SFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  242

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE L
Sbjct  243   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEAL  299



>ref|XP_007047038.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 2 [Theobroma cacao]
 gb|EOX91195.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 2 [Theobroma cacao]
Length=306

 Score =   305 bits (782),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 216/296 (73%), Gaps = 8/296 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  124   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  183

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+ S +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  184   RVAKSGPSAMELDSDSSSEDEAAPV-SFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  242

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE
Sbjct  243   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  297



>gb|KHN42018.1| Putative membrane protein [Glycine soja]
Length=359

 Score =   307 bits (786),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 233/340 (69%), Gaps = 31/340 (9%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             SYCV E K CVGWV KY  DCLCNL DEISF  G ISLICWGVAEIPQI+TNF+ KSS G
Sbjct  4     SYCVKESKPCVGWVEKYLGDCLCNLKDEISFGFGFISLICWGVAEIPQIITNFRAKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSLAFL TW+ GD+FNLVGC LEPATL T          TT+VLVLQ+ YYD+   W K 
Sbjct  64    VSLAFLLTWVAGDIFNLVGCHLEPATLYT---------ITTIVLVLQSFYYDYIYKWGKR  114

Query  1909  RDK-NTI-LVKDNEREALKQRS-RHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPT  1754
               K NT    K+ E++ L+ ++ R H   P       E P +  YY+ SAR+LA++DTP 
Sbjct  115   HGKINTDEAYKEEEKKPLRPKAGRDHSGIPIQNDGPKETP-RRDYYYRSARSLAANDTPP  173

Query  1753  YCYIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRa--taygtflaaaAH  1586
             +   +  A+S P A+  + DSSS+D+     SS+KPV+QPR IPR+    YGTFL A+ +
Sbjct  174   FGTYLRAAKSVPSAIVMNDDSSSDDDEAHPLSSKKPVTQPRPIPRSVPATYGTFLVASMN  233

Query  1585  FPVGGKSLIMEAQTKFAGRR-LLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
             FP  G +L ME   +F GR+ LLQEH    +  GQWLGWLMA IYMGGR+PQIWLN    
Sbjct  234   FPRQGNAL-MEGYNRFNGRKLLLQEHNSMHTALGQWLGWLMAVIYMGGRLPQIWLN----  288

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPW  1289
                GLNPLMFVF LIANATYVGSILVR+TEWE ++ANMPW
Sbjct  289   ---GLNPLMFVFALIANATYVGSILVRTTEWESIRANMPW  325



>ref|XP_007047043.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 7 [Theobroma cacao]
 gb|EOX91200.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 7 [Theobroma cacao]
Length=303

 Score =   305 bits (781),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 216/296 (73%), Gaps = 8/296 (3%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  124   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  183

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+ S +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  184   RVAKSGPSAMELDSDSSSEDEAAPV-SFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  242

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE
Sbjct  243   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  297



>ref|XP_009764843.1| PREDICTED: lysosomal amino acid transporter 1 homolog isoform 
X2 [Nicotiana sylvestris]
Length=325

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 226/320 (71%), Gaps = 16/320 (5%)
 Frame = -1

Query  2275  ELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSS  2096
              ++YCV E+K C+GWVN+YFKDCLCNL+DE SF  G++SL CW VAEIPQI+TNF+ KSS
Sbjct  12    SIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLSCWAVAEIPQIITNFRTKSS  71

Query  2095  SGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWW  1916
              GVSL FL  W+ GD+FNL GC+LEPATLPTQ +TA+LYT TT++LVLQ++YYD+F   W
Sbjct  72    HGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAVLYTTTTIILVLQSLYYDYFYRCW  131

Query  1915  KCRDKNTILVKDNEREALKQRSRHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPTY  1751
             K RD ++    +  ++ L+ +       P      V    +  +YFTSAR+LA S TP +
Sbjct  132   KQRDDDSGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASRRMDFYFTSARSLAGSATPPF  191

Query  1750  CYIM--ARSGPPALQYDADSSSEDETV--PLSSSQKPVSQPRSIPRataygtflaaaAHF  1583
                +    SGP A+  + + SS+++TV  PL+ S   VSQP+ IPR+  YG FLA ++  
Sbjct  192   RSNLRPIASGPSAVGLNHNYSSDEDTVDAPLNIS---VSQPKPIPRSAGYGAFLATSSGM  248

Query  1582  PVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSV  1403
             P   K+LI+     F GR+LLQEH  + S  GQ LGW+MAA+YMGGR+PQIWLNIKRG+V
Sbjct  249   PHQTKALIV----GFGGRKLLQEHGTEHSALGQVLGWMMAAVYMGGRLPQIWLNIKRGNV  304

Query  1402  EGLNPLMFVFVLIANATYVG  1343
             EGLNPLMFVF LIAN TYVG
Sbjct  305   EGLNPLMFVFALIANVTYVG  324



>ref|XP_002302470.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81743.1| zinc finger family protein [Populus trichocarpa]
Length=227

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 194/234 (83%), Gaps = 7/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST+RAP + S +S+NGN   DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-STSRAPHNSSFTSNNGNG--DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHFHSKSRECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F QHGFGF GG GGF PMATAR GNFTFSAA GGL PSLFN+Q++G+P++A Y
Sbjct  117  PPPEPNHFGQHGFGFMGGLGGFAPMATARLGNFTFSAAFGGLIPSLFNLQVHGFPDAAMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G  AG+P+G+ N+FHGGH HG+ QH  Q QQ D  LK L LFIG  V LALIW 
Sbjct  177  G-PAGYPYGF-NSFHGGHPHGYRQHHGQGQQ-DYYLKRLLLFIGFCVFLALIWQ  227



>ref|XP_011017289.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
Length=227

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 193/234 (82%), Gaps = 7/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MAS FGE ST+RAP + S +S+NGN   DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASAFGE-STSRAPQNSSFTSNNGNG--DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHFHSKSRECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F QHGFGF GG GGF PMATAR GNFTFSAA GGL PSLFN+Q++G+P++A Y
Sbjct  117  PPPEPNHFGQHGFGFMGGLGGFAPMATARLGNFTFSAAFGGLIPSLFNLQVHGFPDAAMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G  AGFP+G+ N+FHG H HG+ QH  Q QQ D  LK LFLFIG  V LALIW 
Sbjct  177  G-PAGFPYGF-NSFHGAHPHGYRQHHGQGQQ-DYYLKRLFLFIGFCVFLALIWQ  227



>ref|XP_010254967.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nelumbo nucifera]
Length=225

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 187/232 (81%), Gaps = 8/232 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST++ P SPS S S  N   DAGNFECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-STSKPPQSPSCSGSGSN---DAGNFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALV+E+KLVPLYGRGK  TDPRSKS+PG+ IP+RP GQRPET A
Sbjct  57   KWLHIHSHSQECPVCKALVQEDKLVPLYGRGKTPTDPRSKSVPGINIPNRPAGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N FPQH     G  GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P +  Y
Sbjct  116  PPPDTNHFPQH---GFGFMGGFPPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPEATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
            G +AGFP+G+ N+FHGGHAHGF Q T+Q QQAD  LK +   + +  ILAL+
Sbjct  173  GAAAGFPYGFSNSFHGGHAHGFSQPTSQAQQADFYLKVIIWGVVVFAILALL  224



>ref|XP_009621507.1| PREDICTED: probable vacuolar amino acid transporter YPQ2 isoform 
X2 [Nicotiana tomentosiformis]
Length=325

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 223/317 (70%), Gaps = 12/317 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YCV E+K C+GWVN+YFKDCLCNL+DE SF  G++SL CW VAE+PQI+TNF+ KSS 
Sbjct  13    IAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLFCWAVAEVPQIITNFRTKSSH  72

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSL FL  W+ GD+FNL GC+LEPATLPTQ +TA+LYT TT++LVLQ++YYD+F   WK
Sbjct  73    GVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAVLYTTTTIILVLQSLYYDYFYRCWK  132

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAP-----AVEVPCQTHYYFTSARTLASSDTPTYC  1748
              RD ++    +  ++ L+ +       P      V    +  +YFTSAR+LA S TP + 
Sbjct  133   HRDDDSGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASRRMDFYFTSARSLAGSATPPFR  192

Query  1747  YIM--ARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVG  1574
               +    SGP A+  + + SS+++TV  +     VSQP+ IPR+  YG FLA ++  P  
Sbjct  193   SNLRPIASGPSAVGLNHNYSSDEDTVD-APQNISVSQPKPIPRSAGYGAFLATSSGLPHQ  251

Query  1573  GKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
              K+LI+     F GR+LLQEH  + S  GQ LGW+MAA+YMGGR+PQIWLNIKRG+VEGL
Sbjct  252   TKALIV----GFGGRKLLQEHGTEHSAVGQVLGWMMAAVYMGGRLPQIWLNIKRGNVEGL  307

Query  1393  NPLMFVFVLIANATYVG  1343
             NPLMFVF LIAN +YVG
Sbjct  308   NPLMFVFALIANVSYVG  324



>gb|EYU45103.1| hypothetical protein MIMGU_mgv1a017749mg, partial [Erythranthe 
guttata]
Length=307

 Score =   301 bits (772),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 226/324 (70%), Gaps = 26/324 (8%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACV-GWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNF  2111
             M G+++SYC VERKAC+ GW+N +FKDCLCNL DEISFV G+  L  W VAEIPQI+TNF
Sbjct  1     MKGLKISYCTVERKACINGWINDWFKDCLCNLKDEISFVFGVFGLFFWAVAEIPQIITNF  60

Query  2110  KNKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDH  1931
              NKS+S VSLAFL TWI+GD+FNLVGC+LEPAT       A+LYT  T++L LQ +YY+H
Sbjct  61    NNKSASAVSLAFLSTWIIGDIFNLVGCILEPAT-------AMLYTTVTIILALQCVYYNH  113

Query  1930  FLPWWKCRDKNTILVKDNE-------REALKQRSRHHRTAPAVEVPCQTHYYFTSARTLA  1772
             FL WWK   K    VKD         ++ L   +      P VEVP  T +YF SAR+LA
Sbjct  114   FLQWWKSSHKEAKTVKDEVDSLEPGLQDPLITTTTMTTNVP-VEVPRTTDFYFMSARSLA  172

Query  1771  SSDT-PTYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaa  1595
              S+T P   YI ARSGPPAL++D+  SS ++  PL      ++QPR+IPR   YG F++A
Sbjct  173   GSETPPRQHYIKARSGPPALEHDSSDSSSEQDEPL------ITQPRAIPRTVRYGLFVSA  226

Query  1594  aAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIK  1415
             +A+ P   ++L      +F G RL QE+E   +  GQWLGWLMA IYMGGR+PQIWLNIK
Sbjct  227   SANLPQLSRALRRVHSVEFPGSRLSQEYE---NAYGQWLGWLMAVIYMGGRIPQIWLNIK  283

Query  1414  RGSVEGLNPLMFVFVLIANATYVG  1343
             RG+VEGLNPLMFVF L+ANATYVG
Sbjct  284   RGNVEGLNPLMFVFALLANATYVG  307



>ref|XP_006434924.1| hypothetical protein CICLE_v10002367mg [Citrus clementina]
 ref|XP_006434925.1| hypothetical protein CICLE_v10002367mg [Citrus clementina]
 gb|ESR48164.1| hypothetical protein CICLE_v10002367mg [Citrus clementina]
 gb|ESR48165.1| hypothetical protein CICLE_v10002367mg [Citrus clementina]
 gb|KDO84427.1| hypothetical protein CISIN_1g027010mg [Citrus sinensis]
 gb|KDO84428.1| hypothetical protein CISIN_1g027010mg [Citrus sinensis]
Length=229

 Score =   297 bits (760),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 190/234 (81%), Gaps = 5/234 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MAS FGE ST+R+  +P S++++ +   +AGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASSFGE-STSRSAQNPYSNNNSNS---EAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS+ +ECPVCKA +EEEKLVPLYGRGK+STDPRSKSIPG+ IP+RPTGQRPETA 
Sbjct  57   KWLHGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PP  ++   QHGFGF GG GGF PMA ARFGNFT SAA GGL P LFN+Q++G+P+   Y
Sbjct  117  PPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +A FP+G+ N+FHGGHAHG+PQHT Q QQ D  LK L LFIG  V+L LIW 
Sbjct  177  GPAASFPYGFTNSFHGGHAHGYPQHTGQGQQ-DYYLKRLLLFIGFCVLLVLIWQ  229



>ref|XP_006473447.1| PREDICTED: RING finger protein 5-like isoform X1 [Citrus sinensis]
 ref|XP_006473448.1| PREDICTED: RING finger protein 5-like isoform X2 [Citrus sinensis]
Length=229

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 189/234 (81%), Gaps = 5/234 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MAS FGE ST+R+  +P S++++ +   +AGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASSFGE-STSRSAQNPYSNNNSNS---EAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS+ +ECPVCKA +EEEKLVPLYGRGK+STDPRSKSIPG+ IP+RPTGQRPETA 
Sbjct  57   KWLHGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PP  ++   QHGFGF GG GGF PMA ARFGNFT SAA GGL P LFN+Q++G+P+   Y
Sbjct  117  PPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +A FP+G+ N+FHGGHAHG+PQH  Q QQ D  LK L LFIG  V+L LIW 
Sbjct  177  GPAASFPYGFTNSFHGGHAHGYPQHRGQGQQ-DYYLKRLLLFIGFCVLLVLIWQ  229



>ref|XP_006375056.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP52853.1| zinc finger family protein [Populus trichocarpa]
Length=228

 Score =   293 bits (751),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 186/234 (79%), Gaps = 6/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ++       + S ++ N   DAG+FECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MGSGFGESTSG---VPQNPSFTSSNGNGDAGDFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHFHSKSRECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F QHGFG TGG GGF P ATAR GNFTFSAA GGL PSLFN+Q++G+PN+A Y
Sbjct  117  PPPEPNHFGQHGFGLTGGLGGFAPTATARSGNFTFSAAFGGLIPSLFNLQVHGFPNAAMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ ++FHGGH  G+ +H  Q QQ D  LK L LFIG  V+LAL+W 
Sbjct  177  GPAAGFPYGF-HSFHGGHPRGYHRHQGQGQQ-DYYLKRLLLFIGFCVLLALVWQ  228



>ref|XP_011031310.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Populus euphratica]
Length=228

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 185/234 (79%), Gaps = 6/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ++       + S ++ N   DAG+FECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MESGFGESTSG---VPQNPSFTSSNGNGDAGDFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKA VEEEKLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHFHSKSQECPVCKAQVEEEKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F QHGFG TGG GGF P ATARFGNFTFSAA GGL PSLFN+Q +G+PN+A Y
Sbjct  117  PPPEPNHFGQHGFGLTGGLGGFAPTATARFGNFTFSAAFGGLIPSLFNLQAHGFPNAAMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ ++FHGGH  G+ +H  Q QQ D  LK L LFIG  V+LALIW 
Sbjct  177  GPAAGFPYGF-HSFHGGHPRGYHRHQGQGQQ-DYYLKRLLLFIGFCVLLALIWQ  228



>ref|XP_009397741.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 179/233 (77%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S+ RAP S S   S+ NN  DAG+FECNICF+LAQDP+VTLCGHLFCWPCLY
Sbjct  1    MASGFGESSSGRAPQSSSFGGSSSNN--DAGSFECNICFELAQDPVVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH H+ S ECPVCKA++EEEKLVPLYGRGKN+TDPRSKS PGM IP+RP GQRP T A
Sbjct  59   KWLHGHAQSSECPVCKAIIEEEKLVPLYGRGKNATDPRSKSTPGMNIPNRPAGQRPAT-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N F          F G  P+A  RFGN+TFSAA+GGLFP L + Q++G+P++  Y
Sbjct  118  PPPDPNNF----HHANPWFMGGAPVAGTRFGNYTFSAAIGGLFP-LLSFQVHGFPDATTY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G  AGFP+GYGN FHGGHAHGFP+H +Q QQ D  LK L L IG  VI +L+W
Sbjct  173  GHGAGFPYGYGNAFHGGHAHGFPRHVHQGQQVDMYLKALLLLIGALVIASLVW  225



>ref|XP_002510337.1| rnf5, putative [Ricinus communis]
 gb|EEF52524.1| rnf5, putative [Ricinus communis]
Length=229

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLH HS SKECPVCKALVEEEKLVPLY
Sbjct  26   DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHFHSQSKECPVCKALVEEEKLVPLY  85

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK STDPRSKSIPG+ IP+RP GQRPET APPP+ N F QHGFGF GG GGF PMATA
Sbjct  86   GRGKTSTDPRSKSIPGVNIPNRPAGQRPET-APPPEPNHFAQHGFGFMGGLGGFAPMATA  144

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT SAA GGL PSLFN+Q++G+P++A YGT+ GFP+G+ N+FHGGHAHG+      
Sbjct  145  RFGNFTLSAAFGGLIPSLFNLQVHGFPDAAMYGTATGFPYGFSNSFHGGHAHGY-HQHQG  203

Query  793  QQQADSNLKWLFLFIGITVILALIWN  870
            Q Q D  LK L  FIG  V+LALIW 
Sbjct  204  QGQQDYYLKRLLFFIGFCVLLALIWQ  229



>ref|XP_009396615.1| PREDICTED: lysosomal amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=394

 Score =   298 bits (763),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 198/373 (53%), Positives = 250/373 (67%), Gaps = 18/373 (5%)
 Frame = -1

Query  2263  CVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVS  2084
             C  E +ACVGW+ +YF DC+C++  E+SF +G+ISL CWG+AE+PQI+TNF NK+  G+S
Sbjct  10    CGEEERACVGWIERYFNDCVCSVRGELSFGLGMISLFCWGIAEVPQIITNFHNKTGHGIS  69

Query  2083  LAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRD  1904
             LAFL TW++GD+FNLVGC+LEP TLPTQF+TALLYTA TVVLVLQ +YYD +L   + R 
Sbjct  70    LAFLLTWVVGDIFNLVGCLLEPVTLPTQFYTALLYTAVTVVLVLQILYYDCWLSCCESRG  129

Query  1903  KNTIL-VKDNEREALKQRSRHHR------TAPAVEVPCQTHYYFTSARTLASSDTPTY--  1751
                 L V+++  + L   S  H       TAP    P +    +TSAR+LASS TP Y  
Sbjct  130   FAAQLEVEEDSCKPLNPNSEGHSHPLPTLTAPPTASP-RADVCYTSARSLASSGTPPYRS  188

Query  1750  CYIM-ARSGPPALQYDADSSSEDETVPLSSS-QKPVSQP-RSIPRataygtflaaaAHFP  1580
              Y+  ARSGP A  Y   S S+DE      S    +S+P R + R   YGTF AA+   P
Sbjct  189   SYLGPARSGPSASGYLESSGSDDERSARHRSWHSGMSKPIRILSRPVGYGTFAAASVTLP  248

Query  1579  VGGKSLIMEAQTKFAGRRLLQE---HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRG  1409
                K+ +      F  R+ LQE      + +  G  LGW+MAAIYMGGR+PQI+ NIKRG
Sbjct  249   FQTKASMEVNNIGFDSRKNLQEGGIKSLEENPYGLLLGWVMAAIYMGGRLPQIYKNIKRG  308

Query  1408  SVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLY  1229
             SVEGLNPLMF+F L ANATYVGSILVRS EWE++KAN PWLLDA+ CV+LDLFIILQ+ Y
Sbjct  309   SVEGLNPLMFMFALAANATYVGSILVRSIEWERIKANSPWLLDAIVCVLLDLFIILQFAY  368

Query  1228  Y--THKKIKKRQQ  1196
             Y   HK++   + 
Sbjct  369   YKFMHKRMTSNED  381



>ref|XP_003528194.1| PREDICTED: RING finger protein 5 isoform 2 [Glycine max]
 gb|KHN22276.1| RING finger protein 5 [Glycine soja]
Length=231

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 188/236 (80%), Gaps = 7/236 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST R+PPSPS  ++N N+  DA NFECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGE-STGRSPPSPSYFNNNNNS--DAANFECNICFELAQDPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK+STDPRSKSIPG+ IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKALVEEEKLVPLYGRGKSSTDPRSKSIPGVNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfg--PMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
            PPP+ N F QHGFGF GG GGF   PMAT RFGNF  SAA GG  PSLFN Q++G+ ++A
Sbjct  117  PPPETNHFHQHGFGFMGGLGGFVPPPMATTRFGNFALSAAFGGFIPSLFNFQMHGFHDAA  176

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
             YG  AGFP G+ NTFHG HAHGFP  T+Q QQ D  LK L LF+   V+LA IW 
Sbjct  177  MYGGGAGFPHGFANTFHGVHAHGFPLRTHQGQQ-DYYLKKLLLFVVFCVVLAFIWQ  231



>gb|KCW56810.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=367

 Score =   296 bits (759),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 246/362 (68%), Gaps = 33/362 (9%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P+  KS   EA    + R+LLQE   + SV GQWLGWLMAAIYMGGR+PQIWLN+  G 
Sbjct  243   LPLQNKSF-TEAHVVLSTRKLLQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNVLYGY  301

Query  1405  VEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
                                  SILVR+ EWE ++ANMPWLLDA+ CV LDLFIILQY+YY
Sbjct  302   C--------------------SILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIYY  341

Query  1225  TH  1220
              +
Sbjct  342   RY  343



>gb|AFK34238.1| unknown [Lotus japonicus]
 gb|AFK34841.1| unknown [Lotus japonicus]
Length=228

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 179/234 (76%), Gaps = 6/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++   P    + ++N     DAGNFECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTSRSPPSPSYAGNNNS----DAGNFECNICFDLAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK S+DPRS+SIPG+ IPHRP GQRPET A
Sbjct  57   KWLHFHSQSRECPVCKALVEEEKLVPLYGRGKTSSDPRSRSIPGVNIPHRPAGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F  HGFGFTGG GGF P ATARFGNFT SAA GG  PSLFN QL+G+  +  Y
Sbjct  116  PPPEPNPFAHHGFGFTGGLGGFAPAATARFGNFTLSAAFGGFIPSLFNFQLHGFHGATMY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G + GFP+G+ N+FHGGH H +P HT Q QQ D  LK L  F+   V+LA IW 
Sbjct  176  GGAPGFPYGFSNSFHGGHVHRYPLHTGQGQQ-DYYLKRLLFFVIFCVVLAFIWQ  228



>ref|XP_010941935.1| PREDICTED: E3 ubiquitin-protein ligase RNF5 [Elaeis guineensis]
Length=226

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 179/233 (77%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S+     S  S SS+ +N  DAG+FECNICF+LAQDP+VTLCGHLFCWPCLY
Sbjct  1    MASGFGESSSREPQNSSFSGSSSSSN--DAGSFECNICFELAQDPVVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH+H+HS+ECPVCKA+VEEEKLVPLYGRGKN TDPRSKS+PG+ IP+RP GQRP T A
Sbjct  59   KWLHVHAHSQECPVCKAIVEEEKLVPLYGRGKNPTDPRSKSVPGVNIPNRPAGQRPST-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N FP         F G  P+++ R GN+TFSAA+GGLFP L + Q++G+P++  Y
Sbjct  118  PPPDPNNFPH----SNPWFMGGTPVSSTRLGNYTFSAAIGGLFP-LLSFQVHGFPDATAY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G +AGFP+GY N FHGGHAHG P+H +  QQAD  LK L   +G  V+ +L+W
Sbjct  173  GPAAGFPYGYANAFHGGHAHGLPRHVSHGQQADVYLKALLFLVGALVVASLVW  225



>gb|ACU16582.1| unknown [Glycine max]
Length=231

 Score =   289 bits (739),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 187/236 (79%), Gaps = 7/236 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST R+PPSPS  ++N N+  DA NFECNICF+LAQ PI+TLCGHLFCWPCLY
Sbjct  1    MASGFGE-STGRSPPSPSYFNNNNNS--DAANFECNICFELAQGPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK+STDPRSKSIPG+ IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKALVEEEKLVPLYGRGKSSTDPRSKSIPGVNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfg--PMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
            PPP+ N F QHGFGF GG GGF   PMAT RFGNF  SAA GG  PSLFN Q++G+ ++A
Sbjct  117  PPPETNHFHQHGFGFMGGLGGFVPPPMATTRFGNFALSAAFGGFIPSLFNFQMHGFHDAA  176

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
             YG  AGFP G+ NTFHG HAHGFP  T+Q QQ D  LK L LF+   V+LA IW 
Sbjct  177  MYGGGAGFPHGFANTFHGVHAHGFPLRTHQGQQ-DYYLKKLLLFVVFCVVLAFIWQ  231



>ref|XP_007047044.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 8 [Theobroma cacao]
 gb|EOX91201.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 8 [Theobroma cacao]
Length=298

 Score =   291 bits (745),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 207/298 (69%), Gaps = 17/298 (6%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATL T          +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLYT---------TSTLVLVLQTIYYDNVYRWWKC  114

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  115   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  174

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+ S +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  175   RVAKSGPSAMELDSDSSSEDEAAPV-SFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  233

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGL  1394
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE L
Sbjct  234   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEAL  290



>ref|XP_010099355.1| RING finger protein 5 [Morus notabilis]
 gb|EXB77876.1| RING finger protein 5 [Morus notabilis]
Length=225

 Score =   288 bits (737),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 186/232 (80%), Gaps = 9/232 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S S +GN  +DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSPSCSGNGVNDAGDFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKAL++EEKLVPLYGRGK  +DPRSKS PG+EIPHRPTGQRP+T A
Sbjct  57   RWLHHHSHSQECPVCKALIQEEKLVPLYGRGKTQSDPRSKSYPGIEIPHRPTGQRPQT-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F  +     G  GGF PMATAR GNFT S A GGL PSLFNIQ +G+P++  Y
Sbjct  116  PPPEPNQFTNY---GFGFMGGFVPMATARIGNFTLSTAFGGLIPSLFNIQFHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
            GT++GFP+G+ ++FHGGHAHGFPQ +++  QAD+ LK L L IG+ VILAL+
Sbjct  173  GTTSGFPYGF-HSFHGGHAHGFPQPSSRGHQADNVLKNLLLVIGVFVILALL  223



>ref|XP_004499119.1| PREDICTED: RING finger protein 5-like [Cicer arietinum]
Length=229

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 186/234 (79%), Gaps = 5/234 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++   P  P SS++N N   DAGNFECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTSRSPPSPPYSSNNNNN---DAGNFECNICFDLAQDPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKA++EEEKLVPLYGRGK STDPRSKSIPG+ IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKAMIEEEKLVPLYGRGKTSTDPRSKSIPGVNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP++N F QHGFGFTGG GGF P ATARFGNFTFSA  GG  PSLFN QL+G+   A Y
Sbjct  117  PPPESNPFSQHGFGFTGGLGGFAPAATARFGNFTFSAGFGGFIPSLFNFQLHGFHGGAMY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ N+FHGGH H +P HT Q QQ D  LK L +F+   V+LA IW 
Sbjct  177  GGAAGFPYGFSNSFHGGHVHRYPLHTGQGQQ-DYYLKRLLMFVIFCVVLAFIWQ  229



>ref|XP_007047047.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 11 [Theobroma cacao]
 gb|EOX91204.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 11 [Theobroma cacao]
Length=294

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 206/296 (70%), Gaps = 17/296 (6%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATL T          +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLYT---------TSTLVLVLQTIYYDNVYRWWKC  114

Query  1909  RDKNTILVKDNEREALKQRSRHHRT---APAVEVPCQTHYYFTSARTLASSDT-PTYCYI  1742
             R   T  + ++E++ LK            P+ +   +  +Y+TSAR+LA S T P   Y+
Sbjct  115   RRIKTDNMVEDEKKPLKPGKADSGIPIPKPSPKANPRGEFYYTSARSLAGSGTSPFRTYM  174

Query  1741  -MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGK  1568
              +A+SGP A++ D+DSSSEDE  P+ S +K  +QPR IPRA A     LAA+ + P+G K
Sbjct  175   RVAKSGPSAMELDSDSSSEDEAAPV-SFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSK  233

Query  1567  SLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
             +  MEA+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE
Sbjct  234   AW-MEARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  288



>ref|XP_010941973.1| PREDICTED: E3 ubiquitin-protein ligase RNF5-like [Elaeis guineensis]
Length=226

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 179/233 (77%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S      S  S SS+ +N  DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGESSGREPQNSSFSGSSSSSN--DAGSFECNICFELAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH+H+HS+ECPVCKA++EEEKLVPLYGRGKN TDPRSKS+PG+ IP+RP GQRP TA 
Sbjct  59   KWLHVHAHSQECPVCKAIIEEEKLVPLYGRGKNPTDPRSKSVPGVNIPNRPAGQRPATAT  118

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
             PPD N FP         F G  P+A+ RFGN+TFSAA+GGLFP L + Q++G+P++  Y
Sbjct  119  -PPDPNHFPH----SNPWFMGGTPVASTRFGNYTFSAAIGGLFP-LLSFQVHGFPDATAY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G +AGFP+GY N+FHGGHAHGFP+  +  QQAD  LK L   +G  V+ +L+W
Sbjct  173  GPAAGFPYGYANSFHGGHAHGFPRPASHGQQADVYLKALLFLVGALVVASLVW  225



>ref|XP_007202536.1| hypothetical protein PRUPE_ppa011052mg [Prunus persica]
 ref|XP_007202537.1| hypothetical protein PRUPE_ppa011052mg [Prunus persica]
 gb|EMJ03735.1| hypothetical protein PRUPE_ppa011052mg [Prunus persica]
 gb|EMJ03736.1| hypothetical protein PRUPE_ppa011052mg [Prunus persica]
Length=225

 Score =   286 bits (731),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 184/232 (79%), Gaps = 9/232 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S S +GNN +D G+FECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSPSCSGNNANDVGDFECNICFDLAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPRSKS PG+ IP+RP GQRP+T A
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKTQTDPRSKSYPGINIPNRPAGQRPQT-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F  +    +G  GGF PMATAR GNFT + A GGL PSL NI  +G+P++  Y
Sbjct  116  PPPETNQFTNY---GSGFMGGFVPMATARIGNFTLATAFGGLIPSLLNIHYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
            GT++GFP+G+ ++FHGGHAHGFPQ  +Q+QQ D+ LK LFL IG+ VILALI
Sbjct  173  GTTSGFPYGF-SSFHGGHAHGFPQPASQRQQVDNVLKNLFLLIGVFVILALI  223



>ref|XP_010106044.1| RING finger protein 5 [Morus notabilis]
 gb|EXC07314.1| RING finger protein 5 [Morus notabilis]
Length=235

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 188/239 (79%), Gaps = 9/239 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRApp--spsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPC  342
            MASGFG  ST+R     S S++S+N NN  DAG+FECNICFDLAQDPIVTLCGHLFCWPC
Sbjct  1    MASGFGG-STSRPSQGPSCSTNSNNNNNNGDAGSFECNICFDLAQDPIVTLCGHLFCWPC  59

Query  343  LYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPET  522
            LYKWLHIHS SK+CPVCKAL+EE+KLVPLYGRGK+STDPRSKSIP   IPHRP GQRPET
Sbjct  60   LYKWLHIHSRSKDCPVCKALIEEDKLVPLYGRGKSSTDPRSKSIPDDNIPHRPAGQRPET  119

Query  523  AAPPPDANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYP  693
             APPP+ N FP H     G  GG GGF PMATARFGNFT SAA GGL PSL N+QL+G+P
Sbjct  120  -APPPEPNHFPHHGFGFMGGLGGLGGFAPMATARFGNFTLSAAFGGLIPSLLNLQLHGFP  178

Query  694  NSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            +   YG +AGFP G+ N+FHGG+ H F +HT+Q QQ D  LK + LF+ I V++AL+W 
Sbjct  179  DPV-YGGAAGFPHGFSNSFHGGNVHRFHRHTSQGQQ-DYFLKRVLLFVLICVLIALLWQ  235



>ref|XP_008241618.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Prunus mume]
Length=225

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 183/232 (79%), Gaps = 9/232 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S S +GNN ++ G+FECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSPSCSGNNANEVGDFECNICFDLAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPRSKS PG+ IP+RP GQRP+T A
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKMQTDPRSKSYPGINIPNRPAGQRPQT-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N F  +     G  GGF PMATAR GNFT + A GGL PSL NI  +G+P++  Y
Sbjct  116  PPPETNQFTNY---GFGFMGGFVPMATARIGNFTLATAFGGLIPSLLNIHYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
            GT++GFP+G+ ++FHGGHAHGFPQ  +Q+QQ D+ LK LFL IG+ VILALI
Sbjct  173  GTTSGFPYGF-SSFHGGHAHGFPQPASQRQQVDNVLKNLFLLIGVFVILALI  223



>ref|XP_008796996.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Phoenix dactylifera]
 ref|XP_008796997.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Phoenix dactylifera]
 ref|XP_008796998.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Phoenix dactylifera]
Length=227

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 180/234 (77%), Gaps = 9/234 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S+     S  S S++ +N  DAG+F+CNICF+LAQDP+VTLCGHLFCWPCLY
Sbjct  1    MASGFGESSSREPQNSSFSGSNSSSN--DAGSFDCNICFELAQDPVVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH+H+HS+ECPVCKA++EEEKLVPLYGRGKN TDPRSKS+PG+ IP+RP GQRP T A
Sbjct  59   KWLHVHAHSQECPVCKAIIEEEKLVPLYGRGKNPTDPRSKSVPGVNIPNRPAGQRPST-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD + FP         F G  P+A+ R GN+TFSAA+GGLFP L + Q++G+P++  Y
Sbjct  118  PPPDPSNFPH----SNPWFMGGTPVASTRLGNYTFSAAIGGLFP-LLSFQVHGFPDATAY  172

Query  709  GTSAGFPFGYGNTFHGGH-AHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G +AGFP+GY N+FHGGH AHG P+H +  QQAD  LK L   +G  V+ +L+W
Sbjct  173  GPAAGFPYGYANSFHGGHAAHGIPRHVSHGQQADVYLKALLFLVGALVVASLVW  226



>gb|KDP31813.1| hypothetical protein JCGZ_12274 [Jatropha curcas]
Length=230

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 184/237 (78%), Gaps = 12/237 (5%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE     A   P  +S + NNGSDAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE----SASMPPEFASYSSNNGSDAGDFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETA-  525
            +WLH HSHS ECPVCKAL++EEKLVPLYGRGK  TDPRSKS PG++IP RP GQRPETA 
Sbjct  57   RWLHHHSHSHECPVCKALIQEEKLVPLYGRGKTQTDPRSKSYPGIDIPRRPAGQRPETAP  116

Query  526  APPP-DANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGG--LFPSLFNIQLNGYPN  696
            APPP +AN  P +     G  GGF PMA+AR GNFT S A GG  LFPSLFN+Q +G+P+
Sbjct  117  APPPHEANNMPNY---GFGLMGGFVPMASARIGNFTLSTAFGGLSLFPSLFNVQFHGFPD  173

Query  697  SANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            +  YGT++GFP+G+ + FHG HAHGFPQ  ++ Q AD+ LK L + IG+ V+LAL+W
Sbjct  174  ATVYGTTSGFPYGF-HAFHGAHAHGFPQTMSRGQHADNVLKNLLMLIGVLVVLALLW  229



>ref|XP_010030885.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Eucalyptus 
grandis]
Length=350

 Score =   286 bits (731),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 230/367 (63%), Gaps = 49/367 (13%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++Y   E+K CV WV KYFKDCLCN  DE+SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     ITYRAREKKRCVRWVEKYFKDCLCNAKDEVSFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++ YDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLDYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAP-----AVEVPCQT---HYYFTSARTLASSDTP  1757
              R       +  E+ +LK ++ H    P     A   P +     + FTSAR+LA S   
Sbjct  124   GRHIKKPDPQAEEKGSLKPKATHQSGIPIPGAAAKATPVKASSKEFNFTSARSLAGS---  180

Query  1756  TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
                               DSSS DE   + S+ K VS+P  I R           A F  
Sbjct  181   ------------------DSSSGDEAARVPSA-KSVSRPNPIAR---------LVAFFLT  212

Query  1576  GGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN--------  1421
               KS   EA    + R+LL       +V GQ LGWLMAA YMGGR+ +I LN        
Sbjct  213   LNKSF-TEAHVVLSTRKLLH-GRMKHNVIGQRLGWLMAATYMGGRISKICLNLIVFVIAQ  270

Query  1420  IKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIIL  1241
             IK+GSVEGLN LM +F L+AN TY GSILVR+ EWE +KANMPWLLDA+ CV LDLFIIL
Sbjct  271   IKQGSVEGLNLLMLIFELVANVTYAGSILVRTVEWESIKANMPWLLDAIVCVALDLFIIL  330

Query  1240  QYLYYTH  1220
             QY+YY +
Sbjct  331   QYIYYRY  337



>ref|XP_004300592.1| PREDICTED: uncharacterized protein LOC101293790 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004300593.1| PREDICTED: uncharacterized protein LOC101293790 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   280 bits (716),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 181/234 (77%), Gaps = 10/234 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE  +      P S S +G N +DAG+FECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESMS----VPPQSQSCSGTNANDAGDFECNICFDLAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSH +ECPVCKALV+E+KLVPLYGRGK  TDPRSKS PG+ IP+RP GQRPET A
Sbjct  57   RWLHHHSHCQECPVCKALVQEDKLVPLYGRGKTQTDPRSKSYPGISIPNRPAGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQL-NGYPNSAN  705
            PPP+ N FP +     G  GGF P ATAR GN T +AA+GGLFPS FN+   +G+ ++  
Sbjct  116  PPPETNQFPNY---GFGFMGGFMPTATARIGNMTLAAAIGGLFPS-FNVHYQSGFADATV  171

Query  706  YGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            YGT++GFP+G+ ++FHGGHAHGFPQ   Q+QQ D+ LK LFL IG+ VI ALI+
Sbjct  172  YGTTSGFPYGFSSSFHGGHAHGFPQPVTQRQQVDNVLKNLFLLIGVFVIAALIF  225



>ref|XP_009388941.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   278 bits (712),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 176/233 (76%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S+ R     +SS    ++ +DAG+FECNICF+LAQDP+VTLCGHLFCWPCLY
Sbjct  1    MASGFGESSSGR--DPQNSSFGESSSNNDAGSFECNICFELAQDPVVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH H+ S ECPVCKA+VEEEKLVPLYGRGKNSTDPRSKS+PGM IPHRP GQRP T A
Sbjct  59   KWLHGHAQSSECPVCKAIVEEEKLVPLYGRGKNSTDPRSKSLPGMNIPHRPAGQRPAT-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N F          F G  P+A+ RFGNFTFSAA+GGLFP L + Q++G P++  Y
Sbjct  118  PPPDPNNF----HHANPWFMGGAPVASTRFGNFTFSAAIGGLFP-LLSFQVHGIPDATAY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G  AGFP+GYGN FHGGH HGFP+H    QQAD  LK L L +G  VI +L+W
Sbjct  173  GPGAGFPYGYGNAFHGGHVHGFPRHVQHGQQADVYLKALLLLVGALVIASLVW  225



>ref|XP_008338171.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Malus domestica]
 ref|XP_008361372.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Malus domestica]
Length=227

 Score =   278 bits (711),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 181/233 (78%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S+S +GNN +DAG+FECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSTSCSGNNANDAGDFECNICFELAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS+S+ECPVCKALV +EKLVPLYGRGK  TDPRSKS PG+ IP+RP+ QRP+T A
Sbjct  57   RWLHHHSNSQECPVCKALVHDEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSAQRPQT-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPPD N F  +     G  GGF PMATAR GNFT + A GGL PSL NIQ +G+P++  Y
Sbjct  116  PPPDTNXFANY---GFGFMGGFVPMATARIGNFTLATAFGGLIPSLLNIQYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFP+   ++FHGGHAHGFPQ  N Q Q    LK+LFL +G+ VI+A+I+
Sbjct  173  GTTSGFPYASFSSFHGGHAHGFPQPENHQGQPGDVLKYLFLLLGVFVIVAVIF  225



>gb|KCW56813.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=325

 Score =   280 bits (717),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 224/321 (70%), Gaps = 16/321 (5%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGS  1406
              P+  KS   EA    + R+LLQE   + SV GQWLGWLMAAIYMGGR+PQIWLNIKRGS
Sbjct  243   LPLQNKSFT-EAHVVLSTRKLLQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGS  301

Query  1405  VE--GLNPL-MFVFVLIANAT  1352
             VE    +P   F F+L+ + T
Sbjct  302   VEVITFHPFSKFCFLLMNSTT  322



>ref|XP_010029839.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Eucalyptus grandis]
Length=225

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 165/204 (81%), Gaps = 5/204 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNIC +LAQDP++TLCGHL+CWPCLY+WL  HSH  ECPVCKAL++EEKLVPLY
Sbjct  25   DAGDFECNICLELAQDPVLTLCGHLYCWPCLYRWLTHHSHCHECPVCKALIQEEKLVPLY  84

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK  TDPRSKS PG++IP+RP+GQRPET APPPDAN F  +     G  GGF PMA A
Sbjct  85   GRGKTQTDPRSKSYPGIDIPNRPSGQRPET-APPPDANQFANY---GFGFMGGFMPMAYA  140

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT S A GGL P+LFN+Q +G+ ++  YGT++G+P+G+ NTFHGGHAHGFPQ   +
Sbjct  141  RFGNFTLSTAFGGLIPALFNVQFHGFQDATVYGTTSGYPYGF-NTFHGGHAHGFPQTAVR  199

Query  793  QQQADSNLKWLFLFIGITVILALI  864
             QQAD+ LK L L IGI V+LAL+
Sbjct  200  GQQADTVLKNLLLLIGIFVVLALL  223



>ref|XP_007047035.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX91192.1| RING/U-box superfamily protein [Theobroma cacao]
Length=225

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 178/233 (76%), Gaps = 9/233 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MA+GFGE ++   P    S S+N N   DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MANGFGESTSIPPPSPSCSGSNNAN---DAGDFECNICFELAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSH +ECPVCKAL++EEKLVPLYGRGKN TDPRSKS PGMEIP+RP GQRP TA 
Sbjct  58   RWLHHHSHCQECPVCKALIQEEKLVPLYGRGKNQTDPRSKSYPGMEIPNRPAGQRPATAP  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PP + N F  +     G  GGF PMATAR GNFT     GGL PSLFNIQ +G+P++  Y
Sbjct  118  PPAETNQFANY---GFGLMGGFVPMATARIGNFTM--GFGGLLPSLFNIQFHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFP+G+ N+FHG HA GFPQ T +  QAD+ LK L L IG+ V+LAL++
Sbjct  173  GTTSGFPYGF-NSFHGRHAQGFPQPTTRGHQADNVLKNLLLLIGVFVVLALLY  224



>ref|XP_008377351.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF185 
[Malus domestica]
Length=235

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 181/238 (76%), Gaps = 7/238 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ST+R+P  PS S S+ NNG DAG+FECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MVSGFGE-STSRSPKGPSFSGSSNNNG-DAGDFECNICFDLAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALV+EE LVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  59   KWLHIHSHSQECPVCKALVKEESLVPLYGRGKTSTDPRSKSIPGINIPNRPAGQRPET-A  117

Query  529  PPPDANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNS  699
            PPP+ + F        G  GG GGF P+AT RFGNFTFSAA+GG  PSLFN  L+G+P +
Sbjct  118  PPPEQSHFAHRGFGFMGGMGGLGGFAPVATTRFGNFTFSAAIGGFIPSLFNFPLHGFPEA  177

Query  700  ANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ-QQQADSNLKWLFLFIGITVILALIWN  870
            A +G SAGFP G+ NTFHGG AH    H    Q Q D  LK L + + I+V LAL W 
Sbjct  178  AMFGASAGFPHGFSNTFHGGPAHRHHLHRGTGQGQQDHRLKMLCVIVIISVFLALAWQ  235



>ref|XP_006856132.1| hypothetical protein AMTR_s00059p00157160 [Amborella trichopoda]
 gb|ERN17599.1| hypothetical protein AMTR_s00059p00157160 [Amborella trichopoda]
Length=371

 Score =   280 bits (716),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 188/364 (52%), Positives = 231/364 (63%), Gaps = 49/364 (13%)
 Frame = -1

Query  2251  RKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFL  2072
             +K CV WV KYF DCLCN  D ISF  G++SL+CWGVAE+PQIVTN   K++ GVSLAFL
Sbjct  14    QKECVSWVLKYFGDCLCNSRDSISFAFGLVSLVCWGVAEVPQIVTNCSTKATDGVSLAFL  73

Query  2071  CTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTI  1892
              TW++GDVFNLVGC+LEPATLPTQF+TALLYTATT+VLVLQ IYY++FL W K       
Sbjct  74    LTWVVGDVFNLVGCLLEPATLPTQFYTALLYTATTIVLVLQTIYYEYFLKWLKHHKIEHH  133

Query  1891  LVKDNEREALKQRSRHHRTAPAVEVPCQ-----------THYYFTSARTLASSDTPTYCY  1745
             +   +E E L  +       P+  +P              + Y  SAR+LA + TP    
Sbjct  134   V--PSEVEPLNSKG----NPPSTPIPMAGARMHDTTSHGMNLYIFSARSLAFTRTP----  183

Query  1744  IMARSGPPALQYDADSSSEDETVPLS-----------SSQKPVSQPRSIPRataygtfla  1598
                   PP   +   + S     P             +  KP S P+ +  A  YGTF+A
Sbjct  184   ------PPHDSFLRVTKSVPPVAPSYSSSSEDDDHERAHAKPASAPKRMLNAVGYGTFIA  237

Query  1597  aaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNI  1418
             +    P+ G ++ +        RRLLQEH     V G WLGW+MAAIYMGGR+PQI+LN+
Sbjct  238   SGLTLPIKGDAVPIP-------RRLLQEHGESRKVYGMWLGWMMAAIYMGGRLPQIYLNM  290

Query  1417  KRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQ  1238
             KRGSVEGLNPLMFVF LIANATYVG    RSTEW+ +KANMPWLLDA+ CV LDLFII+Q
Sbjct  291   KRGSVEGLNPLMFVFALIANATYVG----RSTEWDMIKANMPWLLDAIVCVALDLFIIMQ  346

Query  1237  YLYY  1226
             ++YY
Sbjct  347   FVYY  350



>ref|XP_006380746.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
 gb|ERP58543.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
Length=299

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 207/294 (70%), Gaps = 8/294 (3%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             + L+YCV E+K CV WV KYFKDCLC+L DE SF  G+ISL+CWGVAEIPQI+TNF+ KS
Sbjct  1     MSLAYCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITNFRTKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVSLAFL TW+ GD+FNLVGC+LEPATLPTQ++TA+LYT +TVVLVLQ +YYDH   W
Sbjct  61    SHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAVLYTTSTVVLVLQGLYYDHVYRW  120

Query  1918  WKCRDKNTILVKDNEREALKQRS--RHHRTAPAV--EVPCQTHYYFTSARTLASSDTPTY  1751
              +CR        D++++ LK +S  R   + P        +  +Y+ SAR+LA S+TP +
Sbjct  121   CRCRKTKDNQQVDDDQDPLKPKSADRSGISIPKASPRATPRRDFYYMSARSLAGSNTPPF  180

Query  1750  -CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
               Y+  A+SGP A+  D +SSS+DE     S    VSQPR IPR+  YGTFLA + + P+
Sbjct  181   RSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPL  240

Query  1576  GGKSLIMEAQTKFAGRRLLQE-HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNI  1418
               K+L  +A   + GRRLL E    D S  GQWLGWLMAAIYMGGR+PQIWLN+
Sbjct  241   QSKALT-QAYIGYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNV  293



>ref|XP_009364327.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Pyrus x bretschneideri]
Length=235

 Score =   273 bits (698),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 179/239 (75%), Gaps = 9/239 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE S +R+   PS S S+ NN  DAG+FECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MVSGFGE-SMSRSSQGPSFSGSSNNNS-DAGDFECNICFDLAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKAL++EE LVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  59   KWLHIHSHSQECPVCKALIKEESLVPLYGRGKTSTDPRSKSIPGINIPNRPAGQRPET-A  117

Query  529  PPPDANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNS  699
            PPP+ N F        G  GG GGF P+AT RFGNFTFSAA+GG  PSLFN  L+G+P +
Sbjct  118  PPPEQNHFAPRGFGFMGGMGGLGGFAPVATTRFGNFTFSAAIGGFIPSLFNFPLHGFPEA  177

Query  700  ANYGTSAGFPFGYGNTFHGGHA--HGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            A +  SAG P G+ NTFHGGHA  H   + T Q QQ D  LK L + + I+V LAL W 
Sbjct  178  AMFSASAGLPHGFSNTFHGGHANRHHLHRGTGQGQQ-DHRLKVLCMIVIISVFLALAWQ  235



>ref|XP_007136566.1| hypothetical protein PHAVU_009G055700g [Phaseolus vulgaris]
 gb|ESW08560.1| hypothetical protein PHAVU_009G055700g [Phaseolus vulgaris]
Length=229

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST R+PPSPS  ++N N+  DAGNFECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGE-STGRSPPSPSYFNNNNNSN-DAGNFECNICFELAQDPIITLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEE+KLVPLYGRGK STDPRSKSIPGM IP RP GQRPET A
Sbjct  59   KWLHFHSQSRECPVCKALVEEDKLVPLYGRGKTSTDPRSKSIPGMNIPDRPAGQRPET-A  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N+F  H            PMAT RFGNF   AA GG  PS  N QL+G+ + A Y
Sbjct  118  PPPETNSFHPH-GFGFMSGFAPPPMATTRFGNFGLPAAFGGFIPSFLNFQLHGFHDGALY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
              ++GFP G+ +TFHG HAHG+P  T+Q QQ D  LK L L +   V+LA IW 
Sbjct  177  RGASGFPHGFSSTFHGVHAHGYPLRTHQSQQ-DYYLKNLLLGVVFCVLLAFIWQ  229



>ref|XP_009374217.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Pyrus x bretschneideri]
Length=227

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 180/233 (77%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S+S +GNN +DAG+FECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSTSCSGNNANDAGDFECNICFELAQDPIITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS+S++CPVCKAL+++EKLVPLYGRGK  TDPRSKS PG+ IP+RP+ QRP+T A
Sbjct  57   RWLHHHSNSQQCPVCKALIQDEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSAQRPQT-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP  N F  +     G  GGF PMATAR GNFT + A GGL PSL NIQ +G+P++  Y
Sbjct  116  PPPHTNQFANY---GFGFMGGFVPMATARIGNFTLATAFGGLIPSLLNIQYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFP+   ++FHGGHAH FPQ  N Q Q    LK+LFL +G+ VI+A+I+
Sbjct  173  GTTSGFPYASFSSFHGGHAHLFPQPENHQGQPGDVLKYLFLLVGVFVIVAVIF  225



>ref|XP_006416519.1| hypothetical protein EUTSA_v10008430mg [Eutrema salsugineum]
 gb|ESQ34872.1| hypothetical protein EUTSA_v10008430mg [Eutrema salsugineum]
Length=278

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 160/206 (78%), Gaps = 5/206 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKA++EE+KLVPLYGRGK
Sbjct  74   FECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSLSKECPVCKAVIEEDKLVPLYGRGK  133

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +STDPRSKSIPG+E+P+RP+GQRPETA PP   + F  H        G   PMA+ARFGN
Sbjct  134  SSTDPRSKSIPGLEVPNRPSGQRPETAQPPEPNHGFAHH-GFGGFMGGFAAPMASARFGN  192

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGGHA--HGFPQHTNQ  792
             T SAA GGL PSLFN+Q +G+P++A YG +A  GFP G+ NTFHGGH+  H + +HT +
Sbjct  193  VTLSAAFGGLIPSLFNLQFHGFPDAAMYGAAASGGFPHGFSNTFHGGHSHMHSYHRHTGR  252

Query  793  QQQADSNLKWLFLFIGITVILALIWN  870
            Q Q D +LK L  F+ I V+ +L+ +
Sbjct  253  QGQQDYHLKALLGFVFIIVVFSLVLS  278



>ref|XP_009365614.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Pyrus x bretschneideri]
 ref|XP_009365615.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Pyrus x bretschneideri]
Length=246

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 180/251 (72%), Gaps = 22/251 (9%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S +R+   PS S SN N   DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-SMSRSSQGPSFSGSNNNG--DAGDFECNICFELAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSK------------ECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIP  492
            KWLHIHSHS+            ECPVCKALV+EE LVPLYGRGK STDPRSKSIPG+ IP
Sbjct  58   KWLHIHSHSQEXXXXXXXXXXXECPVCKALVKEENLVPLYGRGKTSTDPRSKSIPGISIP  117

Query  493  HRPTGQRPETAAPPPDANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPS  663
            +RP GQRPET APPP+ N FP       G  GG GGF P+AT RFGNFTFSAA+GG  PS
Sbjct  118  NRPAGQRPET-APPPEQNHFPLRGFGLMGGMGGLGGFAPVATTRFGNFTFSAAIGGFIPS  176

Query  664  LFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHG--FPQHTNQQQQADSNLKWLFLFI  837
            LFN  LNG+P+ A YG SAGFP G+ N FHGGH H     + T Q QQ D  LK L + +
Sbjct  177  LFNFPLNGFPDPAIYGESAGFPHGFSNAFHGGHIHRHHLRRGTGQGQQ-DYRLKMLCMIV  235

Query  838  GITVILALIWN  870
              +VILAL W 
Sbjct  236  IFSVILALAWQ  246



>gb|AFK65745.1| C3HC4 transcription factor [Gossypium hirsutum]
Length=236

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 186/240 (78%), Gaps = 10/240 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MAS FGE +++       S+++      DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASEFGESASHSPHNPSCSTNNANG---DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEE+KL PLYGRGK+STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHTHSRSQECPVCKALVEEQKLAPLYGRGKSSTDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP  N FPQ+GFGF GG GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P++A +
Sbjct  117  PPPAPNQFPQNGFGFMGGLGGFAPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPDAAMF  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHT------NQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ +++HGG AHG+  H         Q Q D  LK LFLFI + VI A+I+ 
Sbjct  177  GPAAGFPYGFPSSYHGGLAHGYHHHHHHHHHRTAQGQQDHYLKMLFLFIIVCVIFAMIYQ  236



>ref|XP_008377250.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Malus domestica]
Length=234

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 176/239 (74%), Gaps = 10/239 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M  GFGE ST+R+   PS S SN N   DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MGGGFGE-STSRSSQGPSFSGSNNNG--DAGDFECNICFELAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKALV+EE LVPLYGRGK STDPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLHIHSHSQECPVCKALVKEESLVPLYGRGKTSTDPRSKSIPGISIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQH---gfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNS  699
            PPP+ N F        G  GG GGF P+AT RFGN TFSAA+GG  PSLFN  L+G+P+ 
Sbjct  117  PPPEQNHFXHRGFGFMGGMGGLGGFAPVATTRFGNXTFSAAIGGFIPSLFNFPLHGFPDP  176

Query  700  ANYGTSAGFPFGYGNTFHGGHAHG--FPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
              YG SAGFP G+ N FHGGH H     + T Q QQ D  LK L + +  +VILAL W 
Sbjct  177  TIYGESAGFPHGFSNAFHGGHIHRHHLRRGTGQGQQ-DYRLKMLCMIVIFSVILALAWQ  234



>ref|XP_004291908.1| PREDICTED: E3 ubiquitin-protein ligase RMA1-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004291909.1| PREDICTED: E3 ubiquitin-protein ligase RMA1-like isoform 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_004291910.1| PREDICTED: E3 ubiquitin-protein ligase RMA1-like isoform 3 [Fragaria 
vesca subsp. vesca]
 ref|XP_004291911.1| PREDICTED: E3 ubiquitin-protein ligase RMA1-like isoform 4 [Fragaria 
vesca subsp. vesca]
Length=244

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 181/245 (74%), Gaps = 12/245 (5%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspssss-sngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCL  345
            MASGFG+ ++  +      S  SN N+  DAG+FECNICFDLAQDPIVTLCGHLFCWPCL
Sbjct  1    MASGFGDSASRPSQSQQGPSFPSNNNSNGDAGDFECNICFDLAQDPIVTLCGHLFCWPCL  60

Query  346  YKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETA  525
            YKWLHIHSH++ECPVCKALV+EE LVPLYGRGK STDPRSKSIPG++IP+RP GQRPET 
Sbjct  61   YKWLHIHSHAQECPVCKALVKEENLVPLYGRGKTSTDPRSKSIPGVDIPNRPAGQRPET-  119

Query  526  APPPDANAFPQHgfgftggfggfg----PMA-TARFGNFTFSAAVGGLFPSLFNIQLNGY  690
            APPP+ N F Q GFGF GG GG G    PMA T RFGNFTFSAA GGLFPSL N Q++G+
Sbjct  120  APPPEQNHFAQRGFGFMGGLGGLGGYAPPMATTTRFGNFTFSAAFGGLFPSLLNFQMHGF  179

Query  691  PNSANYGTSAGFPFGYGNTFHGGHAHGF-----PQHTNQQQQADSNLKWLFLFIGITVIL  855
            P++  YG +AGFP G+ NTFHG H H +     P+        D  LK L +F+    ++
Sbjct  180  PDAPLYGATAGFPHGFQNTFHGPHGHRYNFRPGPRVGRPAMVQDYYLKMLIMFVVACALM  239

Query  856  ALIWN  870
            AL+W 
Sbjct  240  ALLWQ  244



>ref|XP_006383256.1| hypothetical protein POPTR_0005s12910g [Populus trichocarpa]
 gb|ABK96246.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP61053.1| hypothetical protein POPTR_0005s12910g [Populus trichocarpa]
Length=227

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 174/235 (74%), Gaps = 11/235 (5%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SG+ E ++ R      SSS + NNG+DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MESGYEESTSVR----LESSSFSSNNGTDAGDFECNICFELAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS ECPVCKA+++EEKLVPLYGRGK   DPRSKS PG++IP RP+GQRPET A
Sbjct  57   RWLHHHSHSHECPVCKAIIQEEKLVPLYGRGKTQADPRSKSYPGIDIPTRPSGQRPET-A  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGG--LFPSLFNIQLNGYPNSA  702
            PPPDAN  P       G  GGF P A  R G FT S A GG  LFPSLFNIQ  GYP++ 
Sbjct  116  PPPDANNLPH---FGFGMPGGFMPAAPTRIGGFTISTAFGGLSLFPSLFNIQFQGYPDAT  172

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
             YGT++GFP+G+ + FHG   H FP  T + QQAD+ LK LF FIG  V+LAL+W
Sbjct  173  VYGTTSGFPYGF-HGFHGNRTHRFPPATTRGQQADNVLKNLFFFIGFLVVLALLW  226



>gb|KHG07638.1| RING finger 5 [Gossypium arboreum]
Length=226

 Score =   267 bits (683),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 178/234 (76%), Gaps = 10/234 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++   P    SSS+N N   DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGESTSMPPPSPSCSSSNNAN---DAGDFECNICFELAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQR-PETA  525
            +WLH HSHS+ECPVCKAL++EEKLVPLYGRGKN TDPRSKS PGMEIP+RP GQR     
Sbjct  58   RWLHHHSHSQECPVCKALIQEEKLVPLYGRGKNKTDPRSKSYPGMEIPNRPAGQRPATAP  117

Query  526  APPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSAN  705
             PPP+ N F  +     G  G F PMATAR GNFT     GGL PSLFNI  +G+P++  
Sbjct  118  PPPPETNQFANY---GFGLMGSFVPMATARIGNFTM--GFGGLLPSLFNIHFHGFPDATV  172

Query  706  YGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            YGT++GFP+G+ NTFHGG AHGFPQ T + QQAD+ LK L L IG+ V+LAL++
Sbjct  173  YGTTSGFPYGF-NTFHGGVAHGFPQPTTRGQQADNVLKNLLLLIGVFVVLALLY  225



>ref|XP_006573604.1| PREDICTED: RING finger protein 5-like [Glycine max]
 gb|KHN36153.1| RING finger protein 5 [Glycine soja]
Length=230

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 174/234 (74%), Gaps = 7/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE +   AP    S +S+     DAG+FECNICFDLAQDP++TLCGHLFCWPCLY
Sbjct  1    MTSGFGESTRASAPSPSCSGNSSN----DAGDFECNICFDLAQDPVITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPR+KS PGMEIPHRP+GQRP+TA 
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKTQTDPRTKSYPGMEIPHRPSGQRPQTAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP   A P  G    G  GGF PMATARFGNFT S A GG  PSL NI  +G+ ++  Y
Sbjct  117  PPPPPEANP-FGSYGFGLMGGFIPMATARFGNFTLSTAFGGFIPSLLNIHFHGFQDATVY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQ-QQQADSNLKWLFLFIGITVILALIW  867
            GT++G+PFG+ N FHGG+  GF Q T Q Q+Q D+ LK L + IG  V+L +I+
Sbjct  176  GTTSGYPFGF-NGFHGGNTRGFTQATGQVQRQEDNVLKNLLMLIGFLVLLTVIF  228



>gb|KEH40088.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=232

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 183/237 (77%), Gaps = 8/237 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++   P  P SS++N +   DAGNFECNICFDLAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGESTSRSPPSPPYSSNNNNS---DAGNFECNICFDLAQDPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKA++EEEKLVPLYGRGK STDPRSKS+PG+ IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKAMIEEEKLVPLYGRGKTSTDPRSKSVPGVNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFT---FSAAVGGLFPSLFNIQLNGYPNS  699
            PPP++N F QHGFGFTGG GGF P  TARFGNFT       +GG  PSLFN QL+G+   
Sbjct  117  PPPESNPFSQHGFGFTGGLGGFAPATTARFGNFTFAAGFGGLGGFIPSLFNFQLHGFHGG  176

Query  700  ANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            A YG +AGFP+G+ N FHGGH H +P HT Q QQ D  LK L +F+   V+LAL+W 
Sbjct  177  AMYGGAAGFPYGFSNAFHGGHVHRYPLHTGQGQQ-DYYLKRLLMFVIFCVVLALLWQ  232



>ref|XP_011025702.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
 ref|XP_011025703.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
 ref|XP_011025704.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
 ref|XP_011025705.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
 ref|XP_011025706.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Populus euphratica]
Length=227

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 163/207 (79%), Gaps = 7/207 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LA+DPIVTLCGHL+CWPCLY+WLH+HSHS ECPVCKA+++EEKLVPLY
Sbjct  25   DAGDFECNICFELARDPIVTLCGHLYCWPCLYQWLHLHSHSHECPVCKAIIQEEKLVPLY  84

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG   +DPRSKS PG++IP RP+GQRPET APPPDAN  P +     G  GG+ P A A
Sbjct  85   GRGNTQSDPRSKSYPGIDIPSRPSGQRPET-APPPDANNSPNY---GFGMPGGYMPTAAA  140

Query  613  RFGNFTFSAAVGGL--FPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHT  786
            R GNFTFS A GGL  FPS FN+Q  G+P++  YGT++GFP+G+ + FHG HA  FP  T
Sbjct  141  RSGNFTFSTAFGGLSHFPSFFNVQFQGFPDATVYGTTSGFPYGF-HGFHGHHARRFPPAT  199

Query  787  NQQQQADSNLKWLFLFIGITVILALIW  867
             + Q+AD+ LK LF F+G  V++AL+W
Sbjct  200  TRGQRADNVLKNLFFFVGFLVVIALLW  226



>gb|KCW56814.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=303

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 209/296 (71%), Gaps = 13/296 (4%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNI  1418
              P+  KS   EA    + R+LLQE   + SV GQWLGWLMAAIYMGGR+PQIWLN+
Sbjct  243   LPLQNKSF-TEAHVVLSTRKLLQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNV  297



>gb|AGV54634.1| vulgaris E3 ubiquitin-protein ligase RMA1 isoform 1 [Phaseolus 
vulgaris]
Length=228

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DA N ECNICF+LAQDPI+TLCGHLFCWPCLYKWLH HS S+ECPVCKALVEE+KLVPLY
Sbjct  26   DAANLECNICFELAQDPIITLCGHLFCWPCLYKWLHFHSQSRECPVCKALVEEDKLVPLY  85

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK STDPRSKSIPGM IP RP GQRPET APPP+ N+F  H            PMAT 
Sbjct  86   GRGKTSTDPRSKSIPGMNIPDRPAGQRPET-APPPETNSFHPH-GFGFMSGFAPPPMATT  143

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNF   AA GG  PS FN QL+G+ + A Y  ++GFP G+ +TFHG HAHG+P  T+Q
Sbjct  144  RFGNFGLPAAFGGFIPSFFNFQLHGFHDGALYRGASGFPHGFFSTFHGVHAHGYPFRTHQ  203

Query  793  QQQADSNLKWLFLFIGITVILALIWN  870
             QQ D  LK L L +   V+LA IW 
Sbjct  204  SQQ-DYYLKNLLLGVVFCVLLAFIWQ  228



>ref|XP_003523865.1| PREDICTED: RING finger protein 5-like isoform 1 [Glycine max]
 gb|KHN04545.1| RING finger protein 5 [Glycine soja]
Length=231

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST R+PPSPS  ++N NN  DA NFECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGE-STGRSPPSPSYFNNNNNN--DAANFECNICFELAQDPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK+STDPRSKSIPG  IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKALVEEEKLVPLYGRGKSSTDPRSKSIPGDNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfg--PMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
            PPP+ N F QHGFGF GG GGF   PMAT RFGNF  SAA GG  PSLFN QL+G+ ++A
Sbjct  117  PPPETNHFHQHGFGFMGGLGGFAPPPMATTRFGNFALSAAFGGFIPSLFNFQLHGFHDAA  176

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
             YG  AGFP G+ NTFHG HAHGFP  T+Q QQ
Sbjct  177  MYGGGAGFPHGFANTFHGVHAHGFPLRTHQGQQ  209



>ref|XP_007156892.1| hypothetical protein PHAVU_002G026100g [Phaseolus vulgaris]
 gb|ESW28886.1| hypothetical protein PHAVU_002G026100g [Phaseolus vulgaris]
Length=231

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE +   AP    S +S+     DAG+FECNICFDLAQDP++TLCGHLFCWPCLY
Sbjct  1    MTSGFGESTRPSAPSPSCSGNSSN----DAGDFECNICFDLAQDPVITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPR+KS PGMEIPHRP+GQRP+TA 
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKTQTDPRTKSYPGMEIPHRPSGQRPQTAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP   A P  G    G  GGF PMATARFGNFT S A  G  PSL NI  +G+ ++  Y
Sbjct  117  PPPPPEANP-FGSYGFGLMGGFIPMATARFGNFTLSTAFAGFIPSLLNIHFHGFQDATVY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHT--NQQQQADSNLKWLFLFIGITVILALIW  867
            GT++G+PFG+ N+FHGG   G+PQ T    Q+Q D+ LK L + IG  V+L +I+
Sbjct  176  GTTSGYPFGF-NSFHGGGTRGYPQATGGQVQRQEDNVLKNLLMLIGFLVLLTVIF  229



>ref|XP_006590675.1| PREDICTED: RING finger protein 5-like [Glycine max]
 gb|KHN42017.1| E3 ubiquitin-protein ligase RNF185 [Glycine soja]
Length=230

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 172/234 (74%), Gaps = 7/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE +   AP    S +S+     DAG+FECNICFDLAQDP++TLCGHLFCWPCLY
Sbjct  1    MTSGFGESTRASAPSPSCSGNSSN----DAGDFECNICFDLAQDPVITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPR+K  PGMEIPHRP+GQRP+T  
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKTQTDPRTKLYPGMEIPHRPSGQRPQTMP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP     P  G    G  GGF PMATARFGNFT S A GG  PSL NI  +G+ ++  Y
Sbjct  117  PPPPPEVNP-FGSYGFGLMGGFIPMATARFGNFTLSTAFGGFIPSLLNIHFHGFQDATVY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQ-QQQADSNLKWLFLFIGITVILALIW  867
            GT++G+PFG+ N FHGG+A GF Q T Q Q+Q D+ LK L + IG  V+L +I+
Sbjct  176  GTTSGYPFGF-NGFHGGNARGFMQATGQVQRQEDNVLKNLLMLIGFLVLLTVIF  228



>ref|XP_010533245.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Tarenaya 
hassleriana]
 ref|XP_010533246.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Tarenaya 
hassleriana]
 ref|XP_010533247.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Tarenaya 
hassleriana]
 ref|XP_010533248.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Tarenaya 
hassleriana]
Length=219

 Score =   261 bits (668),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 155/203 (76%), Gaps = 4/203 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNICFDLAQDPIVTLCGHLFCWPCLYKWLH+HS S ECPVCKAL+EEEKLVPLYGRGK
Sbjct  20   FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHLHSRSGECPVCKALIEEEKLVPLYGRGK  79

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +STDPRSKS+PG+E+P+RP+GQRPETA PP  +N F  H     G  GGF P+A+ARFGN
Sbjct  80   SSTDPRSKSVPGIEVPNRPSGQRPETAHPPEPSNNFAHH---RFGFMGGFAPVASARFGN  136

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGF-PQHTNQQQQ  801
            FTFSA  GGL PSLFN+  NG+P+ A YG +  FP G+ N FHGGH H   P+      Q
Sbjct  137  FTFSAGFGGLIPSLFNLNFNGFPDHAMYGVANSFPHGFSNPFHGGHPHVHSPRRHVGHGQ  196

Query  802  ADSNLKWLFLFIGITVILALIWN  870
             D +LK L +F+   V+++L  +
Sbjct  197  QDFHLKALLVFVAFIVLISLFMS  219



>gb|KHG15330.1| RING finger 5 [Gossypium arboreum]
Length=236

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 188/240 (78%), Gaps = 10/240 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MA GFGE +++       S+S+      DAG+FECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MAGGFGESASHSPHNPSCSTSNANG---DAGDFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHS S+ECPVCKALVEE+KLVPLYGRGK+STDPRSKSIPG+ IP+RP GQRPETA 
Sbjct  58   KWLHIHSRSQECPVCKALVEEQKLVPLYGRGKSSTDPRSKSIPGVNIPNRPAGQRPETAP  117

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP    FPQ+GFGF GG GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P++A +
Sbjct  118  PPPPIQ-FPQNGFGFMGGLGGFAPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPDAAMF  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHT------NQQQQADSNLKWLFLFIGITVILALIWN  870
            G +AGFP+G+ +++HGGHAHG+  H         Q Q D  LK LFLFI + VI A+I+ 
Sbjct  177  GPAAGFPYGFPSSYHGGHAHGYHHHHHHHHHRTAQGQQDHYLKMLFLFIIVCVIFAMIYQ  236



>ref|XP_008444676.1| PREDICTED: RING finger protein 5 [Cucumis melo]
 ref|XP_008444677.1| PREDICTED: RING finger protein 5 [Cucumis melo]
Length=230

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 176/236 (75%), Gaps = 8/236 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASG GE ++ +      S ++      DA NFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGLGESTSRQPQSPSCSDNNG-----DASNFECNICLDLAQDPIVTLCGHLFCWPCLY  55

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSH +ECPVCKA++EE+KLVPLYGRGK STDPRSK IPG+ IP+RP GQRPE A 
Sbjct  56   KWLHIHSHPQECPVCKAIIEEQKLVPLYGRGKTSTDPRSKGIPGINIPNRPAGQRPEAAG  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N FP +GFGF GG GGF PMA+ RFGNFT SAA GGL PSLFN Q++GY + + Y
Sbjct  116  PPPEPNPFPHNGFGFMGGLGGFAPMASTRFGNFTLSAAFGGLVPSLFNFQMHGYADPSMY  175

Query  709  GTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G  A FP+G+ N FHG  GHAHG+  H  +Q Q D  LK L L IG  V+LALIW 
Sbjct  176  GAGANFPYGFPNMFHGSHGHAHGY-YHQLRQGQQDYYLKRLLLLIGFFVLLALIWQ  230



>ref|XP_004152714.1| PREDICTED: RING finger protein 5-like [Cucumis sativus]
 ref|XP_004160021.1| PREDICTED: RING finger protein 5-like [Cucumis sativus]
 gb|KGN62568.1| hypothetical protein Csa_2G360850 [Cucumis sativus]
Length=230

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 176/236 (75%), Gaps = 8/236 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ++ +      S ++      DA NFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MESGFGESTSRQPQSPSCSDNNG-----DASNFECNICLDLAQDPIVTLCGHLFCWPCLY  55

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSH +ECPVCKA++EE+KLVPLYGRGK STDPRSKSIPG+ IP+RP GQRPE A 
Sbjct  56   KWLHIHSHPQECPVCKAIIEEQKLVPLYGRGKTSTDPRSKSIPGINIPNRPAGQRPEAAG  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N FP +GFGF GG GGF PMA+ RFGNFT SAA GGL PSLFN Q++GY + + Y
Sbjct  116  PPPEPNPFPHNGFGFMGGLGGFAPMASTRFGNFTLSAAFGGLVPSLFNFQMHGYADPSMY  175

Query  709  GTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
            G  A FP+G+ N FHG  GHAHG+  H  +Q Q D  LK L   IG  V+LALIW 
Sbjct  176  GAGANFPYGFPNMFHGSHGHAHGY-YHQLRQGQQDYYLKRLLFLIGFFVLLALIWQ  230



>gb|ACU19464.1| unknown [Glycine max]
Length=231

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST R+PPSPS  ++N NN  DA NFE NICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MASGFGE-STGRSPPSPSYFNNNNNN--DAANFERNICFELAQDPIITLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH HS S+ECPVCKALVEEEKLVPLYGRGK+STDPRSKSIPG  IPHRP GQRPET A
Sbjct  58   KWLHFHSQSRECPVCKALVEEEKLVPLYGRGKSSTDPRSKSIPGDNIPHRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfg--PMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
            PPP+ N F QHGFGF GG GGF   PMAT RFGNF  SAA GG  PSLFN QL+G+ ++A
Sbjct  117  PPPETNHFHQHGFGFMGGLGGFAPPPMATTRFGNFALSAAFGGFIPSLFNFQLHGFHDAA  176

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
             YG  AGFP G+ NTFHG HAHGFP  T+Q QQ
Sbjct  177  MYGGGAGFPHGFANTFHGVHAHGFPLRTHQGQQ  209



>ref|XP_010432126.1| PREDICTED: uncharacterized protein LOC104716448 isoform X2 [Camelina 
sativa]
Length=315

 Score =   262 bits (670),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 159/296 (54%), Positives = 206/296 (70%), Gaps = 17/296 (6%)
 Frame = -1

Query  2266  YCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGV  2087
             YC+ E+KACV WV +YF DCLCN+ND++SF +GI SLICWGVAEIPQI+TNF+ KSS GV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  2086  SLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR  1907
             SL+FL  W+ GD+FNLVGC+LEPATLPTQ +TALLYT +TVVLV+Q IYYD+   +  CR
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTALLYTVSTVVLVIQTIYYDYI--YRLCR  125

Query  1906  DKNTILVKDNEREALKQRSRHHR-TAPAVEVPCQTH-------YYFTSARTLASSDTP--  1757
                T + + +E +  K+  +  + T  A+ +P  ++       +Y+TSAR+LA S TP  
Sbjct  126   HGRTKICQTDEEDEEKRPLKPPKTTGSAISIPRGSYKDSPRREFYYTSARSLAGSGTPPS  185

Query  1756  -TYCYIMARSGPPALQYDADSSS-EDETVPLSS--SQKPVSQPRSIPRataygtflaaaA  1589
              +  + +A+SGP AL  +  SSS EDET+      + K ++QPR IPR   +GTFLAA+A
Sbjct  186   RSSYFRVAKSGPSALAIENGSSSDEDETMSTCPVIATKTITQPRPIPRPAGFGTFLAASA  245

Query  1588  HFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN  1421
               P+  KSL  E     + RRLL E   + S  GQWLGWLMAAIYMGGR+PQIWLN
Sbjct  246   SLPLQAKSL-AEKYAHASSRRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLN  300



>ref|XP_008808880.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Phoenix dactylifera]
 ref|XP_008808881.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Phoenix dactylifera]
 ref|XP_008808882.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Phoenix dactylifera]
Length=241

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 169/217 (78%), Gaps = 8/217 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S+     S    SS+ +N  DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGESSSREPQNSSFFGSSSSSN--DAGSFECNICFELAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLH+H+HS+ECPVCKA++EEEKLVPLYGRGKN TDPRSKS+PG+ IP+RP GQRP TA 
Sbjct  59   KWLHVHAHSQECPVCKAIIEEEKLVPLYGRGKNPTDPRSKSVPGVNIPNRPAGQRPATAP  118

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PP     FP         F G  P+A++RFGN+TFSAA GGLFP L + Q++G+P++  Y
Sbjct  119  PPDPTQ-FPH----SNPWFMGGTPVASSRFGNYTFSAAFGGLFP-LLSFQVHGFPDATAY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLK  819
            G +AGFP+GY N+FHGGHAHGFP+H +  QQAD  LK
Sbjct  173  GPAAGFPYGYANSFHGGHAHGFPRHASHGQQADVYLK  209



>gb|AES94854.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=298

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 196/303 (65%), Gaps = 28/303 (9%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             ++ SYCV E K CVGWV  YF DCLCN+ND ISF  G ISLICWGVAEIPQI+TNF+ KS
Sbjct  1     MQTSYCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKS  60

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
             S GVS+ FL TW+ GD+FNLVGC+LEPATLPTQ++TALLYT TT+VLV+Q+ YYD+   W
Sbjct  61    SHGVSIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTALLYTITTIVLVVQSFYYDYIYKW  120

Query  1918  WKCRDK-NTILVKDNEREALKQRSR----------HHRTAPAVEVPCQTHYYFTSARTLA  1772
              K R K N     + E++ LK + R           HR  P  E      YY+ SAR+LA
Sbjct  121   CKRRQKINIEETYEEEKKPLKPKERFELGIPIRSGRHRAIPKPE------YYYGSARSLA  174

Query  1771  SSDTP---TYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-  1604
              + TP   TY  + A+SGP A+  + DSSS+DE     +   P +QPR IPR+       
Sbjct  175   GNVTPPSRTYMRV-AKSGPSAMGLNEDSSSDDE-----AHSVPATQPRQIPRSAGSYGTF  228

Query  1603  laaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWL  1424
             LAA+ + P    +L +      +GR+LL +     S  GQWLGWLMAAIY GGR+PQIWL
Sbjct  229   LAASINLPHQSNALKV-GYIALSGRKLLSQEHVTHSALGQWLGWLMAAIYTGGRIPQIWL  287

Query  1423  NIK  1415
             N++
Sbjct  288   NVR  290



>ref|XP_002893041.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69300.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+ NFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKA++EE++LVPLY
Sbjct  17   DSSNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKECPVCKAVIEEDRLVPLY  76

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK+S DPRSKSIPG+E+P+RP+GQRPETA PP   + F  H        G   PMA+A
Sbjct  77   GRGKSSADPRSKSIPGLEVPNRPSGQRPETAQPPDPNHGFAHHHGFGGFMGGFAAPMASA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGGHA--HGFPQ  780
            RFGN T SAA GGL PSLFN+  +G+P++A YG +A  GFP G+ N FHGGH+  H + +
Sbjct  137  RFGNVTLSAAFGGLIPSLFNLHFHGFPDAAMYGAAASGGFPHGFSNPFHGGHSHMHSYQR  196

Query  781  HTNQQQQADSNLK  819
            H  +Q Q D++LK
Sbjct  197  HGGRQGQQDNHLK  209



>ref|XP_006425746.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 ref|XP_006425747.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 ref|XP_006466711.1| PREDICTED: RING finger protein 5-like isoform X1 [Citrus sinensis]
 ref|XP_006466712.1| PREDICTED: RING finger protein 5-like isoform X2 [Citrus sinensis]
 ref|XP_006466713.1| PREDICTED: RING finger protein 5-like isoform X3 [Citrus sinensis]
 gb|ESR38986.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 gb|ESR38987.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
Length=234

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 181/248 (73%), Gaps = 21/248 (8%)
 Frame = +1

Query  169  MASGFGE----PSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCW  336
            MASGF E    PS N +    S++        DAG FECNICF+LAQDPIVTLCGHLFCW
Sbjct  1    MASGFSESTSVPSQNPSCVGNSAN--------DAGGFECNICFELAQDPIVTLCGHLFCW  52

Query  337  PCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRP  516
            PCLY+WLH HSHS+ECPVCKA+V+EEKLVPLYGRGK  TDPRSKS PG++IP RP GQRP
Sbjct  53   PCLYRWLHHHSHSQECPVCKAVVQEEKLVPLYGRGKTQTDPRSKSYPGIDIPSRPAGQRP  112

Query  517  ETAAPPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPN  696
            ET APPP+A+ FP       G  GG  PMATAR GNFT     GGLFPSLFNIQ +G+P+
Sbjct  113  ET-APPPEASYFPN---LGFGLMGGLMPMATARIGNFTM--GFGGLFPSLFNIQFHGFPD  166

Query  697  SANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALI-WN*  873
            +  YGT++GFP G+ + FHGGH HGFPQ  ++ QQAD+ LK L L IG+ VILAL+ W+ 
Sbjct  167  ATVYGTTSGFPNGF-SAFHGGHVHGFPQ-PSRGQQADNVLKNLLLLIGLFVILALLFWHE  224

Query  874  GERTSAWC  897
                + +C
Sbjct  225  ASVLALFC  232



>ref|XP_006425744.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 ref|XP_006425745.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 gb|ESR38984.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 gb|ESR38985.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
Length=222

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 177/237 (75%), Gaps = 20/237 (8%)
 Frame = +1

Query  169  MASGFGE----PSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCW  336
            MASGF E    PS N +    S++        DAG FECNICF+LAQDPIVTLCGHLFCW
Sbjct  1    MASGFSESTSVPSQNPSCVGNSAN--------DAGGFECNICFELAQDPIVTLCGHLFCW  52

Query  337  PCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRP  516
            PCLY+WLH HSHS+ECPVCKA+V+EEKLVPLYGRGK  TDPRSKS PG++IP RP GQRP
Sbjct  53   PCLYRWLHHHSHSQECPVCKAVVQEEKLVPLYGRGKTQTDPRSKSYPGIDIPSRPAGQRP  112

Query  517  ETAAPPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPN  696
            ET APPP+A+ FP       G  GG  PMATAR GNFT     GGLFPSLFNIQ +G+P+
Sbjct  113  ET-APPPEASYFPN---LGFGLMGGLMPMATARIGNFTM--GFGGLFPSLFNIQFHGFPD  166

Query  697  SANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            +  YGT++GFP G+ + FHGGH HGFPQ  ++ QQAD+ LK L L IG+ VILAL++
Sbjct  167  ATVYGTTSGFPNGF-SAFHGGHVHGFPQ-PSRGQQADNVLKNLLLLIGLFVILALLF  221



>ref|XP_006425748.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 ref|XP_006425749.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 gb|ESR38988.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
 gb|ESR38989.1| hypothetical protein CICLE_v10026329mg [Citrus clementina]
Length=255

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 177/237 (75%), Gaps = 20/237 (8%)
 Frame = +1

Query  169  MASGFGE----PSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCW  336
            MASGF E    PS N +    S++        DAG FECNICF+LAQDPIVTLCGHLFCW
Sbjct  1    MASGFSESTSVPSQNPSCVGNSAN--------DAGGFECNICFELAQDPIVTLCGHLFCW  52

Query  337  PCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRP  516
            PCLY+WLH HSHS+ECPVCKA+V+EEKLVPLYGRGK  TDPRSKS PG++IP RP GQRP
Sbjct  53   PCLYRWLHHHSHSQECPVCKAVVQEEKLVPLYGRGKTQTDPRSKSYPGIDIPSRPAGQRP  112

Query  517  ETAAPPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPN  696
            ET APPP+A+ FP       G  GG  PMATAR GNFT     GGLFPSLFNIQ +G+P+
Sbjct  113  ET-APPPEASYFPN---LGFGLMGGLMPMATARIGNFTM--GFGGLFPSLFNIQFHGFPD  166

Query  697  SANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            +  YGT++GFP G+ + FHGGH HGFPQ  ++ QQAD+ LK L L IG+ VILAL++
Sbjct  167  ATVYGTTSGFPNGF-SAFHGGHVHGFPQ-PSRGQQADNVLKNLLLLIGLFVILALLF  221



>ref|XP_006304178.1| hypothetical protein CARUB_v10010212mg [Capsella rubella]
 gb|EOA37076.1| hypothetical protein CARUB_v10010212mg [Capsella rubella]
Length=229

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 9/201 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+GNFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKA++EE++LVPLY
Sbjct  17   DSGNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKECPVCKAVIEEDRLVPLY  76

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDAN----AFPQHgfgftggfggfgP  600
            GRGK+S DPRSKSIPG+E+P+RP+GQRPETA  PPD N        H        G   P
Sbjct  77   GRGKSSADPRSKSIPGLEVPNRPSGQRPETAQ-PPDPNHGFAHHHHHHGFGGFMGGFAAP  135

Query  601  MATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGGHA--H  768
            MA+ARFGN T SAA GGL PSLFN+  +G+P++A YG +A   FP G+ N FHGGH+  H
Sbjct  136  MASARFGNVTLSAAFGGLIPSLFNLHFHGFPDAAMYGAAASGSFPHGFSNPFHGGHSHMH  195

Query  769  GFPQHTNQQQQADSNLKWLFL  831
             + +HT +Q Q D+ LK + L
Sbjct  196  SYQRHTGRQGQQDNQLKIILL  216



>gb|KDO79459.1| hypothetical protein CISIN_1g027504mg [Citrus sinensis]
 gb|KDO79460.1| hypothetical protein CISIN_1g027504mg [Citrus sinensis]
Length=222

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 178/237 (75%), Gaps = 20/237 (8%)
 Frame = +1

Query  169  MASGFGE----PSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCW  336
            MASGF E    PS N +    S++        DAG FECNICF+LAQDPIVTLCGHLFCW
Sbjct  1    MASGFAESTSVPSQNPSCVGNSAN--------DAGGFECNICFELAQDPIVTLCGHLFCW  52

Query  337  PCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRP  516
            PCLY+WLH HSHS+ECPVCKA+V+EEKLVPLYGRGK  TDPRSKS PG++IP RP GQRP
Sbjct  53   PCLYRWLHHHSHSQECPVCKAVVQEEKLVPLYGRGKTQTDPRSKSYPGIDIPSRPAGQRP  112

Query  517  ETAAPPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPN  696
            ET APPP+A+ FP       G  GGF PMATAR GNFT   A  GLFPSLFNIQ +G+P+
Sbjct  113  ET-APPPEASYFPN---LGFGLMGGFMPMATARIGNFTMGFA--GLFPSLFNIQFHGFPD  166

Query  697  SANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            +  YGT++GFP G+ + FHGGH HGFPQ  ++ QQAD+ LK L L IG+ VILAL++
Sbjct  167  ATVYGTTSGFPNGF-SAFHGGHVHGFPQ-PSRGQQADNVLKNLLLLIGLFVILALLF  221



>ref|XP_002269155.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Vitis vinifera]
 ref|XP_010649199.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Vitis vinifera]
Length=226

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 166/235 (71%), Gaps = 11/235 (5%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE  +     SP+S +  G+  +D G+FECNICF+LAQDPIVTLCGHL+CWPCLY
Sbjct  1    MASGFGESES----MSPASGACGGSGSNDVGDFECNICFELAQDPIVTLCGHLYCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKAL++EEKLVPLYGRGK  +DPRSKSIP   IP RP GQRPETA 
Sbjct  57   EWLHHHSHSQECPVCKALIQEEKLVPLYGRGKTPSDPRSKSIPNDSIPSRPAGQRPETA-  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
             PP AN          G   GF P+ TARFGNF  SAA G L PSLFNI ++G+P+   Y
Sbjct  116  -PPVANPVSH---LGVGLMRGFAPVRTARFGNFALSAAFGHLSPSLFNIHVHGFPDPRVY  171

Query  709  GTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            G + G+P  + N  HG  GH H FP   +Q+Q+ +  LK L LF G+ VILALIW
Sbjct  172  GATPGYPLWFSNAMHGGLGHMHRFPHPISQRQRTNYYLKNLLLFTGVLVILALIW  226



>ref|XP_010498345.1| PREDICTED: RING finger protein 5-like [Camelina sativa]
Length=230

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = +1

Query  259  GNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGR  438
            GNFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKAL+EE++LVPLYGR
Sbjct  21   GNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKECPVCKALIEEDRLVPLYGR  80

Query  439  GKNSTDPRSKSIPGMEIPHRPTGQRPETAAPP-PDANAFPQHgfgftggfggfgPMATAR  615
            GK+S DPRSKSIPG+E+P+RP+GQRPETA PP P+      H        G   PMA+AR
Sbjct  81   GKSSADPRSKSIPGLEVPNRPSGQRPETAQPPDPNHGFAHHHHGFGGFMGGFAAPMASAR  140

Query  616  FGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGG---HAHGFPQ  780
            FGN T SA  GGL PSLFN+  +G+PN+A YG +A   FP G+ N FHGG   H H + +
Sbjct  141  FGNVTLSATFGGLIPSLFNLHFHGFPNAAMYGAAASGSFPHGFSNPFHGGGHSHMHSYQR  200

Query  781  HTNQQQQADSNLK  819
            HT +Q+Q D +LK
Sbjct  201  HTGEQRQQDHHLK  213



>ref|XP_006344828.1| PREDICTED: RING finger protein 5-like [Solanum tuberosum]
Length=221

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 5/204 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++EEKLVPLY
Sbjct  21   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEEKLVPLY  80

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK +PG+EIP RP GQRPET APPP+++ FP       G  GG  P ATA
Sbjct  81   GRGRTSTDPRSKPVPGVEIPRRPAGQRPET-APPPESHTFPN---PGFGLMGGLFPGATA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
             FGNFT SA  GGLFPSL + Q NG+   A +GT+  +PFGY   +HG + H     ++ 
Sbjct  137  SFGNFTMSAGFGGLFPSLLSFQFNGFQGPAAFGTAPNYPFGYPPAYHGANVHNAAAQSS-  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QAD+NLK++FL +G  V L L 
Sbjct  196  QGQADNNLKFMFLLVGFLVFLYLF  219



>ref|XP_010254973.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 isoform 
X5 [Nelumbo nucifera]
Length=316

 Score =   255 bits (652),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 199/293 (68%), Gaps = 12/293 (4%)
 Frame = -1

Query  2278  VELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKS  2099
             +  +YC  ++K CVGWV  YFKDCLCNL+DEISF  G  SLICWGVAEIPQI+TNF  KS
Sbjct  5     ISHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKS  64

Query  2098  SSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPW  1919
               GVSLAFL TW++GDVFNLVGC+LEPATLPTQF+TA+LYT TTVVLVLQ +YYD    W
Sbjct  65    GQGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAVLYTVTTVVLVLQCLYYDRICLW  124

Query  1918  WKCRDKNTILVKDNEREALKQRSRHH-----RTAPAVEVPCQTHYYFTSARTLASSDTPT  1754
             WK + K + ++ D E + L  +          + P    P +  YY TSAR+LASS TPT
Sbjct  125   WKSKGKQSYVMVDEETKPLNSKLLDTSVPIPSSGPQEASPSRDLYY-TSARSLASSSTPT  183

Query  1753  Y-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFP  1580
                Y+ ++RSGP A++  +D SSEDE  P+   +K  SQP+  P +  YG FL A+A+ P
Sbjct  184   LGSYLGISRSGPSAVEEQSD-SSEDEAFPV-YDKKSSSQPKRTPPSVGYGAFLGASANLP  241

Query  1579  VGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLN  1421
                 +L ME      GRR L E E  ++V G  LGWLMAAIYMGGR+PQI+LN
Sbjct  242   FRSMAL-MEGYLASTGRR-LHETEVANNVYGLLLGWLMAAIYMGGRLPQIFLN  292



>ref|NP_564078.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAF79455.1|AC025808_37 F18O14.3 [Arabidopsis thaliana]
 gb|AAL15335.1| At1g19310/F18O14_14 [Arabidopsis thaliana]
 gb|AAM51593.1| At1g19310/F18O14_14 [Arabidopsis thaliana]
 gb|AAM62463.1| unknown [Arabidopsis thaliana]
 gb|AEE29828.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=226

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 4/189 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SK+CPVCKA++EE++LVPLYGRGK
Sbjct  21   FECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKDCPVCKAVIEEDRLVPLYGRGK  80

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +S DPRSKSIPG+E+P+RP+GQRPETA PP   + F  H        G   PMA+ARFGN
Sbjct  81   SSADPRSKSIPGLEVPNRPSGQRPETAQPPDPNHGFAHHHGFGGFMGGFAAPMASARFGN  140

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGGHA--HGFPQHTNQ  792
             T SAA GGL PSLFN+  +G+P++A YG +A  GFP G+ N FHGGH+  H + +HT +
Sbjct  141  VTLSAAFGGLIPSLFNLHFHGFPDAAMYGAAASGGFPHGFSNPFHGGHSHMHSYQRHTGR  200

Query  793  QQQADSNLK  819
            Q Q D +L+
Sbjct  201  QGQQDHHLR  209



>ref|XP_008440158.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Cucumis melo]
 ref|XP_008440160.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Cucumis melo]
Length=228

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 176/233 (76%), Gaps = 6/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MA+ FGE ST+    +PS S+++    +D G+FECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MANEFGE-STSMPHRNPSCSTNSDTTNNDTGDFECNICFELAQDPIITLCGHLFCWPCLY  59

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS  +ECPVCKAL++EEKLVPLYGRGK  +DPR    PG++IP+RP GQRP+T A
Sbjct  60   RWLHHHSQCQECPVCKALIQEEKLVPLYGRGKIPSDPRLNRYPGIDIPNRPAGQRPQT-A  118

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP  N F  +     G  GGF PMA+AR GNFT + A GGL PSLFNIQ +G+P++  Y
Sbjct  119  PPPVPNDFANY---GFGFTGGFMPMASARIGNFTLATAFGGLIPSLFNIQFHGFPDATVY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++G+P+ + NTFHGGH H FPQ + + Q AD+ LK L L +G+ VILAL+W
Sbjct  176  GTTSGYPYAF-NTFHGGHGHHFPQPSTRGQHADNVLKNLLLLVGVFVILALLW  227



>ref|XP_009762480.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
sylvestris]
 ref|XP_009762481.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
sylvestris]
 ref|XP_009762482.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
sylvestris]
Length=220

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 151/204 (74%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++EEKLVPLY
Sbjct  22   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEEKLVPLY  81

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK IPG+EIP+RP GQRPET AP P +N  P       G  GGF P ATA
Sbjct  82   GRGRTSTDPRSKPIPGLEIPNRPAGQRPET-APQPQSNNIPN---LGFGHMGGFFPTATA  137

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT SA  GGLFPSL + Q +G+P    Y T++ +PFGY   +HG H          
Sbjct  138  RFGNFTMSAGFGGLFPSLLSFQFHGFPGPTAYPTTSNYPFGYTPAYHGPHVRN--AQDTT  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QADSN+K++FL +G  V++ L+
Sbjct  196  QVQADSNIKFMFLLVGFLVLIYLL  219



>ref|XP_010526737.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like isoform X1 
[Tarenaya hassleriana]
Length=231

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G FECNICF+LAQDPI+TLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+E+KLVPLY
Sbjct  23   DQGGFECNICFELAQDPIITLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQEDKLVPLY  82

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGKN TDPRSKS PGM+IP RPTGQRPETA PPP  +          G  GGF PMA+ 
Sbjct  83   GRGKNQTDPRSKSYPGMQIPSRPTGQRPETAPPPPPRHEPNSFFGAGIGSMGGFMPMAST  142

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGGHAHGFPQHTN  789
              GNFT    +GGL+PSLFN Q +G+P++  +G++ G PF G+ N FHGGHAHGFP   N
Sbjct  143  SIGNFTM--GIGGLWPSLFNFQFHGFPDATFFGSTMGHPFGGFHNDFHGGHAHGFPSRNN  200

Query  790  QQ----QQADSNLKWLFLFIGITVILALI  864
                   QAD+ LK LF+ IG+ V++AL+
Sbjct  201  PMANGGHQADAALKNLFIIIGVCVLIALL  229



>ref|XP_010026147.1| PREDICTED: RING finger protein 5 [Eucalyptus grandis]
 gb|KCW88066.1| hypothetical protein EUGRSUZ_A00486 [Eucalyptus grandis]
Length=235

 Score =   251 bits (641),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 185/239 (77%), Gaps = 9/239 (4%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE S++RAP SPS SS+N N   DAGNFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGFGE-SSSRAPQSPSCSSNNNN---DAGNFECNICLDLAQDPIVTLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQR-PETA  525
            +WL +HS ++ECPVCKAL+EEEKLVPLYGRGK+S+DPRSKS+PG+ IPHRP GQR     
Sbjct  57   EWLRVHSQAQECPVCKALIEEEKLVPLYGRGKSSSDPRSKSVPGVNIPHRPAGQRPETAP  116

Query  526  APPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFP-SLFNIQLNGYPNSA  702
             PPP+ N F QHG GF GG GGFGPMATARFGNFT SAA GGLFP SLFN QL+G+P++A
Sbjct  117  PPPPEPNLFHQHGLGFRGGLGGFGPMATARFGNFTLSAAFGGLFPSSLFNFQLHGFPDAA  176

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQ---QADSNLKWLFLFIGITVILALIWN  870
             YG S GFPFGY +TFHGGH H    + +  +   Q D +LK L L I + V  AL  N
Sbjct  177  MYGASPGFPFGYPHTFHGGHHHHAHAYHHHPRGHGQQDVHLKMLLLVIAVCVAFALFLN  235



>ref|XP_002310781.1| hypothetical protein POPTR_0007s12280g [Populus trichocarpa]
 gb|EEE91231.1| hypothetical protein POPTR_0007s12280g [Populus trichocarpa]
Length=230

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 161/209 (77%), Gaps = 8/209 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LA+DPIVTLCGHL+CWPCLY+WLH+HSHS ECPVCKA+++EEKLVPLY
Sbjct  25   DAGDFECNICFELARDPIVTLCGHLYCWPCLYQWLHLHSHSHECPVCKAIIQEEKLVPLY  84

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG + +DPRSKS PG++IP RP+GQRPET APPPDAN  P       G  GG+ P A A
Sbjct  85   GRGNSQSDPRSKSYPGIDIPSRPSGQRPET-APPPDANNSPNF---GFGMAGGYMPTAAA  140

Query  613  RFGNFTFSAAVGGL--FPSLFNIQLNGYPNSANYGTSAGFPF--GYGNTFHGGHAHGFPQ  780
            R GNFTFS A GGL  FPS FN+Q  G+P++  YGT++GFP+     + FHG HAH FP 
Sbjct  141  RSGNFTFSTAFGGLSHFPSFFNVQFQGFPDATVYGTTSGFPYGFHGFHGFHGHHAHRFPP  200

Query  781  HTNQQQQADSNLKWLFLFIGITVILALIW  867
             T + Q+AD+ LK LF  IG  V++AL+W
Sbjct  201  ATIRGQRADNVLKNLFFLIGFLVVIALLW  229



>ref|XP_007223183.1| hypothetical protein PRUPE_ppa009193mg [Prunus persica]
 gb|EMJ24382.1| hypothetical protein PRUPE_ppa009193mg [Prunus persica]
Length=302

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ST+R    PS SSSN NN  DAGNFECNIC DLAQDPIVTLCGHLFCWPCLY
Sbjct  67   MASGFGE-STSRPSQGPSYSSSNNNNS-DAGNFECNICLDLAQDPIVTLCGHLFCWPCLY  124

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWLHIHSHS+ECPVCKAL++EE LVPLYGRGK STDPRSK+IPG+ IP+RP GQRPETA 
Sbjct  125  KWLHIHSHSQECPVCKALIKEENLVPLYGRGKTSTDPRSKAIPGINIPNRPAGQRPETAP  184

Query  529  PPPDANAFPQ--HgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSA  702
            PP   +  P+     G  GG GGF P+AT RFGNFTFSAA GGL PSL N QL+G+P++A
Sbjct  185  PPEPNHFPPRGFGFMGGLGGLGGFAPIATTRFGNFTFSAAFGGLIPSLLNFQLHGFPDAA  244

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ--QQQADSNLK  819
             YG +AGFP G+ N+F GGH H +  H     Q Q D  LK
Sbjct  245  MYGATAGFPHGFSNSFPGGHPHRYHIHRRATGQGQQDYFLK  285



>ref|XP_009621500.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
tomentosiformis]
 ref|XP_009621502.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
tomentosiformis]
 ref|XP_009621503.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
tomentosiformis]
 ref|XP_009621504.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
tomentosiformis]
Length=220

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 151/204 (74%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++EEKLVPLY
Sbjct  22   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEEKLVPLY  81

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK I G+EIP+RP GQRPET AP P +N  P       G  GGF P ATA
Sbjct  82   GRGRTSTDPRSKPISGLEIPNRPAGQRPET-APQPQSNNIPN---LGFGHMGGFFPTATA  137

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT SA  GGLFPSL + Q +G+P    Y T++ +PFGY   +HG H       T  
Sbjct  138  RFGNFTMSAGFGGLFPSLLSFQFHGFPGPTAYPTTSNYPFGYTPAYHGPHVRNAQDTT--  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QADSN+K++FL +G  V++ L+
Sbjct  196  QVQADSNIKFMFLLVGFLVLIYLL  219



>ref|XP_006338276.1| PREDICTED: RING finger protein 5-like [Solanum tuberosum]
Length=220

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS   ECPVCKAL++EEKLVPLY
Sbjct  22   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQCHECPVCKALIQEEKLVPLY  81

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK IPG+EIP+RP GQRPET AP P+ N FP H     G  GG  P ATA
Sbjct  82   GRGRTSTDPRSKPIPGLEIPNRPAGQRPET-APQPEPNHFPNH---GFGHMGGLFPTATA  137

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT SA  GGL PSL + Q +G P    Y T++  PFGY   +HG H          
Sbjct  138  RFGNFTMSAGFGGLLPSLLSFQFHGIPGPTAYPTASNHPFGYTPAYHGPHVRN--AQDTA  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QADSNLK +FL +G  V++ L+
Sbjct  196  QGQADSNLKLMFLLVGFLVLIYLL  219



>ref|XP_007017451.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY14676.1| RING/U-box superfamily protein [Theobroma cacao]
Length=287

 Score =   251 bits (641),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MA GFGE ++       S S S+ N   DAGNFECNICFDLAQDPIVTLCGHLFCWPCLY
Sbjct  1    MAGGFGESASR---SPQSPSCSSNNANGDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  57

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            KWL+IHS S ECPVCKAL+EEEKLVPLYGRGK+S+DPRSKSIPG+ IP+RP GQRPET A
Sbjct  58   KWLNIHSRSHECPVCKALIEEEKLVPLYGRGKSSSDPRSKSIPGVNIPNRPAGQRPET-A  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP+ N FPQ+G GF GG GGF PMATARFGNFT SAA GGL PSLFN+Q++G+P++A +
Sbjct  117  PPPEPNQFPQNGLGFMGGLGGFAPMATARFGNFTLSAAFGGLIPSLFNLQVHGFPDAAMF  176

Query  709  GTSAGFP  729
            G +AG P
Sbjct  177  GAAAGQP  183



>ref|XP_009623673.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
tomentosiformis]
Length=220

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 150/204 (74%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICFDLAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKA ++EEKLVPLY
Sbjct  21   DAGDFECNICFDLAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKAFIQEEKLVPLY  80

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK IPG+EIP RP GQRPET APPP +NAFP       G  GGF P ATA
Sbjct  81   GRGRTSTDPRSKPIPGVEIPSRPAGQRPET-APPPVSNAFPN---LGFGHVGGFFPGATA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
             FGNFT SA  GGLFPSLF+ Q +G+PN   +G ++ +PFGY   +   + H   +    
Sbjct  137  SFGNFTMSAGFGGLFPSLFSFQFHGFPNLTAFGATSNYPFGYPPAYRQMNVHNAARPA--  194

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QAD+NLK +FL +G  V L L 
Sbjct  195  QGQADNNLKLMFLLVGFLVFLCLF  218



>ref|XP_004233408.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Solanum lycopersicum]
Length=221

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 150/204 (74%), Gaps = 5/204 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++E+KLVPLY
Sbjct  21   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEQKLVPLY  80

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK +PG+EIP RP GQRPET APPP++N FP       G  GG  P ATA
Sbjct  81   GRGRTSTDPRSKPVPGVEIPRRPAGQRPET-APPPESNTFPN---PGFGLMGGLFPGATA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
             FGNFT SA  GGLFPSL + Q NG+   A +G +  + FGY   +HG + H    H + 
Sbjct  137  SFGNFTMSAGFGGLFPSLLSFQFNGFQGPAAFGAAPNYAFGYPPAYHGVNVHNAAAHPS-  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QAD+NLK++FL +G  V L L 
Sbjct  196  QGQADNNLKFMFLLVGFLVFLYLF  219



>ref|XP_010459594.1| PREDICTED: RING finger protein 5-like [Camelina sativa]
Length=231

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 6/191 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+GNFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKAL+EE++LVPLY
Sbjct  20   DSGNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKECPVCKALIEEDRLVPLY  79

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPP-PDANAFPQHgfgftggfggfgPMAT  609
            GRGK+S DPRSKSIPG+E+P+RP+GQRPETA PP P+      H        G   PMA+
Sbjct  80   GRGKSSADPRSKSIPGLEVPNRPSGQRPETALPPDPNHGFAHHHHGFGGFMGGFAAPMAS  139

Query  610  ARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGG---HAHGF  774
            ARFGN T SA  GGL PSLFN+  +G+PN+A YG +A   FP G+ N FHGG   H H +
Sbjct  140  ARFGNVTLSATFGGLIPSLFNLHFHGFPNAAMYGAAASGSFPHGFSNPFHGGGHSHMHSY  199

Query  775  PQHTNQQQQAD  807
             +HT   +Q D
Sbjct  200  QRHTGLDRQQD  210



>ref|XP_009149406.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Brassica rapa]
 emb|CDY26683.1| BnaA06g13390D [Brassica napus]
Length=227

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 155/212 (73%), Gaps = 7/212 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+ NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLH+HS S ECPVCKA+++E++LVPLY
Sbjct  17   DSSNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHLHSTSSECPVCKAVIQEDRLVPLY  76

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK+STDPRSKSIPG+++P+RP+GQRPETA  PP+ N    H        G   P+A+A
Sbjct  77   GRGKSSTDPRSKSIPGIQVPNRPSGQRPETAQ-PPEPNHGFGHHGFGGFMGGFAAPVASA  135

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPN----SANYGTSAGFPFGYGNTFHGGHA--HGF  774
            RFGN T  AA GGL PSLFN+  +G+P+     A    S  FP G+ N FHGGH+  H +
Sbjct  136  RFGNVTLPAAFGGLIPSLFNLHFHGFPDAAMYGAAAAASGSFPHGFSNPFHGGHSHMHSY  195

Query  775  PQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
             ++T +Q Q D +LK L  F+ + V+ +LI +
Sbjct  196  QRYTGRQGQQDYHLKALLCFVFMVVVFSLILS  227



>ref|XP_008338889.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Malus domestica]
Length=227

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 166/233 (71%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE +       P S S +GNN +D G+FECNICF+LAQDPI+T CGHLFCWPCLY
Sbjct  1    MASGFGESTX----VPPQSVSCSGNNANDVGDFECNICFELAQDPIITRCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS+S+ECP CKAL+EEEKLVPLYGRGK  TDPRSKS PG+ IP+RP+GQRP TA 
Sbjct  57   RWLHHHSNSQECPFCKALIEEEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSGQRPPTAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
                     Q      G  GGF PMAT R GNFT + A GGL PSL N+Q +G+P++  Y
Sbjct  117  ----PPNTNQFANYGFGFMGGFVPMATQRIGNFTLATAFGGLLPSLLNVQYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFPF   N+FHGGH HGF Q  N Q Q     K+ F FIG+ VI+A+I+
Sbjct  173  GTTSGFPFAPFNSFHGGHGHGFVQPENHQWQPADVWKYFFXFIGVFVIVAVIF  225



>ref|XP_007047046.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 10 [Theobroma cacao]
 gb|EOX91203.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 10 [Theobroma cacao]
Length=253

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/291 (52%), Positives = 183/291 (63%), Gaps = 48/291 (16%)
 Frame = -1

Query  2269  SYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSG  2090
             +YCV E K CV WV ++FKDCLCNL D+ SF  G++SL+CWGVAEIPQI+TNFK KSS G
Sbjct  4     AYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSSHG  63

Query  2089  VSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC  1910
             VSL FL TW+ GDVFNLVGC+LEPATLPTQF+TALLYT +T+VLVLQ IYYD+   WWKC
Sbjct  64    VSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTALLYTTSTLVLVLQTIYYDNVYRWWKC  123

Query  1909  RDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTHYYFTSARTLASSDTPTYCYIMARS  1730
             R   T  + ++E++ LK                                        A S
Sbjct  124   RRIKTDNMVEDEKKPLKPGK-------------------------------------ADS  146

Query  1729  GPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf-laaaAHFPVGGKSLIME  1553
             G P  +    ++   E+          +QPR IPRA A     LAA+ + P+G K+  ME
Sbjct  147   GIPIPKPSPKANPRGES---------GTQPRPIPRAAASYGTFLAASVNLPLGSKAW-ME  196

Query  1552  AQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVE  1400
             A+T F  RRLLQE   + S  GQWLGWLMAAIYMGGR+PQIWLNIKRG+VE
Sbjct  197   ARTGFTSRRLLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  247



>ref|XP_010526738.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like isoform X2 
[Tarenaya hassleriana]
Length=231

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 156/209 (75%), Gaps = 7/209 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G FECNICF+LAQDPI+TLCGHLFCWPCLY+WLH HSHS+E PVCKALV+E+KLVPLY
Sbjct  23   DQGGFECNICFELAQDPIITLCGHLFCWPCLYRWLHHHSHSQEWPVCKALVQEDKLVPLY  82

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGKN TDPRSKS PGM+IP RPTGQRPETA PPP  +          G  GGF PMA+ 
Sbjct  83   GRGKNQTDPRSKSYPGMQIPSRPTGQRPETAPPPPPRHEPNSFFGAGIGSMGGFMPMAST  142

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGGHAHGFPQHTN  789
              GNFT    +GGL+PSLFN Q +G+P++  +G++ G PF G+ N FHGGHAHGFP   N
Sbjct  143  SIGNFTM--GIGGLWPSLFNFQFHGFPDATFFGSTMGHPFGGFHNDFHGGHAHGFPSRNN  200

Query  790  QQ----QQADSNLKWLFLFIGITVILALI  864
                   QAD+ LK LF+ IG+ V++AL+
Sbjct  201  PMANGGHQADAALKNLFIIIGVCVLIALL  229



>ref|XP_004232094.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Solanum lycopersicum]
Length=220

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY+WL +HS   ECPVCKAL++EEKLVPLY
Sbjct  22   DAGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLRLHSQCHECPVCKALIQEEKLVPLY  81

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK IPG+EIP RP GQRPET AP P+ N FP H     G  GG  P ATA
Sbjct  82   GRGRTSTDPRSKPIPGLEIPSRPAGQRPET-APQPEPNHFPNH---GFGHMGGLFPTATA  137

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNFT SA  GGL PSL + Q +G+P    Y T++   FGY   +HG H          
Sbjct  138  RFGNFTMSAGFGGLLPSLLSFQFHGFPGPTAYPTASNHHFGYTPAYHGPHVRN--AQDTA  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QADSNLK +FL +G  V++ L+
Sbjct  196  QGQADSNLKLMFLLVGFLVLIYLL  219



>ref|XP_010531190.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Tarenaya 
hassleriana]
Length=232

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 161/214 (75%), Gaps = 14/214 (7%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G+FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+E+KLVPLY
Sbjct  23   DQGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQEDKLVPLY  82

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPP--DANAFPQHgfgftggfggfgPMA  606
            GRGKN +DPRSKS PGM+IP+RP GQRPETAA  P  + N+F  +     G  GGF PMA
Sbjct  83   GRGKNQSDPRSKSYPGMQIPNRPAGQRPETAAAAPQQEPNSFFSY---GFGSMGGFMPMA  139

Query  607  TARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGG---HAHGF  774
            T R GNFT    +GGL+PSLFN Q +G+P++  YG+++G+P+ G+     GG   H HG+
Sbjct  140  TTRIGNFTM--GIGGLWPSLFNFQFHGFPDATVYGSTSGYPYGGFHQGLRGGVGIHGHGY  197

Query  775  PQH---TNQQQQADSNLKWLFLFIGITVILALIW  867
            P +        QAD+ LK LF+ IGI VI+AL++
Sbjct  198  PNNHPMARGGHQADAALKNLFIIIGICVIMALVF  231



>ref|XP_009762035.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Nicotiana 
sylvestris]
Length=220

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 153/205 (75%), Gaps = 8/205 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++EEKLVPLY
Sbjct  21   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEEKLVPLY  80

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK IPG+EIP+RP GQRPET APPP +NAFP       G  GGF P A+A
Sbjct  81   GRGRTSTDPRSKPIPGVEIPNRPAGQRPET-APPPVSNAFPN---LGFGHVGGFFPGASA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTN-  789
             FGNFT SA  GGLFPSLF+ Q +G+P+   +G ++ +PFGY   + G +    P  +  
Sbjct  137  SFGNFTMSAGFGGLFPSLFSFQFHGFPSPTAFGATSNYPFGYHPAYRGANV---PNASRP  193

Query  790  QQQQADSNLKWLFLFIGITVILALI  864
             Q QAD+NLK +FL +G  V L L 
Sbjct  194  AQGQADNNLKLMFLLVGFLVFLCLF  218



>emb|CDY71750.1| BnaCnng74270D [Brassica napus]
Length=227

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 153/212 (72%), Gaps = 7/212 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+ NFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS S ECPVCKA+++E++LVPLY
Sbjct  17   DSSNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSTSSECPVCKAVIQEDRLVPLY  76

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK+STDPRSKSIPG+++P+RP+GQRPETA  PP+ N    H        G   P+ +A
Sbjct  77   GRGKSSTDPRSKSIPGIQVPNRPSGQRPETAQ-PPEPNHGFGHHGFGGFMGGFAAPVGSA  135

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPN----SANYGTSAGFPFGYGNTFHGGHA--HGF  774
            RFGN T  AA GGL PSLFN+  +G+P+     A    S  FP G+ N FHGGH+  H +
Sbjct  136  RFGNVTLPAAFGGLIPSLFNLHFHGFPDAAMYGAAATASGSFPHGFSNPFHGGHSHMHSY  195

Query  775  PQHTNQQQQADSNLKWLFLFIGITVILALIWN  870
             ++T +Q Q D +LK L  F+ + V+ +LI +
Sbjct  196  QRYTGRQGQQDYHLKALLCFVFMVVVFSLILS  227



>ref|XP_004141954.1| PREDICTED: E3 ubiquitin-protein ligase RMA1H1-like [Cucumis sativus]
 ref|XP_004157859.1| PREDICTED: E3 ubiquitin-protein ligase RMA1H1-like [Cucumis sativus]
 gb|KGN48448.1| hypothetical protein Csa_6G487690 [Cucumis sativus]
Length=229

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 169/233 (73%), Gaps = 5/233 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MA+ FGE ++        S++S+  N +D G+FECNICF+LAQDPI+TLCGHLFCWPCLY
Sbjct  1    MANEFGESTSMPHQNPSCSTNSDTTNNNDTGDFECNICFELAQDPIITLCGHLFCWPCLY  60

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS  +ECPVCKAL++EEKLVPLYGRGK  +DPR  + PG++IP+RP GQRP+TA 
Sbjct  61   RWLHHHSQCQECPVCKALIQEEKLVPLYGRGKIPSDPRLNTYPGLDIPNRPAGQRPQTAP  120

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
                            G  GGF PMA+AR GNFT + A GGL PSLFNIQ +G+P++  Y
Sbjct  121  ----PPVPNNFPNYGFGFAGGFMPMASARIGNFTLATAFGGLIPSLFNIQFHGFPDATVY  176

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++G+P+ + NTFHGGH H FPQ + + Q AD+ LK L L +G+ VILAL+W
Sbjct  177  GTTSGYPYAF-NTFHGGHGHHFPQPSTRGQHADNVLKNLLLLVGVFVILALLW  228



>gb|KHG22269.1| RING finger 5 [Gossypium arboreum]
Length=228

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 172/234 (74%), Gaps = 8/234 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE ST+R PPSP  S S  N   DAG FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MGSGFGE-STSRLPPSPPCSGSTDNAN-DAGGFECNICFELAQDPIVTLCGHLFCWPCLY  58

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH H H  ECPVCKAL++EEKLVPLYGRGKN TDPRSK  PGMEIP+RPTGQRP TA 
Sbjct  59   RWLHHHCHCHECPVCKALIQEEKLVPLYGRGKNHTDPRSKLYPGMEIPNRPTGQRPATAP  118

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
              P        G    G  GGF PMAT R GNFT     GGL PSLFNIQ +G+P++  Y
Sbjct  119  --PPPPEANPFGNYRFGLMGGFVPMATTRIGNFTM--GFGGLLPSLFNIQSHGFPDATVY  174

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQ-HTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFPFGY NT HG H HGFPQ  T + QQAD+ LK L L IG+ V+LAL++
Sbjct  175  GTTSGFPFGY-NTVHGSHPHGFPQPPTTRGQQADNVLKNLLLLIGVFVVLALLY  227



>ref|XP_002284651.1| PREDICTED: E3 ubiquitin-protein ligase RNF5 [Vitis vinifera]
 emb|CAN60863.1| hypothetical protein VITISV_016726 [Vitis vinifera]
Length=229

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 155/207 (75%), Gaps = 5/207 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G+FECNICF+LAQDPIVTLCGHLFCWPCLY+WLHIHSHS ECPVCKALV+EEKLVPLY
Sbjct  25   DTGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLHIHSHSHECPVCKALVQEEKLVPLY  84

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK  +DPRS+S+PG+ IP+RP GQRPE  AP PD N FP       G  GGF PMA+A
Sbjct  85   GRGKTPSDPRSRSVPGINIPNRPAGQRPE-VAPRPDVNHFPP--PQGYGFMGGFMPMASA  141

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNT-FHGGHAHGFPQHTN  789
            RFGN T SAA GGL PSL N+ ++G+ ++  YGT++GFP+G+ N+   G        H +
Sbjct  142  RFGNLTLSAAFGGLIPSLLNLHVHGFHDATVYGTTSGFPYGFSNSFHGGHAHGFHHHHAS  201

Query  790  QQQQAD-SNLKWLFLFIGITVILALIW  867
               Q+D S +K   LFIG+ VI++LIW
Sbjct  202  HAHQSDFSFMKRCLLFIGLLVIISLIW  228



>gb|ACU22874.1| unknown [Glycine max]
Length=205

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 154/205 (75%), Gaps = 6/205 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            M SGFGE +   AP    S +S+     DAG+FECNICFDLAQDP++TLCGHLFCWPCLY
Sbjct  1    MTSGFGESTRASAPSPSCSGNSSN----DAGDFECNICFDLAQDPVITLCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKALV+EEKLVPLYGRGK  TDPR+KS PGMEIPHRP+GQ P+TA 
Sbjct  57   RWLHHHSHSQECPVCKALVQEEKLVPLYGRGKTQTDPRTKSYPGMEIPHRPSGQGPQTAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
            PPP   A P  G    G  GGF PMATARFGNFT S A GG  PSL NI  +G+ ++  Y
Sbjct  117  PPPPPEANP-FGSYGFGLMGGFIPMATARFGNFTLSTAFGGFIPSLLNIHFHGFQDATVY  175

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQH  783
            GT++G+PFG+ N FHGG+  GF Q 
Sbjct  176  GTTSGYPFGF-NGFHGGNTRGFTQQ  199



>emb|CAJ13712.1| putative zinc finger protein [Capsicum chinense]
Length=220

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +H    ECPVCKAL++EEKLVPLY
Sbjct  22   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHPQCHECPVCKALIQEEKLVPLY  81

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+  TDPRSK IPG+EIP RP GQRPET AP P+ N FP       G  GGF P ATA
Sbjct  82   GRGRTFTDPRSKPIPGLEIPSRPAGQRPET-APQPEPNNFPN---LGFGHMGGFFPTATA  137

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
            RFGNF+  A  GGL PSL + Q +G+P    Y T++  PFGY   +HG H      H   
Sbjct  138  RFGNFSMFAGFGGLLPSLLSFQFHGFPGPTAYPTTSNHPFGYTPAYHGAHVRN--AHDTA  195

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QADSNLK++FL +G  V++ L+
Sbjct  196  QVQADSNLKFMFLLVGFLVLIYLL  219



>gb|ACN63363.1| RING zinc finger protein 1 [Capsicum annuum]
Length=219

 Score =   243 bits (619),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HS S ECPVCKAL++EEKLVPLY
Sbjct  21   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRLHSQSHECPVCKALIQEEKLVPLY  80

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRG+ STDPRSK +PG+EIP RP GQRPET APPP++N FP       G  GG  P ATA
Sbjct  81   GRGRTSTDPRSKPVPGVEIPRRPAGQRPET-APPPESNTFPN---SGFGLMGGLFPGATA  136

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQ  792
             FGNFT SA  GG  PSL + Q +G+P    +GT+  + +GY   +HG +       +  
Sbjct  137  SFGNFTMSAGFGGFIPSLLSFQFHGFPGPTAFGTTPNYQYGYPPAYHGANVQNAAHPS--  194

Query  793  QQQADSNLKWLFLFIGITVILALI  864
            Q QAD+NLK++FL +G  V L L 
Sbjct  195  QGQADNNLKFMFLLVGFLVFLYLF  218



>ref|XP_010477138.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Camelina 
sativa]
Length=234

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 148/197 (75%), Gaps = 11/197 (6%)
 Frame = +1

Query  259  GNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGR  438
            GNFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH+HS SKECPVCKA +EE++LVPLYGR
Sbjct  22   GNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKECPVCKAAIEEDRLVPLYGR  81

Query  439  GKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDAN---AFPQHgfgftggfggfgPMAT  609
            GK+S DPRSKSIPG+E+P+RP+GQRPET   PPD N   A   H        G   PMA+
Sbjct  82   GKSSADPRSKSIPGLEVPNRPSGQRPETTQ-PPDPNHGFAHHHHHGFGGFMGGFAAPMAS  140

Query  610  ARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSA--GFPFGYGNTFHGG---HAHGF  774
            ARFGN T SA+ GGL PSLFN+  +G+PN+A YG +A   FP G+ N FHGG   H H +
Sbjct  141  ARFGNVTLSASFGGLIPSLFNLHFHGFPNAAMYGAAASGSFPHGFSNPFHGGGHSHMHSY  200

Query  775  PQHT--NQQQQADSNLK  819
             +HT  +QQ+Q D +LK
Sbjct  201  QRHTGLHQQRQQDHHLK  217



>ref|XP_009381286.1| PREDICTED: RING finger protein 5-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 144/202 (71%), Gaps = 8/202 (4%)
 Frame = +1

Query  262  NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRG  441
            NFECNICF+LA+DP+VT CGHLFCWPCLY+WLH HSHS ECPVCKA+VEE+ L+PLYGRG
Sbjct  31   NFECNICFELARDPVVTRCGHLFCWPCLYRWLHGHSHSSECPVCKAIVEEKMLIPLYGRG  90

Query  442  KNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFG  621
             NS DPRSKS+P M IP RP GQRP  +AP PD N F          F G  PMA+ RFG
Sbjct  91   DNSIDPRSKSVPDMNIPQRPAGQRP-ASAPQPDPNQF----QYTNPWFMGGAPMASTRFG  145

Query  622  NFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
            + TFSAA+ GLFP L +  ++G+P+S  YG  A  P  Y N FHGGH HGFP+  +  QQ
Sbjct  146  SLTFSAAIAGLFP-LLSFHVHGFPDSTAYGPVAATP--YYNGFHGGHVHGFPRQAHHGQQ  202

Query  802  ADSNLKWLFLFIGITVILALIW  867
            AD  LK L   +G  VI++L+W
Sbjct  203  ADVYLKALLFLVGALVIVSLVW  224



>ref|XP_010429331.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Camelina 
sativa]
Length=226

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = +1

Query  256  AGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYG  435
             G+FECNICF++AQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKA+V+++KLVPLYG
Sbjct  23   GGDFECNICFEIAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKAVVQDDKLVPLYG  82

Query  436  RGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATAR  615
            RGKN TDPRSK  PGM IP+RP GQRPETAAPPP  +A         G  GGF PMAT R
Sbjct  83   RGKNQTDPRSKRYPGMRIPNRPAGQRPETAAPPPQGDAASNFFNYGIGLMGGFMPMATTR  142

Query  616  FGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQH---T  786
             GN  FS   GGL PSLFN Q +G+P++  YG++ G+  GY N F G   HG   H    
Sbjct  143  IGN--FSMGFGGLLPSLFNFQFHGFPDATFYGSAPGYG-GYHNDFRGVPTHGQEHHHPMA  199

Query  787  NQQQQADSNLKWLFLFIGITVILALIW  867
                 +D+ LK L L +GI V++ L W
Sbjct  200  RGGNHSDATLKNLLLVVGICVVIFLCW  226



>ref|XP_006856127.1| hypothetical protein AMTR_s00059p00153580 [Amborella trichopoda]
 gb|ERN17594.1| hypothetical protein AMTR_s00059p00153580 [Amborella trichopoda]
Length=235

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 166/238 (70%), Gaps = 10/238 (4%)
 Frame = +1

Query  166  NMASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCL  345
            N  S FG+ S       P S S +GN G DAGNFECNICF+LAQDPIVTLCGHLFCWPCL
Sbjct  3    NGTSSFGDESMRHYTKPPQSPSCSGNIGGDAGNFECNICFELAQDPIVTLCGHLFCWPCL  62

Query  346  YKWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETA  525
            YKWLH HS  ++CPVCKAL++EEKLVPLYGRGKN TDPRS+SI G  IP+RP GQRPET 
Sbjct  63   YKWLHNHSQCQDCPVCKALIQEEKLVPLYGRGKNQTDPRSRSILGTNIPNRPAGQRPET-  121

Query  526  APPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSAN  705
            APPPD    P H    T GF G  PMA +RFG+FTFSA   GLFP+LF  Q++G+P++  
Sbjct  122  APPPD----PNHMAHQTFGFMGGAPMAASRFGHFTFSAGF-GLFPALFGFQMHGFPDATA  176

Query  706  YGTSAGFPFGYGNTF----HGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            YG + GFP+G+ N F      GHAHGFP    Q QQ ++ L    L IG+ VI+   +
Sbjct  177  YGAAPGFPYGFSNPFHGGHVHGHAHGFPHPPTQAQQQEAMLSKYLLVIGLFVIICFAF  234



>emb|CAN72794.1| hypothetical protein VITISV_007472 [Vitis vinifera]
Length=258

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 161/233 (69%), Gaps = 11/233 (5%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE  +     SP+S +  G+  +D G+FECNICF+LAQDPIVTLCGHL+CWPCLY
Sbjct  1    MASGFGESES----MSPASGACGGSGSNDVGDFECNICFELAQDPIVTLCGHLYCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS+ECPVCKAL++EEKLVPLYGRGK  +DPRSKSIP   IP RP GQRPETA 
Sbjct  57   EWLHHHSHSQECPVCKALIQEEKLVPLYGRGKTPSDPRSKSIPNDSIPSRPAGQRPETA-  115

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
             PP AN          G   GF P+ TARFGNF  SAA G L PSLFNI ++G+P+   Y
Sbjct  116  -PPVANPVSH---LGVGLMRGFAPVRTARFGNFALSAAFGHLSPSLFNIHVHGFPDPRVY  171

Query  709  GTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQQADSNLKWLFLFIGITVILAL  861
            G + G+PF + N  HG  GH H FP   +Q+Q+ +  LK L LF     +L+ 
Sbjct  172  GATPGYPFWFSNAMHGGLGHMHRFPHPISQRQRTNYYLKNLLLFTDCGCMLSF  224



>ref|XP_002283534.1| PREDICTED: RING finger protein 5 isoform X2 [Vitis vinifera]
Length=171

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +1

Query  379  ECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQ  558
            ECPVCKALVEEEKLVPLYGRGK STDPRSKSIPG+ IP+RPTGQRPETA PPPDAN F Q
Sbjct  8    ECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGINIPNRPTGQRPETA-PPPDANHFMQ  66

Query  559  HgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGY  738
            HGFGF GG GGF PMATARFGNFT SAA GGLFPSLFN+Q++G+P++  YG +AGFP+G+
Sbjct  67   HGFGFMGGLGGFAPMATARFGNFTLSAAFGGLFPSLFNLQVHGFPDATMYGPAAGFPYGF  126

Query  739  GNTFHGGHAHGFPQH-TNQQQQADSNLKWLFLFIGITVILALIWN  870
             N+FHGGHAHGFPQH   Q QQAD  LK LFL IG+ VI+ALIW+
Sbjct  127  SNSFHGGHAHGFPQHPPTQGQQADYYLKMLFLMIGVFVIIALIWS  171



>ref|XP_010023553.1| PREDICTED: lysosomal amino acid transporter 1 homolog [Eucalyptus 
grandis]
Length=417

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 229/403 (57%), Gaps = 57/403 (14%)
 Frame = -1

Query  2281  GVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNK  2102
             G ++  C   R  C  W  KY + CLC+  D +S  +G++S+I WGVAEIPQIVTN+K K
Sbjct  5     GNDMPQCPASRH-CTRWARKYMQYCLCSTRDGVSLSLGVVSVISWGVAEIPQIVTNYKQK  63

Query  2101  SSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLP  1922
             S+ G+S+AFL TW++GDVFNL GC+LEPATLPTQ++ A+LYT TT+VL  QA+YY H  P
Sbjct  64    SAEGLSIAFLMTWVVGDVFNLFGCMLEPATLPTQYYMAVLYTVTTMVLTGQAVYYGHVCP  123

Query  1921  WWK-----CRDKNTILV-------KDNEREALKQRSRHHR--------------------  1838
             W K     C+    I +       K N + ++K+ +   R                    
Sbjct  124   WLKYRRPFCKGPKPIQIESAGNDSKSNCKVSMKEANSSERLQNGSDTIDRQSVLSSPIPL  183

Query  1837  -TAPAVEVPCQTHYYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSS  1664
               +P    P    YY  SAR+L+SS TPT   Y   R  P     +AD+    E   L+ 
Sbjct  184   PASPTNASPGNGLYY-VSARSLSSSHTPTAGSYFPLRMSP----NNADNEGTIEEPLLAG  238

Query  1663  SQKPVSQPRSIPRataygtflaaaAHF---------PVGGKSLIMEAQTKF--AGRRLLQ  1517
                  S P   P+       ++A   F          V   S+  +   +    GR+LLQ
Sbjct  239   DLSEQSAPS--PKTKNMLCLVSAVTFFGTFNLPNPLKVRASSVSRKQSGRVIQVGRKLLQ  296

Query  1516  EHE---FDSSVA-GQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATY  1349
               E   F   V  G +LGW MAAIYMGGR+PQI LNI+RG+VEGLNPLMF+F LI N TY
Sbjct  297   VDEGNGFSGHVGVGSFLGWAMAAIYMGGRLPQICLNIRRGNVEGLNPLMFLFALIGNITY  356

Query  1348  VGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTH  1220
             V SILVRS +W K++ N+PWL+DA  CV+LD+ I++Q++Y+++
Sbjct  357   VASILVRSLDWSKIRPNLPWLVDAAGCVLLDILILIQFIYFSY  399



>tpg|DAA57466.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=226

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  26   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  85

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            NST PR++S+ G+EIP RPTGQRP TA  P  +N +P           G  P+A  R+GN
Sbjct  86   NSTSPRARSVAGVEIPSRPTGQRPSTAPQPDHSNHYPPQ--NPWFMGAGAPPVAGGRWGN  143

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQ  798
            +TFSAA+GGLFP L + Q++G+P  + YG +AGFP+GYG++FHG  GH +GFP+   Q Q
Sbjct  144  YTFSAAIGGLFP-LLSFQVHGFPQVSAYGPAAGFPYGYGHSFHGWHGHGYGFPRQAPQGQ  202

Query  799  QADS  810
            Q D+
Sbjct  203  QVDA  206



>gb|ACR37583.1| unknown [Zea mays]
 tpg|DAA57465.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=247

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  47   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  106

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            NST PR++S+ G+EIP RPTGQRP TA  P  +N +P           G  P+A  R+GN
Sbjct  107  NSTSPRARSVAGVEIPSRPTGQRPSTAPQPDHSNHYPPQ--NPWFMGAGAPPVAGGRWGN  164

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQ  798
            +TFSAA+GGLFP L + Q++G+P  + YG +AGFP+GYG++FHG  GH +GFP+   Q Q
Sbjct  165  YTFSAAIGGLFP-LLSFQVHGFPQVSAYGPAAGFPYGYGHSFHGWHGHGYGFPRQAPQGQ  223

Query  799  QADSNLKWLFLFIGITVILALI  864
            Q D+ LK L L +G+ VI +LI
Sbjct  224  QVDAYLKVLLLVVGVLVIASLI  245



>gb|ABK21979.1| unknown [Picea sitchensis]
 gb|ABR17325.1| unknown [Picea sitchensis]
Length=240

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC +LAQDPIVTLCGHLFCWPCLYKWLH HS S+ECPVCKALVEE+K+VPLYGRGK
Sbjct  42   FECNICLELAQDPIVTLCGHLFCWPCLYKWLHGHSKSQECPVCKALVEEDKIVPLYGRGK  101

Query  445  -NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFG  621
              + DPRSK+IPG+ IPHRP G+RPET AP P  N F Q    F    GG  PM  ARFG
Sbjct  102  VGAPDPRSKAIPGINIPHRPAGRRPET-APSPGPNLFQQQ--PFGFMGGGPAPMGAARFG  158

Query  622  NFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
            NFTFSA   GLFPSLF  Q++G+P+   YG + G+ +G+ N F GGH H F Q   ++Q+
Sbjct  159  NFTFSAGF-GLFPSLFGFQMHGFPDGVGYGAAPGYNYGFSNPFQGGHPHTFHQPMTREQE  217

Query  802  ADSNLKWLFLFIGITVILALIW  867
              + L    L IGI V++ LI+
Sbjct  218  QQAMLSKYLLIIGIFVVVCLIF  239



>ref|XP_008240655.1| PREDICTED: uncharacterized protein LOC103339143 isoform X2 [Prunus 
mume]
Length=395

 Score =   242 bits (617),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 227/375 (61%), Gaps = 23/375 (6%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFK  2108
             MGG+ +     E   C  W  KY +  LC++ D +S  +G+IS++ WGVAEIPQ++TN+K
Sbjct  7     MGGMAVGPTRDEH--CWEWGRKYMEYELCSVKDGVSLTLGLISVVSWGVAEIPQVITNYK  64

Query  2107  NKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHF  1928
             NKS+ G+SLAFL TWILGD+FNL GC+LEPATLPTQ++ A+LYT TT VL +Q IYY   
Sbjct  65    NKSTDGLSLAFLMTWILGDLFNLFGCMLEPATLPTQYYMAMLYTITTAVLAVQTIYYGCI  124

Query  1927  LPWWKCRDKNTILVKDNEREALKQRSRHHRTAPAVEVP--CQT-----HYYFTSARTLAS  1769
              P  K   +   +  D         S  +  +  + +P  C +       Y+ SAR+L+ 
Sbjct  125   YPRLKHNLRQKKVNHDGRSIGFDTPSAGNVLSSPIPLPGICPSISPGRESYYISARSLSR  184

Query  1768  SDTPTYCYIMARSGPPALQYDADSSSEDETVPLSSSQK-PVSQPRSIPRataygtflaaa  1592
             S TPT    +A++  P   +  +S+ E     L+S+   P +  +++    +  T     
Sbjct  185   SHTPTERSYLAQTTAPTFNHIRNSNEEPLLGALASTHSAPSNNIKTVLSVVSLMTLFGTF  244

Query  1591  AHFPVGGK-SLIMEAQTKF----AGRRLLQ--------EHEFDSSVAGQWLGWLMAAIYM  1451
              H  V  K  LI+E  ++      GRRLLQ        +   DSS  G  LGW MAAIY+
Sbjct  245   NHRSVDNKLDLIVENPSRGVVMRVGRRLLQVSSELLQAKGTKDSSRIGNLLGWGMAAIYI  304

Query  1450  GGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldava  1271
             GGR+PQI+LNI++G+VEGLNPLMFVF ++ NATYV SI+V S +W +++ N+PWL+D+  
Sbjct  305   GGRLPQIFLNIRKGNVEGLNPLMFVFAVLGNATYVTSIIVNSLDWSEIRPNLPWLVDSGG  364

Query  1270  cvvldLFIILQYLYY  1226
             C++LD+FI++Q+  Y
Sbjct  365   CMLLDIFILIQFFRY  379



>ref|XP_006404861.1| hypothetical protein EUTSA_v10000313mg [Eutrema salsugineum]
 gb|ESQ46314.1| hypothetical protein EUTSA_v10000313mg [Eutrema salsugineum]
Length=230

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 148/210 (70%), Gaps = 10/210 (5%)
 Frame = +1

Query  262  NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRG  441
            +FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+++KLVPLYGRG
Sbjct  23   DFECNICFELAQDPIVTLCGHLFCWPCLYQWLHHHSHSQECPVCKALVQDDKLVPLYGRG  82

Query  442  KNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDA-NAFPQHgfgftggfggfgPMATARF  618
            KN TDPR+K  PGM IP+RP GQRPETA+PPP    A         G  GGF PMAT R 
Sbjct  83   KNQTDPRTKRYPGMRIPNRPAGQRPETASPPPSQPEAASNFFNYGIGLMGGFMPMATTRI  142

Query  619  GNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGGHAHGFPQHTN--  789
            GNF+F   VGGL PSLFN Q +G+P++  YGT+  +P+ GY   F G   HG  +H    
Sbjct  143  GNFSF--GVGGLLPSLFNFQFHGFPDATLYGTTPVYPYGGYHTGFRGVPTHGQERHNQPM  200

Query  790  ----QQQQADSNLKWLFLFIGITVILALIW  867
                 Q Q+D+ LK L L IG  V++ L W
Sbjct  201  ARGGHQNQSDAFLKKLALLIGFCVLIFLCW  230



>ref|XP_004970087.1| PREDICTED: RING finger protein 5-like [Setaria italica]
Length=248

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  48   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  107

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
             S  PR++S+ G++IP RPTGQRP TA  P   N +P     F G   G  P+A  R+GN
Sbjct  108  TSAAPRARSVAGVQIPSRPTGQRPSTAPQPDHNNHYPHQNPWFMGAHAGGAPVAGGRWGN  167

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
            +TFSAA+GGLFP L + Q++G+P +  YG +AGFP+GYG++FHG H +GFP+   Q QQ
Sbjct  168  YTFSAAIGGLFP-LLSFQVHGFPQATAYGPAAGFPYGYGHSFHGWHGYGFPRQAPQGQQ  225



>gb|ACN35007.1| unknown [Zea mays]
Length=225

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  27   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  86

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +S  PR++S+ G+EIP RPTGQRP TA  P   N +P           G  P+A  R+G+
Sbjct  87   SSAVPRARSVAGVEIPSRPTGQRPSTAPQPDHNNHYPHQ--NPWFNGAGAPPVANGRWGS  144

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQA  804
            +TFSAA+GGLFP L + Q++G+P +  YG +AGFP+GYG++FHG H HGFP+   Q QQ 
Sbjct  145  YTFSAAIGGLFP-LLSFQVHGFPQATAYGPAAGFPYGYGHSFHGWHGHGFPRQAPQGQQV  203

Query  805  DS  810
            D+
Sbjct  204  DA  205



>ref|NP_001152268.1| LOC100285907 [Zea mays]
 gb|ACG46713.1| RING finger protein 5 [Zea mays]
Length=246

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  48   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  107

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +S  PR++S+ G+EIP RPTGQRP TA  P   N +P           G  P+A  R+G+
Sbjct  108  SSAVPRARSVAGVEIPSRPTGQRPSTAPQPDHNNHYPHQ--NPWFNGAGAPPLANGRWGS  165

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQA  804
            +TFSAA+GGLFP L + Q++G+P +  YG +AGFP+GYG++FHG H HGFP+   Q QQ 
Sbjct  166  YTFSAAIGGLFP-LLSFQVHGFPQATAYGPAAGFPYGYGHSFHGWHGHGFPRQAPQGQQV  224

Query  805  DS  810
            D+
Sbjct  225  DA  226



>gb|AFW84960.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=246

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  48   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  107

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +S  PR++S+ G+EIP RPTGQRP TA  P   N +P           G  P+A  R+G+
Sbjct  108  SSAVPRARSVAGVEIPSRPTGQRPSTAPQPDHNNHYPHQ--NPWFNGAGAPPVANGRWGS  165

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQA  804
            +TFSAA+GGLFP L + Q++G+P +  YG +AGFP+GYG++FHG H HGFP+   Q QQ 
Sbjct  166  YTFSAAIGGLFP-LLSFQVHGFPQATAYGPAAGFPYGYGHSFHGWHGHGFPRQAPQGQQV  224

Query  805  DS  810
            D+
Sbjct  225  DA  226



>ref|XP_010680923.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Beta vulgaris 
subsp. vulgaris]
Length=235

 Score =   235 bits (599),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 151/209 (72%), Gaps = 9/209 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            DAG+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL  HS S+ECPVCKALV+E+KLVPLY
Sbjct  27   DAGDFECNICFELAQDPIVTLCGHLYCWPCLYRWLRYHSQSQECPVCKALVQEDKLVPLY  86

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETA--APPPDANAFPQHgfgftggfggfgPMA  606
            GRGK++TDPRS+ +PG++IP+RP+GQRPETA   P PD N F        G  GGF PMA
Sbjct  87   GRGKSNTDPRSRPVPGIDIPNRPSGQRPETAPPPPGPDHNYFSN---LGFGFLGGFMPMA  143

Query  607  TARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGG----HAHGF  774
            TARFGN T SA  GG FPSL + Q NG+P++  YG + GFP+GY +T HG          
Sbjct  144  TARFGNMTMSAGFGGFFPSLLSFQFNGFPHNTMYGAAHGFPYGYPHTVHGNGMSHGHGYQ  203

Query  775  PQHTNQQQQADSNLKWLFLFIGITVILAL  861
              H +  Q  DS LK LF  IG  V++AL
Sbjct  204  HHHHSASQGQDSFLKKLFFIIGFCVLVAL  232



>gb|KCW56809.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=284

 Score =   236 bits (603),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 153/283 (54%), Positives = 194/283 (69%), Gaps = 13/283 (5%)
 Frame = -1

Query  2272  LSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             ++YC  E+K CV WV KYFKDCLCN  DE SF  G+ISL+CWGVAEIPQI+TNF+ KSS 
Sbjct  4     IAYCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSH  63

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
             GVSLAFL TW+ GDVFNLVGC+LEPATLPTQ++TALLYTA+TVVLVLQ++YYDH    WK
Sbjct  64    GVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTALLYTASTVVLVLQSLYYDHVYSLWK  123

Query  1912  CRDKNTILVKDNEREALKQRSRHH---------RTAPAVEVPCQTHYYFTSARTLASSDT  1760
              R       +  E+E LK ++ H            A  V+   +  +++TSAR+LA S T
Sbjct  124   GRHIKKPDPQAEEKEPLKPKATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGT  183

Query  1759  PTY-CYI-MARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAH  1586
             P +  YI +A+SGP  +  D+DSSS+DE   + S+ K VS+P+ IPR+  YGTFLA++  
Sbjct  184   PPFRTYIRVAKSGPSTVHLDSDSSSDDEAARVPST-KSVSKPKQIPRSVGYGTFLASSLT  242

Query  1585  FPVGGKSLIMEAQTKFAGRRLLQEHEFDSSVAGQWLGWLMAAI  1457
              P+  KS   EA    + R+LLQE   + S  GQW GWLMAAI
Sbjct  243   LPLQNKSFT-EAHVVLSTRKLLQEGGMEHSAIGQWFGWLMAAI  284



>ref|XP_011040657.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040658.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040659.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040660.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
Length=416

 Score =   241 bits (614),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 224/398 (56%), Gaps = 61/398 (15%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             + C  W   Y + CLCN+ D +S  +G+IS++ WGVAEIPQIVTN+K KS+ G+SLAFL 
Sbjct  13    QHCSRWARVYMEYCLCNMKDGVSLSLGMISVLSWGVAEIPQIVTNYKEKSTEGLSLAFLL  72

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC---RDKN  1898
             TWI+GD+FN+ GC+LEPATLPTQ++ A+LYT T+ +L  Q +YY H     K    R K 
Sbjct  73    TWIIGDLFNVFGCMLEPATLPTQYYMAVLYTMTSTLLTAQTVYYGHIYHRLKSNRRRPKG  132

Query  1897  TILVKDNEREALKQ-------------RSRHHRTAP------AVEVPCQT---------H  1802
              +     E   +KQ             + R+   AP      +  +P +T          
Sbjct  133   PVSSHSEEAGRIKQGNSDASAQVNSADKQRNEPAAPDGTNGLSSPIPFRTLPQKSSPERD  192

Query  1801  YYFTSARTLASSDTPTYCYIMA-RSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPR  1625
              Y+ SAR+L+SS TPT    +A R+ PP+  +   +S E+   PL          +S P 
Sbjct  193   LYYASARSLSSSHTPTVGSFLAQRTTPPS--FSIGNSIEE---PLLGED---VDTQSAPN  244

Query  1624  ataygtflaaaAHFPVGGKSLIMEAQTKF--------------AGRRLLQ-------EHE  1508
                       +    +G  +L   A ++                GR++LQ       E++
Sbjct  245   LNTKTMLCVVSVVTFLGTLNLHHSANSRLDRVFENKNQGIFIQVGRKILQTSSIMSHEND  304

Query  1507  FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVR  1328
              D +V G +LGW MAAIYMGGR+PQI LNIKRG VEGLNPLMFVF L  N TYV SILV 
Sbjct  305   IDGNVIGTFLGWSMAAIYMGGRLPQICLNIKRGKVEGLNPLMFVFALAGNITYVASILVD  364

Query  1327  STEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             S  W K++AN+PWL+DA  CV+LD  I+LQ++Y+ +++
Sbjct  365   SLAWSKIRANLPWLVDAGGCVLLDTCILLQFIYFRYRR  402



>gb|ACG36773.1| RING finger protein 5 [Zea mays]
Length=247

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  47   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  106

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            NST PR++S+ G+EIP RPTGQRP TA  P  +N +P           G  P+A  R+GN
Sbjct  107  NSTSPRARSVAGVEIPSRPTGQRPSTAPQPDHSNHYPPQ--NPWFMGAGAPPVAGGRWGN  164

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHG--GHAHGFPQHTNQQQ  798
            +TFSAA+GGLFP L + Q++ +P  + YG +AGFP+GYG++FHG  GH +GFP+   Q Q
Sbjct  165  YTFSAAIGGLFP-LLSFQVHVFPQVSAYGPAAGFPYGYGHSFHGWHGHGYGFPRQAPQGQ  223

Query  799  QADS  810
            Q D+
Sbjct  224  QVDA  227



>ref|XP_002322574.2| hypothetical protein POPTR_0016s02400g [Populus trichocarpa]
 gb|EEF04335.2| hypothetical protein POPTR_0016s02400g [Populus trichocarpa]
Length=403

 Score =   239 bits (611),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 221/393 (56%), Gaps = 61/393 (16%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y K CLC++ D +S  +G+IS++ WGVAEIPQI+TN+K KS+ G+SLAFL TW
Sbjct  8     CSQWARIYVKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITNYKEKSTEGLSLAFLLTW  67

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTILVK  1883
             I+GD+FN+ GC+LEPATLPTQ++ A+LYT TT VL  Q IYY H     K   +N   +K
Sbjct  68    IIGDLFNVFGCMLEPATLPTQYYMAVLYTITTSVLTAQTIYYGHIYHRLK---RNRRCIK  124

Query  1882  DNEREALKQ-------------RSRHHRTAP------AVEVPCQTHY---------YFTS  1787
               E   ++Q             + R+   +P      +  +P  T +         Y+ S
Sbjct  125   TEEAGRIRQGNSDAGAQVNNAGKQRNETASPDGTNGSSSPIPFPTLFQKSSPGRELYYMS  184

Query  1786  ARTLASSDTPTYCYIMA-RSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRatayg  1610
             AR+L+SS TP     +A R   P+  +   +S ED   PL       +  +S P      
Sbjct  185   ARSLSSSHTPAVGSFLAQRVASPS--FSMRNSIED---PLLGGD---ATTQSAPNLNTKT  236

Query  1609  tflaaaAHFPVGGKSLIMEAQTKFA--------------GRRLLQ-------EHEFDSSV  1493
                  +    +G  +L   A  + A              GR++LQ       E+  + S 
Sbjct  237   MLCVVSVVTLLGTLNLHQSANNRLARDFENKHQGFVIQVGRKILQASSRMSHENYSEGSG  296

Query  1492  AGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWE  1313
              G +LGW MAAIYMGGR+PQI+LNIKRG+VEGLNPLMFVF LI N TYV SILV S  W 
Sbjct  297   IGTFLGWSMAAIYMGGRLPQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVDSVAWS  356

Query  1312  KMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
             K+ AN+PWL+DA  CV+LD  I+LQ+ Y+ H++
Sbjct  357   KISANLPWLVDAGGCVLLDTCILLQFAYFRHRR  389



>ref|XP_006644765.1| PREDICTED: RING finger protein 5-like [Oryza brachyantha]
Length=224

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 4/179 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC +LAQDP+VTLCGHLFCWPCLY+WLH+H+HS ECPVCKA++EEEKLVPLYGRGK
Sbjct  27   FECNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSHECPVCKAVLEEEKLVPLYGRGK  86

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
             STDPRS+S+ G++IP RP GQRP T AP PD +             GG  P+A  R+GN
Sbjct  87   ASTDPRSRSVAGVQIPSRPAGQRPAT-APQPDHHN--HFPHHNPWIMGGGAPVAGGRWGN  143

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQ  801
            +TFSAA+GGLFP L + Q++G+P +A YG +AGFP+GYG++FHG H HGFP    Q Q 
Sbjct  144  YTFSAAIGGLFP-LLSFQVHGFPQAAAYGHAAGFPYGYGHSFHGWHGHGFPPQAPQGQH  201



>ref|XP_006294956.1| hypothetical protein CARUB_v10024012mg [Capsella rubella]
 gb|EOA27854.1| hypothetical protein CARUB_v10024012mg [Capsella rubella]
Length=224

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 151/207 (73%), Gaps = 4/207 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G+FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKA+V+++KLVPLY
Sbjct  20   DQGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKAVVQDDKLVPLY  79

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGKN TDPRSK  PGM IP+RP+GQRPETAAPPP   A         G  GGF PMAT 
Sbjct  80   GRGKNQTDPRSKHYPGMRIPNRPSGQRPETAAPPPQPEAASNFFNYGIGLMGGFMPMATT  139

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGGHAHGFPQ-HT  786
            R GN  FS   GGL PSLFN Q +G+P++  YG++ G+P+ GY N F G   HG  +   
Sbjct  140  RIGN--FSMGFGGLLPSLFNFQFHGFPDATLYGSAPGYPYGGYHNGFRGVPTHGQERPMA  197

Query  787  NQQQQADSNLKWLFLFIGITVILALIW  867
                Q+D+ LK L +F+GI V++ L W
Sbjct  198  RGANQSDTMLKNLLIFVGICVLIFLCW  224



>ref|XP_008240654.1| PREDICTED: uncharacterized protein LOC103339143 isoform X1 [Prunus 
mume]
Length=415

 Score =   239 bits (610),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 158/395 (40%), Positives = 230/395 (58%), Gaps = 43/395 (11%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFK  2108
             MGG+ +     E   C  W  KY +  LC++ D +S  +G+IS++ WGVAEIPQ++TN+K
Sbjct  7     MGGMAVGPTRDEH--CWEWGRKYMEYELCSVKDGVSLTLGLISVVSWGVAEIPQVITNYK  64

Query  2107  NKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYY---  1937
             NKS+ G+SLAFL TWILGD+FNL GC+LEPATLPTQ++ A+LYT TT VL +Q IYY   
Sbjct  65    NKSTDGLSLAFLMTWILGDLFNLFGCMLEPATLPTQYYMAMLYTITTAVLAVQTIYYGCI  124

Query  1936  ----DHFLPWWKCRDKNTILVKDNEREALKQRSRHHRTAPAVEVPCQTHY----------  1799
                  H L   K    N   V+ +  + + ++  H   +   + P   +           
Sbjct  125   YPRLKHNLRQKKGSKSNLTEVRRSNTDFVGKQVNHDGRSIGFDTPSAGNVLSSPIPLPGI  184

Query  1798  ----------YFTSARTLASSDTPTYCYIMARSGPPALQYDADSSSEDETVPLSSSQK-P  1652
                       Y+ SAR+L+ S TPT    +A++  P   +  +S+ E     L+S+   P
Sbjct  185   CPSISPGRESYYISARSLSRSHTPTERSYLAQTTAPTFNHIRNSNEEPLLGALASTHSAP  244

Query  1651  VSQPRSIPRataygtflaaaAHFPVGGK-SLIMEAQTKFA----GRRLLQ--------EH  1511
              +  +++    +  T      H  V  K  LI+E  ++      GRRLLQ        + 
Sbjct  245   SNNIKTVLSVVSLMTLFGTFNHRSVDNKLDLIVENPSRGVVMRVGRRLLQVSSELLQAKG  304

Query  1510  EFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILV  1331
               DSS  G  LGW MAAIY+GGR+PQI+LNI++G+VEGLNPLMFVF ++ NATYV SI+V
Sbjct  305   TKDSSRIGNLLGWGMAAIYIGGRLPQIFLNIRKGNVEGLNPLMFVFAVLGNATYVTSIIV  364

Query  1330  RSTEWEKMKANMPWlldavacvvldLFIILQYLYY  1226
              S +W +++ N+PWL+D+  C++LD+FI++Q+  Y
Sbjct  365   NSLDWSEIRPNLPWLVDSGGCMLLDIFILIQFFRY  399



>ref|XP_006644034.1| PREDICTED: uncharacterized protein LOC102703908 [Oryza brachyantha]
Length=418

 Score =   239 bits (610),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 159/388 (41%), Positives = 208/388 (54%), Gaps = 45/388 (12%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y K CLC+  D ++  +G++S+I WGVAE+PQI+TN+K KS+ G+SLAFL TW
Sbjct  18    CAEWAQAYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKQKSTEGLSLAFLMTW  77

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTILVK  1883
             I+GD+FNL+GC LEP TLPTQF+ ALLYT TTV+L  Q IYY H     K +   +    
Sbjct  78    IVGDLFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTIYYSHIYHRLKAKKARSTSKP  137

Query  1882  DNEREA----------------LKQRSRHHRTAPAVEVPCQTH----------------Y  1799
                + A                ++  S    T P    P   +                Y
Sbjct  138   QRHQRADASLREKLLAPKVIGEIRNNSHSGATVPVSSSPITVNTEIIRHRHGPSSLGIDY  197

Query  1798  YFTSARTLASSDTPTYCYIMARSGP---PALQYDADSSSEDETVPLSSSQKPVSQPRSIP  1628
             Y+TSAR+L+SS  P      A   P   P    D   S   E  P   +  P+++     
Sbjct  198   YYTSARSLSSSPVPMAGTWSANHHPTNSPPETDDHKESLVSEFTPAQYAPSPLTKNSLSV  257

Query  1627  RataygtflaaaAHFPVGG-KSLIMEAQTKFAGRRLL--QEHEFDSSV-------AGQWL  1478
                       +  HF VG     +        GRRLL   +   DSS+        G  L
Sbjct  258   VPWMALLLGMSLLHFLVGTTHQEVPNGVVIPVGRRLLLLADDHADSSLRDASGSGIGNIL  317

Query  1477  GWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKAN  1298
             GW MA IYMGGR+PQI LN+KRG+ EGLNPLMF F L+ N TYVGSILV+S +W K+K N
Sbjct  318   GWAMAVIYMGGRLPQILLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSLDWSKLKPN  377

Query  1297  MPWlldavacvvldLFIILQYLYYTHKK  1214
             +PWL+DA  CV+LD FIILQ++Y+ ++K
Sbjct  378   LPWLVDAGGCVLLDTFIILQFIYFHYQK  405



>emb|CDX89598.1| BnaC04g36170D [Brassica napus]
Length=227

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 148/206 (72%), Gaps = 7/206 (3%)
 Frame = +1

Query  262  NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRG  441
            +FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+++KLVPLYGRG
Sbjct  23   DFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQDDKLVPLYGRG  82

Query  442  KNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDA---NAFPQHgfgftggfggfgPMATA  612
            KN TDPR+K  PGM IP+RP GQRPETA+PPP     +A         G  GGF PMAT 
Sbjct  83   KNQTDPRTKRYPGMRIPNRPAGQRPETASPPPQQPQNDAASNFFNYGIGLMGGFMPMATT  142

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHG-GHAHGFPQHT  786
            R GNF+F   VGGL PSLFN Q +G+P++A YGT+ G+PF GY N F G    +  P   
Sbjct  143  RIGNFSF--GVGGLLPSLFNFQFHGFPDAALYGTAPGYPFGGYHNGFRGVPGGNNEPTTH  200

Query  787  NQQQQADSNLKWLFLFIGITVILALI  864
                 +D+ LK + + +GI V L L+
Sbjct  201  GGGHPSDAALKNILIVVGICVFLFLL  226



>gb|EAY75948.1| hypothetical protein OsI_03866 [Oryza sativa Indica Group]
Length=224

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = +1

Query  199  NRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSK  378
            NR   S +++   G    D+G+FECNIC +LAQDP+VTLCGHLFCWPCLY+WLH+H+HS+
Sbjct  3    NRVGESSATAVDGGGGAKDSGSFECNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSR  62

Query  379  ECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQ  558
            ECPVCKA +EEEKLVPLYGRGK STDPRS+S+ G++IP RP GQRP T AP PD +    
Sbjct  63   ECPVCKAGLEEEKLVPLYGRGKASTDPRSRSVAGVQIPSRPAGQRPAT-APQPDHHHDHL  121

Query  559  HgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGY  738
                     G   P+A  R+GN+TFSAA+GGLFP L + Q++G+P +A YG +AGFP+GY
Sbjct  122  PHHDPWFMGGAGAPVAGGRWGNYTFSAAIGGLFP-LLSFQVHGFPQAAAYGPAAGFPYGY  180

Query  739  GNTFHGGHAHGFPQHTNQQQQ  801
            G++FHG H HGFP    Q Q 
Sbjct  181  GHSFHGWHGHGFPHQAPQGQH  201



>ref|XP_002533271.1| rnf5, putative [Ricinus communis]
 gb|EEF29103.1| rnf5, putative [Ricinus communis]
Length=233

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 164/219 (75%), Gaps = 5/219 (2%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASG GE ST+  P S S S +N NN +DAG+FECNICF+LAQDPIVTLCGHLFCWPCLY
Sbjct  1    MASGIGE-STSLPPESSSFSGNNNNNANDAGDFECNICFELAQDPIVTLCGHLFCWPCLY  59

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HSHS ECPVCKAL++EEKLVPLYGRGK  TDPRSKS PG++IP RP+GQR    A
Sbjct  60   RWLHHHSHSHECPVCKALIQEEKLVPLYGRGKTQTDPRSKSYPGVDIPRRPSGQR-PETA  118

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGG--LFPSLFNIQLNGYPNSA  702
            PP              G  GGF PMATAR GNFT S A GG  LFPSLFNIQ +G+P++ 
Sbjct  119  PPRPPPEANNFANYGFGLMGGFVPMATARIGNFTLSTAFGGLSLFPSLFNIQFHGFPDAT  178

Query  703  NYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLK  819
             YGT++G P G+ + FHGGHAHGFPQ  ++ Q AD+ LK
Sbjct  179  VYGTTSGLPHGF-HAFHGGHAHGFPQPMSRGQHADNVLK  216



>ref|XP_004967745.1| PREDICTED: lysosomal amino acid transporter 1-like [Setaria italica]
Length=419

 Score =   238 bits (607),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 162/391 (41%), Positives = 214/391 (55%), Gaps = 46/391 (12%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             + C  W   Y K CLC+  D  +  +G+IS+I WGVAE+PQI+TN++ KS+ G+S+AFL 
Sbjct  15    RHCAEWARTYLKYCLCSQKDSAALALGLISVISWGVAEVPQIITNYRQKSTEGLSVAFLM  74

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTI-  1892
             TWI+GD+FNL+GC LEPATLPTQF+ ALLYT TTV+L  Q +YY H     K +      
Sbjct  75    TWIVGDMFNLIGCFLEPATLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKSRATS  134

Query  1891  ---------------LVKDNEREALKQRSRHHRTAPAVEVPCQTHYYFTSARTLASSDTP  1757
                            L+   +  A     +   T P    P   +  FT      SS T 
Sbjct  135   KPQKHQRGDTSLREKLLGAKDGGASGNNHQSDATIPIPSSPIPVNTEFTEQYHAPSSPTS  194

Query  1756  TYCYIMARS-----GPPALQYDADSSSEDETVPLSSSQKP-----VSQPRSIPRataygt  1607
              Y Y+ ARS      P A  +  +S     T P ++ Q+      V+  +S P +     
Sbjct  195   DYYYVSARSLSRSPVPTAGTWLGNSRLSSRTPPQTNGQREPLIGEVTTAQSAPPSRTKNA  254

Query  1606  flaa----------aAHFPVGGKSLIMEAQTKF-AGRRLL-----QEHEFDS----SVAG  1487
             F               HF VG     + + T    GRRLL     Q H   S    S  G
Sbjct  255   FSVVPWMGLLLGTCLLHFLVGNTHREVPSGTVIPVGRRLLLFTDVQGHSSLSHGIGSEIG  314

Query  1486  QWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKM  1307
              +LGW MA IYMGGR+PQI+LN++RG VEGLNPLMF F ++ N+TYVGSILV S EW K+
Sbjct  315   SFLGWAMAIIYMGGRLPQIFLNMQRGHVEGLNPLMFTFAIVGNSTYVGSILVNSLEWSKL  374

Query  1306  KANMPWlldavacvvldLFIILQYLYYTHKK  1214
             + N+PWL+DA  CV+LD FIILQ+LY+ ++K
Sbjct  375   RPNLPWLVDAGGCVILDSFIILQFLYFHYRK  405



>ref|XP_011010093.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
 ref|XP_011010094.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
 ref|XP_011010095.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
Length=416

 Score =   238 bits (606),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 225/397 (57%), Gaps = 63/397 (16%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y K CLC++ D +S  +G+IS++ WGVAEIPQI+TN+K KS+ G+SLAFL TW
Sbjct  15    CSQWARIYMKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITNYKEKSTEGLSLAFLLTW  74

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTILV-  1886
             I+GD+FN+ GC+LEPATLPTQ++ A+LYT TT +L  Q IYY H     K R++  I   
Sbjct  75    IVGDLFNVFGCMLEPATLPTQYYMAVLYTITTSILTAQTIYYGHIYHRLK-RNRRCIKAP  133

Query  1885  ---KDNEREALKQ-------------RSRHHRTAP------AVEVPCQTHY---------  1799
                +  E   ++Q             + R+   +P      ++ +P  T +         
Sbjct  134   ISSQIEEAGRIRQGNSDDGAQVNNAGKQRNETASPDGTNGSSLPIPFPTLFQKSSPGREL  193

Query  1798  YFTSARTLASSDTPTYCYIMA-RSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRa  1622
             Y+ SAR+L+SS TP     +A R   P+  +   +S E+   PL       +  +S P  
Sbjct  194   YYMSARSLSSSHTPAVGSFLAQRMASPS--FSMRNSIEE---PLLGGD---ATTQSAPNL  245

Query  1621  taygtflaaaAHFPVGGKSLIMEAQTKFA--------------GRRLLQ-------EHEF  1505
                      +    +G  +L   A  + A              GR++LQ       E+  
Sbjct  246   NTKTMLCVVSVFTLLGTLNLHQSANNRLARAFENKHQGFVIQVGRKILQASSRMSHENYS  305

Query  1504  DSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRS  1325
             D S  G +LGW MAAIYMGGR+PQI+LNIKRG+VEGLNPLMFVF LI N TYV SILV S
Sbjct  306   DGSGIGTFLGWSMAAIYMGGRLPQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVDS  365

Query  1324  TEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
               W K++AN+PWL+DA  CV+LD  I+LQ++Y+ H++
Sbjct  366   VAWSKIRANLPWLVDAGGCVLLDTCILLQFVYFRHRR  402



>ref|XP_010251611.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Nelumbo nucifera]
Length=418

 Score =   238 bits (606),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 228/407 (56%), Gaps = 49/407 (12%)
 Frame = -1

Query  2287  MGGVELSYCVVERK-ACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNF  2111
             MG  + SY V  R   C  W   Y K CLC+  D  S  +G+IS+I WGVAE+PQI+TN+
Sbjct  1     MGLFKGSYPVCPRNLHCSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNY  60

Query  2110  KNKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYD-  1934
             K KS+  +S+AFL TWI+GD+FNL GC+LEPATLPTQ++ A+LYT TT++L LQ IYY  
Sbjct  61    KKKSTESLSIAFLITWIIGDLFNLFGCLLEPATLPTQYYMAMLYTLTTLILALQTIYYSR  120

Query  1933  --HFLPWWKCRDKNTILVK----DNE---------REALKQRSRHHRTAPAVEVP-----  1814
               H L   +   K+ IL +    D E         + AL  R     +   V VP     
Sbjct  121   IYHLLKSHRHGHKSPILPEIDAVDKEHYTNNFGKKQSALGDRGVLPSSPIPVSVPSHSRD  180

Query  1813  --CQTHYYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQ  1643
               C    Y+ SAR+L+ S TPT   ++    G       +D        PL S  +  S 
Sbjct  181   GSCGRELYYMSARSLSRSHTPTAGSHLACPCGYEGTNSISDHDCRSIEEPLLS--RVGSM  238

Query  1642  PRSIPRataygtflaaaAHFPVGGKSLIMEAQTKFA--------------GRRLLQE---  1514
               + P  T     + +A  F +    L + A ++F+              GRRLLQ+   
Sbjct  239   QSTPPMNTKNMLCVVSALTFFLSTFRLQLSANSRFSMYLENQPGGHVIRIGRRLLQKSSG  298

Query  1513  -----HEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATY  1349
                  H   SS  G +LGW MAAIYMGGR+PQIWLNI+RG V GLNPLMFVF L+ NATY
Sbjct  299   PLLENHGEGSSSVGTFLGWAMAAIYMGGRLPQIWLNIRRGHVGGLNPLMFVFALVGNATY  358

Query  1348  VGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIK  1208
             V SILV S    K++ N+PWL+DA  C++LD FII+Q++++ ++K K
Sbjct  359   VASILVSSLNLSKIRPNLPWLVDAGGCILLDCFIIIQFIHFRYRKPK  405



>ref|XP_011041299.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041300.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041301.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041302.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
Length=416

 Score =   237 bits (605),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 224/397 (56%), Gaps = 63/397 (16%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y K CLC++ D +S  +G+IS++ WGVAEIPQI+TN+K KS+ G+SLAFL TW
Sbjct  15    CSQWARIYMKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITNYKEKSTEGLSLAFLLTW  74

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTILV-  1886
             I+GD+FN+ GC+LEPATLPTQ++ A+LYT TT +L  Q IYY H     K R++  I   
Sbjct  75    IVGDLFNVFGCMLEPATLPTQYYMAVLYTITTSILTAQTIYYGHIYHRLK-RNRRCIKAP  133

Query  1885  ---KDNEREALKQ-------------RSRHHRTAP------AVEVPCQTHY---------  1799
                +  E   ++Q             + R+   +P      ++ +P  T +         
Sbjct  134   ISSQIEEAGRIRQGNSDDGAQVNNAGKQRNETASPDGTNGSSLPIPFPTLFQKSSPGREL  193

Query  1798  YFTSARTLASSDTPTYCYIMA-RSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRa  1622
             Y+ SAR+L+SS TP     +A R   P+  +   +S E+   PL       +  +S P  
Sbjct  194   YYMSARSLSSSHTPAVGSFLAQRMASPS--FSMRNSIEE---PLLGGD---ATTQSAPNL  245

Query  1621  taygtflaaaAHFPVGGKSLIMEAQTKFA--------------GRRLLQ-------EHEF  1505
                      +    +G  +L   A  + A              GR++LQ       E+  
Sbjct  246   NTKTMLCVVSVFTLLGTLNLHQSANNRLARAFENKHQGFVIQVGRKILQASSRMSQENYS  305

Query  1504  DSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRS  1325
             D S  G +LGW MAAIYMGGR+PQI+LNIKRG+VEGLNPLMFVF LI N TYV SILV S
Sbjct  306   DGSGIGTFLGWSMAAIYMGGRLPQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVDS  365

Query  1324  TEWEKMKANMPWlldavacvvldLFIILQYLYYTHKK  1214
               W K++AN+PWL+DA  CV+LD  I+LQ+ Y+ H++
Sbjct  366   VAWSKIRANLPWLVDAGGCVLLDTCILLQFAYFRHRR  402



>ref|XP_008443167.1| PREDICTED: uncharacterized protein LOC103486835 isoform X1 [Cucumis 
melo]
Length=420

 Score =   237 bits (605),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 160/393 (41%), Positives = 217/393 (55%), Gaps = 51/393 (13%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             K C  WV    K CLC + D +S  +G+IS+I WGVAEIPQI+TN++ KSS G+SLAFL 
Sbjct  15    KHCSEWVKNNMKYCLCGVKDGVSLTLGMISVISWGVAEIPQIITNYREKSSDGLSLAFLL  74

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDK----  1901
             TWILGD+FN+ GC+LEPATLPTQ++ ALLYT TT +L  Q IYY H  P  K R +    
Sbjct  75    TWILGDLFNVFGCILEPATLPTQYYMALLYTITTGILFTQTIYYGHIYPQMKYRRRQCKG  134

Query  1900  -------NTILVKD---------------NEREALKQRSRHHRTAPAVEVPCQT------  1805
                    + I  +D               N+ +  K  +    +A    +P         
Sbjct  135   LVHSEANSQIDARDKAQQSNGSVNVNQVNNDDDTSKFNTSKRESASTSPIPLPVLRQNSS  194

Query  1804  ---HYYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPR  1637
                  +F SAR+L+ S TPT   ++  +  PP +         D   P SS+ +P +   
Sbjct  195   TGRELFFMSARSLSRSHTPTAGSFLTQKMTPPNIHNSMQEPLLDGNEP-SSAARPPNVKN  253

Query  1636  SIPRataygtflaaaAHFPVGGK--SLIMEAQTKF---AGRRLLQ--------EHEFDSS  1496
              +   +    F     H     +  S+   +   F    GR+LLQ         +E    
Sbjct  254   MLCLVSMLTFFSTLNHHQSAESRFQSVSGNSNKGFVIPVGRKLLQVADVLQNNGNEISGG  313

Query  1495  VAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEW  1316
             + G +LGW MA IYMGGR+PQI LNIKRG VEGL+PLMF+F LI N+TYV SILV ST W
Sbjct  314   I-GTYLGWAMALIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSW  372

Query  1315  EKMKANMPWlldavacvvldLFIILQYLYYTHK  1217
              K+K N+PWL+DA  CV+LD FI++Q++Y+ ++
Sbjct  373   SKIKPNLPWLVDAFGCVLLDTFILIQFIYFRYR  405



>ref|NP_001289001.1| E3 ubiquitin-protein ligase RNF185 [Brassica rapa]
 ref|XP_009140494.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Brassica rapa]
 ref|XP_009140495.1| PREDICTED: E3 ubiquitin-protein ligase RNF185 [Brassica rapa]
 gb|ADK63399.1| C3HC4 type zinc finger protein [Brassica rapa]
 emb|CDY39671.1| BnaA04g13880D [Brassica napus]
Length=227

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 147/206 (71%), Gaps = 7/206 (3%)
 Frame = +1

Query  262  NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRG  441
            +FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+++KLVPLYGRG
Sbjct  23   DFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQDDKLVPLYGRG  82

Query  442  KNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDA---NAFPQHgfgftggfggfgPMATA  612
            KN TDPR+K  PGM IP+RP GQRPETA+PPP     +A         G  GGF PMAT 
Sbjct  83   KNQTDPRTKRYPGMRIPNRPAGQRPETASPPPQQPQNDAASNFFNYGIGLMGGFMPMATT  142

Query  613  RFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHG-GHAHGFPQHT  786
            R GNF+F   VGGL PSLFN Q +G+P++A YGT+ G+PF GY N F G    +  P   
Sbjct  143  RIGNFSF--GVGGLLPSLFNFQFHGFPDAALYGTAPGYPFGGYHNGFRGVPGGNNEPTAP  200

Query  787  NQQQQADSNLKWLFLFIGITVILALI  864
                 +D+ LK + + +GI V   L+
Sbjct  201  GGGHPSDAALKNILIVVGICVFFFLL  226



>ref|XP_002880526.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56785.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +1

Query  256  AGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYG  435
             G+FECNICF+LAQDPIVTLCGHLFCWPCLY+WLH HSHS+ECPVCKA+V+++KLVPLYG
Sbjct  23   GGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKAVVQDDKLVPLYG  82

Query  436  RGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATAR  615
            RGKN TDPRSK  PG+ IP+RPTGQRPETAAPPP A A         G  GG  PMAT R
Sbjct  83   RGKNQTDPRSKRYPGLRIPNRPTGQRPETAAPPPQAEAASNFFNYGIGLMGGIMPMATTR  142

Query  616  FGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPF-GYGNTFHGGHAHGFPQ-HTN  789
             GN  FS   GGL PSLFN Q +G+P++  YG++ G+P+ GY N F G   HG  +    
Sbjct  143  IGN--FSMGFGGLLPSLFNFQFHGFPDATLYGSTPGYPYGGYHNGFRGVPPHGQERPMAR  200

Query  790  QQQQADSNLKWLFLFIGITVILALIW  867
               Q+D+ LK + L +GI V+L L W
Sbjct  201  GGNQSDATLKNILLVVGICVVLFLCW  226



>ref|XP_001753587.1| predicted protein [Physcomitrella patens]
 gb|EDQ81810.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   236 bits (601),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 161/391 (41%), Positives = 217/391 (55%), Gaps = 54/391 (14%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             K C+ WV  Y  DC+C+  D  S   G++S+I WG+AE+PQI+TNF+ KS+ G+SL FL 
Sbjct  8     KPCLRWVQVYLLDCVCSTRDRFSLAQGLMSVISWGIAEVPQILTNFREKSTEGLSLLFLM  67

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTIL  1889
             TW++GDVFNL+GC LEPATLPTQF+ A+LYT TT +LVLQ +YYDH    W     + + 
Sbjct  68    TWVVGDVFNLMGCYLEPATLPTQFYMAILYTMTTTILVLQTVYYDHLRVRWS---GDRVA  124

Query  1888  VKDNEREALKQRSRHHRTAPAVE-----------VPCQT---------------------  1805
             VKD   E  K      +  P  E           +P  +                     
Sbjct  125   VKDMFPEIQKTDMEAQKQIPIPEAADDANETGGGIPTSSQPTSIRVPHHVHHPHGNSAGS  184

Query  1804  --HYYFTSARTLASSDTPTYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSI  1631
               H Y+ SAR+LASS      Y         + +   + S + T+ L+     V+Q  + 
Sbjct  185   RDHLYYQSARSLASS------YAQPVGSYSCILHHQTAESLNLTICLNFC---VTQITTS  235

Query  1630  PRataygtflaaaAHFPVGGKSLIMEAQTKFAGRRLLQEHEF---DSSVAGQWLGWLMAA  1460
                          +    GG +L     T   GR     H F   ++S  G+  GW+MA 
Sbjct  236   VLMVGSLGLSMYTSPIRTGGNTL----GTTHIGRSHTLAHLFAQQEASPLGEVFGWIMAG  291

Query  1459  IYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlld  1280
             IYMGGR+PQIWLN+KRGS+EGLNPLMFVF L+ NATYVGSILVRS +W ++K N+ WL+D
Sbjct  292   IYMGGRLPQIWLNMKRGSMEGLNPLMFVFALLGNATYVGSILVRSLDWAQLKPNLAWLVD  351

Query  1279  avacvvldLFIILQYLYYTHKKIKKRQQTQS  1187
             A  CVVLD+FI+ Q+ YY + K+K+  +  S
Sbjct  352   AGVCVVLDIFILCQFAYY-YLKLKELDEESS  381



>ref|NP_001044354.2| Os01g0766200 [Oryza sativa Japonica Group]
 dbj|BAD53343.1| putative RING finger protein [Oryza sativa Japonica Group]
 dbj|BAD87152.1| putative RING finger protein [Oryza sativa Japonica Group]
 dbj|BAG91864.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91451.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06268.2| Os01g0766200 [Oryza sativa Japonica Group]
Length=224

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = +1

Query  199  NRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSK  378
            NR   S +++   G    D+G+FECNIC +LAQDP+VTLCGHLFCWPCLY+WLH+H+HS+
Sbjct  3    NRVGESSATAVDGGGGAKDSGSFECNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSR  62

Query  379  ECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQ  558
            ECPVCKA +EEEKLVPLYGRGK STDPRS+S+ G++IP RP GQRP TA+  PD +    
Sbjct  63   ECPVCKAGLEEEKLVPLYGRGKASTDPRSRSVAGVQIPSRPAGQRPATAS-QPDHHHDHL  121

Query  559  HgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGY  738
                     G   P+A  R+GN+TFSAA+GGLFP L + Q++G+P +A YG +AGFP+GY
Sbjct  122  PHHDPWFMGGAGAPVAGGRWGNYTFSAAIGGLFP-LLSFQVHGFPQAAAYGPAAGFPYGY  180

Query  739  GNTFHGGHAHGFPQHTNQQQQ  801
            G++FHG H HGFP    Q Q 
Sbjct  181  GHSFHGWHGHGFPHQAPQGQH  201



>ref|XP_004136760.1| PREDICTED: uncharacterized protein LOC101209754 [Cucumis sativus]
Length=420

 Score =   236 bits (603),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 163/401 (41%), Positives = 212/401 (53%), Gaps = 67/401 (17%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             K C  WV    K CLC   D +S  +G+IS+I WGVAEIPQIVTN++ KSS G+SLAFL 
Sbjct  15    KHCSEWVKNNMKYCLCGTKDGVSLTLGMISVISWGVAEIPQIVTNYREKSSDGLSLAFLL  74

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK--------  1913
             TWILGD+FN+ GC+LEPATLPTQ++ ALLYT TT +L  QAIYY H  P  K        
Sbjct  75    TWILGDLFNVFGCILEPATLPTQYYMALLYTITTGILFTQAIYYGHIYPQMKYRRRQCKG  134

Query  1912  -----------CRDK--------NTILVKDNEREALKQRSRHHRTAPAVEVP-------C  1811
                         RDK        N   V +++        R   +   + +P        
Sbjct  135   LVHSEANAQIDARDKAQQSYGSVNVNQVNNDDMSKFNTSKRESASTSPIPLPMLRQNSST  194

Query  1810  QTHYYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRS  1634
                 Y+ SAR+L+ S TPT   ++  +  PP +             PL    +P S PR 
Sbjct  195   GRELYYMSARSLSRSHTPTSGSFLRQKMTPPYIHNPMQE-------PLLDGNEPSSAPRP  247

Query  1633  IPRataygtflaaaAHFPVGGKSLIMEAQTKF--------------AGRRLLQ-------  1517
              P        +     F          A+++F               GR+LLQ       
Sbjct  248   -PNVKTMLCLVFMLTFFSTLNHH--HSAESRFYSVSDNSNKGFVIPVGRKLLQVAGVLQN  304

Query  1516  -EHEFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGS  1340
               +E      G +LGW MA IYMGGR+PQI LNIKRG VEGL+PLMF+F LI N+TYV S
Sbjct  305   NVNEGGGGGIGTYLGWAMAVIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVAS  364

Query  1339  ILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHK  1217
             ILV ST W K+K N+PWL+DA  CV+LD FI++Q++Y+ ++
Sbjct  365   ILVSSTSWSKIKPNLPWLVDAFGCVLLDTFILIQFIYFRYR  405



>ref|XP_009379177.1| PREDICTED: E3 ubiquitin-protein ligase RNF185-like [Pyrus x bretschneideri]
Length=227

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 168/233 (72%), Gaps = 8/233 (3%)
 Frame = +1

Query  169  MASGFGEPSTNRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLY  348
            MASGFGE ++      P S S +GNN +D G+FECNICF+LAQDPI+  CGHLFCWPCLY
Sbjct  1    MASGFGESTS----VPPQSVSCSGNNANDVGDFECNICFELAQDPIIARCGHLFCWPCLY  56

Query  349  KWLHIHSHSKECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAA  528
            +WLH HS+S+ECP CKAL+EEEKLVPLYGRGK  TDPRSKS PG+ IP+RP+GQRP TA 
Sbjct  57   RWLHHHSNSQECPFCKALIEEEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSGQRPPTAP  116

Query  529  PPPDANAFPQHgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANY  708
                     Q      G  GGF PMAT R GNFT + A GGL PSL N+Q +G+P++  Y
Sbjct  117  ----PPNTNQFANYGFGLMGGFVPMATQRIGNFTLATAFGGLLPSLLNVQYHGFPDATVY  172

Query  709  GTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQADSNLKWLFLFIGITVILALIW  867
            GT++GFPF   N+FHGGH HGF Q  N Q Q     K++FLFIG+ VI+A+I+
Sbjct  173  GTTSGFPFAPFNSFHGGHGHGFFQPENHQWQLADVWKYIFLFIGVFVIVAVIF  225



>ref|XP_009407106.1| PREDICTED: uncharacterized protein LOC103989888 [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   236 bits (602),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 160/421 (38%), Positives = 229/421 (54%), Gaps = 74/421 (18%)
 Frame = -1

Query  2263  CVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVS  2084
             C+  R  C  W   Y K CLC++ D ++  +G IS+I WG+AE+PQI+TN++ KS+ G+S
Sbjct  12    CLSSRH-CSHWARIYLKYCLCSVKDGMALFLGTISIISWGIAEVPQIITNYRQKSTEGLS  70

Query  2083  LAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCR-  1907
             +AFL TW++GD+FN +GC+LEPATLPTQ++ ALLYTATT++L  Q IYY H    +K   
Sbjct  71    IAFLLTWVVGDLFNFIGCLLEPATLPTQYYVALLYTATTLILTGQTIYYGHIYHRFKANC  130

Query  1906  -----------------DKNT-----------ILVKDNEREALKQRSRHHRTA-------  1832
                                N+           +L   +ERE+L   ++  R         
Sbjct  131   GVPGRIEIIKKIGIGTYGSNSYISNEIYHFGYVLEDASERESLLGDAKKTRVVGDRGHDA  190

Query  1831  -----PAVEVP---------CQTHYYFTSARTLASSDTPTYCYIMARSGPPALQYDADSS  1694
                  P+  +P         C   +Y+ SAR+L  S  PT+ +           +   S 
Sbjct  191   KEGNLPSSPIPVAGQVFHDSCGKDFYYMSARSLKKSPVPTFGF-----------WSVHSH  239

Query  1693  SEDETVPLSSSQK-PVSQPRSIPRataygtflaaaAHFPVGG-KSLIMEAQTK-------  1541
              +    P+  +Q+ P S P ++     +    + A  F +   +S I    T        
Sbjct  240   DDGRAPPIDGNQQSPQSAPSNLDTKNMFSIVPSVAFFFGICVIRSYISNMHTASSPGGMV  299

Query  1540  -FAGRRLLQEHEFD--SSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFV  1370
                GR+LLQ+   D  SS  G  LGW MAAIYMGGR+PQI LNI+RG+V+GLNPLMF+F 
Sbjct  300   ILVGRKLLQDKVQDDGSSGVGTLLGWAMAAIYMGGRLPQICLNIRRGNVKGLNPLMFIFA  359

Query  1369  LIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIKKRQQTQ  1190
             L  NATYVGSILV S EW K++ N+PWL+DA  CV+LD FI++Q+ Y+  ++  KR+   
Sbjct  360   LTGNATYVGSILVNSLEWSKLRPNLPWLVDAGGCVILDAFILIQFAYFHIRESNKRESED  419

Query  1189  S  1187
             +
Sbjct  420   N  420



>ref|XP_004163970.1| PREDICTED: uncharacterized protein LOC101227133 [Cucumis sativus]
Length=420

 Score =   236 bits (602),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 162/392 (41%), Positives = 213/392 (54%), Gaps = 49/392 (13%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             K C  WV    K CLC   D +S  +G+IS+I WGVAEIPQIVTN++ KSS G+SLAFL 
Sbjct  15    KHCSEWVKNNMKYCLCGTKDGVSLTLGMISVISWGVAEIPQIVTNYREKSSDGLSLAFLL  74

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK--------  1913
             TWILGD+FN+ GC+LEPATLPTQ++ ALLYT TT +L  QAIYY H  P  K        
Sbjct  75    TWILGDLFNVFGCILEPATLPTQYYMALLYTITTGILFTQAIYYGHIYPQMKYRRRQCKG  134

Query  1912  -----------CRDK--------NTILVKDNEREALKQRSRHHRTAPAVEVP-------C  1811
                         RDK        N   V +++        R   +   + +P        
Sbjct  135   LVHSEANAQIDARDKAQQSYGSVNVNQVNNDDMSKFNTSKRESASTSPIPLPMLRQNSST  194

Query  1810  QTHYYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRS  1634
                 Y+ SAR+L+ S TPT   ++  +  PP +         D   P SS+ +P +    
Sbjct  195   GRELYYMSARSLSRSHTPTSGSFLRQKMTPPYIHNPMQEPLLDGNEP-SSAARPPNVKTM  253

Query  1633  IPRataygtflaaaAHFPVGGK--SLIMEAQTKF---AGRRLLQ--------EHEFDSSV  1493
             +        F     H     +  S+   +   F    GR+LLQ         +E     
Sbjct  254   LCLVFMLTFFSTLNHHHSAESRFYSVSDNSNKGFVIPVGRKLLQVAGVLQNNVNEGGGGG  313

Query  1492  AGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWE  1313
              G +LGW MA IYMGGR+PQI LNIKRG VEGL+PLMF+F LI N+TYV SILV ST W 
Sbjct  314   IGTYLGWAMAVIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSWS  373

Query  1312  KMKANMPWlldavacvvldLFIILQYLYYTHK  1217
             K+K N+PWL+DA  CV+LD FI++Q++Y+ ++
Sbjct  374   KIKPNLPWLVDAFGCVLLDTFILIQFIYFRYR  405



>ref|XP_010251610.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Nelumbo nucifera]
Length=424

 Score =   236 bits (602),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 169/401 (42%), Positives = 225/401 (56%), Gaps = 49/401 (12%)
 Frame = -1

Query  2269  SYCVVERK-ACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             SY V  R   C  W   Y K CLC+  D  S  +G+IS+I WGVAE+PQI+TN+K KS+ 
Sbjct  13    SYPVCPRNLHCSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNYKKKSTE  72

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYD---HFLP  1922
              +S+AFL TWI+GD+FNL GC+LEPATLPTQ++ A+LYT TT++L LQ IYY    H L 
Sbjct  73    SLSIAFLITWIIGDLFNLFGCLLEPATLPTQYYMAMLYTLTTLILALQTIYYSRIYHLLK  132

Query  1921  WWKCRDKNTILVK----DNE---------REALKQRSRHHRTAPAVEVP-------CQTH  1802
               +   K+ IL +    D E         + AL  R     +   V VP       C   
Sbjct  133   SHRHGHKSPILPEIDAVDKEHYTNNFGKKQSALGDRGVLPSSPIPVSVPSHSRDGSCGRE  192

Query  1801  YYFTSARTLASSDTPTY-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPR  1625
              Y+ SAR+L+ S TPT   ++    G       +D        PL S  +  S   + P 
Sbjct  193   LYYMSARSLSRSHTPTAGSHLACPCGYEGTNSISDHDCRSIEEPLLS--RVGSMQSTPPM  250

Query  1624  ataygtflaaaAHFPVGGKSLIMEAQTKFA--------------GRRLLQE--------H  1511
              T     + +A  F +    L + A ++F+              GRRLLQ+        H
Sbjct  251   NTKNMLCVVSALTFFLSTFRLQLSANSRFSMYLENQPGGHVIRIGRRLLQKSSGPLLENH  310

Query  1510  EFDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILV  1331
                SS  G +LGW MAAIYMGGR+PQIWLNI+RG V GLNPLMFVF L+ NATYV SILV
Sbjct  311   GEGSSSVGTFLGWAMAAIYMGGRLPQIWLNIRRGHVGGLNPLMFVFALVGNATYVASILV  370

Query  1330  RSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIK  1208
              S    K++ N+PWL+DA  C++LD FII+Q++++ ++K K
Sbjct  371   SSLNLSKIRPNLPWLVDAGGCILLDCFIIIQFIHFRYRKPK  411



>gb|EEE55436.1| hypothetical protein OsJ_03576 [Oryza sativa Japonica Group]
Length=276

 Score =   231 bits (589),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 148/200 (74%), Gaps = 2/200 (1%)
 Frame = +1

Query  199  NRAppspsssssngnngsDAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSK  378
            NR   S +++   G    D+G+FECNIC +LAQDP+VTLCGHLFCWPCLY+WLH+H+HS+
Sbjct  55   NRVGESSATAVDGGGGAKDSGSFECNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSR  114

Query  379  ECPVCKALVEEEKLVPLYGRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQ  558
            ECPVCKA +EEEKLVPLYGRGK STDPRS+S+ G++IP RP GQRP TA+  PD +    
Sbjct  115  ECPVCKAGLEEEKLVPLYGRGKASTDPRSRSVAGVQIPSRPAGQRPATAS-QPDHHHDHL  173

Query  559  HgfgftggfggfgPMATARFGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGY  738
                     G   P+A  R+GN+TFSAA+GGLFP L + Q++G+P +A YG +AGFP+GY
Sbjct  174  PHHDPWFMGGAGAPVAGGRWGNYTFSAAIGGLFP-LLSFQVHGFPQAAAYGPAAGFPYGY  232

Query  739  GNTFHGGHAHGFPQHTNQQQ  798
            G++FHG H HGFP    Q Q
Sbjct  233  GHSFHGWHGHGFPHQAPQGQ  252



>ref|XP_003611911.1| RING finger protein [Medicago truncatula]
 gb|AES94869.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=239

 Score =   229 bits (585),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 152/210 (72%), Gaps = 8/210 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G+FECNICFDLAQDP++TLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+EEKLVPLY
Sbjct  31   DVGDFECNICFDLAQDPVITLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQEEKLVPLY  90

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK  TDPR+KS PGMEIP RP+GQRP+TA  PP  N    +     G  GGF P ATA
Sbjct  91   GRGKTQTDPRTKSYPGMEIPRRPSGQRPQTAPNPPPHNN--GNFTAGIGLMGGFIPTATA  148

Query  613  RFGN---FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGF-PQ  780
            RFGN          GG  PSL NI  +G+ ++  YGT++G+PFG+ N F GG+A GF  Q
Sbjct  149  RFGNFSFSPGFGGFGGFIPSLMNIHFHGFQDATVYGTTSGYPFGF-NGFQGGNARGFNSQ  207

Query  781  HTNQ-QQQADSNLKWLFLFIGITVILALIW  867
             T Q Q+Q D+ LK L + IG  V+L +I+
Sbjct  208  ATGQVQRQEDNCLKNLLMLIGFLVLLTVIF  237



>ref|XP_010525450.1| PREDICTED: uncharacterized protein LOC104803245 [Tarenaya hassleriana]
 ref|XP_010525451.1| PREDICTED: uncharacterized protein LOC104803245 [Tarenaya hassleriana]
Length=412

 Score =   235 bits (600),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 158/388 (41%), Positives = 216/388 (56%), Gaps = 50/388 (13%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             + C  W  +  K CLC++ D +S  +G IS+I WGVAEIPQI+TN++ KS+ G+S+AFL 
Sbjct  14    RHCSRWARESMKYCLCSVRDGLSLSLGFISVISWGVAEIPQIITNYREKSTEGLSIAFLT  73

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTIL  1889
             TW+LGD+FN+ GC++EPATLPTQF+TALLYT TT VL  QAIYY H  P  K R    + 
Sbjct  74    TWMLGDLFNVFGCLMEPATLPTQFYTALLYTVTTAVLFAQAIYYGHIYPGLKNRKDQVVS  133

Query  1888  VKDNEREALKQRSRHHRTAPA------VEVPCQT------------------HYYFTSAR  1781
              +     A K  +  +    A      V+ PC +                    Y+TSAR
Sbjct  134   HQKQMGAARKSDTGSNEGKIAERWRIGVDSPCGSPSSPIPFPRARRNNSAGRELYYTSAR  193

Query  1780  TLASSDT-PTYCYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtf  1604
             +L+SS T P   ++  R  PP       SS E+  +   +S  P S P +          
Sbjct  194   SLSSSHTPPAGSFLTQRMTPPTRH---GSSLEEPLLRAQTSPLPASPPAT---KMMLCLV  247

Query  1603  laaaAHFPVGGKSLIMEAQTKFAG-----------RRLLQ--------EHEFDSSVAGQW  1481
                     V    L+ E++   +G           R+LLQ         H  +S   G  
Sbjct  248   SVFMFIGTVSLPGLLDESRNMTSGERNRVFVVRGMRKLLQISSSSLGENHSGESGGIGML  307

Query  1480  LGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKA  1301
             +GW MAA YMGGR+PQI LN++RG+VEGLNPLMF+F L+ N+TYV SILV S EW K+  
Sbjct  308   MGWAMAATYMGGRLPQICLNMRRGNVEGLNPLMFLFALVGNSTYVASILVNSMEWSKIGP  367

Query  1300  NMPWlldavacvvldLFIILQYLYYTHK  1217
             N+PWL+DA  CV+LD  I+LQ++Y+ ++
Sbjct  368   NLPWLVDAGGCVILDTLILLQFIYFQYR  395



>gb|AFK39005.1| unknown [Medicago truncatula]
Length=276

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 152/210 (72%), Gaps = 8/210 (4%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D G+FECNICFDLAQDP++TLCGHLFCWPCLY+WLH HSHS+ECPVCKALV+EEKLVPLY
Sbjct  31   DVGDFECNICFDLAQDPVITLCGHLFCWPCLYRWLHHHSHSQECPVCKALVQEEKLVPLY  90

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK  TDPR+KS PGMEIP RP+GQRP+TA  PP  N    +     G  GGF P ATA
Sbjct  91   GRGKTQTDPRTKSYPGMEIPRRPSGQRPQTAPNPPPHNN--GNFTAGIGLMGGFIPTATA  148

Query  613  RFGN---FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGF-PQ  780
            RFGN          GG  PSL NI  +G+ ++  YGT++G+PFG+ N F GG+A GF  Q
Sbjct  149  RFGNFSFSPGFGGFGGFIPSLMNIHFHGFQDATVYGTTSGYPFGF-NGFQGGNARGFNSQ  207

Query  781  HTNQ-QQQADSNLKWLFLFIGITVILALIW  867
             T Q Q+Q D+ LK L + IG  V+L +I+
Sbjct  208  ATGQVQRQEDNCLKNLLMLIGFLVLLTVIF  237



>ref|XP_006365504.1| PREDICTED: RING finger protein 5-like isoform X1 [Solanum tuberosum]
Length=221

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+G+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HSHS ECP+CKAL+EE KLVP+Y
Sbjct  20   DSGDFECNICFELAQDPIVTLCGHLYCWPCLYEWLQVHSHSHECPICKALIEEHKLVPIY  79

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK S+DPRS+  PG+ IP RP GQRP+T AP  D + + +H    + G     PM +A
Sbjct  80   GRGKASSDPRSRLRPGINIPKRPVGQRPQT-APAVDLD-YLRHDEFDSIGGLMSMPMPSA  137

Query  613  RFGNFTFSAAVGGLFPSLFNI-QLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTN  789
            RF N T SA +G + P+LFN+  ++G+ ++  YG ++G P+ +  +FHGG+AHGF  H+N
Sbjct  138  RFENSTLSALIGAI-PALFNLNNVHGFHDATVYGATSGVPYLFSGSFHGGYAHGF-HHSN  195

Query  790  QQQQADSNLKWLFLFIGITVILALI  864
                    +K LFL +G  +I++LI
Sbjct  196  HLDWTKFFMKVLFLIVGFLLIVSLI  220



>gb|KDO64268.1| hypothetical protein CISIN_1g015046mg [Citrus sinensis]
Length=414

 Score =   234 bits (597),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 156/397 (39%), Positives = 225/397 (57%), Gaps = 47/397 (12%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y + CLC++ D +S  +G+ S+I WGVAE+PQI+TN+K KS+ G+S+AFL TW
Sbjct  17    CAEWARIYMEYCLCSVRDGVSLGLGLASVISWGVAEVPQIITNYKEKSTEGLSIAFLTTW  76

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDK-NTILV  1886
             ILGD+FN+ GC+LEPATLPTQ++ A+LYT TTV+L  Q +YY H  P  K   +  T L+
Sbjct  77    ILGDLFNVFGCLLEPATLPTQYYMAMLYTLTTVILTAQTMYYSHIYPRLKHNKRPQTGLM  136

Query  1885  KDNEREALKQRSRHHRTAPAVE--------------------VPC---------QTHYYF  1793
              +    A K R   +     V                     +P              Y+
Sbjct  137   PNQPEAAEKTRPSSNGVGEQVNSSGKWKIDSDTSDTENFSIPIPLPPFPRNGSPGRELYY  196

Query  1792  TSARTLASSDTPTYCYIMARSGPPALQYDADSSSEDETVP--LSSSQKPVSQPRS----I  1631
             TSAR+L+SS TPT    +A+   P+  + +  S E+  +   +S+   P +  ++    +
Sbjct  197   TSARSLSSSHTPTAGSFIAQRMSPS--HHSRISIEEPLLGGHISTQSPPSTNTKTMLCLV  254

Query  1630  PRataygtflaaaAH------FPVGGKSLIMEAQTKF---AGRRLLQEHEFDSSVAGQWL  1478
             P      TF    ++      F    K  +++ + K    +G  L +     SS  G +L
Sbjct  255   PIMIFLTTFNFHYSNTEHDTVFEKPNKGFVIQVRRKLLQVSGGLLQESVTGGSSGIGSYL  314

Query  1477  GWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKAN  1298
             GW MAAIYMGGR+PQI LNI+RG VEGLNPLMFVF L+ NATYV SILV S +W +++ N
Sbjct  315   GWAMAAIYMGGRLPQICLNIRRGHVEGLNPLMFVFALVGNATYVASILVNSVDWSRIRPN  374

Query  1297  MPWlldavacvvldLFIILQYLYYTHKKIKKRQQTQS  1187
             +PWL DA  CV+LD FI++Q++YY ++  ++ +   S
Sbjct  375   LPWLADAGGCVLLDSFILIQFIYYRYRSFQEDKHENS  411



>ref|XP_002457622.1| hypothetical protein SORBIDRAFT_03g010545 [Sorghum bicolor]
 gb|EES02742.1| hypothetical protein SORBIDRAFT_03g010545 [Sorghum bicolor]
Length=419

 Score =   234 bits (598),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 211/393 (54%), Gaps = 45/393 (11%)
 Frame = -1

Query  2248  KACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLC  2069
             + C  W   Y K CLC+  +  +  +G+IS+I WG+AE+PQI+TN++ KS+ G+S+AFL 
Sbjct  16    RHCAEWARIYLKYCLCSQKEGAALALGLISVISWGLAEVPQIITNYRQKSTEGLSVAFLM  75

Query  2068  TWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRD-----  1904
             TWI+GD+FNLVGC LEPATLPTQF+ ALLYT TT++L  Q +YY H     K +      
Sbjct  76    TWIVGDLFNLVGCFLEPATLPTQFYMALLYTMTTLILTGQTLYYSHIYHRLKAKKSRAAS  135

Query  1903  -------------KNTILVKDNEREALKQRSRHHRTAPAVEVPCQ-------------TH  1802
                          +  +  KD         S      P+  +P               T 
Sbjct  136   KPQKHHRGDASLREKLLGAKDGAASRNNNESDATVLIPSSPIPVNMKFVDQCHGSSPSTD  195

Query  1801  YYFTSARTLASSDTPTYCYIMAR----SGPPALQYDADSSSEDETVPLSSSQKPVSQPRS  1634
             YY+ SAR+L+SS  PT    +      S  P    D   S   E  P  S+   V++   
Sbjct  196   YYYMSARSLSSSPVPTAGTWLGSNRQSSRTPPQTNDQRGSLVGEIAPAHSAPSTVTKNAL  255

Query  1633  IPRataygtflaaaAHFPVGGKSLIMEAQTKF-AGRRLL---QEHEFDS------SVAGQ  1484
                            H  VG     M + T    GRRLL    +H   S      S  G 
Sbjct  256   SVAPWMGLLLGMCLLHILVGNTHREMPSGTVIPVGRRLLLFVDDHGNSSLSHGSGSEIGS  315

Query  1483  WLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMK  1304
             +LGW MA IYMGGR+PQI LN++RG VEGLNPLMF F L+ N+TYVGSILV S +W K++
Sbjct  316   FLGWAMAIIYMGGRLPQILLNMQRGHVEGLNPLMFAFALVGNSTYVGSILVNSMDWSKLR  375

Query  1303  ANMPWlldavacvvldLFIILQYLYYTHKKIKK  1205
              N+PWL+DA  CV+LD FIILQ+LY+ ++K ++
Sbjct  376   PNLPWLVDAGGCVLLDSFIILQFLYFHYRKQRE  408



>ref|XP_008660226.1| PREDICTED: RING finger protein 5-like [Zea mays]
Length=246

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCWPCLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  48   FECNICLDLAQDPVVTLCGHLFCWPCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  107

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            +S  PR++S+ G+EIP RPTGQRP TA  P   N +P           G  P+A  R+G+
Sbjct  108  SSAVPRARSVAGVEIPSRPTGQRPSTAPQPDHNNHYPHQ--NPWFNGAGAPPVANGRWGS  165

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTNQQQQA  804
            +TFSAA+GGLFP L + Q++G+P     G   GFP+GYG++FHG H HGFP+   Q QQ 
Sbjct  166  YTFSAAIGGLFP-LLSFQVHGFPQRLPMGLLQGFPYGYGHSFHGWHGHGFPRQAPQGQQV  224

Query  805  DS  810
            D+
Sbjct  225  DA  226



>ref|XP_006365505.1| PREDICTED: RING finger protein 5-like isoform X2 [Solanum tuberosum]
Length=205

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+G+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HSHS ECP+CKAL+EE KLVP+Y
Sbjct  4    DSGDFECNICFELAQDPIVTLCGHLYCWPCLYEWLQVHSHSHECPICKALIEEHKLVPIY  63

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK S+DPRS+  PG+ IP RP GQRP+T AP  D + + +H    + G     PM +A
Sbjct  64   GRGKASSDPRSRLRPGINIPKRPVGQRPQT-APAVDLD-YLRHDEFDSIGGLMSMPMPSA  121

Query  613  RFGNFTFSAAVGGLFPSLFNI-QLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTN  789
            RF N T SA +G + P+LFN+  ++G+ ++  YG ++G P+ +  +FHGG+AHGF  H+N
Sbjct  122  RFENSTLSALIGAI-PALFNLNNVHGFHDATVYGATSGVPYLFSGSFHGGYAHGF-HHSN  179

Query  790  QQQQADSNLKWLFLFIGITVILALI  864
                    +K LFL +G  +I++LI
Sbjct  180  HLDWTKFFMKVLFLIVGFLLIVSLI  204



>ref|XP_007028338.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOY08840.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 2 [Theobroma cacao]
Length=388

 Score =   233 bits (593),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 217/372 (58%), Gaps = 33/372 (9%)
 Frame = -1

Query  2254  ERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAF  2075
              R+ C  W   Y   C+C+  DE SF +G+IS+I W VAEIPQI+TN+K KS  G+SL F
Sbjct  7     RRRECWEWARVYINYCICSARDEGSFALGLISVISWSVAEIPQIITNYKEKSIEGLSLGF  66

Query  2074  LCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNT  1895
             L TWI+GD+FNL GC+LEPATLPTQF+ A+LYT TT +L  Q +YY H  P  K +    
Sbjct  67    LITWIVGDLFNLFGCILEPATLPTQFYMAVLYTMTTSILAAQTVYYGHIYPRLKYKRVCH  126

Query  1894  ILVKDNEREALKQRSRHHRTAPAVEVPC-------QTHYYFTSARTLASSDTPTY-CYIM  1739
                K+++ EA+++     R +  + +P            Y+ SAR+L+ S TPT   +++
Sbjct  127   KDSKEHQPEAVEKVIDADRLSSPIPLPAINVKSSPGRELYYMSARSLSRSHTPTAGSFLV  186

Query  1738  ARSGPPALQYDADSSSEDETVPLSSSQ-----------KPVSQPRSIPRataygtflaaa  1592
              R  PP+      SS E+   PL S+            K +    S+    A      +A
Sbjct  187   QRMTPPS---HTRSSVEE---PLLSAHVSAQSASPPSSKSLLCLVSVLMFIATFNSQLSA  240

Query  1591  AHFPVGGKSLIMEAQTKFAGRRLLQEHEFD--------SSVAGQWLGWLMAAIYMGGRVP  1436
              +       ++ +      GR+LLQ +            S  G +LGW MA IYMGGR+P
Sbjct  241   FNKLHIEHKIVNQGFVIQIGRKLLQVNAASLGESGIGGGSRVGTFLGWAMATIYMGGRLP  300

Query  1435  QIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWlldavacvvld  1256
             QI LNI+RG+VEGLNP MF+F L+ N+TYV SILV ST+W +++ N+PWL+DA  CV+LD
Sbjct  301   QICLNIRRGNVEGLNPFMFMFALVGNSTYVASILVESTDWSRIRPNLPWLVDAAGCVLLD  360

Query  1255  LFIILQYLYYTH  1220
              FI++Q++Y+ +
Sbjct  361   TFILIQFIYFCY  372



>ref|XP_006481307.1| PREDICTED: uncharacterized protein LOC102608727 isoform X1 [Citrus 
sinensis]
 ref|XP_006481308.1| PREDICTED: uncharacterized protein LOC102608727 isoform X2 [Citrus 
sinensis]
 ref|XP_006481309.1| PREDICTED: uncharacterized protein LOC102608727 isoform X3 [Citrus 
sinensis]
 ref|XP_006481310.1| PREDICTED: uncharacterized protein LOC102608727 isoform X4 [Citrus 
sinensis]
Length=414

 Score =   233 bits (594),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 155/397 (39%), Positives = 226/397 (57%), Gaps = 47/397 (12%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y + CLC++ D +S  +G+ S+I WGVAE+PQI+TN++ KS+ G+S+AFL TW
Sbjct  17    CAEWARIYMEYCLCSVRDGVSLGLGLASVISWGVAEVPQIITNYEEKSTEGLSIAFLTTW  76

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDK-NTILV  1886
             ILGD+FN+ GC+LEPATLPTQ++ A+LYT TTV+L  Q +YY H  P  K   +  T L+
Sbjct  77    ILGDLFNVFGCLLEPATLPTQYYMAMLYTLTTVILTAQTMYYSHIYPRLKHNKRPQTGLM  136

Query  1885  KDNEREALKQRSRHHRTAPAVE--------------------VPC---------QTHYYF  1793
              +    A K R   +     V                     +P              Y+
Sbjct  137   PNQPEAAEKTRPSSNGVGEQVNSSGKWKIDSDTSDTENFSIPIPLPPFPRNGSPGRELYY  196

Query  1792  TSARTLASSDTPTYCYIMARSGPPALQYDADSSSEDETVP--LSSSQKPVSQPRS----I  1631
             TSAR+L+SS TPT    +A+   P+  + +  S E+  +   +S+   P +  ++    +
Sbjct  197   TSARSLSSSHTPTAGSFIAQRMSPS--HHSRISIEEPLLGGHISTQSPPSTNTKTMLCLV  254

Query  1630  PRataygtflaaaAH------FPVGGKSLIMEAQTKF---AGRRLLQEHEFDSSVAGQWL  1478
             P      TF    ++      F    K  +++ + K    +G  L +     SS  G +L
Sbjct  255   PIMIFLTTFNFHYSNTEHDTVFEKPNKGFVIQVRRKLLQVSGGLLQESVTGGSSGIGSYL  314

Query  1477  GWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKAN  1298
             GW MAAIYMGGR+PQI LNI+RG VEGLNPLMFVF L+ NATYV SILV S +W +++ N
Sbjct  315   GWAMAAIYMGGRLPQICLNIRRGHVEGLNPLMFVFALVGNATYVASILVNSVDWSRIRPN  374

Query  1297  MPWlldavacvvldLFIILQYLYYTHKKIKKRQQTQS  1187
             +PWL+DA  CV+LD FI++Q++YY ++  ++ +   S
Sbjct  375   LPWLVDAGGCVLLDSFILIQFIYYRYRSFQEDKHENS  411



>ref|XP_006836191.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda]
 gb|ERM99044.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda]
Length=394

 Score =   232 bits (592),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 203/360 (56%), Gaps = 39/360 (11%)
 Frame = -1

Query  2251  RKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFL  2072
              K C  W   Y K C+C++ D +S ++G+IS+I WGVAEIPQI++N+K K+S  +S+AFL
Sbjct  14    NKHCWEWARVYMKYCICDVKDWLSLILGLISVISWGVAEIPQIISNYKEKTSESLSMAFL  73

Query  2071  CTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKC------  1910
              TW+LGD FNL GC+LEPATLPTQF+TA+LY  TT++L LQ+IYY H  P  K       
Sbjct  74    LTWVLGDFFNLFGCLLEPATLPTQFYTAVLYAVTTLILTLQSIYYCHIYPRVKASGPYLS  133

Query  1909  ---RDKNTILVKDNEREALK------QRSRHHRTAPAVEVP---------CQTHYYFTSA  1784
                  ++    K  +RE ++          H+ +   + V               YFTSA
Sbjct  134   PNKSKRDATSEKKTKREYIQTYDSRPSMDDHYVSTSPIPVADTVLPRFSSTGRDLYFTSA  193

Query  1783  RTLASSDTPTYCYIMARSGPPALQYDADSSSEDETVP--LSSSQKPVSQPRSIPRatayg  1610
             R+LASS TPT    +A S    +      S E+  +   +S+   P    +++  + +  
Sbjct  194   RSLASSATPTAGSYLAHSRASPITLLQQHSVEEPLLGAFVSTQSAPPLNTKNMLCSFSAI  253

Query  1609  tflaaaAHFPVGGKSLIMEAQTKFA-------GRRLLQEHEFDSSVA------GQWLGWL  1469
                  + +      S   EA  + +       GR+LLQ     SS+       G ++GW 
Sbjct  254   ILFLGSFNLHRSANSQYNEAMHETSQGVVIQLGRKLLQNVGESSSLGEGHSMVGNFMGWA  313

Query  1468  MAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPW  1289
             M AIYMGGR+PQI LN+KRGSVEGLNPLMF+F LI N+TYVGSILVRS EW K+  N+PW
Sbjct  314   MTAIYMGGRLPQICLNMKRGSVEGLNPLMFIFALIGNSTYVGSILVRSIEWSKIHPNLPW  373



>ref|NP_001159199.1| hypothetical protein [Zea mays]
 ref|XP_008673042.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25379.1| unknown [Zea mays]
 tpg|DAA54054.1| TPA: hypothetical protein ZEAMMB73_248271 [Zea mays]
 tpg|DAA54055.1| TPA: hypothetical protein ZEAMMB73_248271 [Zea mays]
Length=418

 Score =   232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 161/406 (40%), Positives = 222/406 (55%), Gaps = 47/406 (12%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFK  2108
             +GG   + C   R  C  W   Y + CLC+  +  +  +G+IS+I WG AE+PQI+TN++
Sbjct  4     LGGAPPASCPATRH-CAEWARIYLRYCLCSQKEGAALALGLISVISWGFAEVPQIMTNYR  62

Query  2107  NKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHF  1928
              KS+ G+S+AFL TWI+GD+FNLVGC LEPATLPTQ + ALLYT TT++L +Q IYY H 
Sbjct  63    QKSTEGLSVAFLMTWIVGDLFNLVGCFLEPATLPTQMYMALLYTITTLILTVQTIYYSHI  122

Query  1927  ---LPWWKCRDKNTILVKDNEREALKQR---------SRHHRTAPAVEVPC---------  1811
                L   K R  +          +L++R         SR++ +   V +P          
Sbjct  123   YHRLEAKKSRAASKAQKHQRADASLRERLLGAKDGVLSRNNGSDATVLIPSSPIPVNVKL  182

Query  1810  ---------QTHYYFTSARTLASSDTPTYCYIMARS-----GPPALQYDADSSSEDETVP  1673
                       T YY+ SAR+L+ S  PT    +  +      PP    D   S   E  P
Sbjct  183   VDQYHGSSPNTDYYYMSARSLSRSPVPTAGTWLGSNRQSLMTPPQTN-DQRGSLIGEIAP  241

Query  1672  LSSSQKPVSQPRSIPRataygtflaaaAHFPVGGKSLIMEAQTKF-AGRRLLQ--EHEFD  1502
               S+   V++                  H  +G     M + T    GRRLL   E   +
Sbjct  242   AHSAPSTVTKNALSVAPWMGLLLGTCLLHILIGNTHREMPSGTVIPVGRRLLVFVEGHGN  301

Query  1501  SSVA-------GQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVG  1343
             SS++       G++LGW MA IYMGGR+PQI LN++RG  EGLNPLMF F L+ N+TYVG
Sbjct  302   SSLSHGNGSEIGRYLGWAMAIIYMGGRLPQILLNMQRGHAEGLNPLMFTFALLGNSTYVG  361

Query  1342  SILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIKK  1205
             SILV S +W K+  N+PWL+DA  CV+LD FIILQ+LY+ ++K ++
Sbjct  362   SILVNSLDWSKVGPNLPWLVDAGGCVLLDSFIILQFLYFHYRKQRE  407



>ref|XP_010653691.1| PREDICTED: uncharacterized protein LOC100853498 [Vitis vinifera]
Length=414

 Score =   232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 224/397 (56%), Gaps = 44/397 (11%)
 Frame = -1

Query  2254  ERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAF  2075
               + C  W  ++ K CLC++ DEIS  +G+IS+I W +AEIPQI+TN+K KSS G+S+AF
Sbjct  13    RHQHCSLWAWRFMKFCLCSVKDEISLTLGVISVISWAIAEIPQIITNYKEKSSEGLSIAF  72

Query  2074  LCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLP------WW-  1916
             L TWI+GD+FN++GC LEPATLPTQF+ A+LYT TT++L  Q+IYY H         W+ 
Sbjct  73    LMTWIVGDLFNVLGCFLEPATLPTQFYMAVLYTITTLILTAQSIYYGHIYHRLKSGRWYH  132

Query  1915  ------------KCRDKNTILVKDNEREALKQRSRHHRTAP-----AVEVPC-------Q  1808
                         K R+ N         + LK  S      P      V +P         
Sbjct  133   KEIKPNQTGTINKNREDNNSAGGRQVSDGLKNESNVFGEVPLSSPIPVNLPASPRNISPS  192

Query  1807  THYYFTSARTLASSDTPTYCYIMARSGPPALQYDADSSSED--ETVPLSSSQKPVSQPRS  1634
                Y+ SAR+L+ S  P     +A+       +D++S  E    +V LS S  P S  +S
Sbjct  193   RELYYMSARSLSKSHAPAMGSFLAQRKTSPSVHDSNSLEEPLLSSVVLSQS-APASTTKS  251

Query  1633  IPRataygtflaaaAHF-----PVGGKSLIMEAQTKFA---GRRLLQEHE-FDSSVAGQW  1481
             +    +   F     +F        G +     Q   A   GR LLQ  E   +S  G +
Sbjct  252   MLSMLSATMFFLGCFNFLPSENNRDGIAAEKPNQGGIALKVGRTLLQLSEGGGNSGIGTF  311

Query  1480  LGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKA  1301
             LGW MAAIY+GGR+PQI LNI+RG++EGLNPLMF+F L  NATYVGSILV S +W K+K 
Sbjct  312   LGWSMAAIYLGGRLPQIILNIRRGTIEGLNPLMFLFALTGNATYVGSILVSSLDWSKIKP  371

Query  1300  NMPWlldavacvvldLFIILQYLYYTHKKIKKRQQTQ  1190
             N+PWL+DA  CV+LD FI+ Q++++ H +  + Q+ +
Sbjct  372   NLPWLVDAGGCVLLDAFILTQFIHF-HSRTPEDQENK  407



>ref|XP_004230857.1| PREDICTED: RING finger protein 5-like [Solanum lycopersicum]
 ref|XP_004230858.1| PREDICTED: RING finger protein 5-like [Solanum lycopersicum]
Length=221

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 148/205 (72%), Gaps = 5/205 (2%)
 Frame = +1

Query  253  DAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLY  432
            D+G+FECNICF+LAQDPIVTLCGHL+CWPCLY+WL +HSHS ECP+CKAL+EE KLVP+Y
Sbjct  20   DSGDFECNICFELAQDPIVTLCGHLYCWPCLYEWLQVHSHSHECPICKALIEEHKLVPIY  79

Query  433  GRGKNSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATA  612
            GRGK S+DPRS+  PG+ IP RP GQRP+T AP  D + + +H    + G     PM +A
Sbjct  80   GRGKASSDPRSRLRPGINIPKRPVGQRPQT-APAVDMD-YLRHDEFDSIGGLMSMPMPSA  137

Query  613  RFGNFTFSAAVGGLFPSLFNI-QLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGFPQHTN  789
            RF N T SA VG + P+LF++  ++G+ ++  YG ++G P+ +  +FHGG+AHGF  H+N
Sbjct  138  RFENSTLSALVGAI-PALFSLNNVHGFHDATVYGATSGVPYLFSGSFHGGYAHGF-HHSN  195

Query  790  QQQQADSNLKWLFLFIGITVILALI  864
                    +K LFL  G  +I++LI
Sbjct  196  HLDWTKFFMKVLFLIAGFLLIVSLI  220



>ref|XP_002442611.1| hypothetical protein SORBIDRAFT_08g022940 [Sorghum bicolor]
 gb|EES16449.1| hypothetical protein SORBIDRAFT_08g022940 [Sorghum bicolor]
Length=232

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 149/213 (70%), Gaps = 13/213 (6%)
 Frame = +1

Query  259  GNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGR  438
            G+FECNICF+L Q+PIVTLCGHLFCWPCLYKWL IHSHS ECPVCKA+VEE+KLVPLYGR
Sbjct  20   GSFECNICFELPQEPIVTLCGHLFCWPCLYKWLRIHSHSPECPVCKAIVEEDKLVPLYGR  79

Query  439  GKNSTDPRSKSIPG-MEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATAR  615
            GK+  DPRSK++PG  +IP+RP GQRP T AP  D N    +        GG  P+A AR
Sbjct  80   GKDRVDPRSKNVPGAADIPNRPAGQRPAT-APQVDPNTHFPNANPNPWFMGGGIPLANAR  138

Query  616  FGNFTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGY----------GNTFHGGHA  765
            +GN+TFSAA GGLFP L + Q++G+P++  YG  AGFP+GY          G+     HA
Sbjct  139  WGNYTFSAAFGGLFP-LLSFQVHGFPDATAYGQPAGFPYGYGHGHGHAFHGGHAGGHAHA  197

Query  766  HGFPQHTNQQQQADSNLKWLFLFIGITVILALI  864
               P+H  QQQQAD  LK L + +G  VI +LI
Sbjct  198  AAAPRHGQQQQQADVYLKALLILVGFLVIASLI  230



>ref|XP_010251613.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X4 [Nelumbo nucifera]
Length=393

 Score =   230 bits (587),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 154/385 (40%), Positives = 210/385 (55%), Gaps = 48/385 (12%)
 Frame = -1

Query  2269  SYCVVERKA-CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSS  2093
             SY V  R   C  W   Y K CLC+  D  S  +G+IS+I WGVAE+PQI+TN+K KS+ 
Sbjct  13    SYPVCPRNLHCSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNYKKKSTE  72

Query  2092  GVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWK  1913
              +S+AFL TWI+GD+FNL GC+LEPATLPTQ++ A+      +  V +  Y ++F     
Sbjct  73    SLSIAFLITWIIGDLFNLFGCLLEPATLPTQYYMAMSPILPEIDAVDKEHYTNNF-----  127

Query  1912  CRDKNTILVKDNEREALKQRSRHHRTAPAVEVP-------CQTHYYFTSARTLASSDTPT  1754
                         ++ AL  R     +   V VP       C    Y+ SAR+L+ S TPT
Sbjct  128   ----------GKKQSALGDRGVLPSSPIPVSVPSHSRDGSCGRELYYMSARSLSRSHTPT  177

Query  1753  Y-CYIMARSGPPALQYDADSSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPV  1577
                ++    G       +D        PL S  +  S   + P  T     + +A  F +
Sbjct  178   AGSHLACPCGYEGTNSISDHDCRSIEEPLLS--RVGSMQSTPPMNTKNMLCVVSALTFFL  235

Query  1576  GGKSLIMEAQTKFA--------------GRRLLQE--------HEFDSSVAGQWLGWLMA  1463
                 L + A ++F+              GRRLLQ+        H   SS  G +LGW MA
Sbjct  236   STFRLQLSANSRFSMYLENQPGGHVIRIGRRLLQKSSGPLLENHGEGSSSVGTFLGWAMA  295

Query  1462  AIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVRSTEWEKMKANMPWll  1283
             AIYMGGR+PQIWLNI+RG V GLNPLMFVF L+ NATYV SILV S    K++ N+PWL+
Sbjct  296   AIYMGGRLPQIWLNIRRGHVGGLNPLMFVFALVGNATYVASILVSSLNLSKIRPNLPWLV  355

Query  1282  davacvvldLFIILQYLYYTHKKIK  1208
             DA  C++LD FII+Q++++ ++K K
Sbjct  356   DAGGCILLDCFIIIQFIHFRYRKPK  380



>emb|CDM82719.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   230 bits (587),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 160/404 (40%), Positives = 218/404 (54%), Gaps = 67/404 (17%)
 Frame = -1

Query  2242  CVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFKNKSSSGVSLAFLCTW  2063
             C  W   Y K CLC+  D ++  +G+ S++ WG+AE+PQI+TN+K KS+ G+S+AFL TW
Sbjct  18    CAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITNYKQKSTEGLSIAFLMTW  77

Query  2062  ILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHFLPWWKCRDKNTILVK  1883
             I+GD+FNLVGC LEPATLPTQF+ ALLYT TTV+L  Q IYY H       +   T   +
Sbjct  78    IVGDLFNLVGCFLEPATLPTQFYMALLYTITTVILTGQTIYYSHIYHLKVKKTGTTAKSQ  137

Query  1882  DNER--------------EALKQ----------------------RSRHHRTAPAVEVPC  1811
              ++R              EA K                       R RH   +P  +   
Sbjct  138   KHQRGDASLREKLLGHRDEAFKNNIQSGPIIPIPSSPIQVNTEVFRQRHGSVSPGSD---  194

Query  1810  QTHYYFTSARTLASSDTPTYCYI----MARSGPPALQYDADSSSEDETVPLSSSQKPVSQ  1643
                YY+ SAR+L+ S  PT  ++         PP +  D  +S   E VP  S+   +++
Sbjct  195   ---YYYASARSLSRSPVPTGTWLGNNRQTTKVPPQMN-DEGASLFGEFVPAQSAPAAITK  250

Query  1642  PR-------SIPRataygtflaaaAH--------FPVGGKSLIMEAQTKFAGRRLLQEHE  1508
                      S+         L   AH         PVG K L++      AG  L   H 
Sbjct  251   NSLSVVPWISVVLGMCVLHILVGTAHRDASNEIIIPVGRKLLVVA--DDHAGSSL--SHG  306

Query  1507  FDSSVAGQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFVLIANATYVGSILVR  1328
               S + G +LGW MA IYMGGR+PQI+LN++RG  EGL+PLMF F L+ N TYVGSILV 
Sbjct  307   SRSGI-GSFLGWAMAVIYMGGRLPQIFLNMQRGHAEGLSPLMFTFALVGNTTYVGSILVN  365

Query  1327  STEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIKKRQQ  1196
             S +W +++ N+PWL+DA  CV+LD FIILQ+LY+ ++K   R +
Sbjct  366   SLDWARLRPNLPWLVDAGGCVLLDSFIILQFLYFHYRKQSGRDE  409



>gb|ACG49102.1| PQ loop repeat family protein [Zea mays]
Length=418

 Score =   230 bits (586),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 219/415 (53%), Gaps = 65/415 (16%)
 Frame = -1

Query  2287  MGGVELSYCVVERKACVGWVNKYFKDCLCNLNDEISFVVGIISLICWGVAEIPQIVTNFK  2108
             +GG   + C   R  C  W   Y K CLC+  +  +  +G+IS++ WG+AE+PQI+TN++
Sbjct  4     IGGTPPASCPATRH-CAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIMTNYR  62

Query  2107  NKSSSGVSLAFLCTWILGDVFNLVGCVLEPATLPTQFFtallytattvvlvlqAIYYDHF  1928
             +KS+ G+S+AFL TWI+GD+FNL GC LEPATLPTQF+ ALLYT TT++L  Q IYY H 
Sbjct  63    HKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMALLYTITTLILTGQTIYYSHI  122

Query  1927  LPWWKCRDKNTILVKDNEREALKQRSRHHRTA--------------------------PA  1826
                 K +         N R A K +   HR A                          P+
Sbjct  123   YHHLKLK---------NSRAASKPQKHQHRDASLREKLLGAKGGAASINNESDTTVLSPS  173

Query  1825  VEVPC------QTH-------YYFTSARTLASSDTPTY-----CYIMARSGPPALQYDAD  1700
               +P       Q H       YY+ SAR+L+ S  PT          +   PP +  D  
Sbjct  174   SPIPVNMKLVDQYHGSSSNADYYYMSARSLSRSPVPTAGIWSGSNRQSSRSPPQMN-DQR  232

Query  1699  SSSEDETVPLSSSQKPVSQPRSIPRataygtflaaaAHFPVGGKSLIMEAQTKFA-GRRL  1523
              S   E  P  S+   V++                  H  +G K   M + T    GRRL
Sbjct  233   GSLIGEIAPEHSAPSTVTKNALSVAPWMGLLLGTCLLHILIGNKHREMASGTVIPIGRRL  292

Query  1522  L---QEHEFDSSVA------GQWLGWLMAAIYMGGRVPQIWLNIKRGSVEGLNPLMFVFV  1370
             L    +H   S         G +LGW MA IYMGGR+PQI LN++RG VEGLNPLMF F 
Sbjct  293   LLFVDDHGNSSLSQSSRSEIGSFLGWAMAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFA  352

Query  1369  LIANATYVGSILVRSTEWEKMKANMPWlldavacvvldLFIILQYLYYTHKKIKK  1205
             L+ N+TYVGSILV S +W K++ N+PWL+++  CV+LD  IILQ+LY+ ++K ++
Sbjct  353   LLGNSTYVGSILVNSLDWSKLRPNLPWLVESGGCVLLDSCIILQFLYFHYRKRRE  407



>gb|AGT17302.1| RING finger protein [Saccharum hybrid cultivar R570]
Length=240

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 137/181 (76%), Gaps = 6/181 (3%)
 Frame = +1

Query  265  FECNICFDLAQDPIVTLCGHLFCWPCLYKWLHIHSHSKECPVCKALVEEEKLVPLYGRGK  444
            FECNIC DLAQDP+VTLCGHLFCW CLY+WLH+H+HS+ECPVCKA+VEE KLVPLYGRG 
Sbjct  41   FECNICLDLAQDPVVTLCGHLFCWSCLYEWLHVHAHSQECPVCKAVVEEGKLVPLYGRGG  100

Query  445  NSTDPRSKSIPGMEIPHRPTGQRPETAAPPPDANAFPQHgfgftggfggfgPMATARFGN  624
            NST PR++S+ G+EIP RPTGQRP TA  P   N +P           G  P+A  R+GN
Sbjct  101  NSTAPRARSVAGVEIPSRPTGQRPSTAPQPDHNNHYPHQ--NPWFMGAGAPPVAGGRWGN  158

Query  625  FTFSAAVGGLFPSLFNIQLNGYPNSANYGTSAGFPFGYGNTFHGGHAHGF--PQHTNQQQ  798
            +TFSAA+GGLFP L + Q++G+P +  YG +AGFP+GYG++FH G+ HGF  P+   Q Q
Sbjct  159  YTFSAAIGGLFP-LLSFQVHGFPQATAYGHAAGFPYGYGHSFH-GYGHGFPAPRRAPQGQ  216

Query  799  Q  801
            Q
Sbjct  217  Q  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7227583433080