BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21938_g2_i1 len=1166 path=[3925:0-1020 3143:1021-1062 105:1063-1117
160:1118-1165]

Length=1166
                                                                      Score     E

ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           393   6e-129   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           388   9e-127   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               386   2e-126   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               385   4e-126   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               385   9e-126   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               382   1e-125   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   3e-125   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               383   5e-125   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   3e-124   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               379   1e-123   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           373   2e-121   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               372   6e-121   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   7e-119   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           363   3e-117   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                363   3e-117   
ref|XP_006375028.1|  hypothetical protein POPTR_0014s03730g             355   1e-116   
gb|ABB20912.1|  P450 mono-oxygenase                                     361   2e-116   Stevia rebaudiana
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           360   5e-116   
ref|XP_006428105.1|  hypothetical protein CICLE_v10027089mg             353   2e-115   
ref|XP_006375024.1|  hypothetical protein POPTR_0014s03690g             355   2e-115   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             357   1e-114   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           364   1e-114   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           356   1e-114   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               356   2e-114   
ref|XP_007017413.1|  Cytochrome P450                                    355   3e-114   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             355   5e-114   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    355   6e-114   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           354   8e-114   
ref|XP_002510313.1|  cytochrome P450, putative                          354   1e-113   Ricinus communis
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             353   1e-113   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    353   1e-113   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    353   2e-113   
ref|XP_006428104.1|  hypothetical protein CICLE_v10027210mg             347   3e-113   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               353   3e-113   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             353   4e-113   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             352   4e-113   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             353   4e-113   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               352   5e-113   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     350   1e-112   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           351   2e-112   
ref|XP_010686300.1|  PREDICTED: cytochrome P450 CYP82D47-like           347   3e-112   
ref|XP_006428103.1|  hypothetical protein CICLE_v10026027mg             343   3e-112   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               350   7e-112   
ref|XP_010686299.1|  PREDICTED: cytochrome P450 CYP82D47-like           349   1e-111   
emb|CDP07593.1|  unnamed protein product                                346   2e-111   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     350   3e-111   
gb|KDO37196.1|  hypothetical protein CISIN_1g019564mg                   340   4e-111   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               347   5e-111   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     345   5e-111   
ref|XP_010686309.1|  PREDICTED: cytochrome P450 CYP82D47-like           346   8e-111   
gb|KHN22284.1|  Cytochrome P450 82A3                                    344   9e-111   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             346   1e-110   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           346   1e-110   
ref|XP_007017415.1|  Cytochrome P450, putative                          346   1e-110   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   2e-110   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   3e-110   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   3e-110   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             345   3e-110   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   5e-110   
ref|XP_010106080.1|  Cytochrome P450 82A3                               348   6e-110   
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           343   7e-110   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               344   9e-110   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               343   9e-110   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     345   1e-109   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         341   2e-109   
emb|CDP16080.1|  unnamed protein product                                343   2e-109   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           343   3e-109   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         342   5e-109   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           341   6e-109   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               341   9e-109   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             341   9e-109   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       341   1e-108   
emb|CBI32508.3|  unnamed protein product                                334   1e-108   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           340   2e-108   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             340   3e-108   
ref|XP_002510312.1|  cytochrome P450, putative                          339   4e-108   Ricinus communis
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           339   7e-108   Vitis vinifera
gb|KHN42045.1|  Cytochrome P450 82C4                                    337   7e-108   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    339   8e-108   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               338   1e-107   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             337   1e-107   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               338   1e-107   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           338   1e-107   
emb|CDP07595.1|  unnamed protein product                                347   2e-107   
gb|KHN22283.1|  Cytochrome P450 82C4                                    335   2e-107   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               337   2e-107   
ref|XP_010106079.1|  Cytochrome P450 82A3                               337   3e-107   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           337   5e-107   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   336   6e-107   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               334   9e-107   
gb|KDP20667.1|  hypothetical protein JCGZ_03867                         332   1e-106   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             335   2e-106   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               335   2e-106   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    335   2e-106   Vitis vinifera
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               335   3e-106   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     341   3e-106   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         335   3e-106   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             334   4e-106   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               334   5e-106   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            334   6e-106   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    333   6e-106   Vitis vinifera
emb|CBI32517.3|  unnamed protein product                                326   6e-106   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           333   8e-106   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     333   9e-106   Vitis vinifera
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               334   9e-106   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     333   1e-105   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           333   1e-105   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   333   1e-105   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             333   1e-105   
ref|XP_006384482.1|  hypothetical protein POPTR_0004s15470g             327   2e-105   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               331   2e-105   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    332   2e-105   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             332   3e-105   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           332   3e-105   
gb|KFK29807.1|  hypothetical protein AALP_AA7G181700                    326   3e-105   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               332   4e-105   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             332   4e-105   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               332   4e-105   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               332   4e-105   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             332   4e-105   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    332   5e-105   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                331   5e-105   
emb|CBI40977.3|  unnamed protein product                                332   6e-105   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         331   8e-105   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             331   8e-105   
emb|CBI19611.3|  unnamed protein product                                341   1e-104   
ref|XP_002510308.1|  cytochrome P450, putative                          330   2e-104   Ricinus communis
gb|KHG26594.1|  Cytochrome P450                                         330   2e-104   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     330   2e-104   Vitis vinifera
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           330   2e-104   
emb|CBI19610.3|  unnamed protein product                                341   2e-104   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    330   2e-104   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               330   2e-104   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             328   3e-104   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             330   3e-104   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           329   3e-104   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         329   5e-104   
ref|XP_002510311.1|  cytochrome P450, putative                          328   5e-104   Ricinus communis
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   328   5e-104   
gb|KHN42044.1|  Cytochrome P450 82A3                                    329   5e-104   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               329   6e-104   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               341   7e-104   
emb|CDY53704.1|  BnaC03g67210D                                          328   8e-104   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             328   9e-104   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             328   9e-104   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   328   9e-104   
gb|KHN36186.1|  Cytochrome P450 82A3                                    328   1e-103   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               328   1e-103   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           327   1e-103   
gb|AII31759.1|  cytochrome P450 monooxygenase                           327   1e-103   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             325   2e-103   
emb|CDY23316.1|  BnaA08g12300D                                          327   2e-103   
gb|KHG29694.1|  Cytochrome P450                                         327   2e-103   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    327   2e-103   Vitis vinifera
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           327   2e-103   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           327   2e-103   
ref|XP_007017411.1|  Cytochrome P450, putative                          327   2e-103   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           327   3e-103   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             327   3e-103   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               327   3e-103   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    327   3e-103   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             327   3e-103   
gb|KHG29695.1|  Cytochrome P450                                         327   4e-103   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               327   4e-103   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    333   4e-103   Vitis vinifera
gb|KHN00733.1|  Cytochrome P450 82A4                                    326   5e-103   
gb|AES74584.2|  cytochrome P450 family protein                          327   5e-103   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    326   5e-103   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               326   6e-103   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                326   6e-103   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               326   6e-103   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           326   6e-103   
ref|XP_007047111.1|  Cytochrome P450                                    326   6e-103   
gb|AII31758.1|  cytochrome P450 monooxygenase                           326   8e-103   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         325   8e-103   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               325   1e-102   
ref|XP_010106088.1|  Cytochrome P450 82A4                               325   1e-102   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               325   1e-102   Vitis vinifera
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           325   1e-102   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               325   1e-102   
gb|KFK29810.1|  hypothetical protein AALP_AA7G181800                    320   1e-102   
dbj|BAF98469.1|  cytochrome P450                                        324   2e-102   Coptis japonica var. dissecta
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               325   2e-102   
ref|NP_001240972.1|  cytochrome P450 82A3                               324   3e-102   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             324   3e-102   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           324   4e-102   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                324   4e-102   Vitis vinifera
ref|XP_006431673.1|  hypothetical protein CICLE_v10003405mg             318   5e-102   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               324   6e-102   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           323   6e-102   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             323   7e-102   
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             323   8e-102   
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    323   8e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AII31760.1|  cytochrome P450 monooxygenase                           323   1e-101   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               323   1e-101   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           323   1e-101   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                322   2e-101   Vitis vinifera
ref|XP_002510298.1|  cytochrome P450, putative                          322   2e-101   Ricinus communis
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             322   2e-101   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    322   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               322   2e-101   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     322   2e-101   
gb|KHN16362.1|  Cytochrome P450 82A3                                    322   3e-101   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               322   3e-101   
ref|XP_002869304.1|  CYP82C4                                            322   3e-101   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             322   3e-101   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    322   3e-101   
ref|XP_007226806.1|  hypothetical protein PRUPE_ppa017795mg             319   3e-101   
gb|KHN36187.1|  Cytochrome P450 82A3                                    322   4e-101   
gb|KHG01290.1|  Cytochrome P450                                         321   4e-101   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               321   4e-101   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               321   4e-101   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               322   4e-101   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               321   5e-101   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             321   5e-101   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               321   6e-101   
ref|XP_010026987.1|  PREDICTED: cytochrome P450 CYP82D47-like           318   6e-101   
ref|XP_010092357.1|  Cytochrome P450 82A3                               321   6e-101   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    321   7e-101   
gb|KHN04536.1|  Cytochrome P450 82A1                                    319   9e-101   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           320   1e-100   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             320   1e-100   
ref|XP_010026403.1|  PREDICTED: cytochrome P450 82C4-like               318   1e-100   
emb|CBI32505.3|  unnamed protein product                                332   1e-100   
gb|KHN34164.1|  Cytochrome P450 82A4                                    320   1e-100   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               333   1e-100   Vitis vinifera
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               320   1e-100   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               320   2e-100   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               320   2e-100   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             320   2e-100   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    319   2e-100   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     319   3e-100   
ref|XP_003619137.1|  Cytochrome P450                                    319   3e-100   
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           319   4e-100   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           319   4e-100   Vitis vinifera
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               319   4e-100   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               317   5e-100   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             318   6e-100   
ref|XP_009365936.1|  PREDICTED: cytochrome P450 82A3-like               312   6e-100   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   318   6e-100   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               318   6e-100   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             318   7e-100   
gb|KEH33015.1|  cytochrome P450 family 82 protein                       318   7e-100   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             318   7e-100   
ref|XP_002869302.1|  CYP82C4                                            318   8e-100   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     330   8e-100   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     318   8e-100   Vitis vinifera
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           318   1e-99    Vitis vinifera
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               318   1e-99    
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               318   1e-99    
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             318   1e-99    
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         318   1e-99    
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           317   1e-99    
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               318   1e-99    
gb|KEH30997.1|  cytochrome P450 family protein                          317   1e-99    
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           318   1e-99    
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               317   1e-99    
emb|CAN64501.1|  hypothetical protein VITISV_020341                     315   1e-99    Vitis vinifera
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               315   2e-99    
ref|XP_007158552.1|  hypothetical protein PHAVU_002G161900g             311   2e-99    
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               317   2e-99    
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               317   2e-99    
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           317   2e-99    
ref|XP_003619141.1|  Cytochrome P450                                    317   2e-99    
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             317   3e-99    
ref|XP_007222289.1|  hypothetical protein PRUPE_ppa005918mg             313   3e-99    
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               317   3e-99    
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   317   3e-99    
ref|XP_002510301.1|  cytochrome P450, putative                          315   4e-99    Ricinus communis
ref|XP_007033359.1|  Cytochrome P450                                    315   4e-99    
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           315   5e-99    
gb|KHN44000.1|  Cytochrome P450 82A4                                    316   5e-99    
gb|KGN59915.1|  Cytochrome P450                                         316   6e-99    
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                315   6e-99    Vitis vinifera
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             316   6e-99    
ref|XP_010106089.1|  Cytochrome P450 82C4                               316   7e-99    
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               316   7e-99    
ref|XP_010106082.1|  Cytochrome P450 82A3                               315   9e-99    
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           315   9e-99    
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             315   1e-98    
emb|CBI32510.3|  unnamed protein product                                317   1e-98    
ref|XP_008454675.1|  PREDICTED: cytochrome P450 CYP82D47-like           310   1e-98    
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           315   1e-98    
ref|XP_010089020.1|  Cytochrome P450 82A3                               314   2e-98    
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           315   2e-98    
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                317   2e-98    
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   2e-98    
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               314   2e-98    
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               314   2e-98    
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   312   2e-98    
ref|XP_007047112.1|  Cytochrome P450                                    318   3e-98    
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   3e-98    
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           314   3e-98    
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             311   4e-98    
gb|KHN13272.1|  Cytochrome P450 82A4                                    313   6e-98    
gb|KHG07801.1|  Cytochrome P450                                         313   6e-98    
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           313   6e-98    
ref|XP_007136642.1|  hypothetical protein PHAVU_009G061400g             311   7e-98    
gb|KEH30993.1|  cytochrome P450 family protein                          313   7e-98    
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             313   7e-98    
ref|XP_004147805.1|  PREDICTED: cytochrome P450 82A3-like               313   8e-98    
ref|XP_004154823.1|  PREDICTED: cytochrome P450 82A3-like               313   8e-98    
gb|AGC29951.1|  CYP82D61                                                310   8e-98    
ref|XP_003618363.1|  Cytochrome P450                                    313   1e-97    
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               313   1e-97    
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    325   1e-97    
ref|XP_002522370.1|  cytochrome P450, putative                          312   1e-97    
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               312   1e-97    
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               312   2e-97    
gb|AGO03797.1|  cytochrome P450-like protein                            311   2e-97    
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             311   2e-97    
ref|XP_010106083.1|  Cytochrome P450 82A3                               311   2e-97    
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    311   2e-97    
gb|AGN54072.1|  cytochrome P450 monooxygenase                           311   2e-97    
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           311   3e-97    
ref|XP_003618354.1|  Cytochrome P450                                    311   3e-97    
ref|XP_008219200.1|  PREDICTED: cytochrome P450 82A1-like               307   3e-97    
gb|KCW67755.1|  hypothetical protein EUGRSUZ_F01490                     310   4e-97    
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    311   4e-97    
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           311   4e-97    
gb|KGN59907.1|  hypothetical protein Csa_3G852560                       312   5e-97    
gb|ABK28662.1|  unknown                                                 310   6e-97    
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    310   6e-97    
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               311   6e-97    
ref|XP_008388074.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    303   6e-97    
ref|XP_003604789.1|  Cytochrome P450                                    311   6e-97    
gb|AFK38862.1|  unknown                                                 310   8e-97    
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                310   8e-97    
ref|XP_008464762.1|  PREDICTED: cytochrome P450 CYP82D47-like           310   9e-97    
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               310   1e-96    
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           309   1e-96    
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               310   1e-96    
gb|KDP20666.1|  hypothetical protein JCGZ_03866                         305   2e-96    
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           309   2e-96    
emb|CAN65652.1|  hypothetical protein VITISV_016780                     307   3e-96    
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               309   3e-96    
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               309   3e-96    
ref|XP_003618345.1|  Cytochrome P450                                    308   3e-96    
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             308   4e-96    
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           308   5e-96    
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     307   5e-96    
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               308   6e-96    
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   308   7e-96    
gb|AAP49697.1|  cytochrome P-450-like protein                           298   8e-96    
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           305   9e-96    
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               306   1e-95    
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                306   2e-95    
gb|AES74583.2|  cytochrome P450 family 82 protein                       307   2e-95    
emb|CAN72749.1|  hypothetical protein VITISV_004418                     298   2e-95    
ref|XP_003618365.1|  Cytochrome P450                                    307   2e-95    
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               306   3e-95    
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               306   3e-95    
ref|XP_009365916.1|  PREDICTED: cytochrome P450 82A4-like               302   3e-95    
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           306   4e-95    
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               305   4e-95    
gb|AAS90126.1|  cytochrome P450                                         306   4e-95    
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           306   5e-95    
ref|XP_002313829.2|  hypothetical protein POPTR_0009s11180g             301   6e-95    
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             304   7e-95    
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     305   7e-95    
gb|KHN19614.1|  Cytochrome P450 82A4                                    305   8e-95    
emb|CAN76287.1|  hypothetical protein VITISV_027433                     305   1e-94    
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           305   1e-94    
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         305   1e-94    
gb|KDO57195.1|  hypothetical protein CISIN_1g0450771mg                  299   1e-94    
gb|KDO38290.1|  hypothetical protein CISIN_1g0485651mg                  297   1e-94    
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           304   2e-94    
ref|XP_002510297.1|  cytochrome P450, putative                          304   2e-94    
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     304   2e-94    
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               303   3e-94    
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             303   3e-94    
gb|KHN39915.1|  Cytochrome P450 82A2                                    300   4e-94    
ref|XP_004147821.1|  PREDICTED: cytochrome P450 82A3-like               303   4e-94    
gb|EYU23761.1|  hypothetical protein MIMGU_mgv1a004606mg                303   5e-94    
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     303   5e-94    
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             303   5e-94    
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           303   5e-94    
ref|XP_003618366.1|  Cytochrome P450                                    305   5e-94    
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           303   8e-94    
gb|KDP34891.1|  hypothetical protein JCGZ_09179                         299   9e-94    
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           302   9e-94    
ref|XP_006375029.1|  putative cytochrome P450 family protein            302   9e-94    
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               302   1e-93    
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             301   1e-93    
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    302   1e-93    
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              302   1e-93    
ref|XP_006431671.1|  hypothetical protein CICLE_v10002486mg             291   1e-93    
ref|XP_011083776.1|  PREDICTED: cytochrome P450 CYP82D47-like           302   1e-93    
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   302   3e-93    
ref|XP_006432703.1|  hypothetical protein CICLE_v10003959mg             298   3e-93    
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         301   3e-93    
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    301   3e-93    
ref|XP_003546624.1|  PREDICTED: cytochrome P450 82A2-like               300   5e-93    
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         301   5e-93    
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    300   5e-93    
gb|KHG24650.1|  Cytochrome P450 protein                                 300   6e-93    
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    300   7e-93    
gb|KEH37856.1|  cytochrome P450 family protein                          300   8e-93    
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               299   8e-93    
ref|XP_007226237.1|  hypothetical protein PRUPE_ppa017476mg             296   1e-92    
gb|KHG01223.1|  Cytochrome P450 protein                                 299   1e-92    
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           299   1e-92    
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           301   1e-92    
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         299   2e-92    
ref|XP_004147824.1|  PREDICTED: cytochrome P450 82A3-like               299   2e-92    
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               298   3e-92    
gb|KHN16363.1|  Cytochrome P450 82A4                                    298   4e-92    
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         298   5e-92    
ref|XP_003618361.1|  Cytochrome P450                                    297   1e-91    
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    297   1e-91    
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               301   1e-91    
ref|XP_007049681.1|  Cytochrome P450                                    296   2e-91    
gb|KHN36747.1|  Cytochrome P450 82A2                                    293   2e-91    
ref|XP_004154827.1|  PREDICTED: cytochrome P450 82C4-like               287   3e-91    
ref|XP_006366436.1|  PREDICTED: cytochrome P450 82A3-like               287   3e-91    
ref|XP_002531093.1|  cytochrome P450, putative                          295   4e-91    
emb|CBI36489.3|  unnamed protein product                                288   4e-91    
emb|CBI32515.3|  unnamed protein product                                287   5e-91    
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             295   7e-91    
ref|XP_010104162.1|  Cytochrome P450 82C4                               293   7e-91    
ref|XP_007041358.1|  Cytochrome P450, putative                          294   7e-91    
ref|XP_002510305.1|  cytochrome P450, putative                          295   8e-91    
gb|AJD25200.1|  cytochrome P450 CYP82D70                                294   1e-90    
gb|KHN22285.1|  Cytochrome P450 82A4                                    294   2e-90    
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               294   2e-90    
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               294   2e-90    
emb|CAN77159.1|  hypothetical protein VITISV_019026                     296   2e-90    
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               293   2e-90    
gb|KCW55291.1|  hypothetical protein EUGRSUZ_I01217                     286   2e-90    
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               293   2e-90    
emb|CBI36493.3|  unnamed protein product                                287   3e-90    
ref|NP_001240077.1|  cytochrome P450 82A2                               293   3e-90    
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     293   3e-90    
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             293   5e-90    
ref|XP_006376421.1|  cytochrome P450 family protein                     292   5e-90    
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    294   6e-90    
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 292   6e-90    
emb|CAN75482.1|  hypothetical protein VITISV_020998                     291   7e-90    
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             291   7e-90    
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                292   7e-90    
gb|KCW55290.1|  hypothetical protein EUGRSUZ_I01217                     287   9e-90    
ref|XP_004154900.1|  PREDICTED: cytochrome P450 82A3-like               292   1e-89    
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     291   1e-89    
sp|H2DH24.1|C7D47_PANGI  RecName: Full=Cytochrome P450 CYP82D47         286   1e-89    
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                291   1e-89    
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               300   2e-89    
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           291   2e-89    
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               291   2e-89    
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               291   2e-89    
ref|XP_007017407.1|  Cytochrome P450                                    291   2e-89    
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           291   2e-89    
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               291   2e-89    
emb|CBI29742.3|  unnamed protein product                                281   3e-89    
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    290   4e-89    
ref|XP_010060879.1|  PREDICTED: cytochrome P450 CYP82D47-like           290   4e-89    
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               290   5e-89    
emb|CAN63328.1|  hypothetical protein VITISV_012723                     279   9e-89    
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               290   1e-88    
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               289   1e-88    
emb|CDP15727.1|  unnamed protein product                                290   1e-88    
ref|XP_004154896.1|  PREDICTED: cytochrome P450 82A4-like               289   1e-88    
prf||2209439B  cytochrome P450 monooxygenase                            289   1e-88 
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             288   2e-88    
ref|XP_002510306.1|  cytochrome P450, putative                          289   2e-88    
emb|CBI29738.3|  unnamed protein product                                294   2e-88    
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             288   2e-88    
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           289   2e-88    
ref|XP_004147825.1|  PREDICTED: cytochrome P450 82C4-like               289   2e-88    
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    288   2e-88    
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         288   2e-88    
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           288   2e-88    
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           289   2e-88    
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         288   2e-88    
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 288   3e-88    
ref|XP_003618351.1|  Cytochrome P450 82A1                               288   4e-88    
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             288   4e-88    
ref|XP_008464763.1|  PREDICTED: cytochrome P450 82A3-like               288   4e-88    
emb|CDP15728.1|  unnamed protein product                                288   5e-88    
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 287   7e-88    
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               287   8e-88    
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               286   1e-87    
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           286   1e-87    
gb|EYU23760.1|  hypothetical protein MIMGU_mgv1a026908mg                286   1e-87    
gb|KHG29587.1|  Cytochrome P450 protein                                 286   1e-87    
ref|XP_011099830.1|  PREDICTED: cytochrome P450 CYP82D47-like           286   1e-87    
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         286   2e-87    
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               286   2e-87    
gb|KHN08850.1|  Cytochrome P450 82C4                                    283   2e-87    
sp|F2Z9C1.1|P6H_ESCCA  RecName: Full=Protopine 6-monooxygenase; A...    286   2e-87    
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             286   2e-87    
gb|KGN59911.1|  hypothetical protein Csa_3G852600                       286   3e-87    
ref|XP_004147823.1|  PREDICTED: cytochrome P450 82A3-like               286   3e-87    
ref|XP_004168433.1|  PREDICTED: cytochrome P450 82A3-like               286   3e-87    
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             285   3e-87    
gb|KCW68809.1|  hypothetical protein EUGRSUZ_F02408                     283   4e-87    
ref|XP_004154824.1|  PREDICTED: cytochrome P450 82C4-like isoform 1     277   4e-87    
ref|XP_006479335.1|  PREDICTED: cytochrome P450 82G1-like               280   6e-87    
ref|XP_002531094.1|  cytochrome P450, putative                          284   8e-87    
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           284   1e-86    
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             284   2e-86    



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 248/336 (74%), Gaps = 13/336 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFG----EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             + N +V MLFG      E  E  +  +A RR FEL G + VADF+P+LRWLDIGGHEKAM
Sbjct  191   IMNTMVKMLFGVRYTGKEEEERGRAHKAIRRFFELMGVSAVADFLPYLRWLDIGGHEKAM  250

Query  996   RETAMEMESFAERWMeehkrkrksksskee-EADFMDTMLSLFETTASSSHQSRLPGGYD  820
             +ETA EM+S  E W+ EH+R+R+ +  K   E D MD MLS+ E          LPG +D
Sbjct  251   KETANEMDSLVEEWLAEHRRQRELRGIKYGDEEDLMDVMLSICE-------DRDLPG-FD  302

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D IIK+TCLA+  A TDTT VTL W LSL+LNNY++L++ QDELD HVGK R V+ESD+
Sbjct  303   ADTIIKATCLALQSAGTDTTIVTLTWTLSLILNNYQILKKAQDELDAHVGKHRWVQESDI  362

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             K L+YLQA++KE +RLYPA PL +PHE +EDC I+ Y I KGTRL+ N  KIH DP +W 
Sbjct  363   KNLVYLQAIVKEALRLYPAAPLLLPHECIEDCDISGYDIPKGTRLLVNIWKIHYDPDLWP  422

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P+EF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPGIS+ L++VQ  LA L+ GF+++
Sbjct  423   NPEEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGISMGLQVVQYVLAVLLQGFEIK  482

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             R S+EPID++ES GLT  KA+PL+ LL PRL  NLY
Sbjct  483   RPSDEPIDMSESFGLTILKASPLEILLAPRLAPNLY  518



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   388 bits (996),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 245/337 (73%), Gaps = 17/337 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             V N +  +LFG      EDE +  +K  +A RR FEL GA VVADF+P+LRWLDIGGHEK
Sbjct  213   VMNTMGKILFGKGRRSNEDEGI--NKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEK  270

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+E + EM+S  E W+ EHK KR    S EEE DFMD MLS+ E          LPG +
Sbjct  271   AMKEVSKEMDSVVEEWLTEHKTKRGIIKSGEEE-DFMDVMLSICE-------DRDLPG-F  321

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D  IK+ C+ +L A TDTT VTL WAL L+LNNYE L++ QDELD HVG  R V+ESD
Sbjct  322   DADTAIKANCMGLLSAGTDTTIVTLTWALCLLLNNYEALKKAQDELDAHVGNNRWVQESD  381

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KE +RLYPA PLSVPHE+MEDC+I  Y I KGTRL+ N  KI  DP +W
Sbjct  382   IKNLVYLQAIVKEVLRLYPAGPLSVPHESMEDCVIGGYDIPKGTRLLVNLWKIQHDPNIW  441

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFL+ HKDVDV+GN+FEL+PFGSGRRMCPGISLAL++V   +A L+ GFDM
Sbjct  442   PNPHEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVVPFVIAVLLQGFDM  501

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +R S+E ID++ES GLT  KA+PLQ LL PRL S LY
Sbjct  502   KRPSDEAIDMSESFGLTVLKASPLQVLLAPRLASVLY  538



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 255/338 (75%), Gaps = 17/338 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             + N +V +LFG      EDE  E SK  +A +RL EL GA VVADF+P+LRWLDIGGHEK
Sbjct  188   IMNTMVKLLFGVQYTGNEDE--ERSKAHKAIQRLLELLGAFVVADFLPYLRWLDIGGHEK  245

Query  1002  AMRETAMEMESFAERWMeehkrkrkskssk-eeEADFMDTMLSLFETTASSSHQSRLPGG  826
              M+ TA E++   E W+ EH+RKRK + +   +E DFMD MLS+ E    + H      G
Sbjct  246   IMKSTAKEIDFIVEDWLAEHRRKRKLRGNNCGDEEDFMDVMLSICED--KNLH------G  297

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +DTD IIK+TC+A+  A TDTT VTLIW LSL+LNNYE L++ QDELDTH+GK R V+ES
Sbjct  298   FDTDAIIKATCMALQTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQES  357

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA++KE+ RLYPA PL +PHE++EDC+++ Y I KGTRL+ N  K+  DP++
Sbjct  358   DIKNLVYLQAIVKESFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEI  417

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPG+SLAL+++Q  ++ L+ GFD
Sbjct  418   WPNPHEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFD  477

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++R S+E ID++ES GLT  KA+PL+  L PRL+SNLY
Sbjct  478   IKRPSDEAIDMSESFGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   385 bits (989),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 238/333 (71%), Gaps = 13/333 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVE--ESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRE  991
             V N +  MLFG     E    K  +A RR FEL GA VVAD++P+LRWLDIGG+EKAM+E
Sbjct  189   VMNTIQKMLFGSSNEEEGINYKAHKAIRRYFELAGAFVVADYLPYLRWLDIGGYEKAMKE  248

Query  990   TAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQ  811
              + EM+S  E W+ EHK K+      E   DFMD MLS+ E          LP  +D+D 
Sbjct  249   VSKEMDSVVEEWLAEHKTKKIKSGEVE---DFMDVMLSICE-------NKHLPA-FDSDT  297

Query  810   IIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKEL  631
              IK+TC+ +L A TDTT VTL W L L+LNNYE L++ QDE+D HVGK   V+ESD+K L
Sbjct  298   AIKATCMGILSAGTDTTIVTLTWILCLLLNNYEALQKAQDEIDAHVGKNTWVQESDIKNL  357

Query  630   IYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPD  451
             +YLQA++KE +RLYPA PLSVPHE+MEDC+I  Y I KGTRL+ N  KIH DP +W  P 
Sbjct  358   VYLQAIVKEALRLYPAGPLSVPHESMEDCVIGGYDIPKGTRLLVNLWKIHHDPNIWKNPH  417

Query  450   EFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRIS  271
             EF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPGISL L++V   +A L+ GFDM+R S
Sbjct  418   EFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGISLVLQVVPFVIAMLLQGFDMKRPS  477

Query  270   NEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +EPID++ES GL+  KA+PL+ LL PRL   LY
Sbjct  478   DEPIDMSESFGLSVLKASPLEVLLAPRLAPVLY  510



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   385 bits (988),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 243/337 (72%), Gaps = 16/337 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             V N +  MLFG      EDE +  +   +A RR FEL GA VVADF+P+LRWLDIGGHEK
Sbjct  194   VMNTMGKMLFGKGRRSNEDEGINNA--HKAIRRFFELLGAFVVADFLPYLRWLDIGGHEK  251

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++ + EM+S  E W+ EHK KR+   S E E DFMD MLS+ E          LP  +
Sbjct  252   AMKKVSREMDSVVEEWLAEHKTKREIIKSGEAEEDFMDVMLSICENRG-------LPE-F  303

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D  IK+TC+ +L A TDTT VT  W LSL+LNNYE L++ QDELD HVGK R V+ESD
Sbjct  304   DADTAIKATCMGVLAAGTDTTIVTSTWTLSLLLNNYESLKKAQDELDAHVGKNRWVQESD  363

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KE +RLYPA PL+VPHE+MEDC I+ Y I KGTRL+ N  KIH DP +W
Sbjct  364   IKNLVYLQAIVKEALRLYPAAPLAVPHESMEDCTISGYDIPKGTRLLVNIWKIHHDPNIW  423

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFLT HKDVDV+GN+FELIPFGSGRRMCPGISL L++V   +A L+ GF++
Sbjct  424   PNPHEFKPERFLTTHKDVDVKGNHFELIPFGSGRRMCPGISLTLQVVPFVIAVLLQGFNI  483

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +R S+EPID++E  GLT  KA+PL+ LL PRL   LY
Sbjct  484   KRPSDEPIDMSEIFGLTVLKASPLEVLLAPRLAPVLY  520



>ref|XP_006366469.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=455

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 252/338 (75%), Gaps = 16/338 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             + N +V MLFG      EDE  ++SK  +A RRLFEL GA VVADF+P+LRWLDIGGHEK
Sbjct  125   IMNTMVKMLFGVQYKGNEDE--QKSKAHKAIRRLFELLGAFVVADFLPYLRWLDIGGHEK  182

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEAD-FMDTMLSLFETTASSSHQSRLPGG  826
             AM+ETA E++   E W+ EH+RKRK + +K ++ D FMD MLS+        H+ +   G
Sbjct  183   AMKETAKEIDFIVEDWLSEHRRKRKLRGNKCKDEDDFMDVMLSI-------CHEDKNIHG  235

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +D D  IK+TC+ ML A T TT VTLIW LSL+LNNYE L++ QDELDTH+GK R V+ES
Sbjct  236   FDVDTTIKATCMIMLSAGTVTTIVTLIWTLSLLLNNYEALKKAQDELDTHIGKNRWVQES  295

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKE++RLY   PL +PHE++EDC+++ Y I KGTRL+ N  K+  DPK+
Sbjct  296   DIKNLVYLQAIIKESLRLYSPGPLLLPHESIEDCVVSGYDIPKGTRLLVNVWKLRNDPKI  355

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EF+PERFLT HK+VDVRGN+FELIPFG+GRR+CPG S AL++VQ  LA L+ GFD
Sbjct  356   WPNPHEFKPERFLTTHKNVDVRGNHFELIPFGTGRRICPGTSFALQVVQYVLAILLQGFD  415

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++R S+E ID++ES GLT  KA+PL+    PRL SNLY
Sbjct  416   IKRPSDEAIDMSESFGLTILKASPLEVHPTPRLNSNLY  453



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 245/335 (73%), Gaps = 17/335 (5%)
 Frame = -3

Query  1158  NMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             N +  +LFG      EDE +  +K  +A RR FEL G  VVADF+P+LRWLDIGGHEKAM
Sbjct  196   NTMGKILFGKGRRSNEDEGI--NKAHKAIRRFFELLGVFVVADFLPYLRWLDIGGHEKAM  253

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             +E + EM+S  E W+ EHK KR    S EE  DFMD MLS+ E          LPG  D 
Sbjct  254   KEVSKEMDSVVEEWLTEHKTKRGIIKSGEE-EDFMDVMLSVCE-------DRDLPG-VDA  304

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
             D  IK+TC+A+L A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK R V+ESD+K
Sbjct  305   DTAIKATCMALLSAGTDTTMVTLTWILSLLLNNYQSLQKAQDELDAHVGKNRWVQESDIK  364

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
              L+Y QA++KE +RLYPA PLS+PHE+MEDC I+ Y I KGTRL+ N  KI RDP +W  
Sbjct  365   NLVYFQAIVKEALRLYPAGPLSLPHESMEDCTISGYDIPKGTRLLVNIWKIQRDPNIWPN  424

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             P EF+PERFL+ HKDVDV+GN+FEL+PFGSGRRMCPGISLAL+++   +A L+ GFDM+R
Sbjct  425   PHEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKR  484

Query  276   ISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             + +EPID++ES GLT  KA+PL+ LL PRL  +LY
Sbjct  485   LLDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  519



>ref|XP_006366437.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=520

 Score =   383 bits (983),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 202/337 (60%), Positives = 249/337 (74%), Gaps = 16/337 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             V N +  MLFG      EDE +  +K  +A RR FEL GA VVADF+P+LRWLDIGGHEK
Sbjct  193   VMNTMGKMLFGKGRRSNEDEGI--NKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEK  250

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+E + EM+S  E W+ EHK KR    S E E DFMD MLS+ E          LPG +
Sbjct  251   AMKEVSKEMDSVVEEWLTEHKTKRGIIKSGEAEEDFMDVMLSICE-------DRDLPG-F  302

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D  IK+TC+A+L A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK R V+ESD
Sbjct  303   DADTAIKATCMALLSAGTDTTIVTLTWTLSLLLNNYQALQKAQDELDAHVGKNRWVQESD  362

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KE +RLYPA PLSVPHE+MEDC I+ Y I  GTRL+ N  KIH DP +W
Sbjct  363   IKNLVYLQAIVKEGLRLYPAAPLSVPHESMEDCTISGYDIPNGTRLLVNLWKIHHDPNIW  422

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFL+ HKDVDV+GN+FEL+PFGSGRRMCPGISLAL+++   +A L+ GFDM
Sbjct  423   PNPHEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDM  482

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +R+S+EPID++ES GLT  KA+PL+ LL PRL  +LY
Sbjct  483   KRLSDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  519



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 247/334 (74%), Gaps = 11/334 (3%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEE--SKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRE  991
             + N +V MLFG++    E  +K  +A RR FEL GA VVADF+P+LRWLDIGGHEKAM+E
Sbjct  197   IMNTMVKMLFGKECTEGEGINKAHKAIRRFFELMGATVVADFLPYLRWLDIGGHEKAMKE  256

Query  990   TAMEMESFAERWMeehkrkr-ksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTD  814
              A E++S  E W+ EHKR+R        EE DFMD MLS+ E          LPG +D D
Sbjct  257   VAKEIDSVVEEWLGEHKRRRDSKGIKSGEEEDFMDVMLSICEN-------RDLPG-FDAD  308

Query  813   QIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKE  634
               IK+TC+A+L A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK R V++SD+K 
Sbjct  309   TSIKATCMALLAAGTDTTIVTLTWTLSLLLNNYQALKKAQDELDAHVGKNRCVQDSDIKN  368

Query  633   LIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKP  454
             L+YLQA++KE +RLY A PLSVPHE+MEDC I+ Y I KGTRL+ N  KIH DP +W  P
Sbjct  369   LVYLQAIVKEALRLYSAAPLSVPHESMEDCTISGYDIPKGTRLLVNIWKIHCDPDLWPNP  428

Query  453   DEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRI  274
             DEF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPGIS AL+ V   LA L+ GF+++R 
Sbjct  429   DEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGISFALQAVPFVLAGLLQGFELKRP  488

Query  273   SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             S+EPID++ES GLT  KA+PLQ LL PRL  NLY
Sbjct  489   SDEPIDMSESFGLTILKASPLQVLLAPRLAPNLY  522



>ref|XP_009624056.1| PREDICTED: cytochrome P450 82A3-like, partial [Nicotiana tomentosiformis]
Length=510

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 243/336 (72%), Gaps = 21/336 (6%)
 Frame = -3

Query  1164  VTNMLVSMLFG----EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             + N +V MLFG      E  E S+  +A RR FEL G + VADF+P+LRWLDIGGHEKAM
Sbjct  191   IMNTMVKMLFGVRYTGKEEEERSRAHKAIRRFFELMGVSAVADFLPYLRWLDIGGHEKAM  250

Query  996   RETAMEMESFAERWMeehkrkrksksskee-EADFMDTMLSLFETTASSSHQSRLPGGYD  820
             +ETA EM+   E W+ EH+R+R+ +  K   E D MD MLS+ E          LPG +D
Sbjct  251   KETANEMDCLVEEWLAEHRRQRELRGIKYGDEEDLMDVMLSICE-------DRDLPG-FD  302

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D IIK+TCLA+  A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK+R V+ESD+
Sbjct  303   ADTIIKATCLALQSAGTDTTIVTLTWTLSLILNNYQALKKAQDELDAHVGKDRWVQESDI  362

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             K L+YLQA++KE +RLYPA PL +PHE++EDC+I+ Y I KGTRL+ N  KIH DP +W 
Sbjct  363   KNLVYLQAIVKEALRLYPAAPLLLPHESIEDCVISGYDIPKGTRLLVNIWKIHYDPDLWP  422

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              PDEF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPGIS+ L           +GF+M+
Sbjct  423   NPDEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGISMGLR--------KKNGFEMK  474

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             R  +EPID++ES GLT  KA+PL+ LL PRL SNLY
Sbjct  475   RPLDEPIDMSESFGLTILKASPLEILLAPRLASNLY  510



>ref|XP_009804510.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=525

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/334 (60%), Positives = 244/334 (73%), Gaps = 11/334 (3%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEE--SKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRE  991
             + N +V MLFG++    E  +K  +A RR FEL GA VVADF+P+LRWLDIGGHEKAM+E
Sbjct  199   IMNTMVKMLFGKECSEGEGINKAHKAIRRFFELLGATVVADFLPYLRWLDIGGHEKAMKE  258

Query  990   TAMEMESFAERWMeehkrkr-ksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTD  814
              A E++S  E W+ EHKR+R        EE DFMD MLS+ E        +R   G+D D
Sbjct  259   VAKEIDSVVEEWLGEHKRRRDSKGIKSGEEEDFMDVMLSICE--------NRDFPGFDAD  310

Query  813   QIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKE  634
               IK+TC+A+L A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK R V++SD+K 
Sbjct  311   TSIKATCMALLSAGTDTTIVTLTWTLSLLLNNYQALQKAQDELDVHVGKNRCVQDSDIKN  370

Query  633   LIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKP  454
             L+YLQAV+KE +RLY A PLSVPHE+MEDC I+ Y I KGTRL+ N  KIH DP +W  P
Sbjct  371   LVYLQAVVKEALRLYSAAPLSVPHESMEDCTISGYDIPKGTRLLVNIWKIHSDPDLWPNP  430

Query  453   DEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRI  274
              EF PERFLT HKDVDVRG +FELIPFGSGRRMCPGIS AL+ V   LA L+ GF+++R 
Sbjct  431   HEFLPERFLTTHKDVDVRGTHFELIPFGSGRRMCPGISFALQAVPFVLAGLLQGFELKRP  490

Query  273   SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             SNEPID++ES GLT  KA+PL+ LL PRL  NLY
Sbjct  491   SNEPIDMSESFGLTILKASPLEILLAPRLAPNLY  524



>ref|XP_006364811.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   372 bits (956),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 255/338 (75%), Gaps = 17/338 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             + N +V MLFG      EDE  E +K Q+A RR  ELFG +VVADF+P+LRWLDIGGHEK
Sbjct  192   IMNSMVKMLFGVQYTDKEDE--ERNKAQKAIRRFLELFGVSVVADFLPYLRWLDIGGHEK  249

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEAD-FMDTMLSLFETTASSSHQSRLPGG  826
             AM+ETA EM+   E W+ EH+RKRK + +K  + D FMD MLS+ E             G
Sbjct  250   AMKETAKEMDFIIEDWLAEHRRKRKLRGNKCGDEDDFMDVMLSICEDKDLH--------G  301

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +D D IIK+TC+ MLLA  DTT VTL W LSL+LNNY+ L++ +DELDTH+GK R V+ES
Sbjct  302   FDADTIIKATCVVMLLAGVDTTVVTLTWTLSLLLNNYQSLKKAKDELDTHIGKNRCVQES  361

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K LIYLQA++KE+ RLYPA PLS+PHE++EDC+++ Y+I KGTRL+ N  K+H DP++
Sbjct  362   DIKNLIYLQAIVKESFRLYPATPLSLPHESIEDCVVSGYNIPKGTRLVLNISKLHYDPEI  421

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EF+PERFLT HKDVDVRGN+FELIPFGSGRRMCPG+SLAL++V+  LA L+ GF+
Sbjct  422   WPNPQEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVVEYVLAVLLQGFE  481

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++R S+E ID++ES GLT  KA+PL+  L PRL S LY
Sbjct  482   IKRPSDEAIDMSESFGLTILKASPLEVHLTPRLNSYLY  519



>ref|XP_004238200.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=519

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 247/337 (73%), Gaps = 17/337 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             V N +  +LFG      EDE +  +K  +A RR FEL GA VVADF+P+LRWLDIGGHEK
Sbjct  193   VMNTMGKILFGKGRRSNEDEGI--NKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEK  250

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+E + E++S    W+ EHK KR    S EEE DFMD MLS+ E         R   G+
Sbjct  251   AMKEVSKELDSVVAEWLTEHKTKRGIIKSGEEE-DFMDVMLSICE--------DRDLLGF  301

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D  IK+TC+A+L A TDTT VTL W LSL+LNNY+ L++ QDELD HVGK R V+ESD
Sbjct  302   DADTAIKATCMALLSAGTDTTIVTLTWTLSLLLNNYQSLQKAQDELDAHVGKNRWVQESD  361

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KE +RLYPA PLSVPHE+MEDC I+ Y I KGTRL+ N  KI  DP +W
Sbjct  362   IKSLVYLQAIVKEALRLYPAAPLSVPHESMEDCTISGYDIPKGTRLLVNLWKIQHDPNIW  421

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFL+ HKDVDV+GN+FEL+PFGSGRRMCPGISLAL+++   +A L+ GF+M
Sbjct  422   PNPLEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAKLLQGFNM  481

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +R S+EPID++ES GLT  KA+PL+ LL PRL  +LY
Sbjct  482   KRPSDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  518



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 245/335 (73%), Gaps = 12/335 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVV----EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             V  M+V   + E E      E  + ++A R  FEL G   V D +P+LRWLD+GGHEKAM
Sbjct  202   VFKMVVGKRYSEAETSHGKDENDRRRKALRDFFELTGTFTVGDSLPFLRWLDLGGHEKAM  261

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             ++TA E++   E W+EEHK+KR S +++ E  DFM  MLSL    A       LP  YD 
Sbjct  262   KKTAKELDHILEEWLEEHKQKRNSGNAESEH-DFMGMMLSLLNDAAE------LPS-YDA  313

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
             D I K+TCL+++LAA+DTT VTL WALSL+LNN   L++ Q+ELD HVG+++ VEESD+K
Sbjct  314   DTINKATCLSLILAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIK  373

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
             +L+YLQA+IKET+RLYPA PLSVPHE+MEDC+++ YHI  GTRL+ N  KIHRDP  W+ 
Sbjct  374   KLVYLQAIIKETLRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSD  433

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             P EF+PERFLT +KD DVRG NFELIPFGSGRRMCPG+SLAL++++L LA+L+ GF++  
Sbjct  434   PCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGT  493

Query  276   ISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               +EP+D+ E+ G+TN K +PL+ L+ PRL +  Y
Sbjct  494   PLDEPVDMGEAIGITNLKVSPLEVLITPRLPAVCY  528



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 240/332 (72%), Gaps = 8/332 (2%)
 Frame = -3

Query  1158  NMLVSMLFG-EDEVVEESKFQ--RASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             NM++ ML G  D   +E + +  +  R  F+  G  +V+D +P LRW D GG+EKAMR+T
Sbjct  207   NMVLRMLSGGRDSSSKEERMRCHKLVRDFFQSMGTFLVSDALPLLRWFDFGGYEKAMRKT  266

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++   E W+++HK KR S+ +   + DFMD MLS+ +  A+         G+D D I
Sbjct  267   AKDLDHLLESWLQQHKSKRSSEQADGNQ-DFMDVMLSMLDDMATDEDLK----GFDADTI  321

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL +L   TDT +V+LIWALSL+LN  +VL+  ++ELD+HVG+ER+VEE D+K L 
Sbjct  322   NKATCLTILAGGTDTVTVSLIWALSLLLNKPQVLKTAREELDSHVGRERQVEERDMKNLA  381

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YL A++KET+RLYPA PL+ PHE+ EDC++  YHI  GTRL+ N  KIHRDP +W+ PDE
Sbjct  382   YLNAIVKETLRLYPAGPLTAPHESTEDCLLGGYHIPAGTRLLANLWKIHRDPSIWSDPDE  441

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             FRPERFLT HKDVDV+G +FELIPFGSGRR+CPGIS  L+ +Q  LASL+ GF+   +S+
Sbjct  442   FRPERFLTTHKDVDVKGQHFELIPFGSGRRICPGISFGLQFMQFTLASLIQGFEFATMSD  501

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             EP+D+TES GLTN KATPL+ L+ PRL S+LY
Sbjct  502   EPVDMTESIGLTNLKATPLEVLVAPRLSSDLY  533



>ref|XP_006375028.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
 gb|ERP52825.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
Length=342

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 235/306 (77%), Gaps = 8/306 (3%)
 Frame = -3

Query  1089  RRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksksske  910
             R   EL G  VV+D +P+LRWLD+GG EKAM+ T+  ++   E+W+EEHK+K+ S ++K 
Sbjct  42    RTFLELAGMFVVSDALPFLRWLDLGGVEKAMKRTSKNIDRAVEKWLEEHKQKKASGTAKG  101

Query  909   eEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSL  730
             EE DFMD MLS+ +     S++S        D I K+TCL ++LAA DTTSVTL W LSL
Sbjct  102   EE-DFMDLMLSVLDDGKELSNRS-------ADTINKATCLTLVLAAADTTSVTLTWTLSL  153

Query  729   VLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAME  550
             +LNN EVL++ QDELD HVG+ER+V+ESD+K L+YLQA+IKET RLYPA PLSVPHE+ME
Sbjct  154   LLNNREVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHESME  213

Query  549   DCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFG  370
             +C +  Y I  GTRL TN  KIHRDP+VW+ PDEF+PERFLT HKD D RG +FELIPFG
Sbjct  214   ECTVGGYQIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELIPFG  273

Query  369   SGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPR  190
             SGRRMCPG+S AL++V LALA+L+HGFD+  + + PID+TE+ G+TN KATPL+ALL PR
Sbjct  274   SGRRMCPGVSFALQVVNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALLTPR  333

Query  189   LESNLY  172
             L   LY
Sbjct  334   LSPGLY  339



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 242/334 (72%), Gaps = 8/334 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED---EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMR  994
             + N+LV ++ G+    + VE  +FQ+  ++LFEL GA VV+D IP ++  DIGG++K M+
Sbjct  196   ILNVLVRIISGKRFPFKSVEGIRFQKMEKKLFELLGAFVVSDLIPSMKRFDIGGYQKQMK  255

Query  993   ETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTD  814
               A E+    E W+   K +++S   KE +  FMD ++S+ +  + +        GYD D
Sbjct  256   MAAEEINDIMEGWLNNRKTQKESGEQKEGDQYFMDVLISVLKDASDADFP-----GYDHD  310

Query  813   QIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKE  634
              +IK+TC+A+L A +DTTSVT+IWAL+L+LN+ E ++  QDE+D HVG++R VEESDLK 
Sbjct  311   TVIKATCMALLAAGSDTTSVTIIWALALLLNHPEKMKIAQDEIDKHVGRDRLVEESDLKN  370

Query  633   LIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKP  454
             L+Y+ A+IKETMRLYPA PLSVPHEAMEDC++  YHI KGTRL+ NF KI  DP +W +P
Sbjct  371   LVYINAIIKETMRLYPAAPLSVPHEAMEDCVVGGYHIPKGTRLLPNFWKIQHDPNIWPEP  430

Query  453   DEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRI  274
              EF+PERFL+ HKDVDV+G +FEL+PFG+GRRMCP I+  L+I+ L LA+L+  F++R+ 
Sbjct  431   YEFKPERFLSTHKDVDVKGKHFELLPFGTGRRMCPAITFVLQILPLTLANLIQQFEIRKP  490

Query  273   SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             SN+PID+TES GLT  +ATPL  L+ PRL   +Y
Sbjct  491   SNDPIDMTESAGLTTKRATPLDVLIAPRLSLKMY  524



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   360 bits (923),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 222/315 (70%), Gaps = 8/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q   R  F L G  V+AD IP+L WLD+ GHEKAM+ TA E++S  E WMEEH++
Sbjct  221   EAVRCQTVMRSFFRLVGQFVIADAIPFLGWLDMQGHEKAMKRTAKELDSILEGWMEEHRK  280

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
              R S      E DFMD MLS+ + +  S        GYD D I K+TC+ ++L   DT  
Sbjct  281   MRLSNDEANGEQDFMDVMLSILKDSKLS--------GYDADTINKATCMNLILGGNDTIK  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V L WALSL++NN EVL+R+QDELD HVGK+R VEESD+K+L YLQAV+KE +RLYP  P
Sbjct  333   VCLTWALSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALRLYPPAP  392

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS PHEAME+C +  YH+  GTR++ N  KI RDP+VW+ P EFRPERFLT H  VDV G
Sbjct  393   LSGPHEAMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPERFLTSHVGVDVLG  452

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRR CPG SL L++V LALA L+H F +   S  P+D+TES GLTN KAT
Sbjct  453   QHFELIPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGLTNLKAT  512

Query  216   PLQALLIPRLESNLY  172
             PL+ LL+PRL S+LY
Sbjct  513   PLEVLLLPRLPSHLY  527



>ref|XP_006428105.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
 gb|ESR41345.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
Length=367

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 231/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+LFG  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  58    DSSDFQEHATDFFDLFGKFVVSDALPYLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKS  117

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+         +LPGG DTD +IK+ CL+++LAA+DTT+
Sbjct  118   KRGSSEVKGDE-DFMYVMLSLFD-----DKTKQLPGGDDTDTVIKAICLSLILAASDTTA  171

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VLE+ Q+ELD HVG  R+V ESD+  L YLQ V+KET+RLYPA P
Sbjct  172   VTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAP  231

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L VPHE++EDC I+ YH+  GT+LI N  KI RDP VW +P  F PERFLT +KDVD++G
Sbjct  232   LLVPHESIEDCNISGYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKG  291

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+ P+D+ E+  LT  KAT
Sbjct  292   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKAT  351

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  352   PLEVLLTPRLSASLY  366



>ref|XP_006375024.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
 gb|ERP52821.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
Length=425

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 246/321 (77%), Gaps = 10/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE++  +E  ++ + R   EL G  VV+D +P+LRWLD+GG EKAM+ TA  ++   E+W
Sbjct  112   GEEKPSDE--WRDSLRAFLELSGMFVVSDALPFLRWLDLGGAEKAMKRTAKNLDHAVEKW  169

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK+K+ S ++K EE DFMD MLS+ +     S++S        D I K+TCL ++LA
Sbjct  170   LEEHKQKKASGTAKGEE-DFMDLMLSVLDDGKELSNRS-------ADTINKATCLTLILA  221

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             A+DTTSVTL W LSL+LNN E+L++ QDELD HVG+ER+V+ESD+K L+YLQA+IKET R
Sbjct  222   ASDTTSVTLTWTLSLLLNNREILKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFR  281

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PLSVPHE+ME+C +  YHI  GTRL TN  KIHRDP+VW+ PDEF+PERFLT HK
Sbjct  282   LYPAAPLSVPHESMEECTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHK  341

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             D D RG +FELIPFGSGRRMCPG+S AL+++ LALA+L+HGFD+  + + PID+TE+ G+
Sbjct  342   DCDFRGQHFELIPFGSGRRMCPGVSFALQVLNLALATLLHGFDIETLDDAPIDMTETGGI  401

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ALL PRL   LY
Sbjct  402   TNIKATPLEALLTPRLSPGLY  422



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 239/321 (74%), Gaps = 8/321 (2%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE   E  +++  +  F       V+D +P+LR+LD+GGH +AM++TA E++   E W+
Sbjct  225   EDEESVEG-WKKGLKDFFHWTRVFSVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWL  283

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             +EHKRKR +   K +E DFMD ML +F+  A +        G D+D  IK+T LA++LAA
Sbjct  284   KEHKRKRAAGIVKGKE-DFMDVMLDVFDNDAEAVQ------GGDSDTTIKATSLALILAA  336

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIWALSL++NN  VL++ Q ELDTHVGKER+VEESD++ L+YL+AV+KET+RL
Sbjct  337   SDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PLS+PHEA+EDC I+ YH+ +GTRL+ N  KIHRD +VW+ P+EF PERFLT H+ 
Sbjct  397   YPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
              DVRG NFE  PFGSGRRMCPG+S AL ++ LALA+L+HGFD    S EP+D+ ES GLT
Sbjct  457   FDVRGKNFEFSPFGSGRRMCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLT  516

Query  231   NFKATPLQALLIPRLESNLYG  169
             N +ATPL+ LL PRL S LYG
Sbjct  517   NLRATPLEVLLSPRLSSRLYG  537



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 245/335 (73%), Gaps = 12/335 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVV----EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             V  M+V   + E E      E  + ++A R  FEL G   V D +P+LRWLD+GGHEKAM
Sbjct  472   VFKMVVGKRYSEAETSHGKDENDRRRKALRDFFELTGTFTVGDSLPFLRWLDLGGHEKAM  531

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             ++TA E++   E W+EEHK+KR S +++ E  DFM  MLSL    A       LP  YD 
Sbjct  532   KKTAKELDHILEEWLEEHKQKRNSGNAESEH-DFMGMMLSLLNDAAE------LPS-YDA  583

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
             D I K+TCL+++LAA+DTT VTL WALSL+LNN   L++ Q+ELD HVG+++ VEESD+K
Sbjct  584   DTINKATCLSLILAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIK  643

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
             +L+YLQA+IKET+RLYPA PLSVPHE+MEDC+++ YHI  GTRL+ N  KIHRDP  W+ 
Sbjct  644   KLVYLQAIIKETLRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSD  703

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             P EF+PERFLT +KD DVRG NFELIPFGSGRRMCPG+SLAL++++L LA+L+ GF++  
Sbjct  704   PCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGT  763

Query  276   ISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               +EP+D+ E+ G+TN K +PL+ L+ PRL +  Y
Sbjct  764   PLDEPVDMGEAIGITNLKVSPLEVLITPRLPAVCY  798


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             +  + + A R   EL G   V D +P+LRWLD+GGHEKAM++TA E++   E+W+
Sbjct  107   DNDRCRNAVRNFLELTGTFTVGDSLPFLRWLDLGGHEKAMKKTAKELDQILEKWL  161



>ref|XP_010686308.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=515

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 235/325 (72%), Gaps = 9/325 (3%)
 Frame = -3

Query  1146  SMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             S+ F + EV   ++  +A R  FEL G  V AD +P+LRW+DIGGHEK M+  A E++  
Sbjct  194   SIEFYQSEV--HNQCMKAIRDFFELAGVFVPADALPFLRWMDIGGHEKKMKRVAKEIDVV  251

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             A++W++EHK +  SK  +E+  DFMD MLS+FET   +      P  +D+D IIK+TC+A
Sbjct  252   AQKWLDEHKERTNSKEREEKR-DFMDVMLSVFETGQDT------PFKFDSDTIIKATCMA  304

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+LAATDTT+VTL WALSL+LNN +V ++ Q ELDT VGKER+VEESDLK L+YLQAV+K
Sbjct  305   MILAATDTTAVTLTWALSLLLNNKDVFKKTQAELDTVVGKERQVEESDLKNLVYLQAVLK  364

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             ETMRLYPA PLS P EA+ DC +N YHI  GT+L  N  KIHRDP+VW  P EF PERFL
Sbjct  365   ETMRLYPAGPLSGPREAIVDCTVNGYHIPPGTQLFVNLHKIHRDPEVWEDPLEFHPERFL  424

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             + +K  DVRG  FE +PFG+GRR+CPGIS AL  +Q  LASL+HGFD+   S+  +D+TE
Sbjct  425   STYKQYDVRGQQFEYMPFGNGRRICPGISFALLAMQFTLASLLHGFDISIPSDGTVDMTE  484

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
               GLTN KATPL+ +   RL  NLY
Sbjct  485   GFGLTNLKATPLEVIATHRLPHNLY  509



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 232/320 (73%), Gaps = 10/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE  E  + Q A R+ F   G  +V D +P+LRWLD+GGHEKAM++TA E+++  E W+
Sbjct  213   EDEKKEARRVQDAVRKFFYFAGVFMVGDLVPYLRWLDLGGHEKAMKKTAKEIDAIIEEWL  272

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             +EHK++R++  + E   DFMD ML+          Q    GGY+ D + K+TCL M+L  
Sbjct  273   QEHKQRRRAGDTGEH--DFMDAMLTEL--------QGADLGGYEADTVNKATCLNMILGG  322

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT VTLIWA+SL+LNN  VL++ QDELD  VG+ER V ESD  +L+Y+QA++KET+RL
Sbjct  323   SDTTMVTLIWAISLLLNNRHVLKQAQDELDAEVGRERFVTESDTGKLVYIQAIVKETLRL  382

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPAVPLS  HE  ED  +N YH+QKGTRLITN  KI  +P++W  P EF+PERFLT HK+
Sbjct  383   YPAVPLSAQHEFTEDSTVNGYHVQKGTRLITNLWKIQTNPQMWPDPLEFKPERFLTTHKN  442

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +DVRG++FELIPFGSGRR CPGIS AL++V  ALAS +H F++   SNE +D++ES GLT
Sbjct  443   IDVRGHHFELIPFGSGRRSCPGISFALQMVSFALASFLHAFEVSTPSNELVDMSESFGLT  502

Query  231   NFKATPLQALLIPRLESNLY  172
             N KATPL  L+ PRL S LY
Sbjct  503   NVKATPLNVLIKPRLCSKLY  522



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   355 bits (911),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 246/334 (74%), Gaps = 16/334 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMR  994
             N+++ M+ G+     D   E  +++ A R  F+L G  V++D +P+L+WLDIGG E+ M+
Sbjct  200   NVILRMIVGKRIPSSDSDAEGERWKDALRDFFDLSGKFVISDALPFLKWLDIGGDERFMK  259

Query  993   ETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTD  814
             +   E++  AE W+++HKR + S + + ++ DFMD M S+              G +D D
Sbjct  260   KVTKELDEVAEGWLQDHKRMKASGNQESDQ-DFMDVMFSILSDV----------GKHDAD  308

Query  813   QIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKE  634
              I K+TCLAM+LAA+DTT VTL WALSL+LNN   L++ Q+ELD HVG+++ VEESD+K+
Sbjct  309   TINKATCLAMILAASDTTMVTLTWALSLLLNNRGALKKAQEELDIHVGRDKLVEESDIKK  368

Query  633   LIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKP  454
             L+YL+A++KET+RLYPA PLS+PHE+MEDCI++ YHI  GTRL+ N  KIHRDP+VW+ P
Sbjct  369   LVYLRAILKETLRLYPAGPLSLPHESMEDCIVSGYHIPAGTRLLINVYKIHRDPRVWSDP  428

Query  453   DEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRI  274
              EF+PERFLT +KD DVRG NFELIPFGSGRRMCPG+S AL++++L LA+L+ GF++   
Sbjct  429   CEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELTLANLLQGFELGTP  488

Query  273   SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +EP+D++E+ GLTN KA+PL+ L+ PRL +  Y
Sbjct  489   LDEPVDMSEAMGLTNLKASPLEVLITPRLPAVCY  522



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   355 bits (911),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 238/321 (74%), Gaps = 8/321 (2%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE   E  +++  +  F   G   V+D +P+LR+LD+GGH +AM++TA E++   E W+
Sbjct  225   EDEESVEG-WKKGLKDFFHWTGVFSVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWL  283

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             +EHKRKR +   K +E DFMD ML +F+  A +        G D+D  IK+T LA++LAA
Sbjct  284   KEHKRKRAAGIVKGKE-DFMDVMLDVFDNDAEAVQ------GGDSDTTIKATSLALILAA  336

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIWALSL++NN  VL++ Q ELDTHVGKER+VEESD++ L+YL+AV+KET+RL
Sbjct  337   SDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PL VPHEA+EDC I+ YH+ +GTRL+ N  KIHRD +VW+ P+EF PERFLT H+ 
Sbjct  397   YPAGPLLVPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
              DVRG NFE  PFGSGRRMCPG+S AL ++ LALA+L+HG D    S EP+D+ ES GLT
Sbjct  457   FDVRGKNFEFFPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSGLT  516

Query  231   NFKATPLQALLIPRLESNLYG  169
             N +ATPL+ LL PRL S LYG
Sbjct  517   NLRATPLEVLLSPRLPSRLYG  537



>ref|XP_011030958.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X3 [Populus 
euphratica]
Length=527

 Score =   355 bits (910),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 244/321 (76%), Gaps = 10/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE++  +E  ++ + R   EL G  VV+D +P+LRWLD+GG EKAM+ TA  ++   E+W
Sbjct  214   GEEKASDE--WRDSLREFLELSGMFVVSDALPFLRWLDLGGAEKAMKRTAKNLDHAVEKW  271

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK+++ S ++K EE DFMD MLS+ +     S++S        D I K+TCL ++LA
Sbjct  272   LEEHKQRKASGTAKGEE-DFMDLMLSVLDGAKELSNRS-------ADTINKATCLTLILA  323

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             A DTTSVTL W LSL+LNN +VL++ QDELD HVG+ER+V+ESD+K L+YLQA+IKET R
Sbjct  324   AADTTSVTLTWTLSLLLNNRDVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFR  383

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PLS+PHE+ME+C +  YHI  GTRL TN  KIHRDP+VW+ PDEF+PERFLT HK
Sbjct  384   LYPAAPLSLPHESMEECTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHK  443

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             D D RG +FELIPFGSGRRMCPG+S AL+++ LALA+L+HGFD+  + + PID+TE+ G+
Sbjct  444   DCDFRGQHFELIPFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGI  503

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ LL PRL   LY
Sbjct  504   TNVKATPLKVLLTPRLSPGLY  524



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   354 bits (909),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 248/336 (74%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D +P LRW D+ G+EK M++T
Sbjct  206   NVIFRMIVGKRYEDE--QDEKGRDALREFFDLAGRFIVSDALPILRWFDLDGYEKMMKKT  263

Query  987   AMEMESFAERWMeehkrkrkskss----keeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHK +R S       K  + DFMD MLS+ + T         PG YD
Sbjct  264   ARELDRVVQGWLNEHKIRRNSNKRRGNDKNNDQDFMDVMLSIVDAT------EEFPG-YD  316

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+ ++LA +DTTSV+L WALSL+LN+ E L++ Q ELDT +G+E+RV+ESDL
Sbjct  317   ADTFIKATCMGLVLAGSDTTSVSLTWALSLLLNHREALKKAQHELDTQIGREKRVKESDL  376

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             K L+Y+QA+IKET+RLYPA PL VPHE+MEDC ++ YH+ KGTRL+ NF KIHRDP +W+
Sbjct  377   KNLVYIQAIIKETLRLYPAGPLGVPHESMEDCTVDGYHVPKGTRLLFNFWKIHRDPHIWS  436

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P +FRPERFLT +KDVD+RG NFELIPFGSGRRMCPGI+LA++++ L+LA+L+HGF++ 
Sbjct  437   DPLKFRPERFLTTYKDVDIRGQNFELIPFGSGRRMCPGINLAMQLMSLSLAALLHGFEVT  496

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              ++NEP+ +TE+ GLTN KATPL+ L+ PRL+   Y
Sbjct  497   TLANEPVGMTEAIGLTNLKATPLEVLVTPRLQERAY  532



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 244/337 (72%), Gaps = 14/337 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE---DEVVEESK-----FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ ++ G+    E  +E K     +++A R  F L G  + AD +P+LRWLDIGGHEK
Sbjct  197   NIILRIIVGKFIGYETADEGKESNEGWKQALRDFFHLSGRFIAADAVPFLRWLDIGGHEK  256

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
              M+ TA +++     W+ EHK K+ S   K+ E DFMD +L + +  A ++  SR     
Sbjct  257   TMKHTANKLDIVVTEWLNEHKEKKASGCVKKGEEDFMDLILDIMDDEAEAT-LSR-----  310

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D+D I K+TCLA+ LAA+DTTSVTLIWALSL++NN +VL++ QDELD  VG+ER+V ESD
Sbjct  311   DSDTINKATCLALTLAASDTTSVTLIWALSLLVNNPDVLKKAQDELDVQVGRERQVHESD  370

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  LI+L+A++KET+RLYPA PLSVPHE+M+DC +  YHI  GTRL+TN  KIHRDP+VW
Sbjct  371   VNNLIFLKAIVKETLRLYPAGPLSVPHESMKDCTVAGYHIPAGTRLVTNLSKIHRDPRVW  430

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P E++ ERFLT H+D DVRG  FE IPFGSGRRMCPG+S AL+++ + LA+L+HGF+ 
Sbjct  431   SNPSEYQQERFLTSHQDFDVRGKTFEFIPFGSGRRMCPGVSFALQVLHITLATLLHGFNF  490

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                + EP+D+TE+ GLTN +ATPL+  + PRL  +LY
Sbjct  491   GTPTGEPLDMTENFGLTNLRATPLEVAINPRLGPHLY  527



>ref|XP_007222623.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
 gb|EMJ23822.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
Length=525

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 229/321 (71%), Gaps = 9/321 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE  E S+ Q A R  F  +G  VV D +P+LRWLD+GGHEKAM++   E+++    W+
Sbjct  214   EDEKKEASRVQTALREFFHYWGLFVVGDAVPYLRWLDLGGHEKAMKKIGKELDAIVGEWV  273

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             E HK++R S  +K E+ DF+D MLS+ +            GG+D D + K+T L M+  A
Sbjct  274   EGHKQRRASGYAKGEQ-DFIDAMLSVLDGADL--------GGFDADTVNKATILTMISGA  324

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT VTL WA+SL+LNN  VL+R Q+ELDT +G++R V ESD+ +L+Y+QA++KET+RL
Sbjct  325   SDTTMVTLTWAISLLLNNPHVLKRAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRL  384

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PLS P E  EDC I  YH+ KGTRLITN  KI  DP++W  P EF+PERFLT H+D
Sbjct  385   YPAAPLSGPREFTEDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHRD  444

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDV+G +FELIPFGSGRR CPG++  L++VQ  LAS VH F++   S+ PID+TES GLT
Sbjct  445   VDVKGLHFELIPFGSGRRACPGLAFGLQMVQFTLASFVHAFEISNPSSAPIDMTESFGLT  504

Query  231   NFKATPLQALLIPRLESNLYG  169
             N KATPLQ L+ PRL S LYG
Sbjct  505   NVKATPLQVLINPRLPSQLYG  525



>ref|XP_011030947.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 244/321 (76%), Gaps = 10/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE++  +E  ++ + R   EL G  VV+D +P+LRWLD+GG EKAM+ TA  ++   E+W
Sbjct  215   GEEKPSDE--WRDSLREFLELSGMFVVSDALPFLRWLDLGGAEKAMKRTAKNLDHAVEKW  272

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK+++ S ++K EE DFMD MLS+ +     S++S        D I K+TCL ++LA
Sbjct  273   LEEHKQRKASGTAKGEE-DFMDLMLSVLDDAKELSNRS-------ADTINKATCLTLILA  324

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             A DTTSVTL W LSL+LNN +VL++ QDELD HVG+ER+V+ESD+K L+YLQA+IKET R
Sbjct  325   AADTTSVTLTWTLSLLLNNRDVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFR  384

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PLS+PHE+ME+C +  YHI  GTRL TN  KIHRDP+VW+ PDEF+PERFLT HK
Sbjct  385   LYPAAPLSLPHESMEECTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHK  444

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             D D RG +FELIPFGSGRRMCPG+S AL+++ LALA+L+HGFD+  + + PID+TE+ G+
Sbjct  445   DCDFRGQHFELIPFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGI  504

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ LL PRL   LY
Sbjct  505   TNVKATPLKVLLTPRLSPGLY  525



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 244/321 (76%), Gaps = 10/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE++  +E  ++ + R   EL G  VV+D +P+LRWLD+GG EKAM+ TA  ++   E+W
Sbjct  215   GEEKPSDE--WRDSLREFLELSGMFVVSDALPFLRWLDLGGAEKAMKRTAKNLDHAVEKW  272

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK+++ S ++K EE DFMD MLS+ +     S++S        D I K+TCLA++LA
Sbjct  273   LEEHKQRKASGTAKGEE-DFMDLMLSVLDDAKELSNRS-------ADTINKATCLALILA  324

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             A+DTTSVTL W LSL+LNN EVL++ QDELD HVG+ER+V+ESD+K L+YLQA+ KE+ R
Sbjct  325   ASDTTSVTLTWTLSLLLNNREVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIFKESFR  384

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PLS PHE+ME+C +  YHI  GTRL TN  KIHRDP+VW+ PDEF+PERFLT HK
Sbjct  385   LYPAAPLSGPHESMEECTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHK  444

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             D D RG +FELIPFGSGRRMCPG+S AL+++ LALA+L+HGFD+  + + PID+TE+ G+
Sbjct  445   DCDFRGQHFELIPFGSGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGI  504

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ LL PRL   LY
Sbjct  505   TNVKATPLKVLLTPRLSPGLY  525



>ref|XP_006428104.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
 gb|ESR41344.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
Length=367

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 231/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+LFG  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  58    DSSDFQEHATDFFDLFGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVLQGWLDEHKS  117

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+         +LPGG DTD +IK+ CL+++LAA+DTT+
Sbjct  118   KRGSSEVKGDE-DFMYVMLSLFD-----DKTKQLPGGDDTDTVIKAICLSLILAASDTTA  171

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VLE+ Q+ELD HVG  R+V ESD+  L +LQ V+KET+RLYPA P
Sbjct  172   VTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAP  231

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE++EDC I+ YH+  GT+LI N  KI RDP VW +P +F PERFLT +KDVD++G
Sbjct  232   LLLPHESIEDCTISGYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKG  291

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+  +D+ E+  LT  KAT
Sbjct  292   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKAT  351

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  352   PLEVLLTPRLSASLY  366



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 234/317 (74%), Gaps = 8/317 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + ++A R+  EL G   +AD +P+LRWLD+ G EK+M  TA E++   E W+++HK+
Sbjct  247   ENDRCRKAIRKFSELTGGFAIADAVPFLRWLDLDGCEKSMGRTAKELDQILEGWLKDHKQ  306

Query  936   krksk--sskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDT  763
             KR S      ++E DFMD M+S+      +     +P  +D D I K+TCLA++L  TDT
Sbjct  307   KRISSDDQVIKDENDFMDVMISVL-----TEADEEIPS-FDADTITKATCLALILGGTDT  360

Query  762   TSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPA  583
             T VTL WAL+LVLN+ +VL+++QDELDTH+G+ER+V ESD K+L+YLQAV+KET+RLYPA
Sbjct  361   TMVTLTWALTLVLNHGDVLKKVQDELDTHIGRERQVNESDTKKLVYLQAVVKETLRLYPA  420

Query  582   VPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
              PLSVPHE++EDC I  YH+  GTRL  N  KI RDP VW KP+EFRPERFLT HKD+DV
Sbjct  421   TPLSVPHESIEDCTIAGYHVPAGTRLFVNIPKIQRDPNVWEKPNEFRPERFLTTHKDIDV  480

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             RG NFELIPFGSGRR CPGIS AL+++ L LASL+HGF+     +EP+D++E  GLTN K
Sbjct  481   RGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFEFATPGDEPLDMSEGVGLTNLK  540

Query  222   ATPLQALLIPRLESNLY  172
             ATPLQ LL PRL + L+
Sbjct  541   ATPLQVLLTPRLHAPLF  557



>ref|XP_006375025.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
 gb|ERP52822.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
Length=569

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 236/306 (77%), Gaps = 8/306 (3%)
 Frame = -3

Query  1089  RRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksksske  910
             R   EL G  VV+D +P+LRWLD+GG EKAM+ T+  ++   E+W+EEHK+K+ S ++K 
Sbjct  269   RTFLELAGMFVVSDALPFLRWLDLGGVEKAMKRTSKNIDRAVEKWLEEHKQKKASGTAKG  328

Query  909   eEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSL  730
             EE DFMD MLS+ +     S++S        D I K+TCLA++LAA+DTTSVTL W LSL
Sbjct  329   EE-DFMDLMLSVLDDAKELSNRS-------ADTINKATCLALILAASDTTSVTLTWTLSL  380

Query  729   VLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAME  550
             +LNN E+L++ QDELD HVG+ER+V+ESD+K L+YLQA+IKET RLYPA PLSVPHE+ME
Sbjct  381   LLNNREILKKAQDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHESME  440

Query  549   DCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFG  370
             +C +  Y I  GTRL TN  KIHRDP+VW+ PDEF+PERFLT  KD D RG +FELIPFG
Sbjct  441   ECTVGGYQIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTQKDCDFRGQHFELIPFG  500

Query  369   SGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPR  190
             SGRRMCPG+S AL++V LALA+L+HGFD+  + + PID+TE+ G+TN KATPL+ALL PR
Sbjct  501   SGRRMCPGVSFALQVVNLALATLLHGFDIETVDDAPIDMTETGGITNIKATPLEALLTPR  560

Query  189   LESNLY  172
             L   LY
Sbjct  561   LSPGLY  566



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   352 bits (904),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 226/321 (70%), Gaps = 9/321 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE  E  + Q A +  F   G  VV D +P+LRWLD+GGHEKAM+  A E+++    W+
Sbjct  214   EDEKTEARRVQSALKEFFYYVGLFVVGDAVPYLRWLDLGGHEKAMKRIAKELDAIVGGWV  273

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             EEHKR+R    +K E  DF+D MLS+ +            GG+D D + K+T L M+   
Sbjct  274   EEHKRRRARGDAKGE-PDFIDAMLSVLDGADL--------GGFDADTVNKATSLNMIAGG  324

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT VTLIWA+SL+LNN  VL+  Q+ELDT +G++R V ESD+ +L+Y+QA++KET+RL
Sbjct  325   SDTTMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRL  384

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PLS P E  +DC I  YH+ KGTRLITN  KI  DP++W  P EF+PERFLT H+D
Sbjct  385   YPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHRD  444

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDV+G +FELIPFGSGRR CPG++ AL++VQ  LAS VH FD+   SN PID+TES GLT
Sbjct  445   VDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPSNSPIDMTESFGLT  504

Query  231   NFKATPLQALLIPRLESNLYG  169
             N KATPLQ L+ PRL S LYG
Sbjct  505   NIKATPLQVLIKPRLPSQLYG  525



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 238/321 (74%), Gaps = 8/321 (2%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE   E  +++  +  F   G   V+D +P+LR+LD+GGH +AM++TA E++   E W+
Sbjct  225   EDEESVEG-WKKGLKDFFHWTGVFSVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWL  283

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             +EHKRKR +   K +E DFMD ML +F+  A +        G D+D  IK+T LA++LAA
Sbjct  284   QEHKRKRAAGIVKGKE-DFMDLMLDVFDNDAEAVQ------GGDSDTTIKATSLALILAA  336

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             ++TT+VTLIWALSL++NN  VL++ Q ELDTHVGKER+VEESD++ L+YL+AV+KET+RL
Sbjct  337   SNTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PL VPHEA+EDC I+ YH+ +GTRL+ N  KIHRD +VW+ P+EF PERFLT H+ 
Sbjct  397   YPAGPLLVPHEAIEDCTIDGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
              DVRG NFE  PFGSGRR CPG+S AL ++ LALA+L+HGFD    S EP+D+ ES GLT
Sbjct  457   FDVRGKNFEFFPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLT  516

Query  231   NFKATPLQALLIPRLESNLYG  169
             N +ATPL+ LL PRL S LYG
Sbjct  517   NLRATPLEVLLSPRLPSRLYG  537



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   352 bits (903),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 231/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+LFG  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  213   DSSDFQEHATDFFDLFGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKS  272

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+         +LPGG DTD +IK+ CL+++LAA+DTT+
Sbjct  273   KRGSSEVKGDE-DFMYVMLSLFD-----DKTKQLPGGDDTDTVIKAICLSLILAASDTTA  326

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VLE+ Q+ELD HVG  R+V ESD+  L YLQ V+KET+RLYPA P
Sbjct  327   VTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAP  386

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L VPHE++EDC I+ YH+  GT+LI N  KI RDP VW +P  F PERFLT +KDVD++G
Sbjct  387   LLVPHESIEDCNISGYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKG  446

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+ P+D+ E+  LT  KAT
Sbjct  447   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKAT  506

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  507   PLEVLLTPRLSASLY  521



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 248/336 (74%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LRWLD+ G+EK M++T
Sbjct  175   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRWLDLDGYEKMMKKT  232

Query  987   AMEMESFAERWMeehkrkrksks----skeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHKR+R +      +K+ + DFMD MLS+ +          LPG YD
Sbjct  233   AHELDRVVQGWLNEHKRRRSANKRRGDNKDSDQDFMDVMLSIVDAA------EELPG-YD  285

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSV+L WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  286   ADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  345

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
               L+Y+QA+IKETMRLYPA PL VPHE+MEDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  346   MNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWS  405

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFELIPFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  406   DPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  465

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++EP+D+ E+ G+TN KATPL+ L+ PRL  + Y
Sbjct  466   TLADEPVDMAEAIGMTNLKATPLEVLVTPRLPEHAY  501



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 248/336 (74%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LRWLD+ G+EK M++T
Sbjct  205   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRWLDLDGYEKMMKKT  262

Query  987   AMEMESFAERWMeehkrkrksks----skeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHKR+R +      +K+ + DFMD MLS+ +          LPG YD
Sbjct  263   AHELDRVVQGWLNEHKRRRSANKRRGDNKDSDQDFMDVMLSIVDAA------EELPG-YD  315

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSV+L WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  316   ADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  375

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
               L+Y+QA+IKETMRLYPA PL VPHE+MEDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  376   MNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWS  435

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFELIPFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  436   DPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  495

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++EP+D+ E+ G+TN KATPL+ L+ PRL  + Y
Sbjct  496   TLADEPVDMAEAIGMTNLKATPLEVLVTPRLPEHAY  531



>ref|XP_010686300.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 234/325 (72%), Gaps = 9/325 (3%)
 Frame = -3

Query  1146  SMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             SM F + EV   +++ +A R  FEL G  V AD +P+LRW+DIGG+EK M+  A  ++  
Sbjct  107   SMEFYQSEVY--NQYIKAIRDFFELAGVFVPADALPFLRWMDIGGYEKKMKRVAKVIDGV  164

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             A++W+EEHK +  SK  +E+  DFMD MLS+FET          P  +D+D IIK T +A
Sbjct  165   AQKWLEEHKERTSSKEKEEKR-DFMDVMLSVFETGQDK------PFKFDSDTIIKVTSMA  217

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+LAA+DTT+VTL WALSL+LNN ++L++ Q ELD  VGKER+VEESDLK L+YLQ V+K
Sbjct  218   MILAASDTTTVTLTWALSLLLNNKDILKKTQAELDNVVGKERQVEESDLKNLVYLQTVLK  277

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             ETMRLYPA PLSVP EA+ DC ++ Y+I  GT+L  N  KIHRDP+VW  P +F PERFL
Sbjct  278   ETMRLYPAAPLSVPREAITDCTVSGYYIPVGTQLFVNLYKIHRDPEVWENPLDFHPERFL  337

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T +KD DVRG +FE +PFGSGRR+CPGIS AL  +Q  LASL+HGF++   S+E +D+TE
Sbjct  338   TTNKDYDVRGQSFEYMPFGSGRRICPGISFALLAMQFTLASLLHGFNISIPSDETVDMTE  397

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
               G+T  KATPL  ++  RL  NLY
Sbjct  398   GFGITILKATPLDVIVTQRLPHNLY  422



>ref|XP_006428103.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
 gb|ESR41343.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
Length=335

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 229/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+L G  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  26    DSSDFQEHATNFFDLCGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKS  85

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+  A      +LP G DTD +IK+ CL+++LAA+DTT+
Sbjct  86    KRGSSEVKGDE-DFMYVMLSLFDDKAK-----QLPDGDDTDTVIKAICLSLILAASDTTA  139

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VL++ Q+ELD  VG  R+V ESD+K L YLQ ++KET+RLYPA P
Sbjct  140   VTLTWAIALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGP  199

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L VPHE++EDC I  YH+  GT+LI N  K+ RDP VW +P +F PERFL  +KDVD++G
Sbjct  200   LLVPHESIEDCTIRGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKG  259

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+ P+D+ E+  LT  KAT
Sbjct  260   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKAT  319

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  320   PLEVLLTPRLSASLY  334



>ref|XP_004306669.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=539

 Score =   350 bits (897),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/337 (52%), Positives = 235/337 (70%), Gaps = 11/337 (3%)
 Frame = -3

Query  1161  TNMLVSMLFG------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             +N+++ M+ G      E E  E    ++A R  F+L G  V++D +P+LRWLD+GG+EKA
Sbjct  199   SNVMLRMVVGKRFLGLEQENEEIECLRKALREFFKLGGEFVISDAVPYLRWLDLGGYEKA  258

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGY  823
             M++TA E++   ++ +EEHK K  +         DFMD +LS+ +            G  
Sbjct  259   MKKTAKELDGALQKCLEEHKHKSSNSVQHVNGENDFMDMVLSVLDDDCIQD----FGGSV  314

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
               D I K+TCL++LL  TDTT+VTL WALSL+LNN EVL++ Q ELD HVG++R+V ESD
Sbjct  315   TADTISKATCLSVLLGGTDTTAVTLTWALSLLLNNPEVLKKAQLELDNHVGRDRQVNESD  374

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KET+RLYPA PLSVPHE+ EDC + +YH+  GTRL+ N  KI RDP +W
Sbjct  375   VKNLVYLQAIMKETLRLYPAAPLSVPHESREDCTVGDYHVSSGTRLLINLSKIQRDPNIW  434

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P +F+PERFLT HK+VDVRG + E  PFG+GRR+CPGISLAL++ QL LA L+HGF++
Sbjct  435   IEPCKFQPERFLTTHKNVDVRGQSLEFTPFGTGRRICPGISLALQVTQLTLAHLLHGFEI  494

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S EP+D+ ES GLTN KATPL+  L PRL   LY
Sbjct  495   TAPSGEPVDMGESSGLTNMKATPLEVFLTPRLHPKLY  531



>ref|XP_010686299.1| PREDICTED: cytochrome P450 CYP82D47-like, partial [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 232/320 (73%), Gaps = 9/320 (3%)
 Frame = -3

Query  1146  SMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             S+ F + EV   ++   A R  FEL G  V AD +P+LRW+DIGG+EK M+  A  ++  
Sbjct  222   SIEFYQSEV--HNQCMEALRDFFELAGVFVPADALPFLRWMDIGGYEKKMKRVAKVIDVV  279

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             A++W+EEHK +  SK  +E+  DFMD MLS+FET  +       P  +D+D IIK+  +A
Sbjct  280   AQKWLEEHKERTSSKEKEEKR-DFMDVMLSVFETGQNK------PFKFDSDTIIKANSMA  332

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+LAATDTT+VTL WALSL+LNN +VL +IQ ELD  VGKER+VEESDLK L+YLQAV+K
Sbjct  333   MILAATDTTAVTLTWALSLLLNNKDVLNKIQAELDNVVGKERQVEESDLKNLVYLQAVLK  392

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             ETMRLYPA PLS P EA+ DC ++ YHI  GT+L  N  KIHRDP+VW  P +F PERFL
Sbjct  393   ETMRLYPAAPLSAPREAITDCTVSGYHISAGTQLFVNLYKIHRDPEVWENPLDFHPERFL  452

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T +KD DVRG +F+ +PFGSGRR+CPGIS AL  +Q  LASL+HGFD+   S+E +D+TE
Sbjct  453   TTNKDYDVRGQSFKYMPFGSGRRICPGISFALLAMQFTLASLLHGFDISMPSDETVDMTE  512

Query  246   SCGLTNFKATPLQALLIPRL  187
             S GLTN KATPL+ +   RL
Sbjct  513   SFGLTNLKATPLEVIATHRL  532



>emb|CDP07593.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 234/341 (69%), Gaps = 15/341 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE---------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N+++ M+ G+          E  E  + Q+A+R  F L G  VVADF+P+L WLD+ GHE
Sbjct  124   NVIIRMIAGKRYFGGAIDVSEEKEARQCQKAARDFFHLVGIYVVADFVPFLGWLDLEGHE  183

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             K ++ETA EM+   E W++EHKR+++S     ++ DFMD MLS+  T         L GG
Sbjct  184   KKLKETAKEMDQIVEGWLKEHKRRKESGKGDGQQ-DFMDVMLSV--TQGGQGEIMNLAGG  240

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I+K+TCL ++   +DTT+V L WALSL+LNN +VL + ++ELD HVGK+RRV ES
Sbjct  241   YDADTIVKATCLNLMSGGSDTTAVMLTWALSLLLNNPQVLRKAREELDLHVGKDRRVTES  300

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIIN--NYHIQKGTRLITNFVKIHRDP  472
             D+  L+YLQA++KET RLYP+ PL V  +  EDC     NYH+ KGTRLI N  K+ RDP
Sbjct  301   DINNLVYLQAIVKETFRLYPSSPLGVTRDFNEDCTFGGGNYHVPKGTRLIFNLWKLQRDP  360

Query  471   KVWAK-PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
              +W   P E+RPERFL+ HKDV++ G  FEL+PFG+GRR+CPG+   ++++ L LA L+H
Sbjct  361   NIWPDDPSEYRPERFLSTHKDVEINGKQFELVPFGAGRRICPGLHFGIQMIHLVLADLLH  420

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              FD+ + S+EP+D+TES GLTN KATPL  L+ PRL  NLY
Sbjct  421   AFDISKPSDEPVDMTESAGLTNAKATPLDVLIAPRLSPNLY  461



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 238/336 (71%), Gaps = 15/336 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGE-----DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
               N+++ M+ G+         E  ++++A +  FEL G  +VAD  P+LRWLDIGG E+ 
Sbjct  300   TANVILKMIVGKRISSLGNDAESGRWKKALKEFFELSGKFLVADAFPFLRWLDIGGDERL  359

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M++    +   AE W++EHK+KR S   ++EE DFMD MLS+                YD
Sbjct  360   MKKVKKVLNEVAEEWLQEHKQKRASGEFRDEEEDFMDVMLSILTDAKE----------YD  409

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D I K+TCL ++LAATD T+VTL W L+L+LNN + L++ Q E+D H+GK++ VEE+D+
Sbjct  410   ADTINKATCLILILAATDPTAVTLTWCLALLLNNRDALKKAQQEIDIHIGKDKPVEENDI  469

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             K L+YLQA+IKET+RL+PA PL+VPHE+ME+C +N YHI  GT L+ N  KIHRD +VW+
Sbjct  470   KNLVYLQAIIKETLRLHPAGPLAVPHESMENCTVNGYHIPAGTELLINLYKIHRDSRVWS  529

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P +F+PERFLT HK+ DVRG NFELIPF SGRRMCPG+S AL++VQL LA+L+HGFD+ 
Sbjct  530   DPYKFQPERFLTTHKNFDVRGQNFELIPFSSGRRMCPGVSFALQVVQLTLANLLHGFDLA  589

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                +EP+D+ E+ GL+NFKATPL+  + PRL ++ Y
Sbjct  590   TPFDEPVDMREAAGLSNFKATPLEVSISPRLPNSCY  625



>gb|KDO37196.1| hypothetical protein CISIN_1g019564mg [Citrus sinensis]
Length=339

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 239/333 (72%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+    V+  ++     R FE+ G  VV+D +P+LRWLDIGG E++M+  
Sbjct  14    IRNVVLRMIVGKGCNSVDGEEWMELLTRSFEMSGKFVVSDALPFLRWLDIGGDERSMKNI  73

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E+++  + W+E+HKRKR S+  KEEE DFM  ML +       S       G D D +
Sbjct  74    AEELDNLLQGWLEKHKRKRNSQEIKEEELDFMSVMLLILGDKEQYS-------GRDVDTV  126

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL ++LAATDTT+VTL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+
Sbjct  127   NKATCLGLILAATDTTAVTLTWVISLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLV  186

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KETMRLYPAVPL VPHE+ME+CI+N YH+  GT++  N  K+ RDP+VW +P +
Sbjct  187   YLQAILKETMRLYPAVPLLVPHESMEECIVNGYHVPAGTQIFINAWKLQRDPRVWEEPCK  246

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F P+ FLT  KD+DV+G NFEL+PF SGRRMCPG+S AL+++Q  LASL+HGFD    SN
Sbjct  247   FHPKTFLTRQKDIDVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSN  306

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GLT  K+TPL+ L+ PRL ++LYG
Sbjct  307   EPVDMGEGLGLTMEKSTPLEVLVAPRLSASLYG  339



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   347 bits (889),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 231/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+LFG  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  213   DSSDFQEHATDFFDLFGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKS  272

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+         +LPGG DTD +IK+ CL+++LAA+DTT+
Sbjct  273   KRGSSEVKGDE-DFMYVMLSLFD-----DKTKQLPGGDDTDTVIKAICLSLILAASDTTA  326

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VLE+ Q+ELD HVG  R+V ESD+  L +LQ V+KET+RLYPA P
Sbjct  327   VTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAP  386

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE++EDC I+ YH+  GT+LI N  KI RDP VW +P +F PERFLT +KDVD++G
Sbjct  387   LLLPHESIEDCTISGYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKG  446

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+  +D+ E+  LT  KAT
Sbjct  447   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKAT  506

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  507   PLEVLLTPRLSASLY  521



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 178/336 (53%), Positives = 245/336 (73%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LR LD+ G+E+ M++T
Sbjct  160   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRRLDLDGYERMMKKT  217

Query  987   AMEMESFAERWMeehkrkrksksskeeEAD----FMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHK +R +   + +  D    FMD MLS+ +          +PG YD
Sbjct  218   AQELDRVVQGWLNEHKSRRSANKRRGDNKDSDRDFMDVMLSIVDAA------EEIPG-YD  270

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSVTL WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  271   ADTFIKATCMALILAGSDTTSVTLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  330

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
               L+Y+QA+IKETMRLYPA PL VPHE+MEDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  331   MNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWS  390

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFELIPFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  391   DPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  450

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++EP+D+T++ G+TN KATPL+ L+ PRL  + Y
Sbjct  451   TLADEPVDMTKAIGMTNLKATPLEVLVTPRLPEHAY  486



>ref|XP_010686309.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   346 bits (888),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 232/325 (71%), Gaps = 9/325 (3%)
 Frame = -3

Query  1146  SMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             S+ F + EV   ++  +A R  FEL G  V AD +P+LRWLDIGG+EK M+  A  ++  
Sbjct  195   SIEFHQSEV--HNQCMKAIRDFFELAGVFVPADALPFLRWLDIGGYEKKMKRVAKVIDVV  252

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             A++W+EEHK ++ SK   E+  DFMD MLS+FET          P  +D+D IIK+T +A
Sbjct  253   AQKWLEEHKERKSSKEKDEKR-DFMDVMLSVFETGQDK------PFKFDSDTIIKATSMA  305

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+LAATDTT+VTL WALSL+LNN ++L++ Q ELD  VGKER+VEESDLK L+YLQAV+K
Sbjct  306   MILAATDTTAVTLTWALSLLLNNKDILKKTQAELDNVVGKERQVEESDLKNLVYLQAVLK  365

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             ETMRLYPA PLSVP EA+ DC ++ Y+I  GT+L  N  KIHRDP+VW  P EF PERFL
Sbjct  366   ETMRLYPAAPLSVPREAITDCTVSGYYIPVGTQLFVNLYKIHRDPEVWEDPLEFHPERFL  425

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T +K  DVRG  FE +PFGSGRR+CPGIS AL  +Q  LASL+HGFD+    +  +D+TE
Sbjct  426   TTYKQYDVRGQQFEYMPFGSGRRICPGISFALLAMQFTLASLLHGFDISIPCDGTVDMTE  485

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
               GLTN KATPL+ +   RL  N+Y
Sbjct  486   GFGLTNLKATPLEVIATHRLPRNIY  510



>gb|KHN22284.1| Cytochrome P450 82A3 [Glycine soja]
Length=452

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 230/321 (72%), Gaps = 9/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE+E  E  + ++A R  F+L GA  V+D +P+LRWLD+ G EK M++TA E++ F + W
Sbjct  138   GENE--ENERIRKALREFFDLTGAFNVSDALPYLRWLDLDGAEKKMKKTAKELDGFVQVW  195

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK KR S++  +   D MD +LSL E       + +   G D D  IK+TCL ++LA
Sbjct  196   LEEHKSKRNSEAEPKSNQDLMDVLLSLVE-------EGQEFDGQDADTTIKATCLGLILA  248

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
              +DTT+ TL WALSL+LNN EVL +   ELDT +G E+ VE SDLK+L YLQ++IKET+R
Sbjct  249   GSDTTTTTLSWALSLLLNNREVLNKAIHELDTQIGSEKIVEISDLKKLEYLQSIIKETLR  308

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PL+VPHE++EDC +  YH+  GTRL+TN  K+ RDP ++  P EF PERFLT HK
Sbjct  309   LYPAAPLNVPHESLEDCTVGGYHVPTGTRLLTNISKLQRDPSLYPNPLEFWPERFLTTHK  368

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVD++G +FELIPFG+GRRMCPG+S  L+++QL LA+L+HGFD+     E +D+ E  GL
Sbjct  369   DVDIKGQHFELIPFGAGRRMCPGLSFGLQVMQLTLATLLHGFDIVTSDGEHVDMLEQIGL  428

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KA+PLQ +L PRL  ++Y
Sbjct  429   TNIKASPLQVILTPRLSGHIY  449



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 240/333 (72%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+    V+  ++     R FE+ G  VV+D +P+LRWLDIGG E++M+  
Sbjct  200   IRNVVLRMIVGKGCNSVDGEEWMELLTRSFEMSGKFVVSDALPFLRWLDIGGDERSMKNI  259

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E+++  + W+E+HKRKR S+  KEEE DFM  ML +       S       G D D +
Sbjct  260   AEELDNLLQGWLEKHKRKRNSQEIKEEELDFMSVMLLILGDKEQYS-------GRDVDTV  312

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL ++LAATDTT+VTL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+
Sbjct  313   NKATCLGLILAATDTTAVTLTWVISLLLNHRDILNKAQNELDIQVGSKRQVNESDIKNLV  372

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KETMRLYPAVPL VPHE+ME+CI+N YHI  GT+L  N  K+ RDP+VW +P +
Sbjct  373   YLQAILKETMRLYPAVPLLVPHESMEECIVNGYHIPAGTQLFINAWKLQRDPRVWEEPYK  432

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F P+RFLT HKD+DV+G NFEL+PF SGRRMCPG+S AL+++Q  LASL+HGFD    SN
Sbjct  433   FHPKRFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSN  492

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GLT  K+TPL  L+ PRL ++LYG
Sbjct  493   EPVDMGEGLGLTMEKSTPLVVLVAPRLSASLYG  525



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/336 (53%), Positives = 245/336 (73%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LR LD+ G+E+ M++T
Sbjct  205   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRRLDLDGYERMMKKT  262

Query  987   AMEMESFAERWMeehkrkrksksskeeEAD----FMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHK +R +   + +  D    FMD MLS+ +          +PG YD
Sbjct  263   AQELDRVVQGWLNEHKSRRSANKRRGDNKDSDRDFMDVMLSIVDAA------EEIPG-YD  315

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSVTL WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  316   ADTFIKATCMALILAGSDTTSVTLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  375

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
               L+Y+QA+IKETMRLYPA PL VPHE+MEDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  376   MNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWS  435

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFELIPFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  436   DPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  495

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++EP+D+T++ G+TN KATPL+ L+ PRL  + Y
Sbjct  496   TLADEPVDMTKAIGMTNLKATPLEVLVTPRLPEHAY  531



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 240/335 (72%), Gaps = 12/335 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVV----EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             V  M+V   + E E      E    ++A R  FEL G   V D +P+LRWLD+GGHEKAM
Sbjct  202   VFKMVVGKRYSEAETSHGKDENDGHRKALRDFFELTGTFTVGDSLPFLRWLDLGGHEKAM  261

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             ++TA E++   E W+EEHK+KR S +++ E  DFM  MLSL    A       LP  Y+ 
Sbjct  262   KKTAKELDHILEEWLEEHKQKRNSGNAESEH-DFMGMMLSLLNDAA------ELPS-YNA  313

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
             D IIK+TCLA++L  TDTT+VT+ WALSL+LN+++VLE+ Q ELDT+VG+ER V+ESD+K
Sbjct  314   DTIIKATCLAIILGGTDTTTVTITWALSLLLNHHDVLEKAQHELDTYVGRERPVQESDVK  373

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
              L+YLQA+IKET RLYPA PLSV HE++EDC    Y I  GTRL+ N  K+ RDPK W+ 
Sbjct  374   NLVYLQAIIKETTRLYPAAPLSVMHESVEDCTTAGYFIPAGTRLLVNLSKLQRDPKAWSN  433

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             PDEFRPERFLT HK  DVRG N+EL+PFGSGRR+CPGIS AL+++Q +LASL+  F++  
Sbjct  434   PDEFRPERFLTTHKHFDVRGQNYELVPFGSGRRVCPGISFALQVLQFSLASLLQAFEITT  493

Query  276   ISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              S+EP+D+ E  GLTN KATPL+ +L PRL  +LY
Sbjct  494   PSDEPVDMGEGAGLTNLKATPLEVILTPRLPPHLY  528



>ref|XP_010696627.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=512

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 230/315 (73%), Gaps = 7/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E ++  +A R  F L GA V AD +P+LRWLDIGG+EK M++ A++++  A+ W+EEH+R
Sbjct  204   EYTRCLKAIREFFVLGGAFVPADALPFLRWLDIGGYEKKMKKAALDIDVIAQNWLEEHRR  263

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R+SK ++E+   FMD ML + E T  +  +      ++ D IIK+TC+AM+L   D+T+
Sbjct  264   RRRSKETQEKRY-FMDAMLDIMENTQENVSK------FEADTIIKATCMAMILGGADSTA  316

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
              TL WALSL+LNN ++L++ Q ELD  VGK R+VEESDLK L+YLQAV+KETMRLYPA P
Sbjct  317   ATLTWALSLLLNNKDILKKTQAELDIQVGKNRQVEESDLKNLVYLQAVLKETMRLYPAAP  376

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LSVP EA+ +C +N YHI  GTRL  N  K+HRDPKVW  P EFRPERFLT +K+ DVRG
Sbjct  377   LSVPREAIINCTVNGYHISAGTRLFVNLYKVHRDPKVWEDPLEFRPERFLTTYKEYDVRG  436

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
               FE +PFGSGRR+CPGIS AL  +Q  LA L+H F++  +S+E +D+TE  GLTN KAT
Sbjct  437   QQFEYMPFGSGRRICPGISSALRFMQFTLAKLLHAFEITILSDEAVDMTEGFGLTNLKAT  496

Query  216   PLQALLIPRLESNLY  172
             PL+ +L  RL  N+Y
Sbjct  497   PLEVILTHRLPHNIY  511



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 236/322 (73%), Gaps = 10/322 (3%)
 Frame = -3

Query  1131  EDEVVEESK-FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             EDE  E +K +++  +  F       V+D +P+LR LD+GGH +AM++TA E++   E W
Sbjct  225   EDE--ESAKGWKKGLKDFFHWTAVFSVSDALPFLRLLDLGGHVEAMKKTAKELDLVVEDW  282

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHKRKR +   K +E DFMD ML +F+  A +        G D+D I K+T LA++LA
Sbjct  283   LEEHKRKRAAGIVKGKE-DFMDLMLDVFDNDAEAVQ------GGDSDTINKATSLALILA  335

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             A+DTT+VTLIWALSL++NN  VL++ Q ELDTHVGKER+VEESD++ L++L+AVI+ET+R
Sbjct  336   ASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVFLKAVIRETLR  395

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PL +PHEA EDC I+ YH+ +GTRL+ +  KIHRD +VW+ P+EF PERFLT H+
Sbjct  396   LYPAAPLLLPHEATEDCTIDGYHVPRGTRLLVDVSKIHRDERVWSNPNEFDPERFLTTHR  455

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
               D RG NFE  PFGSGRRMCPG+S AL  + LALA+L+HGFD    S EP+D+ ES GL
Sbjct  456   GFDARGKNFEFFPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHESSGL  515

Query  234   TNFKATPLQALLIPRLESNLYG  169
             TN +ATPL+ LL PRL S LYG
Sbjct  516   TNLRATPLEVLLCPRLPSGLYG  537



>ref|XP_010061806.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=541

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 245/336 (73%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LRWLD+ G+E+ M++T
Sbjct  214   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRWLDLDGYERMMKKT  271

Query  987   AMEMESFAERWMeehkrkrksks----skeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHK +R +      +K+ + DFMD MLS  +          LPG YD
Sbjct  272   AQELDRVVQGWLNEHKSRRSTNKRRGDNKDSDQDFMDVMLSTVDAA------EELPG-YD  324

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSV+L WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  325   ADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  384

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             + L+Y+QA+IKETMRLYPA PL VPHE+ EDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  385   ENLVYIQAIIKETMRLYPAAPLGVPHESTEDCTVDGYHIPKGTRLLFNFSKIHRDQHIWS  444

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFEL+PFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  445   DPQEFRPERFLTTHRNFDVRGQNFELLPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  504

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++E +D+ E+ G+TN KATPL+ L+ PRL  + Y
Sbjct  505   TLADEQVDMAEAIGMTNLKATPLEVLVTPRLPEHTY  540



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 227/317 (72%), Gaps = 7/317 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A  + F L G  VV+D +P+L WLD+ GHE+AM+ TA E+++  E W++EH++
Sbjct  208   EARRCQKAINQFFRLIGIFVVSDALPFLGWLDLQGHERAMKNTAKELDAILEGWLDEHRQ  267

Query  936   krkskssk-eeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             +R S   K E E DF+D MLSL E    S+ Q      YD +  IKSTCLA++L  +DTT
Sbjct  268   RRVSAGIKDEGEQDFIDVMLSLKEEGQLSNFQ------YDANTSIKSTCLALILGGSDTT  321

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             + TL WA+SL+LNN  +L++ Q+ELD HVGKER+VE+SD+K L+YLQA+IKET+RLYPA 
Sbjct  322   AGTLTWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAG  381

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PL  P EAMEDC +  YH+  GTRLI N  KI RDP+VW  P  F PERFLT H DVDVR
Sbjct  382   PLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVR  441

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G  FELIPFGSGRR CPG+S AL+++ L LA L+H F++    ++P+DLTES GLT  KA
Sbjct  442   GQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKA  501

Query  219   TPLQALLIPRLESNLYG  169
             TPL+ +L PRL   LYG
Sbjct  502   TPLEVILTPRLPPKLYG  518



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   345 bits (884),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 231/312 (74%), Gaps = 7/312 (2%)
 Frame = -3

Query  1104  FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrks  925
             +++  +  F   G   V+D +P+LR+LD+GGH +AM++TA E++   E W+EEHKRKR +
Sbjct  233   WKKGLKDFFHWTGVFPVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLEEHKRKRAA  292

Query  924   ksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLI  745
                K +E DFMD ML +F+  A +        G D+D I K+T L ++LAA+DTT+VTLI
Sbjct  293   GIVKGKE-DFMDLMLDVFDNDAEAVQ------GGDSDTINKATSLTLILAASDTTAVTLI  345

Query  744   WALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVP  565
             WALSL++NN   L++ Q ELDTHV KER+VEESD++ L+YL+AV+KET+RLYP  PL +P
Sbjct  346   WALSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLKAVLKETLRLYPPGPLLIP  405

Query  564   HEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFE  385
             HEA+EDC I+ YH+ +GTRL+ N  KIHRD +VW+ P+EF PERFLT H+  DVRG NFE
Sbjct  406   HEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFE  465

Query  384   LIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQA  205
              +PFGSGRRMCPG+S AL  + LALA+L+HGFD    S EP+D+ E+ GLTN +ATPL+ 
Sbjct  466   FLPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHENSGLTNLRATPLEV  525

Query  204   LLIPRLESNLYG  169
             LL PRL S LYG
Sbjct  526   LLCPRLPSRLYG  537



>ref|XP_010106080.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07350.1| Cytochrome P450 82A3 [Morus notabilis]
Length=641

 Score =   348 bits (892),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 226/305 (74%), Gaps = 5/305 (2%)
 Frame = -3

Query  1125  EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee  946
             E+  + + ++  R  F+L    VV+D +P+LRWLD+GG EKAM++ + E++  A+RW+EE
Sbjct  266   ELGSDDRCRKTLRDFFDLAATFVVSDALPYLRWLDLGGCEKAMKKASKELDQLAQRWLEE  325

Query  945   hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATD  766
             HK KR S    +++ DFMD MLS+ +    S   S     YD D I K+  LA++LA TD
Sbjct  326   HKLKRVSGEVTKDDQDFMDVMLSILDGADQSGIAS-----YDVDTITKAISLALILAGTD  380

Query  765   TTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYP  586
             TT+ T+IWA++L+LNN E L++ Q ELD HVGKER+V+ESDLK L YLQA++KET+RL+P
Sbjct  381   TTTATMIWAIALLLNNREALKKAQQELDQHVGKERQVKESDLKNLDYLQAILKETLRLFP  440

Query  585   AVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVD  406
             A PLSVPHE+ EDC +  YH+   TRLI N  K+H DP VW +P EFRPERFLT H++VD
Sbjct  441   AAPLSVPHESTEDCTVAGYHVPARTRLILNLSKLHLDPTVWHEPSEFRPERFLTTHQNVD  500

Query  405   VRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNF  226
             VRG NFELIPFGSGRRMCPG+S AL+++QL LA+L+HGF++   S+EP+D+ E+ GLT+ 
Sbjct  501   VRGQNFELIPFGSGRRMCPGVSFALQVLQLTLATLLHGFEIATTSDEPVDMRETVGLTSI  560

Query  225   KATPL  211
             K +PL
Sbjct  561   KTSPL  565



>ref|XP_010686293.1| PREDICTED: cytochrome P450 CYP82D47-like [Beta vulgaris subsp. 
vulgaris]
Length=518

 Score =   343 bits (881),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 233/325 (72%), Gaps = 9/325 (3%)
 Frame = -3

Query  1146  SMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             SM F + E  E +   +A+R  FEL G  V AD +P+L WLDIGG+EK M+  A ++   
Sbjct  195   SMEFYQSE--EYNLCTKANRDFFELAGVFVPADALPFLTWLDIGGYEKKMKRVAKDINVV  252

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             A++W+EEHK +R SK  +E+  DFMD +LS+FET          P  +D+D IIK+T + 
Sbjct  253   AQKWLEEHKERRSSKEKEEKR-DFMDVLLSVFETGQDK------PFKFDSDTIIKATSMG  305

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             ++LAATDTT++TL WALSL+LNN +VL++ Q ELD  VGKER+VEESDLK L+YLQAV+K
Sbjct  306   IILAATDTTAITLTWALSLLLNNKDVLKKTQAELDNVVGKERQVEESDLKNLVYLQAVLK  365

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             ETMRLYPA PL+VP EA+ DC +N Y+I  GT+L  N  KIHRDPKVW  P EF PERF 
Sbjct  366   ETMRLYPAGPLAVPREAITDCTVNGYYIPAGTQLFVNLYKIHRDPKVWEDPLEFHPERFP  425

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T +K  D+RG  FE +PFG+G+R+CPGIS AL  +Q  LASL+HGFD+   ++E +D+TE
Sbjct  426   TTYKQYDIRGQQFEYMPFGNGKRICPGISFALLAMQFTLASLLHGFDISIPTDETVDMTE  485

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
             S GLTN KATPL+ +   RL  NLY
Sbjct  486   SFGLTNLKATPLEVIATHRLPHNLY  510



>ref|XP_003528211.2| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=541

 Score =   344 bits (882),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 230/321 (72%), Gaps = 9/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE+E  E  + ++A R  F+L GA  V+D +P+LRWLD+ G EK M++TA E++ F + W
Sbjct  227   GENE--ENERIRKALREFFDLTGAFNVSDALPYLRWLDLDGAEKKMKKTAKELDGFVQVW  284

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEHK KR S++  +   D MD +LSL E       + +   G D D  IK+TCL ++LA
Sbjct  285   LEEHKSKRNSEAEPKSNQDLMDVLLSLVE-------EGQEFDGQDADTTIKATCLGLILA  337

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
              +DTT+ TL WALSL+LNN EVL +   ELDT +G E+ VE SDLK+L YLQ++IKET+R
Sbjct  338   GSDTTTTTLSWALSLLLNNREVLNKAIHELDTQIGSEKIVEISDLKKLEYLQSIIKETLR  397

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PL+VPHE++EDC +  YH+  GTRL+TN  K+ RDP ++  P EF PERFLT HK
Sbjct  398   LYPAAPLNVPHESLEDCTVGGYHVPTGTRLLTNISKLQRDPSLYPNPLEFWPERFLTTHK  457

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVD++G +FELIPFG+GRRMCPG+S  L+++QL LA+L+HGFD+     E +D+ E  GL
Sbjct  458   DVDIKGQHFELIPFGAGRRMCPGLSFGLQVMQLTLATLLHGFDIVTSDGEHVDMLEQIGL  517

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KA+PLQ +L PRL  ++Y
Sbjct  518   TNIKASPLQVILTPRLSGHIY  538



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 229/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             + S FQ  +   F+L G  VV+D +P+LRWLDIGG+EK M++TA E +   + W++EHK 
Sbjct  213   DSSDFQEHATNFFDLCGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKS  272

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DFM  MLSLF+  A      +LP G DTD +IK+ CL+++LAA+DTT+
Sbjct  273   KRGSSEVKGDE-DFMYVMLSLFDDKAK-----QLPDGDDTDTVIKAICLSLILAASDTTA  326

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VL++ Q+ELD  VG  R+V ESD+K L YLQ ++KET+RLYPA P
Sbjct  327   VTLTWAIALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGP  386

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L VPHE++EDC I  YH+  GT+LI N  K+ RDP VW +P +F PERFL  +KDVD++G
Sbjct  387   LLVPHESIEDCTIRGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKG  446

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRRMCPGIS A +++ L LASL+HGFD    S+ P+D+ E+  LT  KAT
Sbjct  447   QNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKAT  506

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  507   PLEVLLTPRLSASLY  521



>gb|KCW68808.1| hypothetical protein EUGRSUZ_F02407 [Eucalyptus grandis]
Length=562

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 245/336 (73%), Gaps = 16/336 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             N++  M+ G   EDE  ++ K + A R  F+L G  +V+D  P LRWLD+ G+E+ M++T
Sbjct  235   NVVFRMIVGKRYEDE--QDEKGREALRSYFDLAGRFIVSDAFPILRWLDLDGYERMMKKT  292

Query  987   AMEMESFAERWMeehkrkrksks----skeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             A E++   + W+ EHK +R +      +K+ + DFMD MLS  +          LPG YD
Sbjct  293   AQELDRVVQGWLNEHKSRRSTNKRRGDNKDSDQDFMDVMLSTVDAA------EELPG-YD  345

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D  IK+TC+A++LA +DTTSV+L WALSL+LN+ EVL++ Q ELDT +G+ER V ESDL
Sbjct  346   ADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDL  405

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
             + L+Y+QA+IKETMRLYPA PL VPHE+ EDC ++ YHI KGTRL+ NF KIHRD  +W+
Sbjct  406   ENLVYIQAIIKETMRLYPAAPLGVPHESTEDCTVDGYHIPKGTRLLFNFSKIHRDQHIWS  465

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EFRPERFLT H++ DVRG NFEL+PFGSGRRMCPGI+LA++++ L+LA+L+HGFD+ 
Sbjct  466   DPQEFRPERFLTTHRNFDVRGQNFELLPFGSGRRMCPGINLAMQLISLSLAALLHGFDIT  525

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              +++E +D+ E+ G+TN KATPL+ L+ PRL  + Y
Sbjct  526   TLADEQVDMAEAIGMTNLKATPLEVLVTPRLPEHTY  561



>gb|KDP38433.1| hypothetical protein JCGZ_04358 [Jatropha curcas]
Length=481

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 236/330 (72%), Gaps = 17/330 (5%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee-hk  940
             +  +++ A  + FEL G  V++D +P+LRWLD+GG++K+M++TA E++ F + W++E   
Sbjct  154   DSDEWREAVNKFFELSGKYVLSDSLPFLRWLDLGGYQKSMKKTAKELDVFVQSWLDEHKC  213

Query  939   rkrksksskeeEADFMDTMLSLFETTASSSH--------------QSRLPGGYDTDQIIK  802
             ++  S+ + + E DFMD MLS+F+  A   H                 LP  +D D I K
Sbjct  214   KRSSSECNVKGEEDFMDVMLSIFDE-AEELHGIPFYVVKEFCLDEAEELPC-HDADTIKK  271

Query  801   STCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYL  622
             +TCLA+ LAA+DTT +TL WALS +L N EVL++ Q ELDT +G+ER +EE D+K+L+Y+
Sbjct  272   ATCLALTLAASDTTKITLTWALSFLLKNGEVLKKAQLELDTEIGRERNIEEPDMKKLVYI  331

Query  621   QAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFR  442
             +A+IKET+RL PA PLSVPHE+MEDC++ +Y I KGTRL+ N  K+HRDP++W  P EFR
Sbjct  332   EAIIKETLRLEPAAPLSVPHESMEDCVVGSYDIPKGTRLLVNLWKMHRDPRIWLDPYEFR  391

Query  441   PERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEP  262
             PERFLT HKD DV+G NFEL+PFGSGRRMCPG+S AL+++QL LA+L+H FD+   S + 
Sbjct  392   PERFLTTHKDFDVKGQNFELMPFGSGRRMCPGVSFALQVMQLTLANLLHAFDISVPSGKQ  451

Query  261   IDLTESCGLTNFKATPLQALLIPRLESNLY  172
             IDL E  G+TN +AT L  +L PRL + LY
Sbjct  452   IDLVEGFGVTNNEATQLDVVLCPRLPAYLY  481



>emb|CDP16080.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 223/327 (68%), Gaps = 9/327 (3%)
 Frame = -3

Query  1140  LFGEDEVVEESK---FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMES  970
              FG  +V +E +    Q   R  F L G  V+AD +P+LRWLD GG+EK MR  A EM+ 
Sbjct  208   FFGAVDVSKEEEARLCQNVMREFFHLTGLFVLADSVPYLRWLDWGGYEKKMRVNAQEMDQ  267

Query  969   FAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCL  790
              A RW++EH++K++S  +  +  DFMD MLSL E  A ++      GGYD D I K+TC 
Sbjct  268   LANRWLKEHRQKKQSGEATSDHRDFMDVMLSLKEAAAIAA-----VGGYDADTITKATCT  322

Query  789   AMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVI  610
              ++   +DTT V LIW LSL++NN +VL++ Q+ELD  VGK RRV ESD+  L+YLQA+I
Sbjct  323   ILISGGSDTTLVALIWTLSLIMNNPQVLKKAQEELDLQVGKGRRVSESDISNLVYLQAII  382

Query  609   KETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA-KPDEFRPER  433
             KE +RLYP  PL    E  EDCI+  YHI KGTR+I N  KI RDP VW   P EFRPER
Sbjct  383   KEALRLYPPEPLGGARELREDCIVGGYHIPKGTRVILNIRKIQRDPNVWHDDPLEFRPER  442

Query  432   FLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDL  253
             FLT HK +D +G NFELIPFG GRR+CPGI+  L+I+ L L +L+H F++   SNEP+D+
Sbjct  443   FLTTHKHIDAKGYNFELIPFGGGRRICPGINFGLQILHLVLPNLLHAFELSTPSNEPVDM  502

Query  252   TESCGLTNFKATPLQALLIPRLESNLY  172
             TES GL+N KATPLQ L+ PRL  +LY
Sbjct  503   TESAGLSNMKATPLQLLVAPRLPHHLY  529



>ref|XP_008236910.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=540

 Score =   343 bits (879),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/341 (53%), Positives = 245/341 (72%), Gaps = 16/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++  M+ G+         E  E  + ++  R  F+L G  V++D +P+LRWLD+GG EK
Sbjct  200   NVMFRMVVGKRFLGAKTKQEEEENERCRKGLRDFFKLGGEFVISDALPFLRWLDLGGFEK  259

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++T+ +++   + W+EEHK+KR +  + + E DFMD  LS+F+   +      +P   
Sbjct  260   AMKKTSKDLDVALQGWLEEHKQKRSNCGNAKAEHDFMDMTLSVFDEIKAED----IPAST  315

Query  822   DT--DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              T  D I K+TCLA++L  TDTT+VTL WALSL+LNN E L + Q ELD HVG+ER+V+E
Sbjct  316   STSADTINKATCLALILGGTDTTTVTLTWALSLLLNNREALRKAQHELDKHVGRERQVKE  375

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             +D+K L+YLQA++KETMRLYPA PLSVPHE MEDC + NYH++ GTRL+ N  KI RDP 
Sbjct  376   TDVKNLVYLQAIVKETMRLYPAAPLSVPHECMEDCTVANYHVKAGTRLLVNLSKIQRDPN  435

Query  468   VWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
              W  PD+F+PERFLT HKD DVRG NFE +PFGSGRR+CPGISLAL++VQL LA L+HGF
Sbjct  436   AWVDPDQFQPERFLTTHKDFDVRGQNFEFMPFGSGRRICPGISLALQVVQLTLAHLLHGF  495

Query  288   DMRRI--SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++     S+EPID+ E+ G+TN KATP++ LL PRL ++LY
Sbjct  496   EIATPSGSDEPIDMGETLGITNMKATPVEVLLTPRLPAHLY  536



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 229/315 (73%), Gaps = 9/315 (3%)
 Frame = -3

Query  1113  ESK-FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             ESK +++  R LF+L G  V AD IP+LRW DIGG EKAM +TA E++  AE W++EHK+
Sbjct  219   ESKIWKQGLRDLFDLIGKFVAADAIPFLRWFDIGGFEKAMIKTAKELDLVAEGWLKEHKK  278

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   + E   FM  ML++ + T  +        G  +D I K+  L+++L A+DTT+
Sbjct  279   KRASGFKQGE-EHFMGLMLNILDHTQVAQ-------GPHSDPINKAVSLSLILVASDTTA  330

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL++NN   L++ QDELD HVG+ER+++ESD+K L YLQA++KET+RLYPA P
Sbjct  331   VTLNWALSLLVNNPNALKKAQDELDMHVGRERQIQESDIKNLEYLQAILKETLRLYPAGP  390

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS+PHE+ EDC +  Y I  GT+L+ N  KIH DP+VW  P EFRPERFLT HKD DVRG
Sbjct  391   LSLPHESTEDCTVGGYDIPAGTKLVINIWKIHHDPRVWENPFEFRPERFLTSHKDFDVRG  450

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFE IPFGSGRR CPGIS  L+++QL LA+L+H FD+   SNEP+D+TE+ GLTN +AT
Sbjct  451   QNFEFIPFGSGRRRCPGISFGLQVMQLTLANLLHSFDIETPSNEPVDMTENIGLTNLRAT  510

Query  216   PLQALLIPRLESNLY  172
             PL+ L+ PRL  +LY
Sbjct  511   PLEILMHPRLPPHLY  525



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   341 bits (875),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 229/324 (71%), Gaps = 11/324 (3%)
 Frame = -3

Query  1137  FGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAER  958
             F  D+  E  ++ +A R  FEL G  +V+D +P+LRW D+GG+EKAM++TA  ++   E 
Sbjct  205   FSSDK--EGVEYHKAIRCFFELTGKFMVSDALPFLRWFDLGGYEKAMKKTAKSLDHLLED  262

Query  957   WMeehkrkrksksskeeEADFMDTMLSLF--ETTASSSHQSRLPGGYDTDQIIKSTCLAM  784
             W++EHKRKR S     ++ DFMD MLS+   ET A     S      D D I K+TCL +
Sbjct  263   WLQEHKRKRVSGQPTGDQ-DFMDVMLSILDDETRAQDIKSS------DADIINKATCLNV  315

Query  783   LLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKE  604
             L+A TDT +V+L WALSL+LNN  VL + ++ELD HVG+ERRVEE D+  L+YL A+IKE
Sbjct  316   LIATTDTVTVSLTWALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYLDAIIKE  375

Query  603   TMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLT  424
             T+RLY AV +   HE+ E+C++   +I  GTRLI N  KIH DP VW+ PD+F PERFLT
Sbjct  376   TLRLYSAVQVLAAHESTEECVVGGCYIPAGTRLIINLWKIHHDPSVWSDPDQFMPERFLT  435

Query  423   HHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTES  244
              HKDVDVRG +FELIPFGSGRR+CPG+SLAL+ +Q  LASL+ GF+    S+ P+D+TES
Sbjct  436   THKDVDVRGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGPVDMTES  495

Query  243   CGLTNFKATPLQALLIPRLESNLY  172
              GLTN KATPL  LL PRL SNLY
Sbjct  496   IGLTNLKATPLDVLLTPRLSSNLY  519



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   341 bits (875),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 231/316 (73%), Gaps = 8/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++A R  FE FG  V +D  P+L+WLD+GGHEKAM++TA  ++   ++W++EH++
Sbjct  222   ENEEYRKALRDFFEWFGVFVPSDSFPFLKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQQ  281

Query  936   krksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             K+ +  + + E  DFMD MLS        S        YD   + K+TCLA++LA +DTT
Sbjct  282   KKNNLGAVKMEEHDFMDVMLSNVRDDGQLSK-------YDAHIVTKATCLALILAGSDTT  334

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             +VT+IWALSL+LNN EVL+R Q ELD HVG++R+V+ESD+K L+YLQAV+KET+RLYPA 
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             P+ +PHE++EDC++  YHI  GTRLI N  K+ RDP++W  P EF PERFLT  KD DVR
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDFDVR  454

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G + +LIPFGSGRRMCPGIS AL+++ LALA+L+HGF++ R + E +D+ ES G+T+ + 
Sbjct  455   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  514

Query  219   TPLQALLIPRLESNLY  172
              PL+ +L PRL   +Y
Sbjct  515   NPLEVVLTPRLPPQVY  530



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   341 bits (874),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 227/307 (74%), Gaps = 7/307 (2%)
 Frame = -3

Query  1083  LFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksksskee-  907
                L G  V++D IPWLRWLD+GGHE+AM++ A E++     W+EEHK+KRK     +  
Sbjct  214   FLRLSGTFVLSDAIPWLRWLDLGGHERAMKKVAKELDLVFNGWLEEHKQKRKISGQVKGD  273

Query  906   --EADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALS  733
               + DFMD MLS+ +   ++     +   YD D + K+T +A+++A  +  +V + WAL+
Sbjct  274   DDQLDFMDVMLSILDVDGAN----EITTDYDADTVNKATSMALIVAGVEAPAVQMTWALA  329

Query  732   LVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAM  553
             L+LNN E L++ Q+ELD  +GK R+V+ESD+K L+YLQA+IKE+ RLYPA PLS+PHE+ 
Sbjct  330   LLLNNREALKKAQEELDQIIGKGRQVKESDIKNLVYLQAIIKESTRLYPAGPLSLPHEST  389

Query  552   EDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPF  373
             EDC++ +YH+  GTRL  N  K+HRDP+VW++P+EFRPERFLT HK  DV+G++FELIPF
Sbjct  390   EDCMVGDYHVPAGTRLFVNLSKLHRDPRVWSEPNEFRPERFLTTHKSFDVKGHDFELIPF  449

Query  372   GSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIP  193
             GSGRRMCPG+SLAL+++ L LASL+HGF++   ++EP+D+ E+ GLTN KATPL+ L  P
Sbjct  450   GSGRRMCPGMSLALKVIALTLASLLHGFEIATPTDEPVDMVETVGLTNNKATPLEVLFTP  509

Query  192   RLESNLY  172
             RL + LY
Sbjct  510   RLPAQLY  516



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 231/316 (73%), Gaps = 8/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++A R  FE FG  V +D  P+L+WLD+GGHEKAM++TA  ++   ++W++EH++
Sbjct  228   ENEEYRKALRDFFEWFGVFVPSDSFPFLKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQQ  287

Query  936   krksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             K+ +  + + E  DFMD MLS        S        YD   + K+TCLA++LA +DTT
Sbjct  288   KKNNLGAVKMEEHDFMDVMLSNVRDDGQLSK-------YDAHIVTKATCLALILAGSDTT  340

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             +VT+IWALSL+LNN EVL+R Q ELD HVG++R+V+ESD+K L+YLQAV+KET+RLYPA 
Sbjct  341   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  400

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             P+ +PHE++EDC++  YHI  GTRLI N  K+ RDP++W  P EF PERFLT  KD DVR
Sbjct  401   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDFDVR  460

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G + +LIPFGSGRRMCPGIS AL+++ LALA+L+HGF++ R + E +D+ ES G+T+ + 
Sbjct  461   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  520

Query  219   TPLQALLIPRLESNLY  172
              PL+ +L PRL   +Y
Sbjct  521   NPLEVVLTPRLPPQVY  536



>emb|CBI32508.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRET  988
             V N+ +  + G+     ES++ +A      L G  +V+D +P+L WLD + G+   M+ T
Sbjct  9     VANLTMRTVAGKRCENGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGT  68

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++    RW+EEH++KR S S  E E DF+  MLS+ +    S+H       +D D +
Sbjct  69    ARQLDQVLGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQLSAHD------HDHDTV  122

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IK+TCL ++LA  DT ++TL WALSL++NN   L++ Q+ELD HVG+ ++V ESD+K+L+
Sbjct  123   IKATCLTVMLAGNDTIAITLTWALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLV  182

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKET+RLYPA PL++PHEAMEDC I  +HIQ GTRL+ N  K+HRDP +W+ P E
Sbjct  183   YLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLE  242

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT H  +DVRG +FEL+PFGSGRRMCPGISLALEI+QL LA L+HGF++  +++
Sbjct  243   FQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVAD  302

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              P+D+TE  GL   KATPL+  L+PRL S LY
Sbjct  303   SPLDMTEGVGLAMPKATPLEVTLVPRLPSELY  334



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 226/315 (72%), Gaps = 9/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++A R  FE FG  V +D  P+L+WLD+GGHEKAM++TA  ++   ++W+++HK 
Sbjct  217   ENEEYRKALRDFFEWFGVFVPSDSFPFLKWLDLGGHEKAMKKTAKVLDEVFDKWIQDHKN  276

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
                    +E   DFMD MLS        S        YD   + K+TCL+++LA +DTT+
Sbjct  277   NLGEVKMEEH--DFMDVMLSNVRDDGQLSK-------YDAHTVTKATCLSLILAGSDTTT  327

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VT+IWALSL+LNN EVL+R Q ELD  VG++R+V+ESD+K L+YLQA++KET+RLYPA P
Sbjct  328   VTMIWALSLLLNNQEVLKRAQLELDERVGRQRQVKESDVKNLLYLQAIVKETLRLYPAAP  387

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             + VPHE+++DC++  YHI  GTRLI N  K+ RDP++W  P EFRPERFLT  KD DVRG
Sbjct  388   ILVPHESVDDCVVAGYHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSAKDFDVRG  447

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              N  LIPFGSGRRMCPGIS AL+++ LALA+L+HGF++ R S E +D+ ES G+T+ +  
Sbjct  448   QNPRLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPSKEFLDMEESAGMTSIRKN  507

Query  216   PLQALLIPRLESNLY  172
             PL+ +L PRL  ++Y
Sbjct  508   PLEVVLTPRLPPHVY  522



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   340 bits (871),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 228/307 (74%), Gaps = 7/307 (2%)
 Frame = -3

Query  1083  LFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksksskee-  907
                L G  V++D IPWLRWLD+GGHE+AM++ A E++     W+EEHK++RK     +  
Sbjct  214   FLRLSGTFVLSDAIPWLRWLDLGGHERAMKKVAKELDLVFNGWLEEHKQRRKISGQVKGG  273

Query  906   --EADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALS  733
               + DFMD MLS+ +   ++   S     YD D + K+T +A+++A  +  +V + WAL+
Sbjct  274   DDQLDFMDVMLSILDVDGANEITS----DYDADTVNKATSMALIVAGVEAPAVQMTWALA  329

Query  732   LVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAM  553
             L+LNN E L++ Q+ELD  +GK+R+V+ESD+K L+YLQA+IKE+MRLYPA PLS+PHE+ 
Sbjct  330   LLLNNREALKKAQEELDQIIGKDRQVKESDIKNLVYLQAIIKESMRLYPAGPLSLPHEST  389

Query  552   EDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPF  373
             EDC++ +YH+  GTRL+ N  K+HRDP+VW+ P+EFRPERFLT HK  DV+G++FELIPF
Sbjct  390   EDCMVGDYHVPAGTRLLVNLSKLHRDPRVWSDPNEFRPERFLTTHKSFDVKGHDFELIPF  449

Query  372   GSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIP  193
             GSGRRMCPG+SLAL+++ L LASL+HGF++   ++E +D+ E+ G+TN KATPL+ L  P
Sbjct  450   GSGRRMCPGMSLALKVIALTLASLLHGFEIGTPTDETVDMGETVGVTNNKATPLEVLFTP  509

Query  192   RLESNLY  172
             RL + LY
Sbjct  510   RLPAQLY  516



>ref|XP_002510312.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52499.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   339 bits (870),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/339 (51%), Positives = 236/339 (70%), Gaps = 17/339 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++  ++FG+         E  +  +++ A R  F L G  VV+D +P+LRWLD+GG+EK
Sbjct  189   NVIFRIIFGKRYINYTTTQEDGDSDQWREAVRNFFVLSGKFVVSDAVPFLRWLDLGGYEK  248

Query  1002  AMRETAMEMESFAERWM-eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             +M++TA E++   + W+ E  +++  S +  + E DFMD MLS+ +          LP  
Sbjct  249   SMKKTARELDVVVQGWLDEHKRKRLMSGNRVKGEEDFMDVMLSILDDA------EELPS-  301

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
              D D I K+TCLA+ LAA+ TT +TL WAL+ +LNN ++L++ Q ELDTHVGKER V+ES
Sbjct  302   LDADTINKATCLALTLAASGTTKITLTWALAYLLNNLDILKKAQHELDTHVGKERNVQES  361

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA++KET+RL PA  LSVPHE+ EDC++  YHIQKGT+L+ N  K+HRD  V
Sbjct  362   DMKNLVYLQAIVKETLRLNPAATLSVPHESTEDCVVGGYHIQKGTKLLVNLWKMHRDSDV  421

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W+ P EF+P RFLT HKD DVRG NFELIPFGSGRRMCPG+S AL++++L LA LVHGFD
Sbjct  422   WSAPYEFKPGRFLTTHKDFDVRGQNFELIPFGSGRRMCPGVSFALQVMELTLAGLVHGFD  481

Query  285   MRRISNEPIDLTESCGL-TNFKATPLQALLIPRLESNLY  172
             +   S + IDL    GL TN + T L+ +L PRL ++LY
Sbjct  482   ISIPSGKQIDLDAGFGLETNDETTQLEVILSPRLSAHLY  520



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   339 bits (869),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 223/312 (71%), Gaps = 9/312 (3%)
 Frame = -3

Query  1107  KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrk  928
             + Q+A R  F L G  VV D IP L WLD+GGHEKAM++TA E++S A+ W+EEH+R++ 
Sbjct  225   RCQKAIREFFRLLGLFVVKDGIPSLGWLDLGGHEKAMKKTAKEIDSIAQEWLEEHRRRKD  284

Query  927   sksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTL  748
                      DFMD +LS+ +  A       LP  YD D I K+T +A++   TDT +VTL
Sbjct  285   WGEDNGMH-DFMDVLLSVLDGKA-------LPE-YDADTINKATSMALISGGTDTMTVTL  335

Query  747   IWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSV  568
              WALSL+LNN E L++ ++ELDTHVGKER V  SD+ +L+YLQA++KET+RL P  PLS 
Sbjct  336   TWALSLILNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGPLSG  395

Query  567   PHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNF  388
             P +  EDCII  YH+ KGTRL+ N  K+HRDP VW  P+EF+PERFLT H+DVD RG +F
Sbjct  396   PRQFTEDCIIGGYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPERFLTTHRDVDARGQHF  455

Query  387   ELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQ  208
             +L+PFG+GRR CPGI+ AL+++ LALAS +HGF++   SN P+D++E  GLTN K+TPL+
Sbjct  456   QLLPFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKSTPLE  515

Query  207   ALLIPRLESNLY  172
              L+ PRL  N Y
Sbjct  516   ILIAPRLPYNSY  527



>gb|KHN42045.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 228/317 (72%), Gaps = 10/317 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++  R    LFG  V++D IP+L WLDI G+EKAM+ TA E++   E W+EEHKR
Sbjct  152   EARRYKKVMRECVSLFGVFVLSDAIPFLGWLDINGYEKAMKRTASELDPLVEGWLEEHKR  211

Query  936   krksksskeeEAD-FMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             KR      +EE D FMD ML++ +    S        GYD+D IIK+TCL ++LA +DTT
Sbjct  212   KRAFNMDAKEEQDNFMDVMLNVLKDAEIS--------GYDSDTIIKATCLNLILAGSDTT  263

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
              ++L W LSL+LN+   L+++QDELDT++GK+R+VEESD+ +L+YLQA++KETMRLYP  
Sbjct  264   MISLTWVLSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPS  323

Query  579   PLSVPHEAMEDCIINN-YHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
             PL     AMEDC  +  YHI  GTRL+ N  KIHRD +VW+ P +F+P RFLT HKDVDV
Sbjct  324   PLITLRAAMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDV  383

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             +G N+EL+PFGSGRR CPG SLAL +V L +A L+H F++   SN+ +D+TES GLTN K
Sbjct  384   KGQNYELVPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLK  443

Query  222   ATPLQALLIPRLESNLY  172
             ATPL+ LL PRL++ LY
Sbjct  444   ATPLEILLTPRLDTKLY  460



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   339 bits (869),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 230/316 (73%), Gaps = 8/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++A R     FG  V +D  P+L+WLD+GGHEKAM++TA  ++   ++W++EH++
Sbjct  222   ENEEYRKALRDFSNXFGVFVPSDSFPFLKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQQ  281

Query  936   krksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             K+ +  + + E  DFMD MLS        S        YD   + K+TCLA++LA +DTT
Sbjct  282   KKNNLGAVKMEEHDFMDVMLSNVRDDGQLSK-------YDAHIVTKATCLALILAGSDTT  334

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             +VT+IWALSL+LNN EVL+R Q ELD HVG++R+V+ESD+K L+YLQAV+KET+RLYPA 
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             P+ +PHE++EDC++  YHI  GTRLI N  K+ RDP++W  P EFRPERFLT  KD DVR
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSEKDFDVR  454

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G + +LIPFGSGRRMCPGIS AL+++ LALA+L+HGF++ R + E +D+ ES G+T+ + 
Sbjct  455   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  514

Query  219   TPLQALLIPRLESNLY  172
              PL+ +L PRL   +Y
Sbjct  515   NPLEVVLTPRLPPQVY  530



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 227/315 (72%), Gaps = 7/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E +     +   F LFG  VV+D +P+LRWLDIGG+EK M++TA E +   ++W++EHK 
Sbjct  213   EGTDLHEHAASFFTLFGKFVVSDALPFLRWLDIGGNEKLMKKTAKEFDIILQQWLDEHKI  272

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   + +E DF+  MLSL    A      +LP   D D +IK+ CL ++L A DTTS
Sbjct  273   KRGSSEVEGDE-DFIYVMLSLLYDNAK-----QLPDS-DADTVIKALCLTVILGAADTTS  325

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA+SL+LNN + L++ QDEL+ HVG  R+V ESD+K L+YLQA++KETMRLYPA P
Sbjct  326   VTLTWAISLLLNNRDALKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAAP  385

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PH++MEDC I+ YH+  GT+L  N  K+H DPKVW +P +F PERFLT HKD+D+RG
Sbjct  386   LLLPHQSMEDCTISGYHVPAGTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKDIDLRG  445

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              NFELIPFGSGRR+CPGIS A +++ L LASL+HGFD+    +EP+D+ E+  LT  +AT
Sbjct  446   QNFELIPFGSGRRICPGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRAT  505

Query  216   PLQALLIPRLESNLY  172
             PL+ LL PRL ++LY
Sbjct  506   PLKVLLTPRLSASLY  520



>ref|XP_007207908.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
 gb|EMJ09107.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
Length=502

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 245/341 (72%), Gaps = 16/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++  M+ G+         E  E  + ++  R  F+L G  V++D +P+LRWLD+GG EK
Sbjct  162   NVMFRMVVGKRFLGAKTKQEEEENERCRKGLRDFFKLGGEFVISDALPFLRWLDLGGFEK  221

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++T+ +++   + W+EEHK+KR    + + E DFMD MLS+F+   +      +P   
Sbjct  222   AMKKTSKDLDVALQGWLEEHKQKRSHCGNAKAEHDFMDMMLSVFDEINAKD----IPAST  277

Query  822   DT--DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              T  D I K+TCLA++L  TDTT+VTL WALSL+LNN E L + Q ELD HVG+ER+V+E
Sbjct  278   STSADTINKATCLALILGGTDTTTVTLTWALSLLLNNREALWKAQHELDMHVGRERQVKE  337

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             +D++ L+YLQA++KETMRLYPA PLSVPHE MEDC + + H++ GTRL+ N  KI RDP 
Sbjct  338   TDVQNLVYLQAIVKETMRLYPAAPLSVPHECMEDCTVASNHVKAGTRLLVNLSKIQRDPN  397

Query  468   VWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
             VW  PD+F+PERFLT HKD DVRG NFE +PFGSGRR+CPGISLAL++VQL LA L+HGF
Sbjct  398   VWVDPDQFQPERFLTTHKDFDVRGQNFEFMPFGSGRRICPGISLALQVVQLTLAHLLHGF  457

Query  288   DMRRI--SNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++     S+EPID+ E+ G+TN KATP++ LL PRL ++LY
Sbjct  458   EIATPSGSDEPIDMGETLGITNMKATPVEVLLTPRLRAHLY  498



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 226/317 (71%), Gaps = 7/317 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A  + F L G  +V+D +P+L WLD+ GHE+AM+ TA E+++  E W++EH++
Sbjct  215   EARRCQKAINQFFRLIGIFLVSDALPFLGWLDLQGHERAMKNTAKELDAILEGWLDEHRQ  274

Query  936   krksksskee-EADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             +R S   K+E E DF+D MLSL E    S+ Q      YD +  IKSTCLA++L  +DTT
Sbjct  275   RRVSAGIKDEDEQDFIDVMLSLKEEGQLSNFQ------YDANTSIKSTCLALILGGSDTT  328

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             + TL WA+SL+LNN  +L++ Q+ELD  VGKER+VE+SD+K L+YLQA+IKET+RLYPA 
Sbjct  329   AGTLTWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAG  388

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PL  P EAMEDC +  YH+  GTRLI N  KI RDP+VW  P  F PERFLT H DVDVR
Sbjct  389   PLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVR  448

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G  FELIPFGSGRR CPG+S AL+++ L LA L+H F +    ++P+DLTES GLT  KA
Sbjct  449   GQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKA  508

Query  219   TPLQALLIPRLESNLYG  169
             TPL+ +L PRL   LYG
Sbjct  509   TPLEVILTPRLPPKLYG  525



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 226/327 (69%), Gaps = 12/327 (4%)
 Frame = -3

Query  1128  DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMe  949
             +E  E  + ++A R    L    VV+D IP+L+WLD GG  KAM+ TA +++   + W+E
Sbjct  212   EEKEENERCRKALRDFLRLSSEFVVSDKIPFLKWLDFGGIGKAMKATAKDLDVALQGWLE  271

Query  948   ehkrkrksksskeeEA-----DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAM  784
             EHK+KR S+S           DFMDTMLS+    ++       P     D  IK+TCLA 
Sbjct  272   EHKQKRNSRSELNSGNVKDERDFMDTMLSVLGDVSAEG----FPSTTIADTTIKATCLAA  327

Query  783   LLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKE  604
             +L  TD T+  L W LSL+LNN E L++ Q+ELD  VG+ER+V+ESD+K L+YLQA++KE
Sbjct  328   ILGGTDPTTAVLTWVLSLLLNNREALKKAQEELDNQVGRERQVKESDVKNLVYLQAIVKE  387

Query  603   TMRLYPAVPLSVPHEAMEDCIINN---YHIQKGTRLITNFVKIHRDPKVWAKPDEFRPER  433
             T+RLYP  PLS+PHE +EDC + N   YH++ GTRL+ N  KIHR+P VW  P  F+PER
Sbjct  388   TLRLYPPSPLSIPHECIEDCNVGNGTNYHVKTGTRLLVNIWKIHRNPNVWLDPFRFQPER  447

Query  432   FLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDL  253
             FLT HKD DVRG NFE IPFGSGRRMCPG+SL L++VQL LA L+HGF++   S+EP+D+
Sbjct  448   FLTTHKDFDVRGQNFEFIPFGSGRRMCPGVSLGLQVVQLTLAQLLHGFEIATPSDEPVDM  507

Query  252   TESCGLTNFKATPLQALLIPRLESNLY  172
             TES G+TN KATPL+ LL PRL + LY
Sbjct  508   TESTGVTNMKATPLEVLLTPRLPAKLY  534



>emb|CDP07595.1| unnamed protein product [Coffea canephora]
Length=880

 Score =   347 bits (891),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 227/327 (69%), Gaps = 11/327 (3%)
 Frame = -3

Query  1140  LFGEDEVVEESK---FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMES  970
              FG  +V EE +    Q+  R  F L G  V+AD +P+LRWLD GG+E+ M+  A E++ 
Sbjct  560   FFGAADVSEEKEAKVCQKVMREFFYLTGLFVLADSVPYLRWLDWGGYERKMKVNAQEVDR  619

Query  969   FAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCL  790
              A+ W++EH+RK+ S  +  +  DFMD MLSL E    S+       GYD D I K+TC+
Sbjct  620   LADGWLKEHRRKKHSGEATSDHQDFMDVMLSLTEGADFSA-------GYDADTITKATCV  672

Query  789   AMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVI  610
              ++   +DTT V L W LSL++NN  VL++ Q+ELD HVGKERRV ESD+  L+YLQA+I
Sbjct  673   GLISGGSDTTVVMLTWTLSLIMNNPRVLKKAQEELDLHVGKERRVTESDISNLVYLQAII  732

Query  609   KETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA-KPDEFRPER  433
             KET+RLYP  PL    E  EDCII  YHI KGTR+I N  KI RDP VW   P EFRPER
Sbjct  733   KETLRLYPPGPLGGTRELSEDCIIGGYHIPKGTRVILNMWKIQRDPNVWHDGPLEFRPER  792

Query  432   FLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDL  253
             FLT HK +DV+G +FELIPFG+GRR+CPGI+L L+++ L LA+L+H FD+   SNEP+D+
Sbjct  793   FLTTHKHIDVKGYHFELIPFGAGRRICPGINLGLQMLHLVLANLLHAFDLSTPSNEPVDM  852

Query  252   TESCGLTNFKATPLQALLIPRLESNLY  172
             TES GLTN KATPLQ L+ PRL  +LY
Sbjct  853   TESAGLTNIKATPLQLLVAPRLPPHLY  879



>gb|KHN22283.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 230/320 (72%), Gaps = 9/320 (3%)
 Frame = -3

Query  1125  EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee  946
             E  E  + ++A R LF+L G+  V+D +P+LRW D+ G EK M+ TA E++ F E W++E
Sbjct  144   ETEENERIRKAMRDLFDLSGSFSVSDALPYLRWFDLDGAEKKMKTTAKELDGFVEVWLQE  203

Query  945   hkrkrksksskeeEA--DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             HKR R +  S +E+   DFMD +L+L E       + +   G D D  IK+TCLA++LA 
Sbjct  204   HKRNRNNSGSGQEKGNHDFMDLLLNLVE-------EGQEFDGRDGDTTIKATCLALILAG  256

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
              DTT+ T+ WALSL+LNN+ +L ++  ELDTH+G E+ V+ SDLK+L YLQ++IKET+RL
Sbjct  257   MDTTAGTMTWALSLLLNNHGILNKVVHELDTHIGTEKMVKVSDLKKLEYLQSIIKETLRL  316

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS+PHE+M+DC +  YH+  GTRL+TN  K+ RDP +++ P EF PERFLT HKD
Sbjct  317   YPVGPLSLPHESMQDCTVGGYHVPSGTRLLTNISKLQRDPLLYSNPLEFCPERFLTTHKD  376

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +DV+G +FELIPFG+GRRMCPG+S  L+I+QL LA+L+HGFD+     +P D+ E  GLT
Sbjct  377   IDVKGQHFELIPFGAGRRMCPGLSFGLQIMQLTLATLLHGFDIVIHDAKPTDMLEQIGLT  436

Query  231   NFKATPLQALLIPRLESNLY  172
             N KA+PLQ +L PRL + +Y
Sbjct  437   NIKASPLQVILTPRLSTYIY  456



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/339 (53%), Positives = 236/339 (70%), Gaps = 17/339 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE---------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             NM+V M+ G+         ++  E  + QRA  R F L G  VV+D +P+L W D+ GHE
Sbjct  168   NMIVKMVAGKRYFGSSAKMEDAEEARQCQRAIARFFHLIGIFVVSDALPFLGWFDLQGHE  227

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             K MR+TA E++   ERW++EH+R+R S  S+ + +DF+D MLSL      S  Q      
Sbjct  228   KEMRKTASELDGILERWIDEHQRRRVSGQSEGD-SDFIDVMLSLEGEGKLSDLQ------  280

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD    IKSTCLA++L  +DTT+ TL WA++L+LNN E+L++ Q+E+D HVGK R+VE+S
Sbjct  281   YDPRTSIKSTCLALILGGSDTTAGTLTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDS  340

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D++ L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y +  GTRLI N  KI RDPKV
Sbjct  341   DIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKV  400

Query  465   WAKPDEFRPERFLTHHK-DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
             W  P+EFRPERFLT  + + DVRG NFEL+PFGSGRR CPG SLAL+++ L+LA ++H F
Sbjct  401   WRNPEEFRPERFLTGKETEYDVRGQNFELMPFGSGRRSCPGASLALQVLHLSLARVLHSF  460

Query  288   DMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             D+  +S+  +D+ ES GLT  KATPL+ LL PRLE  LY
Sbjct  461   DLLTVSDSEVDMRESPGLTIPKATPLEVLLTPRLEQELY  499



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/337 (53%), Positives = 246/337 (73%), Gaps = 14/337 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++  M+ G+         E+  + + ++A R  FEL G  VV+D +P+L+WLD GG+EK
Sbjct  197   NVIFRMVVGKRYLEATSLSEIGSDDRCRKALRDFFELTGTFVVSDALPYLKWLDFGGYEK  256

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             +M++T+ E++  A+RW+EEHKRKR S     ++ DFMD MLS+ +       +  +   Y
Sbjct  257   SMKKTSKELDQLAQRWLEEHKRKRVSGEVNGDQ-DFMDVMLSILDGA-----ELGISSTY  310

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T LA++LA TDTT+VT+ WAL+L+LNN E L++ + ELD +VGKER+V+ESD
Sbjct  311   DADTINKATSLALILAGTDTTTVTMTWALALLLNNREALKKAEQELDLYVGKERQVKESD  370

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             LK L+YLQA++KETMRLYPA PLS+PHE+ EDC +  YH+  GTRL+ N  K+H DPKVW
Sbjct  371   LKNLVYLQAILKETMRLYPAGPLSLPHESTEDCTVGGYHVPAGTRLLLNLSKLHLDPKVW  430

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EFRPERFLT HK+VDVRG NFELIPF SGRRMCPG+S AL+++QL LA+L+HGF +
Sbjct  431   DQPSEFRPERFLTAHKNVDVRGQNFELIPFSSGRRMCPGVSFALQVMQLTLAALLHGFKI  490

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S+EP+D+ E+ GLTN KATPL  ++ PRL +  Y
Sbjct  491   ATRSDEPVDMRETVGLTNLKATPLDVIITPRLHAGAY  527



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   337 bits (863),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/322 (54%), Positives = 224/322 (70%), Gaps = 9/322 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             + E  E  + Q+  R    LFG  V++D IP+L WLD  G+EKAM+ TA E++  A  W+
Sbjct  215   DGEEAEARRNQKVMRDFVRLFGVFVLSDAIPFLGWLDFNGYEKAMKRTAKELDILAGGWL  274

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             EEHK++R     +++E DFMD ML++ E            GG+D D I K+TCL ++LA 
Sbjct  275   EEHKQRRLLGGKEKQEQDFMDVMLNILEKANI--------GGFDADTINKATCLNVILAG  326

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT VTL WALSL+LNN +VL++ +DELD HVGK+R V+ESD+  L+YLQA+IKET+RL
Sbjct  327   SDTTMVTLTWALSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRL  386

Query  591   YPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             YP  PL     A EDC ++  YH+  GTRL+ N  KI RD +VW  PDEF PERFLT  K
Sbjct  387   YPPSPLIAHRSAKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTSQK  446

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             ++D++G NFELIPFGSGRR CPGI+LAL IV   LA L+H F++ + S E +D+TES GL
Sbjct  447   EIDLKGQNFELIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGL  506

Query  234   TNFKATPLQALLIPRLESNLYG  169
             TN KATPL+ LLIPRL   LYG
Sbjct  507   TNLKATPLEILLIPRLNPRLYG  528



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   336 bits (862),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 238/333 (71%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+    ++  +++    R FE+ G  VV+D +P+LRWLDIGG E++M++ 
Sbjct  200   IRNVVLRMIVGKGCNSMDSEEWKELLTRFFEMSGKFVVSDALPFLRWLDIGGDERSMKKI  259

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W+EEHK KR S+   +EE DFM  MLS+   T           G D D I
Sbjct  260   AKELDVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDTDQYY-------GRDVDTI  312

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+ CL ++LAATDTT+VTL W +SL+LN++++L + ++ELD  VG +R+V ESD+K L+
Sbjct  313   NKAICLGLILAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLV  372

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KE MRLYPA PL +PHE++E+C ++ Y++  GT+L  N  K+ RDP VW +P +
Sbjct  373   YLQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCK  432

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD DVRG NFEL+PF SGRRMCPG+S AL+++Q  LASL+HGFD+   SN
Sbjct  433   FQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSN  492

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GLT  K+TPL+ L+ PRL ++LYG
Sbjct  493   EPLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>ref|XP_004308852.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=471

 Score =   334 bits (857),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 235/344 (68%), Gaps = 16/344 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
              +N++  M+ G+         E  E  +F++  R    L G  V++D +P+LRWLD+GG+
Sbjct  127   TSNVMFRMVVGKRFFVANSAQENEENERFRKELREFSRLGGEFVISDAVPYLRWLDLGGY  186

Query  1008  EKAMRETAMEMESFAERWMeehk-----rkrksksskeeEADFMDTMLSLFETTASSSHQ  844
             EKAM++TA E++   ++W++EHK     R   S      E DFMD ML++ +        
Sbjct  187   EKAMKKTAKELDGALQKWLDEHKHNLHGRSTNSVKHVNGENDFMDMMLAVLDDDYC---M  243

Query  843   SRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKE  664
                 G    D I+K+TCLA+LL  TDTT+VTL WALSL+LNN EVL++ Q ELD HVG+E
Sbjct  244   EEFAGSRTADTILKATCLAVLLGGTDTTTVTLTWALSLLLNNPEVLKKAQLELDNHVGRE  303

Query  663   RRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKI  484
             R+V ESD+K L+YLQA++KET+RLYPA PLSVPHE+ EDC I +YH+  GTRL+ N  K+
Sbjct  304   RQVNESDVKNLVYLQAIVKETLRLYPAGPLSVPHESREDCTIGDYHVSSGTRLLINLSKM  363

Query  483   HRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALAS  304
              RDP VW  P  F+PERFLT HK+VDVRG +FEL PFGSGRRMCPGISLAL++ QL LA 
Sbjct  364   QRDPDVWDDPCRFQPERFLTTHKNVDVRGQSFELTPFGSGRRMCPGISLALQVTQLTLAH  423

Query  303   LVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             L+HGF++   S+EP+D+ E  G+ N KATPL+ LL P L   LY
Sbjct  424   LLHGFEITTPSDEPVDMGERSGIANMKATPLEVLLTPSLHPKLY  467



>gb|KDP20667.1| hypothetical protein JCGZ_03867 [Jatropha curcas]
Length=437

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 230/315 (73%), Gaps = 8/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E   ++ A R   EL G   V+D +P+LRWLD+GG EK M+E   +++   E W++EHK+
Sbjct  129   ESGTWRDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKENLKKLDPVVEEWLQEHKQ  188

Query  936   krkskssk-eeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             K+++     +EE DFM  +LS+            L  G D D I K+TC+A++LAA+DTT
Sbjct  189   KKEASGGVPKEEEDFMYVLLSIL------GDAKELSTG-DADTINKATCMALILAASDTT  241

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             ++T+IWALSL+L N +VL++ Q+ELD H G++R+VEESD+K L+YLQA+IKET RLYPAV
Sbjct  242   AITMIWALSLLLKNPDVLKKAQNELDIHFGRKRQVEESDIKSLVYLQAIIKETFRLYPAV  301

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PL +PHE+ME+CII+  HI   TRLI N  KI +DP VW  P+EF+PERFLT HKDVD +
Sbjct  302   PLLIPHESMEECIIDGNHIPPKTRLIINAAKIQKDPIVWPNPEEFQPERFLTAHKDVDFK  361

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G  FELIPFGSGRR+CPGIS AL+++ L LA+L+H F++   S++PID++E+ G+TN K+
Sbjct  362   GQFFELIPFGSGRRICPGISFALQVLNLTLATLLHSFEIETSSSDPIDMSETSGITNLKS  421

Query  219   TPLQALLIPRLESNL  175
             TP+  +L PRL +NL
Sbjct  422   TPVDVVLTPRLAANL  436



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 239/333 (72%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ ++ G+    ++  +++    R FE+ G  VV+D +P+LRWLDIGG E++M++ 
Sbjct  200   IRNVVLRIIVGKGCNSMDSEEWKELLTRFFEMSGKFVVSDALPFLRWLDIGGDERSMKKI  259

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W+EEHK KR S+   +EE DFM  MLS+   T           G D D I
Sbjct  260   AKELDVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDTEQYY-------GRDVDTI  312

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+ CL ++LAATDTT+VTL W +SL+LN++++L + ++ELD  VG +R+V ESD+K+L+
Sbjct  313   NKAICLGLILAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLV  372

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KE MRLYPA PL +PHE++E+C ++ Y++  GT+L  N  K+ RDP VW +P +
Sbjct  373   YLQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCK  432

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD DVRG NFEL+PF SGRRMCPG+S AL+++Q  LASL+HGFD+   SN
Sbjct  433   FQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSN  492

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GLT  K+TPL+ L+ PRL ++LYG
Sbjct  493   EPLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 235/340 (69%), Gaps = 17/340 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE---------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             NM+V M+ G+         D   E  + Q+A  + F L G  VV+D +P+LRW D+ GHE
Sbjct  193   NMVVRMVAGKRYFGASASCDNDDEARRCQKAINQFFHLIGIFVVSDALPFLRWFDVQGHE  252

Query  1005  KAMRETAMEMESFAERWMeehkrkrk-sksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             +AM++TA E+++  E W++EH+ +R   +   E E DF+D MLSL +    S+ Q     
Sbjct  253   RAMKKTAKELDAILEGWLKEHREQRVDGEIKAEGEQDFIDIMLSLQKGGHLSNFQ-----  307

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              YD+D  IKSTCLA++L  +DTT+ T+ WA+SL+LNN + L++ Q+ELD +VG ER+VEE
Sbjct  308   -YDSDTSIKSTCLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLNVGMERQVEE  366

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD++ L Y+QA+IKET+RLYPA PL  P EA EDC +  YH+  GTRL+ N  KIHRDP+
Sbjct  367   SDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRDPR  426

Query  468   VWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
             VW +P  FRPERFLT    VDVRG NFELIPFGSGRR CPG+S AL+++ L LA L+H F
Sbjct  427   VWQEPSAFRPERFLTSDA-VDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAF  485

Query  288   DMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             +    S++P+D+TES GLT  KATPL+ LL PRL + LY 
Sbjct  486   EFATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLYA  525



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRET  988
             V N+ +  + G+     ES++ +A      L G  +V+D +P+L WLD + G+   M+ T
Sbjct  190   VANLTMRTVAGKRCENGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGT  249

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++    RW+EEH++KR S S  E E DF+  MLS+ +    S+H       +D D +
Sbjct  250   ARQLDQVLGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQLSAHD------HDHDTV  303

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IK+TCL ++LA  DT ++TL WALSL++NN   L++ Q+ELD HVG+ ++V ESD+K+L+
Sbjct  304   IKATCLTVMLAGNDTIAITLTWALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLV  363

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKET+RLYPA PL++PHEAMEDC I  +HIQ GTRL+ N  K+HRDP +W+ P E
Sbjct  364   YLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLE  423

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT H  +DVRG +FEL+PFGSGRRMCPGISLALEI+QL LA L+HGF++  +++
Sbjct  424   FQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVAD  483

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              P+D+TE  GL   KATPL+  L+PRL S LY
Sbjct  484   SPLDMTEGVGLAMPKATPLEVTLVPRLPSELY  515



>ref|XP_003527704.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=535

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 230/320 (72%), Gaps = 9/320 (3%)
 Frame = -3

Query  1125  EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee  946
             E  E  + ++A R LF+L G+  V+D +P+LRW D+ G EK M+ TA E++ F E W++E
Sbjct  217   ETEENERIRKAMRDLFDLSGSFSVSDALPYLRWFDLDGAEKKMKTTAKELDGFVEVWLQE  276

Query  945   hkrkrksksskeeEA--DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             HKR R +  S +E+   DFMD +L+L E       + +   G D D  IK+TCLA++LA 
Sbjct  277   HKRNRNNSGSGQEKGNHDFMDLLLNLVE-------EGQEFDGRDGDTTIKATCLALILAG  329

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
              DTT+ T+ WALSL+LNN+ +L ++  ELDTH+G E+ V+ SDLK+L YLQ++IKET+RL
Sbjct  330   MDTTAGTMTWALSLLLNNHGILNKVVHELDTHIGTEKMVKVSDLKKLEYLQSIIKETLRL  389

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS+PHE+M+DC +  YH+  GTRL+TN  K+ RDP +++ P EF PERFLT HKD
Sbjct  390   YPVGPLSLPHESMQDCTVGGYHVPSGTRLLTNISKLQRDPLLYSNPLEFCPERFLTTHKD  449

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +DV+G +FELIPFG+GRRMCPG+S  L+I+QL LA+L+HGFD+     +P D+ E  GLT
Sbjct  450   IDVKGQHFELIPFGAGRRMCPGLSFGLQIMQLTLATLLHGFDIVIHDAKPTDMLEQIGLT  509

Query  231   NFKATPLQALLIPRLESNLY  172
             N KA+PLQ +L PRL + +Y
Sbjct  510   NIKASPLQVILTPRLSTYIY  529



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 239/329 (73%), Gaps = 15/329 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMR  994
             N+++ M+ G+         E  +++ A +  F+L G  V++D +P+LRWLD+GG EK M+
Sbjct  200   NVMLRMIVGKRIPSSGSDAEGERWKDALQDFFDLSGKFVISDALPFLRWLDVGGDEKFMK  259

Query  993   ETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTD  814
             +   E++  AE W+++HK+K  S + + ++ DFMD M S+  T A         G +D +
Sbjct  260   KVRKELDEVAEGWLQDHKQKTASGNQESDQ-DFMDVMFSILSTDA---------GKHDAE  309

Query  813   QIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKE  634
              I K+ CL ++L   DTT+VTL WALSL+LNN + L++ Q+ELD HVG+++ VEESD+K+
Sbjct  310   TINKANCLNLILGGFDTTTVTLTWALSLLLNNRDALKKAQEELDIHVGRDKLVEESDVKK  369

Query  633   LIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKP  454
             LIYLQA++KET+RLYPA PLSVPHE+ EDC ++ YHI  GTRL+ N  KIHRDP+VW+ P
Sbjct  370   LIYLQAIVKETLRLYPAGPLSVPHESTEDCTVSGYHIPAGTRLLINLYKIHRDPRVWSDP  429

Query  453   DEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRI  274
              EF+PERFLT +KD DVRG NFELIPFGSGRRMCPG+S AL++++L LA+L+ GF++   
Sbjct  430   CEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELTLANLLQGFELGTP  489

Query  273   SNEPIDLTESCGLTNFKATPLQALLIPRL  187
              +E +D++E+ G+TN KA+PL+ L+ PRL
Sbjct  490   LDELVDMSEAIGMTNLKASPLEVLITPRL  518



>gb|KDP38434.1| hypothetical protein JCGZ_04359 [Jatropha curcas]
Length=558

 Score =   335 bits (860),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 221/310 (71%), Gaps = 13/310 (4%)
 Frame = -3

Query  1158  NMLVSMLFGEDEVV------EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             N+++ M+FG+          E  ++++A R  FEL G  + AD +P+LRW DIGGHEKAM
Sbjct  190   NLILKMIFGKSVGYMTTSHGESERWKKALRDFFELSGRFIAADAVPFLRWFDIGGHEKAM  249

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             +ETA E++  AE W++EHK+K+ S     EE DFMD ML+  +         ++    D+
Sbjct  250   KETAKELDLVAEEWLKEHKKKKASGVKHGEE-DFMDVMLNTIDDDV------QVALNRDS  302

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
             D I K+T L + +AA+DTT+VTL WALSL++NN  VL++ Q ELD HVGKERRV ESD+ 
Sbjct  303   DTINKATSLGLTVAASDTTTVTLTWALSLLINNPNVLKKAQKELDIHVGKERRVNESDMN  362

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
              L+YL A+IKET+RLYPA PLSVPHE+ EDC + +YHI  GTRL+ N  KI RDP+VW+ 
Sbjct  363   NLVYLNAIIKETLRLYPAGPLSVPHESFEDCTVGSYHIPSGTRLLVNIWKIQRDPRVWSY  422

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             P EFRPERFLT HKD DVRG NFELIPF SGRRMCPG+S AL ++QL LA+L+HGFD   
Sbjct  423   PSEFRPERFLTTHKDFDVRGQNFELIPFSSGRRMCPGVSFALHVLQLTLATLLHGFDFAS  482

Query  276   ISNEPIDLTE  247
              ++ PID+ E
Sbjct  483   PTDGPIDIRE  492



>ref|XP_007222593.1| hypothetical protein PRUPE_ppa004169mg [Prunus persica]
 gb|EMJ23792.1| hypothetical protein PRUPE_ppa004169mg [Prunus persica]
Length=525

 Score =   334 bits (857),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 233/337 (69%), Gaps = 17/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G        EDE  E  + Q A +  F   G +VV D +P+LRWLD+GGHEK
Sbjct  197   NVILRMVAGKRYSVAADEDEKKEARRVQSALKVFFYYVGVSVVGDVVPYLRWLDLGGHEK  256

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++ A E+++    W+EEHKR+R    +K E+ DF+D MLS+ +            GG+
Sbjct  257   AMKKVAKELDAIVGGWVEEHKRRRARGDAKGEQ-DFIDAMLSVLDGADL--------GGF  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D + K+T L M+   +DTT VTL WA+SL+LNN  VL+R Q+ELDT +G++R V ESD
Sbjct  308   DADTVNKATSLNMIAGGSDTTMVTLTWAISLLLNNPHVLKRAQNELDTEIGRQRVVSESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYPA PLS P E  EDC I  YH+ KGTRLITN  KI  DP++W
Sbjct  368   IGKLVYLQAIVKETLRLYPAAPLSAPREFTEDCTIGGYHVSKGTRLITNLWKIQTDPRIW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFLT H+DVDV+G +FELIPFGSGRR CPG++  L++VQ  LAS VH F++
Sbjct  428   PAPLEFKPERFLTTHRDVDVKGLHFELIPFGSGRRSCPGLAFGLQMVQFTLASFVHAFEI  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S+ PID+TES GL N KATPLQ L+ PRL S LY
Sbjct  488   SNPSSAPIDMTESFGLINVKATPLQVLIKPRLPSQLY  524



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 229/337 (68%), Gaps = 17/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++V M+ G        EDE  E  + Q A R  F   G  +V D +P+LRWLD+GGHEK
Sbjct  198   NVIVRMVAGKRYSVAADEDEKKEALRVQNALREFFNFVGMFLVGDAVPYLRWLDLGGHEK  257

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++TA ++++    W+EEHK++R    +K E+ DF+D MLS+ +            GG+
Sbjct  258   AMKKTAKDLDAMVGEWVEEHKQRRAKGGAKGEQ-DFIDAMLSVLDGADL--------GGF  308

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L M+   +DTT VTL WA+SL++NN  VL+R  +ELDT +G++R V E D
Sbjct  309   DADTINKATSLNMIAGGSDTTMVTLTWAISLLVNNPHVLKRALNELDTKIGRQRVVSEED  368

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA++KET+RLYPA PLS P E  EDC I   HI+KGTRLI N  K+  DPK+W
Sbjct  369   ISNLVYIQAIVKETLRLYPAAPLSGPREFTEDCTIAGCHIRKGTRLIMNLWKLQTDPKIW  428

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+PERFLT HKDVDV+G++FELIPFGSGRR CPG++ AL++VQ  LAS +H F++
Sbjct  429   PDPLEFKPERFLTTHKDVDVKGHHFELIPFGSGRRACPGLAFALQMVQFTLASFLHAFEI  488

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S+ PID+TES GLTN K TPL+ L+ PRL    Y
Sbjct  489   SNPSSAPIDMTESFGLTNMKVTPLKVLIKPRLSFEFY  525



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   334 bits (857),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 227/317 (72%), Gaps = 10/317 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++       LFG  V++D IP+L WLDI G+EKAM+ TA E++   E W+EEHKR
Sbjct  222   EARRYKKVMGECVSLFGVFVLSDAIPFLGWLDINGYEKAMKRTASELDPLVEGWLEEHKR  281

Query  936   krksksskeeEAD-FMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             KR      +EE D FMD ML++ +    S        GYD+D IIK+TCL ++LA +DTT
Sbjct  282   KRAFNMDAKEEQDNFMDVMLNVLKDAEIS--------GYDSDTIIKATCLNLILAGSDTT  333

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
              ++L W LSL+LN+   L+++QDELDT++GK+R+VEESD+ +L+YLQA++KETMRLYP  
Sbjct  334   MISLTWVLSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPS  393

Query  579   PLSVPHEAMEDCIINN-YHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
             PL     AMEDC  +  YHI  GTRL+ N  KIHRD +VW+ P +F+P RFLT HKDVDV
Sbjct  394   PLITLRAAMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDV  453

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             +G N+EL+PFGSGRR CPG SLAL +V L +A L+H F++   SN+ +D+TES GLTN K
Sbjct  454   KGQNYELVPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLK  513

Query  222   ATPLQALLIPRLESNLY  172
             ATPL+ LL PRL++ LY
Sbjct  514   ATPLEILLTPRLDTKLY  530



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRET  988
             V N+++  + G+     ES++ +A      L G  +V+D +P+L WLD + G+   M+ T
Sbjct  190   VANLVMRTVAGKRCGNGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGT  249

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++    RW+EEH++KR S S  E E DF+  MLS+ +    S H       +D D +
Sbjct  250   ARQLDQVIGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQFSGHD------HDHDTV  303

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IK+TCL ++LA+ DT ++TL WALSL++NN   L++ Q+ELD HVG+ ++V ESD+K+L+
Sbjct  304   IKATCLTVMLASNDTIAITLTWALSLLMNNPHALKKAQEELDFHVGRNQQVYESDIKKLV  363

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKET+RLYPA PL++PHEAMEDC I  +HIQ GTRL+ N  K+HRDP +W+ P E
Sbjct  364   YLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLE  423

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT H  +DVRG +FEL+PFGSGRRMCPGIS ALEI+QL LA L+HGF++  +++
Sbjct  424   FQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISFALEILQLTLARLLHGFELGVVAD  483

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              P+D+TE  GL   KATPL+  L+PRL S LY
Sbjct  484   SPLDMTEGVGLALPKATPLEVTLVPRLPSELY  515



>emb|CBI32517.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 220/301 (73%), Gaps = 7/301 (2%)
 Frame = -3

Query  1071  FGAAVVADFIPWLRWLD-IGGHEKAMRETAMEMESFAERWMeehkrkrksksskeeEADF  895
              G  +V+D +P+L WLD + G+   M+ TA +++    RW+EEH++KR S S  + E DF
Sbjct  1     MGQFMVSDALPFLGWLDTVRGYTAKMKGTARQLDRVIGRWVEEHRQKRLSGSINDAEQDF  60

Query  894   MDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNY  715
             +  MLS+ +    S H       +D D +IK+TCL ++LA  DT +VTL WALSL++NN 
Sbjct  61    IHAMLSVIDDAQLSGHD------HDHDTVIKATCLTVMLAGNDTIAVTLTWALSLLMNNP  114

Query  714   EVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIIN  535
               L++ Q+ELD HVG+ ++V ESD+K+L+YLQA+IKET+RLYPA PL++PHEAMEDC I 
Sbjct  115   RALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIA  174

Query  534   NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRM  355
              +HIQ GTRL+ N  K+HRDP +W+ P EF+PERFLT H  +DV G +FEL+PFGSGRRM
Sbjct  175   GFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVGGQHFELLPFGSGRRM  234

Query  354   CPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNL  175
             CPGISLALEI+QL LA L+HGF++  +S+ P+D+TE  GL   KATPL+  L+PRL S L
Sbjct  235   CPGISLALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPLEVTLVPRLPSEL  294

Query  174   Y  172
             Y
Sbjct  295   Y  295



>ref|XP_008245476.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=522

 Score =   333 bits (855),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 212/315 (67%), Gaps = 12/315 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++Q+A R  F L G  V+ D +PWL WLD+GG +KAM++TA E+++    W+EEHK+
Sbjct  219   EARRWQKAMREFFHLAGLFVLGDAVPWLSWLDLGGQQKAMKKTAKELDNIVAEWLEEHKQ  278

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             K   +  +    DFMD MLS    T  +        G+D D +IK+TCL ++   +DTT 
Sbjct  279   KITEEKDQ----DFMDVMLSAINGTDVA--------GFDADTVIKATCLILIAGGSDTTM  326

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL+LNN +VL+++ +ELD +VGK R +EESD+  L+YLQA +KE MRL PA P
Sbjct  327   VTLTWALSLLLNNRQVLKKVYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGP  386

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS   E  EDC I  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKDVDVRG
Sbjct  387   LSGQREFTEDCTIGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRG  446

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
               FEL+PFGSGRR CPGIS  L++  L LAS +H FD+    N P+D+T S GLTN K T
Sbjct  447   QQFELMPFGSGRRACPGISFGLQMTLLTLASFLHSFDVATQENAPVDMTGSIGLTNIKLT  506

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL  NLY
Sbjct  507   PLDVLIKPRLSPNLY  521



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   333 bits (855),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 224/311 (72%), Gaps = 9/311 (3%)
 Frame = -3

Query  1101  QRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksk  922
             Q+  R    LFG  V++D IP+L WLD+ G++KAM+ TA E++S    W++EHK KR   
Sbjct  224   QKVIRDFAHLFGVFVLSDAIPFLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKEKRLLG  283

Query  921   sskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIW  742
                +++ DFMD ML++ E    S        G+D D + K+TCL ++LA +DTT VTL W
Sbjct  284   GEGKDDQDFMDVMLTVLEDVNFS--------GFDADTVNKATCLNLILAGSDTTKVTLTW  335

Query  741   ALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPH  562
             ALSL+LN+  VL++ Q ELD  VGK+R+V+ESD+K L+YLQA+IKET+RLYPA P+   H
Sbjct  336   ALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLH  395

Query  561   EAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFE  385
              AMEDC +   Y+I  GT+++ N  KIHRD +VW  P EF+PERF+T HKD DVRG +FE
Sbjct  396   AAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFE  455

Query  384   LIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQA  205
             LIPFGSGRR CPGISLAL++V  ALASL+H +++ + S+  +D+TES GLTN KATPL+ 
Sbjct  456   LIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEV  515

Query  204   LLIPRLESNLY  172
             LL PRL++ LY
Sbjct  516   LLSPRLKAELY  526



>ref|XP_004291926.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=538

 Score =   334 bits (856),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 234/324 (72%), Gaps = 10/324 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E E  E  ++++A+R  F L G  V AD +P+LRWLD+GGHEKAM++TA E++   ERW+
Sbjct  217   EREKEENERYRKATREFFRLTGEFVTADAVPFLRWLDLGGHEKAMKKTAKELDDVLERWL  276

Query  951   eehkrkrksksskeeEA---DFMDTMLSLFETTASSSHQSRLPGGYDT-DQIIKSTCLAM  784
             EEHK KR S +S        DFMD MLS+ + +           GY T D I K+TCLA+
Sbjct  277   EEHKLKRSSINSTSTSHEPDDFMDMMLSVLDDSILEFR------GYTTADTINKATCLAL  330

Query  783   LLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKE  604
             +L  TDTT+VTL WALSL++NN  VL++ Q+ELD  VG+ R+V ESD+K L+YLQAVIKE
Sbjct  331   ILGGTDTTTVTLTWALSLLVNNPAVLKKAQNELDAKVGRNRQVNESDVKNLMYLQAVIKE  390

Query  603   TMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLT  424
             T+RLYPAVPL  PHE+ EDC + NY +   TRLI N  K+HRDP VW  P  FRPERFL+
Sbjct  391   TLRLYPAVPLLAPHESTEDCTVGNYRVPAKTRLIVNVWKLHRDPNVWQDPCIFRPERFLS  450

Query  423   HHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTES  244
                D DVRG NFEL+PFGSGRR+CPGISLAL++++L LA L+HG+++    +EP+D++E+
Sbjct  451   CLGDFDVRGQNFELMPFGSGRRICPGISLALQVIELTLAHLLHGYEITAPLDEPVDMSET  510

Query  243   CGLTNFKATPLQALLIPRLESNLY  172
              GLTN KATPLQ LL PRL +++Y
Sbjct  511   VGLTNMKATPLQVLLKPRLHADIY  534



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 231/338 (68%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGEDE----VVEESKFQR-----ASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N++  M+ G+        EE K Q      A +  F L G  V +D +P+LRW D+GG+ 
Sbjct  196   NVIFKMVGGKQSDGTTASEEDKDQNDRCRIALKSFFVLSGQFVASDVLPYLRWFDVGGYV  255

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+ TA E++   E W++EHKRKR    ++ +  DFMD MLS+  T         LP  
Sbjct  256   KAMKRTAKELDDVVEGWLDEHKRKRACGEAEGDR-DFMDVMLSILGTA------DELPS-  307

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I K+TCLA++   TDTT+VTL WALSL+LNN  VL++ Q ELD+ +G+ER+V ES
Sbjct  308   YDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTES  367

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKET+RLYPA PLSVPHE++EDC I  Y +  GTRL+ N  K+H++P V
Sbjct  368   DVKNLVYLQAIIKETLRLYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLV  427

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EFRPERFLT HKD+DVRG NFE +PFGSGRRMCP +S AL+ + + LA+++H F+
Sbjct  428   WPAPLEFRPERFLTTHKDLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFE  487

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   S+ P+D+T   G+T+ + TPL+ +L PRL  +LY
Sbjct  488   IETASDGPVDMTAGMGVTSPRVTPLEVILTPRLPLHLY  525



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 231/338 (68%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGEDE----VVEESKFQR-----ASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N++  M+ G+        EE K Q      A +  F L G  V +D +P+LRW D+GG+ 
Sbjct  196   NVIFKMVGGKQSDGTTASEEDKDQNDRCRIALKSFFVLSGQFVASDVLPYLRWFDVGGYV  255

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+ TA E++   E W++EHKRKR    ++ +  DFMD MLS+  T         LP  
Sbjct  256   KAMKRTAKELDDVVEGWLDEHKRKRACGEAEGDR-DFMDVMLSILGTA------DELPS-  307

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I K+TCLA++   TDTT+VTL WALSL+LNN  VL++ Q ELD+ +G+ER+V ES
Sbjct  308   YDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTES  367

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKET+RLYPA PLSVPHE++EDC I  Y +  GTRL+ N  K+H++P V
Sbjct  368   DVKNLVYLQAIIKETLRLYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLV  427

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EFRPERFLT HKD+DVRG NFE +PFGSGRRMCP +S AL+ + + LA+++H F+
Sbjct  428   WPAPLEFRPERFLTTHKDLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFE  487

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   S+ P+D+T   G+T+ + TPL+ +L PRL  +LY
Sbjct  488   IETASDGPVDMTAGMGVTSPRVTPLEVILTPRLPLHLY  525



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 235/333 (71%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+    V+  ++     R  E+ G  VV+D +P+LRWLDIGG E++M++T
Sbjct  206   IRNVILRMIVGKGCNSVDSEEWMELLTRFLEMSGKFVVSDALPFLRWLDIGGDERSMKKT  265

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W EEHKRKR S+  K EE DFM  M S+   T   S       G D D I
Sbjct  266   AKELDIVVQGWFEEHKRKRDSREVKGEELDFMSVMPSILGDTEQYS-------GRDVDTI  318

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+ CL +++A  DTT+VTL W +SL+LN+ ++L+++Q+ELD  VG +R+V ESDLK L+
Sbjct  319   NKAVCLGLIIAGLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLV  378

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA +KE MRLYPAVPL +PHEA+E+C +N YH+   T+L+ N  K+ RDP+VW +P +
Sbjct  379   YLQATLKEAMRLYPAVPLLIPHEAIEECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCK  438

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD+DVRG + EL+PFGSGRRMCPG+S AL+++Q  +ASL+ GFD    SN
Sbjct  439   FQPERFLTKHKDIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSN  498

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GLT  K+ PL+ L+ PRL ++LYG
Sbjct  499   EPLDMGEGFGLTMEKSRPLEVLIAPRLSASLYG  531



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 232/339 (68%), Gaps = 16/339 (5%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVV---EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+     FG        E  + Q+A  + F L G  VV+D +P+LRW D+ GHE+
Sbjct  196   NMVVRMVAGKRYFGASATCDDDEARRCQKAINQFFHLIGIFVVSDALPFLRWFDLQGHER  255

Query  1002  AMRETAMEMESFAERWMeehkrkrk-sksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             AM++TA E++S  E W++EH+ +R   +   E E DF+D ML L +T   S+ Q      
Sbjct  256   AMKKTAKELDSILEGWLQEHRMQRVDGEVKVEGEQDFIDVMLDLQKTGHLSNFQ------  309

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD+D  IKSTCLA++L  +DT++ TL WA+SL+LNN + L++ Q+ELD +VG ER+VEES
Sbjct  310   YDSDTSIKSTCLAIILGGSDTSAGTLTWAISLLLNNRQALKKAQEELDLNVGMERQVEES  369

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D++ L YLQA+IKET+RLYPA PL  P EA EDC +  Y +  GTRL+ N  KIHRDP+V
Sbjct  370   DIRNLAYLQAIIKETLRLYPAGPLLGPREAQEDCNVGGYDVPAGTRLVVNLWKIHRDPRV  429

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W +P  FRPERFLT    VDVRG NFELIPFGSGRR CPG+S AL+++ L LA L+H F+
Sbjct  430   WEEPSAFRPERFLTSDA-VDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFE  488

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                 S+EP+D+TES GLT  KATPL+ LL PRL   LY 
Sbjct  489   FATPSDEPVDMTESPGLTIPKATPLEVLLTPRLPPQLYA  527



>ref|XP_006384482.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
 gb|ERP62279.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
Length=344

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/337 (52%), Positives = 230/337 (68%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEES--KFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEK  1003
             N++V ML     FG D   +E   +FQ+A    F L G  +V+D +P+L WLD + G   
Sbjct  14    NIIVRMLAGKRYFGTDTNGDEESRRFQKALGDFFYLLGLFLVSDAVPFLGWLDFVKGIVG  73

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
              M+ TA E++     W+E+H+R R + S  EEE DF+  MLS  E    S+         
Sbjct  74    KMKRTATEIDCVFSSWVEDHRRNRLNGSINEEERDFIHVMLSNLEDGKISA--------V  125

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             DTD  IK TCL+++L   DTT VTL WALSL+LNN EVLE+ QDELD  VGK R+V+E+D
Sbjct  126   DTDTAIKGTCLSLILGGHDTTFVTLTWALSLILNNREVLEKAQDELDIQVGKHRQVDETD  185

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KETMRLYPA PLS P +AMEDC +  +HI  GTRL+ N  K+HRDP +W
Sbjct  186   IKNLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVAGFHIPAGTRLLVNLWKLHRDPNIW  245

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFL  H ++DVRG +FE +PFGSGRRMCPGISLAL+++ L LA L+HGF+M
Sbjct  246   SNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPGISLALQVLHLTLARLLHGFEM  305

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               +S+  ID++E  G+T  K TPL+ +L PRL S+LY
Sbjct  306   GTVSDALIDMSEGPGITIPKETPLEVILRPRLHSSLY  342



>ref|XP_004293232.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=469

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 226/340 (66%), Gaps = 19/340 (6%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G        +DE  E      A R+     G   V D IP++RWLD+GGHEK
Sbjct  137   NVILRMISGKRYSFAANDDEKKEAGHIHTAVRKFIYFVGLFTVGDSIPYIRWLDLGGHEK  196

Query  1002  AMRETAMEMESFAERWMeehkrkrkskssk---eeEADFMDTMLSLFETTASSSHQSRLP  832
              M++TA EM++  E W+EEHKRKR  +  +   +E  DFMD ++   E    S       
Sbjct  197   EMKKTAKEMDAILEGWLEEHKRKRALREEEDDIKEPGDFMDALVYALEGADLS-------  249

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
              GYD + + K+TCL ++ A +D+  VTL WA+SL+LN+  VLER Q+ELDT VG+ER V 
Sbjct  250   -GYDANTVNKATCLNLIAAGSDSMYVTLTWAISLLLNHPHVLERAQEELDTEVGRERAVA  308

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             ESDL +L+YLQA++KET+RLYPA PL+ PHE  EDC I  YH+ KGTRLITN  ++  DP
Sbjct  309   ESDLCKLVYLQAIVKETLRLYPAAPLAAPHEFNEDCTIAGYHVPKGTRLITNIWRVQTDP  368

Query  471   KVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
             + W +P EF+PERFLT HKDVDVRG NFELIPFGSGRR CP +S +L++VQ  LAS +H 
Sbjct  369   QAWPEPLEFKPERFLTTHKDVDVRGQNFELIPFGSGRRSCPAVSFSLQMVQSTLASFLHA  428

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             F +    N  +D++ES G TN KATPL+ L+ PRL   LY
Sbjct  429   FQISAPFNAHVDMSESFGATNVKATPLEVLIKPRLPFELY  468



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 230/316 (73%), Gaps = 7/316 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E + +QR   +   L G  VV+D +P+LRWLDIGG+E+ M +TA   +   + W++EHK 
Sbjct  218   EINDWQRQITKFTALTGQFVVSDALPFLRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  277

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DF+  +LSL +  A      +LP   D D +IK+ C+ +++AATDTT+
Sbjct  278   KRVSGEVKGDE-DFIYVLLSLLDDNAE-----QLPD-RDADTVIKAICVTLIVAATDTTA  330

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VL++ QDELD  VG ER+V ESD++ L+YLQA+IKETMRLYPA P
Sbjct  331   VTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAGP  390

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE++E+CI+N Y +  GT+L  N  KI RDP VW +P +F+PERFLT HKD+DV G
Sbjct  391   LLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG  450

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRRMCP +S  L+++QL LASLVHGFD    S+EP+D+ E+ GLT  KAT
Sbjct  451   QDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKAT  510

Query  216   PLQALLIPRLESNLYG  169
             PL+ L+ PRL ++LYG
Sbjct  511   PLEVLVSPRLSASLYG  526



>ref|XP_007151146.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
 gb|ESW23140.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
Length=524

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/336 (50%), Positives = 224/336 (67%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E +E+ K QR   A R    LFG   V +F+PWLRW D GGHEKA
Sbjct  194   NMVLQMVVGKRYFGGENLEDEKAQRCVRAMREFMRLFGVFTVGEFVPWLRWFDFGGHEKA  253

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M+ TA E++S     +EEH++++      +E  DFMD M+SL + T           G D
Sbjct  254   MKATAKELDSIIGEELEEHRKRKGLGEKVDEAKDFMDVMISLLDGTTIE--------GID  305

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST LA++   TDTT+  L WALSL+L N  VLE++++ELD H+GKE+ V ESD+
Sbjct  306   ADTMIKSTVLAVISGGTDTTNTVLTWALSLILRNPSVLEKVKEELDIHIGKEKCVSESDI  365

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +LIY+QA++KET+RLYP  P S P E  E+C +  Y+I+KGTRLI N  KIH D  VW 
Sbjct  366   SKLIYVQAIVKETLRLYPPAPTSGPREFTENCTLRGYNIKKGTRLIINLWKIHTDSNVWE  425

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFLT HKD D++G++FEL+PFG GRR+CPG+S  L++V   LASL+H F++ 
Sbjct  426   DPLEFKPERFLTTHKDTDIKGHHFELLPFGGGRRICPGVSFGLQMVHFILASLLHSFEII  485

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S  PID+TE  GLTN KATPL  L+ PRL  N Y
Sbjct  486   SSSPNPIDMTEIFGLTNTKATPLNILIKPRLSLNCY  521



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 226/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+LV M+ G        EDE  E  + Q A R  F   G  +V D +P+LRWLD+GGHEK
Sbjct  196   NVLVRMVNGKRYSVAADEDEKKEARRVQNALREFFHYAGLFLVGDAVPYLRWLDLGGHEK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             A+++ A E+++    W+EEHK++R    +K E+ DF+D MLS+ +            GG+
Sbjct  256   AIKKIAKELDTIVGEWVEEHKQRRAKGDAKGEQ-DFIDAMLSVLDGAEL--------GGF  306

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L M+ A +DT  VTL WA+SL+LNN  VLER  +ELDT +G++R V E D
Sbjct  307   DADTINKATSLNMIAAGSDTIMVTLTWAISLLLNNSHVLERALNELDTKIGRQRVVSEQD  366

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA+IKET+RLYP  PLS P E  EDC I  YHI+KGTRL  N  K+  DPK W
Sbjct  367   ISNLVYIQAIIKETLRLYPPAPLSGPREFTEDCTIAGYHIRKGTRLTMNLWKLQTDPKNW  426

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              KP EF+PERFLT HK VDV+G +FELIPFGSGRR CPG++  L++VQ  LAS +H F++
Sbjct  427   PKPFEFKPERFLTTHKKVDVKGQHFELIPFGSGRRACPGLAFGLQMVQFTLASFLHAFEI  486

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ PID+TES GLTN K TPL+ L+ PRL   LYG
Sbjct  487   LNPSSTPIDMTESFGLTNNKRTPLKVLIKPRLSFELYG  524



>gb|KFK29807.1| hypothetical protein AALP_AA7G181700 [Arabis alpina]
Length=349

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 233/341 (68%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + ++A  + F L G   V+D  P L W D+ GH
Sbjct  14    NMIVRMVAGKRYFGGGSASSEDTEEARQCKKAIAKFFHLIGIFTVSDAFPTLTWFDLQGH  73

Query  1008  EKAMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             EK M++T  E++   ERW+E   ++++ ++ ++  ++DF+D MLSL E    S  Q    
Sbjct  74    EKEMKKTGRELDVILERWIENHRQQRKVTEKNENNDSDFIDVMLSLAEQGKLSHLQ----  129

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD    IKSTCLA++L  +DTT+ TL WA++L+LNN E+L++ QDE+D HVG +R VE
Sbjct  130   --YDASTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKKAQDEIDLHVGTDRNVE  187

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL  P EA+EDC +  Y++ +GTRLI N  KI RDP
Sbjct  188   DSDIENLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYNVSRGTRLIVNVWKIQRDP  247

Query  471   KVWAKPDEFRPERFLTHHKDV-DVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T    V DVRG NFELIPFGSGRR CPG SLAL+++ L LA  +H
Sbjct  248   KVYMEPNEFRPERFITGEAKVFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLH  307

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D++ES GLT  KATPL+ L+ PRLE  L+
Sbjct  308   SFEVKTVLDSPVDMSESPGLTIPKATPLEVLISPRLEKQLF  348



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 235/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             N++V M+ G+           ++  E  + +RA  + F L G   V+D  P LRW D  G
Sbjct  189   NVIVRMVAGKRYLGGAVSESSEDAAEARQCKRAISKFFHLIGIFTVSDAFPALRWFDFQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW E H+++RK   +KE ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGSELDVILERWTENHRQERKVSGTKENDSDFIDVMLSLEEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCL+++L  +DTTS TL WA++L+LNN E+L++ QDE+D HVG++R VE
Sbjct  305   --YDANTSIKSTCLSLILGGSDTTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD+  L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYKEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D+TES GLT  KATPL+ L+ PRL+ +L+
Sbjct  483   SFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_007151144.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
 gb|ESW23138.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
Length=519

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 227/338 (67%), Gaps = 15/338 (4%)
 Frame = -3

Query  1164  VTNMLVSMLFGE----DEVVEESK---FQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             + NM++ M+ G+       V++ K   F RA      LFG   V D +PWLRW D GGHE
Sbjct  187   IFNMVLQMITGKRYFSAATVDDEKARRFVRAMEEFMRLFGLFTVGDAVPWLRWFDFGGHE  246

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+ETA E++S     +EEH++++      +E  DFMD M+SLF+         R   G
Sbjct  247   KAMKETAKELDSIIGEELEEHRKRKGLGEKVDEAKDFMDIMISLFD--------GRTIDG  298

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
              D D +IKST LA++   TDT+++ L W +SL+L N  VLE+++ ELD H+GKE+ V E 
Sbjct  299   VDADTVIKSTLLAVIAGGTDTSNIVLTWEISLILRNPLVLEKVKVELDIHIGKEKCVSEF  358

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+ +L YLQA++KET+RLYP  PLS P E +EDC ++ Y+I+KGTRLITN  KIH D  V
Sbjct  359   DISKLTYLQAIVKETLRLYPPAPLSTPREFIEDCTLSGYNIKKGTRLITNLWKIHTDSNV  418

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W    EF+PERFLT HKD+DV+G++FEL+PFG GRRMCPGIS  +E+V  +LAS +H F+
Sbjct  419   WEDSLEFKPERFLTTHKDIDVKGHHFELLPFGGGRRMCPGISFGIEVVHFSLASFLHSFE  478

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   S  PID+TE+ GLTN KATPL+ L+ PRL  + Y
Sbjct  479   ILSSSPNPIDMTENFGLTNTKATPLEILIKPRLSFSCY  516



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 234/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+           ++  E S+ +RA  + F L G   V+D  P LRW D+ G
Sbjct  189   NMIVRMVAGKRYFGGAGSESSEDTEEASQCKRAISKFFHLIGIFTVSDAFPALRWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW+E H+++RK   +KE ++DF+D MLSL +    S  Q    
Sbjct  249   HEKEMKQTGSELDVILERWIENHRQERKVSGTKENDSDFIDVMLSLAKQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD    IKSTCLA++L  +DTT+ TL WA++L+LNN E+L+  QDE+D HVG++R VE
Sbjct  305   --YDATTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD+K L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYVEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D++ES GLT  KATPL+ L+ PRL    +
Sbjct  483   SFEVKTVLDMPVDMSESPGLTIPKATPLEVLISPRLNEQFF  523



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 234/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+           ++  E S+ +RA  + F L G   V+D  P LRW D+ G
Sbjct  189   NMIVRMVAGKRYFGGAGSESSEDTEEASQCKRAISKFFHLIGIFTVSDAFPSLRWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW+E H+++RK   +KE ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGSELDVILERWIENHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD    IKSTCLA++L  +DTT+ TL WA++L+LNN E+L+  QDE+D HVG++R VE
Sbjct  305   --YDATTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD+  L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYEEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D++ES GLT  KATPL+ L+ PRL   L+
Sbjct  483   SFEVKTVLDMPVDMSESPGLTIPKATPLEVLISPRLNEQLF  523



>ref|XP_007151142.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
 gb|ESW23136.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
Length=519

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 225/335 (67%), Gaps = 19/335 (6%)
 Frame = -3

Query  1164  VTNMLVSMLFG---------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             + NM++ M+ G         +DE  +  +F RA      LFG   V D +PWLRW D GG
Sbjct  187   IFNMVLQMITGKRYFSAATVDDE--KAQRFVRAVEEFMRLFGVFTVGDAVPWLRWFDFGG  244

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEKAM+ETA E++      +EEH++++      +E  DFMD M+SLF+            
Sbjct  245   HEKAMKETAKELDIILGEELEEHRKRKGLGEKDDEVQDFMDVMISLFDGITID-------  297

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
              G+D D +IKST L ++   TDT+S  L W +SL+L N  VLE+++ ELD HVGKE+ V 
Sbjct  298   -GFDADTVIKSTVLLVIAGGTDTSSTLLTWVISLILRNPLVLEKVKVELDIHVGKEKCVS  356

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             ES + +L YLQA++KET+RLYP  PL  PHE +EDCI++ Y+I+KGTRLITN  KIH D 
Sbjct  357   ESHISKLTYLQAIVKETLRLYPPGPLLAPHEIIEDCILSGYNIKKGTRLITNLWKIHTDK  416

Query  471   KVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
              VW  P EF+PERFLT +KD+DV+G++FELIPFG GRRMCPGIS  LE+VQ +LAS++H 
Sbjct  417   NVWEDPLEFKPERFLTTYKDLDVKGHHFELIPFGGGRRMCPGISFGLEVVQFSLASILHS  476

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRL  187
             F+    S +PID+TE+ GLTN K TPL+ L+ PRL
Sbjct  477   FEFLSSSPDPIDMTETFGLTNTKGTPLEILIKPRL  511



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   332 bits (850),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 228/339 (67%), Gaps = 15/339 (4%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVV---EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++V M+     FG   V    E  + Q+A +  F L G  VV+D +P L WLD+ GHEK
Sbjct  194   NVVVRMVAGKRYFGASAVCVDGEARRCQKAIKEFFRLIGMFVVSDALPLLWWLDVHGHEK  253

Query  1002  AMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             AM+ TA E++   E W++E  +R+       E E DF+D MLSL E    ++ Q      
Sbjct  254   AMKMTAKELDDLLEAWLKEHRQRRISGGIKAEGEQDFIDVMLSLQEEGHLANFQ------  307

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D  IKSTCLA++L  TDTT+ TL WA+SL+LNN E+L++ Q+ELD  VG+ER V+ES
Sbjct  308   YDADISIKSTCLALILGGTDTTAGTLTWAISLLLNNPELLKKAQEELDLQVGRERLVDES  367

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D++ L+YLQA+IKET+RLYPA PL  P EAM DC +  YH+  GTRLI N  KI RDP+V
Sbjct  368   DIQNLVYLQAIIKETLRLYPAGPLLGPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRV  427

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W+ P  F PERFLT H +VDVRG  FELIPFGSGRR CPG S AL+++ L LA  +H F+
Sbjct  428   WSNPSAFVPERFLTSHANVDVRGQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFE  487

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             +    ++P+D+TES GLT  KATPL+ LL PR+ +N+Y 
Sbjct  488   LSTPLDQPVDMTESPGLTIPKATPLEVLLKPRVPANVYA  526



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 234/332 (70%), Gaps = 7/332 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRET  988
             V N+ +  + G+     ES++ ++      L G  +V+D +P+L WLD + G+   M+ T
Sbjct  190   VANLTMRTVAGKRCENGESRWCQSLGDFMNLMGQFMVSDALPFLGWLDTVRGYTAKMKGT  249

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++    RW+EEH++KR S S  + E DF+  MLS+ +    S H       +D D +
Sbjct  250   ARQLDRVIGRWVEEHRQKRLSGSINDAEQDFIHAMLSVIDDAQLSGHD------HDHDTV  303

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IK+TCL ++LA  DT +VTL WALSL++NN   L++ Q+ELD HVG+ ++V ESD+K+L+
Sbjct  304   IKATCLTVMLAGNDTIAVTLTWALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLV  363

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKET+RLYPA PL++PHEAMEDC I  +HIQ GTRL+ N  K+HRDP +W+ P E
Sbjct  364   YLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLE  423

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT H  +DV G +FEL+PFGSGRRMCPGISLALEI+QL LA L+HGF++  +S+
Sbjct  424   FQPERFLTKHVGLDVGGQHFELLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVSD  483

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              P+D+TE  GL   KATPL+  L+PRL S LY
Sbjct  484   SPLDMTEGVGLAMPKATPLEVTLVPRLPSELY  515



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   332 bits (851),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 223/312 (71%), Gaps = 9/312 (3%)
 Frame = -3

Query  1104  FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrks  925
             F    R    LFG  V++D IP+L WLD+ G++KAM+ TA E++S    W++EHK KR  
Sbjct  238   FGAVIRDFAHLFGVFVLSDAIPFLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKEKRLL  297

Query  924   ksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLI  745
                 +++ DFMD ML++ E    S        G+D D + K+TCL ++LA +DTT VTL 
Sbjct  298   GGEGKDDQDFMDVMLTVLEDVNFS--------GFDADTVNKATCLNLILAGSDTTKVTLT  349

Query  744   WALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVP  565
             WALSL+LN+  VL++ Q ELD  VGK+R+V+ESD+K L+YLQA+IKET+RLYPA P+   
Sbjct  350   WALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITL  409

Query  564   HEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNF  388
             H AMEDC +   Y+I  GT+++ N  KIHRD +VW  P EF+PERF+T HKD DVRG +F
Sbjct  410   HAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHF  469

Query  387   ELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQ  208
             ELIPFGSGRR CPGISLAL++V  ALASL+H +++ + S+  +D+TES GLTN KATPL+
Sbjct  470   ELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLE  529

Query  207   ALLIPRLESNLY  172
              LL PRL++ LY
Sbjct  530   VLLSPRLKAELY  541



>gb|KDP38432.1| hypothetical protein JCGZ_04357 [Jatropha curcas]
Length=529

 Score =   331 bits (849),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 230/316 (73%), Gaps = 8/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E   ++ A R   EL G   V+D +P+LRWLD+GG EK M+E   +++   E W++EHK+
Sbjct  221   ESGTWRDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKENLKKLDPVVEEWLQEHKQ  280

Query  936   krkskssk-eeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             K+++     +EE DFM  +LS+            L  G D D I K+TC+A++LAA+DTT
Sbjct  281   KKEASGGVPKEEEDFMYVLLSIL------GDAKELSTG-DADTINKATCMALILAASDTT  333

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             ++T+ WALSL+LNN +VL++ Q+ELD HVG++ +VEESD+K L+YLQA+IKE  RLYPAV
Sbjct  334   AITMTWALSLLLNNPDVLKKAQNELDIHVGRKIQVEESDIKSLVYLQAIIKEAFRLYPAV  393

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PL +PHE+ME+CII+  HI   TRLI N  KI +DP VW  P+EF+PERFLT HKDVD +
Sbjct  394   PLLIPHESMEECIIDGNHIPPKTRLIINAAKIQKDPIVWPNPEEFQPERFLTAHKDVDFK  453

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G  FELIPFGSGRR+CPGIS AL+++ L LA+L+H F++   S++PID++E+ GLTN K+
Sbjct  454   GQFFELIPFGSGRRICPGISFALQVLNLTLATLLHSFEIETSSSDPIDMSETSGLTNQKS  513

Query  219   TPLQALLIPRLESNLY  172
             +P+  +L PRL +NLY
Sbjct  514   SPVDVVLTPRLAANLY  529



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 231/316 (73%), Gaps = 7/316 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E + +Q+   ++  LFG  VV+D +P+LR LDIGG+E+ M +TA   +   + W++EHK 
Sbjct  220   EANDWQQQITKIAALFGQFVVSDALPFLRRLDIGGYERLMSKTAKYFDIILQEWVDEHKM  279

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DF+  +LSL +  A      +LP   D D +IK+ CL +++AATDTT+
Sbjct  280   KRVSGEIKGDE-DFIYVLLSLLDDNAE-----QLPD-RDADTVIKAICLTLIVAATDTTA  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN +VL++ QDELD  VG ER+V ESD++ L+YLQA+IKETMRLYPA P
Sbjct  333   VTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAGP  392

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE++E+CI+N Y +  GT+L  N  KI RDP VW +P +F+PERFLT HKD+DV G
Sbjct  393   LLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG  452

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRRMCP +S  L+++QL LASLVHGFD    S+EP+D+ E+ GLT  KAT
Sbjct  453   QDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKAT  512

Query  216   PLQALLIPRLESNLYG  169
             PL+ L+ PRL ++LYG
Sbjct  513   PLEVLVSPRLSASLYG  528



>emb|CBI19611.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   341 bits (875),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 229/330 (69%), Gaps = 11/330 (3%)
 Frame = -3

Query  1155  MLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEM  976
             M     F  D+  E  ++ +A R  FEL G  +V+D +P+LRW D+GG+EKAM++TA  +
Sbjct  199   MTAGKRFSSDK--EGVEYHKAIRCFFELTGKFMVSDALPFLRWFDLGGYEKAMKKTAKSL  256

Query  975   ESFAERWMeehkrkrksksskeeEADFMDTMLSLF--ETTASSSHQSRLPGGYDTDQIIK  802
             +   E W++EHKRKR S     +  DFMD MLS+   ET A     S      D D I K
Sbjct  257   DHLLEDWLQEHKRKRVSGQPTGD-QDFMDVMLSILDDETRAQDIKSS------DADIINK  309

Query  801   STCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYL  622
             +TCL +L+A TDT +V+L WALSL+LNN  VL + ++ELD HVG+ERRVEE D+  L+YL
Sbjct  310   ATCLNVLIATTDTVTVSLTWALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYL  369

Query  621   QAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFR  442
              A+IKET+RLY AV +   HE+ E+C++   +I  GTRLI N  KIH DP VW+ PD+F 
Sbjct  370   DAIIKETLRLYSAVQVLAAHESTEECVVGGCYIPAGTRLIINLWKIHHDPSVWSDPDQFM  429

Query  441   PERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEP  262
             PERFLT HKDVDVRG +FELIPFGSGRR+CPG+SLAL+ +Q  LASL+ GF+    S+ P
Sbjct  430   PERFLTTHKDVDVRGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGP  489

Query  261   IDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +D+TES GLTN KATPL  LL PRL SNLY
Sbjct  490   VDMTESIGLTNLKATPLDVLLTPRLSSNLY  519



>ref|XP_002510308.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52495.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/331 (52%), Positives = 232/331 (70%), Gaps = 8/331 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETA  985
             V    V +L GE +    + +Q A R   EL G   V+D +P+LRWLD+GG EK M++  
Sbjct  199   VGQRFVELLDGEQDEGSSNSWQDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKQNL  258

Query  984   MEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQII  805
              +++    +W+++ + K+ S  +K +E DFMD +L++ +     S       G D D I 
Sbjct  259   EKLDCVVRKWLQDRRDKKSSGIAKRQE-DFMDVLLTILKDAEELS-------GRDADTIN  310

Query  804   KSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIY  625
             K+TCLA++LAA+DTT++TL W LSL+LNN E L+  Q E+D HVGKER+V ESD ++L+Y
Sbjct  311   KATCLALILAASDTTAITLTWTLSLLLNNREALKTAQHEVDIHVGKERQVTESDAQDLVY  370

Query  624   LQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEF  445
             LQAVIKE+ RLYPAVPL +PHEAME+C +N YHI  GTRLI N  K+H+DP VW  P EF
Sbjct  371   LQAVIKESFRLYPAVPLLLPHEAMEECTVNGYHIPAGTRLIINASKVHKDPSVWLNPQEF  430

Query  444   RPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNE  265
             +PERFLT HKDVD RG NF+LIPFGSGRR CPGI  AL+++ L LA+++H F++   S+ 
Sbjct  431   QPERFLTSHKDVDFRGQNFDLIPFGSGRRKCPGILFALQVLSLTLATVLHSFEIETSSDN  490

Query  264   PIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             PID+ ES G TN KA+PL+ +L PRL ++LY
Sbjct  491   PIDMCESAGTTNAKASPLEVVLTPRLPAHLY  521



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/310 (57%), Positives = 228/310 (74%), Gaps = 7/310 (2%)
 Frame = -3

Query  1101  QRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksk  922
             ++A R  F L G   VAD +P+LRWLD+GGHEKAM++TA +++   +  ++EHKRKR S 
Sbjct  223   RKALRDFFHLTGTFTVADSLPFLRWLDLGGHEKAMKKTAKKLDQILKECLDEHKRKRNSG  282

Query  921   sskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIW  742
              S +E  +FM  MLSL E   +  H S     YD D I K+TCLA+++  TDTT+VT+ W
Sbjct  283   KSYDELDNFMYMMLSLLED--AGDHPS-----YDADTINKATCLAIIVGGTDTTTVTISW  335

Query  741   ALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPH  562
             ALSL+LN+ +VL++ Q+ELDT VGK+R VEESD+K L+YLQA+I ET RLYPA PLSVPH
Sbjct  336   ALSLLLNHRDVLKKAQNELDTFVGKDRLVEESDIKNLVYLQAIINETTRLYPAAPLSVPH  395

Query  561   EAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFEL  382
             E++EDCI   Y I  GTRL+ N  K+ RDPKVW+ PDEFRPERFLT  K +DVRG NFE 
Sbjct  396   ESVEDCITGGYFIPAGTRLLVNISKLQRDPKVWSDPDEFRPERFLTTQKHMDVRGQNFEF  455

Query  381   IPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQAL  202
             IPFGSGRR+CPGIS AL+++QL LA+L+  F++  + +EP+D+ E  GLTN KATPL  +
Sbjct  456   IPFGSGRRVCPGISFALQVLQLNLATLLQSFEITTLFDEPVDMREGAGLTNLKATPLNVV  515

Query  201   LIPRLESNLY  172
               PRL  +LY
Sbjct  516   FTPRLPPHLY  525



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 230/338 (68%), Gaps = 18/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G        E +  E  + Q+A R  F L G  VV+D +P+L WLD+GGH K
Sbjct  196   NVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLGLFVVSDALPFLGWLDVGGHVK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++TA E++  A+ W+EEH+R++ S  +  ++ DFMD MLS+   T         P GY
Sbjct  256   AMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQ-DFMDVMLSILGATD--------PNGY  306

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++   TDTTS TL WA+SL+LNN  VL + Q+ELDTHVGKER V E D
Sbjct  307   DADXINKATSLILIAGGTDTTSXTLTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEMD  366

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYPA PLS   + ++D ++  YHI KGTRL+ N  KI RDP+VW
Sbjct  367   ISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRVW  426

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P  F+P RFLT +KDVDV+G +F L PFG GRR+CPG + AL+++ L LA+ +H F +
Sbjct  427   LNPTXFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQL  486

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLES-NLY  172
                SN PID++ES G+TN K+TPL+ L+ PRL S NLY
Sbjct  487   STPSNSPIDMSESFGITNIKSTPLEVLISPRLASYNLY  524



>ref|XP_009364169.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=528

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 213/315 (68%), Gaps = 11/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E   +Q A R  F L G  V+ D IPWL WLD+GGH+KAM++TA  ++S    W+EEHK+
Sbjct  223   EARTWQNAMREFFRLVGMFVLGDAIPWLWWLDLGGHQKAMKQTAKALDSIVMGWLEEHKQ  282

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R     ++   DFM  MLS+ +     +H S    G+DTD +IK+TCLA++   +DTT+
Sbjct  283   RRAEGHDQQ---DFMGVMLSVLD----GAHVS----GFDTDTVIKATCLALIAGGSDTTT  331

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTLIW LSL+LNN   L+++ +ELD HVGKER V ESD+  L+YLQA +KE MRL PA P
Sbjct  332   VTLIWTLSLLLNNRHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGP  391

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS   E  ED  +  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKD+DVRG
Sbjct  392   LSGQREFTEDGTVGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRG  451

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FEL+PFGSGRR CPGI+  L+   L LA  +H FD+  + N P+D+T S GLTN K T
Sbjct  452   QHFELMPFGSGRRACPGITFGLQATLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLT  511

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL S ++
Sbjct  512   PLDVLVKPRLSSQIF  526



>emb|CBI19610.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   341 bits (874),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 224/315 (71%), Gaps = 9/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A R  F L G  VV D IP L WLD+GGHEKAM++TA E++S A+ W+EEH+R
Sbjct  627   EARRCQKAIREFFRLLGLFVVKDGIPSLGWLDLGGHEKAMKKTAKEIDSIAQEWLEEHRR  686

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             ++          DFMD +LS+ +  A       LP  YD D I K+T +A++   TDT +
Sbjct  687   RKDWGEDNGMH-DFMDVLLSVLDGKA-------LPE-YDADTINKATSMALISGGTDTMT  737

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL+LNN E L++ ++ELDTHVGKER V  SD+ +L+YLQA++KET+RL P  P
Sbjct  738   VTLTWALSLILNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGP  797

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS P +  EDCII  YH+ KGTRL+ N  K+HRDP VW  P+EF+PERFLT H+DVD RG
Sbjct  798   LSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPERFLTTHRDVDARG  857

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +F+L+PFG+GRR CPGI+ AL+++ LALAS +HGF++   SN P+D++E  GLTN K+T
Sbjct  858   QHFQLLPFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKST  917

Query  216   PLQALLIPRLESNLY  172
             PL+ L+ PRL  N Y
Sbjct  918   PLEILIAPRLPYNSY  932


 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 194/331 (59%), Gaps = 49/331 (15%)
 Frame = -3

Query  1137  FGEDEVVEESKFQRASRRLFELF----GAAVVADFIPWLRWLDIGGHEKAMRETAMEMES  970
             F   +  E  + QR  RR+F  F    G   VAD IP+L WLD+G HEK +++TA EM+S
Sbjct  8     FSASDASENKQAQRC-RRVFREFCHLSGLFAVADAIPFLGWLDLGRHEKTLKKTAKEMDS  66

Query  969   FAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCL  790
              A+ W+EEH+R++ S      + DFMD MLS+ +        S+  G YD D + K+TCL
Sbjct  67    IAQEWLEEHRRRKDSGEVNSTQ-DFMDVMLSVLD--------SKNLGDYDADTVNKATCL  117

Query  789   AMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVI  610
             A+++  +DTT VTL WALSL+LNN + L++ Q+ELD  VGKER V E D+ +L+YLQA++
Sbjct  118   ALIVGGSDTTVVTLTWALSLLLNNRDTLKKAQEELDIQVGKERLVNEQDISKLVYLQAIV  177

Query  609   KETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERF  430
             KET+RLYP   L  P +  EDC +  YH+ KGTRLI N  KI +DP++W           
Sbjct  178   KETLRLYPPAALGGPRQFTEDCTLGGYHVSKGTRLILNLSKIQKDPRIWM----------  227

Query  429   LTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLT  250
                                      CPGI+ AL+++ L LA+ +  FD    SN  +D+ 
Sbjct  228   ------------------------TCPGIAFALQMLHLTLANFLQAFDFSTPSNAQVDMC  263

Query  249   ESCGLTNFKATPLQALLIPRLESNLYG*TKT  157
             ES GLTN K+TPL+ L+ PR+ S LY  T T
Sbjct  264   ESLGLTNMKSTPLEVLISPRM-SLLYRYTTT  293



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 236/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-------DEVVEESKFQRASR----RLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+        E  E+++  R  +    + F L G   V+D  P LRW D+ G
Sbjct  189   NMIVRMVAGKRYFGGTGSETSEDTEEARQCKIAISKFFHLIGIFTVSDAFPALRWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   E+W+E H+++RK   +KE ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGSELDVILEKWIENHRQQRKVSGTKENDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCLA++L  +DTT+ TL WA++L+LNN E+L++ QDE+D HVG++R VE
Sbjct  305   --YDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD+K L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYMEPNEFRPERFVTGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D++ES GLT  KATPL+ L+ PRL   L+
Sbjct  483   SFEVKTVLDMPVDMSESPGLTIPKATPLEVLMSPRLNEQLF  523



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 227/316 (72%), Gaps = 7/316 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E + +Q+   +   L G  VV+D +P+LRWLDIGG+E+ M +TA   +   + W++EHK 
Sbjct  220   EVNDWQQQITKFTALSGQFVVSDALPFLRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  279

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S  +K +E DFM  +LSL +  A      +LP   D D +IK+ C+ +++AA DT+ 
Sbjct  280   KRDSGDAKGDE-DFMYVLLSLLDDNAE-----QLPD-RDADAVIKAICVTLIVAAADTSV  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L++NN +VL++ QDELD  VG ER V ESD + L+YLQA+IKETMRLYPA P
Sbjct  333   VTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAP  392

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE +E+CI+N YH+  GT+L  N  KI RDP VW +P +F+PERFLT HKD+DV G
Sbjct  393   LLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG  452

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRRMCP +S  L+++QL LASLVHGFD    S+EP+D+ E+ GLT  KAT
Sbjct  453   QDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKAT  512

Query  216   PLQALLIPRLESNLYG  169
             PL+ L+ PRL ++LYG
Sbjct  513   PLEVLVSPRLSASLYG  528



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETA  985
             + N+++ M+ G           +    + ++ G  VV+D +P+LRWLDIGG E++M++TA
Sbjct  160   ICNVILRMIVG-----------KGCNSVDKMSGKFVVSDALPFLRWLDIGGDERSMKKTA  208

Query  984   MEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQII  805
              E++   +  +EEHKRKR S+  K EE DFM  MLS+   T   S       G D D I 
Sbjct  209   KELDIVVQGCLEEHKRKRDSREMKGEELDFMSVMLSILGDTEKYS-------GRDVDTIN  261

Query  804   KSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIY  625
             K+ CL +++A  DTT+VTL W +SL+LN+ ++L+++Q+ELD  VG +R+V ESDLK L+Y
Sbjct  262   KAVCLGLIIAGLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVY  321

Query  624   LQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEF  445
             LQA +KE MRLYPAVPL +PHEA+E+C +N YH+  GT+L+ N  K+ RDP+VW +P +F
Sbjct  322   LQATLKEAMRLYPAVPLLIPHEAIEECTVNGYHVPAGTQLLINVWKLQRDPRVWEEPCKF  381

Query  444   RPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNE  265
             +PERFLT HKD+DVRG + EL+PFGSGRRMCPG+S AL+++Q  +ASL+ GFD    SNE
Sbjct  382   QPERFLTKHKDIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNE  441

Query  264   PIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             P+D+ E  GLT  K+ PL+ L+ PRL ++LYG
Sbjct  442   PLDMGEGFGLTMEKSRPLEVLIAPRLSASLYG  473



>ref|XP_007156852.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
 gb|ESW28846.1| hypothetical protein PHAVU_002G022900g [Phaseolus vulgaris]
Length=527

 Score =   330 bits (845),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 227/317 (72%), Gaps = 10/317 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  +++RA R    LFGA V++D  P+L WLDI G+EK M+ TA E+++  E W+EEHKR
Sbjct  217   EARRYRRAMRDWVCLFGAFVLSDAFPFLGWLDINGYEKDMKRTASELDTLVEGWLEEHKR  276

Query  936   krksksskeeEAD-FMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             KR    + +EE D FMD +L++ + T  S        GYD+D IIK+TCL ++LA TD T
Sbjct  277   KRALSVNGKEERDDFMDVLLNVLQGTEIS--------GYDSDTIIKATCLNLVLAGTDPT  328

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
              VTL WALSL+LN+   L+R Q ELDT +GK+R+VEESD+ +L+YLQAV+KET+RLYP  
Sbjct  329   MVTLTWALSLLLNHPTELKRTQHELDTLIGKDRKVEESDIDQLVYLQAVVKETLRLYPPS  388

Query  579   PLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
             P+     AMEDC  +  YHI  GT+L+ N  KIHRD +VW+ P +F+PERFLT HKDVDV
Sbjct  389   PIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPHDFKPERFLTSHKDVDV  448

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             +G N+EL+PF SGRR CPG SLAL +V L L+ L+H F +   SN+ +D+TES GLTN K
Sbjct  449   KGQNYELVPFSSGRRACPGASLALRVVHLTLSRLLHSFTVACPSNQVVDMTESFGLTNLK  508

Query  222   ATPLQALLIPRLESNLY  172
             ATPL+ LL PRLES LY
Sbjct  509   ATPLEVLLTPRLESKLY  525



>ref|XP_008343753.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 214/315 (68%), Gaps = 11/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E   +Q+A R  F L G  V+ D IPWL WLD+GGH+KAM++TA  ++S    W+EEHK+
Sbjct  223   EARAWQKAMREFFHLVGMFVLGDAIPWLWWLDLGGHQKAMKKTAKALDSIVMGWLEEHKQ  282

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R     ++   DFM  MLS+ +     +H S    G+DTD +IK+TCL+++L  +DTT 
Sbjct  283   RRAKGQDQQ---DFMGVMLSVLD----GAHVS----GFDTDTVIKATCLSLILGGSDTTM  331

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTLIW LSL+LNN   L+++ +ELD HVGKER V ESD+  L+YLQA +KE MRL PA P
Sbjct  332   VTLIWTLSLLLNNRHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGP  391

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             +S   E  ED  +  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKD+DVRG
Sbjct  392   ISGQREFTEDGTVGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRG  451

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FEL+PFGSGRR CPGI+  L++  L LA  +H FD+  + N P+D+T S GLTN K T
Sbjct  452   QHFELMPFGSGRRACPGITFGLQVTLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLT  511

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL   ++
Sbjct  512   PLDVLVKPRLTPQIF  526



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   329 bits (843),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 217/332 (65%), Gaps = 11/332 (3%)
 Frame = -3

Query  1158  NMLVSMLFGE--DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETA  985
             N+++ M+ G+      E   F++  R  F   G  V+ D IP+L WLD GGHEK M+ TA
Sbjct  197   NVILRMVVGKRCSGGGEAEHFRKTMREFFHYLGMFVLRDAIPFLGWLDAGGHEKGMKTTA  256

Query  984   MEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
              EM       +EE  +++  +     +E DFMD+MLS+ E    +        GYD+D I
Sbjct  257   KEMNCLVSELLEEHRRKRGSAGKVATKEQDFMDSMLSVLEEKDFA--------GYDSDMI  308

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IKS CL ++   +DT++VTL W +SL+LNN + LE+ Q+ELD  VG+ER+V E D+ +LI
Sbjct  309   IKSACLNLIAGGSDTSTVTLTWTISLLLNNKQALEKAQEELDRLVGRERQVNEFDISKLI  368

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKE++RLYP  PLS P    E+C I   HI+KGTRLI N  KIHRDPK W  P +
Sbjct  369   YLQAIIKESLRLYPPAPLSAPRVTRENCTIGGCHIKKGTRLIINVWKIHRDPKNWPDPLQ  428

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F PERFLT HKD+DVRG NFELIPFGSGRR CPG +  L++V +ALA  +  F +   + 
Sbjct  429   FTPERFLTSHKDIDVRGQNFELIPFGSGRRACPGTAFGLQMVHIALARFLQAFQISNPTT  488

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             EPID+TES GLTN KATPL+ LL PRL   LY
Sbjct  489   EPIDMTESPGLTNLKATPLEVLLSPRLPPGLY  520



>ref|XP_002510311.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52498.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/331 (52%), Positives = 230/331 (69%), Gaps = 8/331 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETA  985
             V   LV +L GE +    + +Q A R   EL G   V+D +P+LRWLD+GG EK M++  
Sbjct  199   VGQRLVELLDGEQDEGSSNSWQDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKQNL  258

Query  984   MEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQII  805
              +++    +W+++ + K+ S  +K +E  FMD +LS+       S       G D D I 
Sbjct  259   EKLDCVVRKWLQDRRDKKSSGIAKRQEG-FMDVLLSILNDAEELS-------GRDADTIN  310

Query  804   KSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIY  625
             K+TCLA++LAA+DTT++TL W LSL+LNN E L+  Q E+D HVGKER+V ESD ++L+Y
Sbjct  311   KATCLALILAASDTTAITLTWTLSLLLNNREALKAAQHEVDIHVGKERQVTESDARDLVY  370

Query  624   LQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEF  445
             LQA+IKE+ RLYPAVPL +PHEAME+C +N YHI  GTRLI N  K+H DP VW  P EF
Sbjct  371   LQAIIKESFRLYPAVPLLLPHEAMEECTVNGYHIPAGTRLIINVSKVHEDPSVWLNPQEF  430

Query  444   RPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNE  265
             +PERFLT HKDVD RG NF+LIPFGSGRR CPGI  AL+++ L LA+++H F++   S+ 
Sbjct  431   QPERFLTSHKDVDFRGQNFDLIPFGSGRRKCPGILFALQVLSLTLATVLHSFEIETSSDN  490

Query  264   PIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             PID+ ES G TN KA+PL+ +L PRL ++LY
Sbjct  491   PIDMCESAGTTNAKASPLEVVLTPRLPAHLY  521



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 226/339 (67%), Gaps = 15/339 (4%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEES---KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+     FG     ++S   + Q+A  + F L G   V+D +P+  WLD  GHE 
Sbjct  166   NMVVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEM  225

Query  1002  AMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             AM++TA E+++  E W+EE  +R+       E E DF+D MLSL E    S  Q      
Sbjct  226   AMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQ------  279

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +  D  IKSTCLA++L  +DTTS TL WA+SL+LNN  +L++ Q+ELD  +G +R+V++S
Sbjct  280   HSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDS  339

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKET+RLYPA PL  P EAMEDC +  YHI  GTRLI N  KI RDP+V
Sbjct  340   DIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRV  399

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P  F+PERFLT H DVD RG  FELIPFGSGRR CPG S AL+++ L LA L+H F+
Sbjct  400   WKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFE  459

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             +   S++P+D+TES GLT  KATPL+ +L PRL  N YG
Sbjct  460   LATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPNPYG  498



>gb|KHN42044.1| Cytochrome P450 82A3 [Glycine soja]
Length=538

 Score =   329 bits (844),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 226/321 (70%), Gaps = 14/321 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  +++R  R    LFG  V++D  P+L WLDI G+EK M+ TA E+++  E W+EEHKR
Sbjct  219   EARRYRRVMRDWVCLFGVFVLSDSFPFLGWLDINGYEKDMKRTASELDALVEGWLEEHKR  278

Query  936   krksksskeeEA-----DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             KRK K            DFMD ML++ + T  S        GYD+D IIK+TCL ++LA 
Sbjct  279   KRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEIS--------GYDSDTIIKATCLNLILAG  330

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             TD T VTL WALSL+LN+   L+R + ELDT +GK+R+VEESD+K+L+YLQAV+KET+RL
Sbjct  331   TDPTMVTLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRL  390

Query  591   YPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             YP  P+     AMEDC  +  YHI  GT+L+ N  KIHRD +VW++P++F+PERFLT HK
Sbjct  391   YPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHK  450

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVDV+G N+EL+PF SGRR CPG SLAL +V L LA L+H FD+   SN+ +D+TES GL
Sbjct  451   DVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGL  510

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ LL PRL++  Y
Sbjct  511   TNLKATPLEVLLTPRLDTKFY  531



>ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=538

 Score =   329 bits (843),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 226/321 (70%), Gaps = 14/321 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  +++R  R    LFG  V++D  P+L WLDI G+EK M+ TA E+++  E W+EEHKR
Sbjct  219   EARRYRRVMRDWVCLFGVFVLSDSFPFLGWLDINGYEKDMKRTASELDALVEGWLEEHKR  278

Query  936   krksksskeeEA-----DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             KRK K            DFMD ML++ + T  S        GYD+D IIK+TCL ++LA 
Sbjct  279   KRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEIS--------GYDSDTIIKATCLNLILAG  330

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             TD T VTL WALSL+LN+   L+R + ELDT +GK+R+VEESD+K+L+YLQAV+KET+RL
Sbjct  331   TDPTMVTLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRL  390

Query  591   YPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             YP  P+     AMEDC  +  YHI  GT+L+ N  KIHRD +VW++P++F+PERFLT HK
Sbjct  391   YPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHK  450

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVDV+G N+EL+PF SGRR CPG SLAL +V L LA L+H FD+   SN+ +D+TES GL
Sbjct  451   DVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGL  510

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL+ LL PRL++  Y
Sbjct  511   TNLKATPLEVLLTPRLDTKFY  531



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   341 bits (874),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 225/321 (70%), Gaps = 9/321 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             EDE  E  + Q A +  F   G  V+ D +P+LRWLD+GGHEKAM++ A E+++    W+
Sbjct  706   EDEKTEARRVQSALKLFFYYVGLFVLGDAVPYLRWLDLGGHEKAMKKIAKELDAIVGGWV  765

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             EEHKR+R    +K E  DF+D MLS+ +            GG+D D + K+T L M+  A
Sbjct  766   EEHKRRRARGDAKGE-PDFIDAMLSVLDGADL--------GGFDADTVNKATSLNMIAGA  816

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT VTL WA+SL+LNN  +L+R Q ELDT +G++R V ESD+ +L+Y+QA++KET+RL
Sbjct  817   SDTTMVTLTWAISLLLNNPHMLKRAQTELDTEIGRQRVVSESDISKLVYIQAIVKETLRL  876

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PLS P E  +DC I  YH+ KGTRLITN  KI  DP++W  P EF+PERFLT  KD
Sbjct  877   YPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTTQKD  936

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDV+G +FELIPFGSGRR CPG++ AL++VQ  LAS VH F++    + PID+TES GLT
Sbjct  937   VDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFEISNPLSAPIDMTESFGLT  996

Query  231   NFKATPLQALLIPRLESNLYG  169
             N KATPLQ L+ PRL S LYG
Sbjct  997   NVKATPLQVLIKPRLPSQLYG  1017


 Score =   287 bits (735),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 184/277 (66%), Gaps = 12/277 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++Q+A R  F L G  V+ D +PWL WLD+GG +KAM++ A E++S    W+EEHK+
Sbjct  230   EARRWQKAMREFFHLAGLFVLGDAVPWLSWLDLGGQQKAMKKNAKELDSIVAEWLEEHKQ  289

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             K      +    DFMD MLS    T  +        G+D D +IK+TCL ++   +DTT 
Sbjct  290   KITEGKDQ----DFMDVMLSAINGTDVA--------GFDADTVIKATCLILIAGGSDTTM  337

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL+LNN +VL++I +ELD +VGK R +EESD+  L+YLQA +KE MRL PA P
Sbjct  338   VTLTWALSLLLNNRQVLKKIYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGP  397

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS   E  EDC I  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKDVDVRG
Sbjct  398   LSGQREFTEDCTIGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRG  457

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
               FEL+PFGSGRR CPGIS  L++  L LAS +   D
Sbjct  458   QQFELMPFGSGRRACPGISFGLQMTLLTLASFLFSMD  494



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   328 bits (841),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 233/340 (69%), Gaps = 17/340 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + Q+A  + F L G   ++D  P L W D+ GH
Sbjct  189   NMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGH  248

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             EK M++T  E++   ERW+E H+++RK   +KE ++DF+D MLSL E    S  Q     
Sbjct  249   EKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQ-----  303

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              YD +  IKSTCLA++L  +DTT+ TL WA++L+LNN ++L++ QDE+D  VG +R VE+
Sbjct  304   -YDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVED  362

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD++ L+YLQA+IKET+RLYPA PL  P EAMEDC I  YH+  GTRLI N  KI RDPK
Sbjct  363   SDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTIAGYHVSCGTRLIVNVWKIQRDPK  422

Query  468   VWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
             VW +P+EFRPERFLT   K+ DVRG NFELIPFGSGRR CPG SLA++++ L LA  +H 
Sbjct  423   VWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHS  482

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             FD++   +  +D++ES GLT  KATPL+ ++ PRLE +L+
Sbjct  483   FDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   328 bits (842),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             +++   E  ++    + F   G  VV+D +P+LRW DIGG E+AM++ A E++  A+ W+
Sbjct  221   QEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWL  280

Query  951   eehkrkrksksskeeEA--DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLL  778
             +EHKRKR+S     +E   DFMD MLS+    A      +LPG  D D I K+TCLA++L
Sbjct  281   DEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQ-----QLPGD-DADTINKATCLALIL  334

Query  777   AATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETM  598
             AA+DT+ +TL W LSL+LN+ +VL++ Q+ELD H+GK R+V E D+K L+YLQA+IKE M
Sbjct  335   AASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAM  394

Query  597   RLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHH  418
             RLYPA PL+ PH + EDC +N+Y +  GT L  N  KIHRDP+VW +P +F+PERFLT H
Sbjct  395   RLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTH  454

Query  417   KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCG  238
             K +DVRG NFEL+PF SGRRMCPG S A+ +  L LA+L+HGFD     +EP+D++E   
Sbjct  455   KHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMS  514

Query  237   LTNFKATPLQALLIPRLESNLYG  169
             LT  K TP++ L+ PRL ++LYG
Sbjct  515   LTLVKTTPVKVLITPRLSASLYG  537



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   328 bits (841),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 226/339 (67%), Gaps = 15/339 (4%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEES---KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+     FG     ++S   + Q+A  + F L G   V+D +P+  WLD  GHE 
Sbjct  188   NMVVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEM  247

Query  1002  AMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             AM++TA E+++  E W+EE  +R+       E E DF+D MLSL E    S  Q      
Sbjct  248   AMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQ------  301

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +  D  IKSTCLA++L  +DTTS TL WA+SL+LNN  +L++ Q+ELD  +G +R+V++S
Sbjct  302   HSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDS  361

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKET+RLYPA PL  P EAMEDC +  YHI  GTRLI N  KI RDP+V
Sbjct  362   DIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRV  421

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P  F+PERFLT H DVD RG  FELIPFGSGRR CPG S AL+++ L LA L+H F+
Sbjct  422   WKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFE  481

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             +   S++P+D+TES GLT  KATPL+ +L PRL  N YG
Sbjct  482   LATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPNPYG  520



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   328 bits (842),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             +++   E  ++    + F   G  VV+D +P+LRW DIGG E+AM++ A E++  A+ W+
Sbjct  221   QEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWL  280

Query  951   eehkrkrksksskeeEA--DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLL  778
             +EHKRKR+S     +E   DFMD MLS+    A      +LPG  D D I K+TCLA++L
Sbjct  281   DEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQ-----QLPGD-DADTINKATCLALIL  334

Query  777   AATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETM  598
             AA+DT+ +TL W LSL+LN+ +VL++ Q+ELD H+GK R+V E D+K L+YLQA+IKE M
Sbjct  335   AASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAM  394

Query  597   RLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHH  418
             RLYPA PL+ PH + EDC +N+Y +  GT L  N  KIHRDP+VW +P +F+PERFLT H
Sbjct  395   RLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTH  454

Query  417   KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCG  238
             K +DVRG NFEL+PF SGRRMCPG S A+ +  L LA+L+HGFD     +EP+D++E   
Sbjct  455   KHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMS  514

Query  237   LTNFKATPLQALLIPRLESNLYG  169
             LT  K TP++ L+ PRL ++LYG
Sbjct  515   LTLVKTTPVKVLITPRLSASLYG  537



>gb|KHN36186.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 225/316 (71%), Gaps = 9/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++  R    LFG  V++D IP+L W+D  G++KAM++TA E+++    W+EEHKR
Sbjct  221   EARRYKKTMRDFMRLFGVFVLSDAIPFLGWIDNNGYKKAMKKTASEIDTLVAGWLEEHKR  280

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR + ++ +EE D M  ML++ +    S        GYD+D IIK+TCL ++LA  D+  
Sbjct  281   KRATSTNGKEEQDVMGVMLNVLQDLKVS--------GYDSDTIIKATCLNLILAGGDSIM  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V L WALSL+LNN   L++ QDELDT +GK+R+VEESD+K+L YLQA++KETMRLYP  P
Sbjct  333   VALTWALSLLLNNEIELKKAQDELDTQIGKDRKVEESDIKKLAYLQAIVKETMRLYPPSP  392

Query  576   LSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             +     AME+C  +  YHI  GT LI N  KIHRD  VW  P +F+PERFLT HKDVDV+
Sbjct  393   VITLRAAMEECTFSCGYHIPAGTHLIVNTWKIHRDGCVWPDPHDFKPERFLTSHKDVDVK  452

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G N+ELIPFGSGRR+CPG SLAL +V +ALA L+H F++   SN+ +D+TES GLTN KA
Sbjct  453   GQNYELIPFGSGRRVCPGSSLALRVVHMALARLLHSFNVASPSNQAVDMTESIGLTNLKA  512

Query  219   TPLQALLIPRLESNLY  172
             TPL+ LL PRL++ LY
Sbjct  513   TPLEVLLTPRLDTKLY  528



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 226/339 (67%), Gaps = 15/339 (4%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEES---KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+     FG     ++S   + Q+A  + F L G   V+D +P+  WLD  GHE 
Sbjct  195   NMVVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEM  254

Query  1002  AMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             AM++TA E+++  E W+EE  +R+       E E DF+D MLSL E    S  Q      
Sbjct  255   AMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQ------  308

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             +  D  IKSTCLA++L  +DTTS TL WA+SL+LNN  +L++ Q+ELD  +G +R+V++S
Sbjct  309   HSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDS  368

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K L+YLQA+IKET+RLYPA PL  P EAMEDC +  YHI  GTRLI N  KI RDP+V
Sbjct  369   DIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRV  428

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P  F+PERFLT H DVD RG  FELIPFGSGRR CPG S AL+++ L LA L+H F+
Sbjct  429   WKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFE  488

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             +   S++P+D+TES GLT  KATPL+ +L PRL  N YG
Sbjct  489   LATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPNPYG  527



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 222/315 (70%), Gaps = 10/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  +F  A  R+ EL GA +V+D +P+LRWLD+GG+++AM+ TA EM+     W+ EH+ 
Sbjct  213   EARRFTGAMHRMMELLGAFMVSDVVPFLRWLDLGGYQRAMKRTAAEMDGIIGGWLREHRD  272

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R    ++ +E DFMD MLS  E       +  L   +D D +IK+  LA+++A TDTTS
Sbjct  273   RRSEGRAEGKE-DFMDVMLSTMEK------EGELFSDHDPDTVIKANSLALIIAGTDTTS  325

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VT+IWAL+L+LN+  VL   Q+ELD+HVGK+R V+ESD+++L+YLQA++KET+RLYP  P
Sbjct  326   VTMIWALALLLNHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETLRLYPPGP  385

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
               +PH+ MEDC ++ + +  GT+++ N   I  DP+VW  P  FRPERFLT HKDVD+RG
Sbjct  386   TLIPHQTMEDCQVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRG  445

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FEL+PFGSGRR CPG S AL++V LALA ++HGFDM   +  P+D+TE  G T  KAT
Sbjct  446   RHFELLPFGSGRRACPGASFALQVVHLALARIIHGFDM---AGGPVDMTEGKGATLPKAT  502

Query  216   PLQALLIPRLESNLY  172
             PLQ L+ PRL   LY
Sbjct  503   PLQVLVTPRLPPGLY  517



>gb|AII31759.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 223/320 (70%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  ++++A R  F L G  V+ D +P+LRWLDIGG+EK M+ TA E++  +  W+
Sbjct  211   EEDQKEVLRYRKALRDFFHLTGMFVLGDAVPFLRWLDIGGYEKRMKITAKELDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++  +   +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKGGRWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   +L++ Q+ELDTH+GK+R V E+D+ +L+Y+QA++KET+RL
Sbjct  322   SDTTTVTLIWGLSLMLNKPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRL  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSETCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDVRG +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    SN  IDLT + GLT
Sbjct  442   VDVRGQHFELMPFGSGRRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPL+AL+ PRL   LY
Sbjct  502   NIKSTPLEALVSPRLAPELY  521



>ref|XP_006432705.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
 gb|ESR45945.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
Length=452

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 236/333 (71%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+  + V+  ++     R  E+ G  VV+D +P+LRWLDIGG E++M++ 
Sbjct  127   IRNVVLRMIVGKGCDSVDGEEWIELLTRFSEMSGKFVVSDALPFLRWLDIGGDERSMKKI  186

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W+EEHKRKR S+  KEE+ DFM  MLS+   T   S       G D D I
Sbjct  187   AKELDIVVQGWLEEHKRKRDSQEIKEEDLDFMSVMLSILGDTKQYS-------GRDVDTI  239

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL ++LAATD T +TL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+
Sbjct  240   NKATCLGLVLAATDNTKMTLTWVISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLV  299

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KE MRLYP  PL +PH+++E+C I+ Y++   T+LI N  K+ RDP VW +P +
Sbjct  300   YLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCK  359

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD+DVRG NFEL+PFGSGRR CPG+S AL++++  LA+L+HGFD    SN
Sbjct  360   FQPERFLTRHKDIDVRGQNFELLPFGSGRRTCPGVSFALQVMEFTLAALLHGFDFATPSN  419

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GL+  KA PL+ L+ PRL ++LYG
Sbjct  420   EPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  452



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 233/340 (69%), Gaps = 17/340 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + Q+A  + F L G   ++D  P L W D+ GH
Sbjct  189   NMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGH  248

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             EK M++T  E++   ERW+E H+++RK   +KE ++DF+D MLSL E    S  Q     
Sbjct  249   EKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQ-----  303

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              YD +  IKSTCLA++L  +DTT+ TL WA++L+LNN ++L++ QDE+D  VG +R VE+
Sbjct  304   -YDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVED  362

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD++ L+YLQA+IKET+RLYPA PL  P EAMEDC +  YH+  GTRLI N  KI RDPK
Sbjct  363   SDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPK  422

Query  468   VWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
             VW +P+EFRPERFLT   K+ DVRG NFELIPFGSGRR CPG SLA++++ L LA  +H 
Sbjct  423   VWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHS  482

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             FD++   +  +D++ES GLT  KATPL+ ++ PRLE +L+
Sbjct  483   FDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>gb|KHG29694.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 224/320 (70%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  ++++A R  F L G  V+ D +P+LRWLDIGG+EK M++TA E++  +  W+
Sbjct  211   EEDQKEVLRYRKALRDFFHLTGMFVLGDAVPFLRWLDIGGYEKWMKKTAKELDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++  +   +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKGGRWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   +L++ Q+ELDT++G++R V E+D+ +L+Y+QA++KET+R+
Sbjct  322   SDTTTVTLIWGLSLMLNKPHILKKAQEELDTYIGRDRLVNETDIGKLVYIQAIVKETLRM  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDVRG +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    SN  IDLT + GLT
Sbjct  442   VDVRGQHFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPLQAL+ PRL   LY
Sbjct  502   NIKSTPLQALVSPRLAPELY  521



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 219/314 (70%), Gaps = 7/314 (2%)
 Frame = -3

Query  1107  KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee-hkrkr  931
             + Q+A  + F L G  VV+D +P+L WLD+ GHE+AM+ TA E++S  E W+EE  +R+ 
Sbjct  219   RCQKAISQFFRLIGIFVVSDALPFLWWLDLQGHERAMKTTAKELDSILEGWLEEHRQRRV  278

Query  930   ksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVT  751
              S    E E DF+D MLSL E    S  Q      YD++  IKSTCLA++L  +DTT+ T
Sbjct  279   SSLIKAEGEQDFIDVMLSLQEEGRLSGFQ------YDSETSIKSTCLALILGGSDTTAGT  332

Query  750   LIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLS  571
             L WA+SL+LNN   L++ Q+ELD  VG ER+VEESD+K L+YLQA+IKET+RLYPA PL 
Sbjct  333   LTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLL  392

Query  570   VPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNN  391
              P EA++DC +  Y++  GTRLI N  K+ RDP VW  P  F+PERFL  H DVDV+G  
Sbjct  393   GPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHADVDVKGQQ  452

Query  390   FELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPL  211
             FEL+PFGSGRR CPG+S AL+++ L LA L+H F++    ++P+D+TES GLT  KATPL
Sbjct  453   FELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPL  512

Query  210   QALLIPRLESNLYG  169
             + LL PRL S LY 
Sbjct  513   EVLLTPRLNSKLYA  526



>ref|XP_008378401.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 213/315 (68%), Gaps = 11/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E   +Q+A R  F L G  V+ D IPWL WLD+GGH+KAM++TA  ++S    W+EEHK+
Sbjct  223   EARAWQKAMREFFHLVGMFVLGDAIPWLWWLDLGGHQKAMKKTAKALDSIVMGWLEEHKQ  282

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R     ++   DFM  MLS+ +     +H S    G+DTD +IK+TCL+++L  +DTT 
Sbjct  283   RRAKGQDQQ---DFMGVMLSVLD----GAHVS----GFDTDTVIKATCLSLILGGSDTTM  331

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTLIW LSL+LNN   L+++ +ELD HVGKER V ESD+  L+YLQA +KE MRL PA P
Sbjct  332   VTLIWTLSLLLNNRHALKKVHEELDKHVGKERLVNESDISNLVYLQATVKEAMRLCPAGP  391

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             +S   E  ED  +  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKD+DVRG
Sbjct  392   ISGQREFTEDGTVGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDIDVRG  451

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FEL+PFGSGRR CPGI+  L++  L LA  +H FD+  + N P+D+T S GLTN K  
Sbjct  452   QHFELMPFGSGRRACPGITFGLQVTLLTLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLX  511

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL   ++
Sbjct  512   PLDVLVKPRLTPQIF  526



>ref|XP_010070486.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59284.1| hypothetical protein EUGRSUZ_H01963 [Eucalyptus grandis]
Length=525

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 221/317 (70%), Gaps = 9/317 (3%)
 Frame = -3

Query  1119  VEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehk  940
              E  + QR+ RR F+LFG  V++D I  L WLD GG++++M ETA E++  A+ W+EEH+
Sbjct  213   AEAKRCQRSIRRFFDLFGVVVLSDAISGLGWLDFGGYKRSMNETAKELDVLAQGWLEEHR  272

Query  939   rkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             RKR S    + E DFMD ML + E    S         +D D ++K+TCL M++A TDT 
Sbjct  273   RKRLSHPGGDGEQDFMDLMLKVIEGVKFSD--------FDADTVVKATCLNMIIAGTDTL  324

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
              V L WALSL++NN   L++ Q ELDTHVGK RRVEESD+K L YLQA++KETMR YP V
Sbjct  325   IVGLTWALSLLVNNRHALKKAQQELDTHVGKNRRVEESDVKNLTYLQAIVKETMRFYPPV  384

Query  579   PLSVPHEAMEDCIINN-YHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
             P++    + E+C  ++ Y I  GTRL+ N+ KI RD +VW+ PD F PERFLT H++VDV
Sbjct  385   PINGLRSSTEECTFSSGYRIPAGTRLLLNYWKIQRDERVWSNPDRFEPERFLTTHENVDV  444

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             RG NFELIPFG+GRR C G SLAL  + L LASL+  F++  +S +P+D+TES GLTN K
Sbjct  445   RGQNFELIPFGAGRRSCAGTSLALHTMHLTLASLLQSFEIDTVSGKPVDMTESPGLTNLK  504

Query  222   ATPLQALLIPRLESNLY  172
             A+PL+ +LIPRL+  +Y
Sbjct  505   ASPLEVVLIPRLDQKVY  521



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/337 (52%), Positives = 232/337 (69%), Gaps = 17/337 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFGE-----DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             V N+++ ++ G+      E  E  K++++     EL G  VV+D +P+LRWLDIGG EK 
Sbjct  196   VLNVILMIIVGKRIPNSSEGDETVKWKKSLDDFSELSGKFVVSDALPFLRWLDIGGEEKF  255

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M++ A E++   E W++EHK KR +  +  EE DFM  MLS+                +D
Sbjct  256   MKKIAKELDQVVEGWLQEHKHKRAANEANSEE-DFMGVMLSILRDAEE----------HD  304

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERR-VEESD  643
              D + K+T LA++LAA DTTS T+ WALSL+LNN   L+++Q ELDT VG +R  V ESD
Sbjct  305   ADTVNKATSLALILAAEDTTSTTMTWALSLLLNNRNRLKKVQQELDTQVGMDRLLVTESD  364

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
              K L+YLQ+V+KET+RLYPA PLSV HEA+EDC +N+YH+  GT LI N  KIHRDP VW
Sbjct  365   TKNLVYLQSVVKETLRLYPAAPLSVIHEAIEDCTVNDYHVSAGTWLILNLHKIHRDPGVW  424

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EFRPERFLT HKDVDVRG NFELIPFGSGRRMCPG+S AL+I+ L LA+++H FD 
Sbjct  425   SDPCEFRPERFLTTHKDVDVRGQNFELIPFGSGRRMCPGVSFALQILHLTLANVLHWFDF  484

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                 +EP+ + E  GLT+ +ATPL+  + PRL ++LY
Sbjct  485   ATPLDEPVAMREGAGLTSPRATPLEVHITPRLPASLY  521



>ref|XP_010060880.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW67758.1| hypothetical protein EUGRSUZ_F01493 [Eucalyptus grandis]
Length=540

 Score =   327 bits (839),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 215/315 (68%), Gaps = 8/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E+ + Q+A R LF  FG  + AD +P+LRWLD+GGHEKAM+ TA E++     W+EEHKR
Sbjct  231   EKQRCQKALRALFRFFGLFLAADALPFLRWLDLGGHEKAMKRTAEELDEIIGGWLEEHKR  290

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
               K  S      DFMD MLS+        H     GGYD D IIK+TCLAM+   +DTT 
Sbjct  291   DNKDLSETSGSRDFMDVMLSV--------HNDDEVGGYDADTIIKATCLAMIAGGSDTTM  342

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA+SL+LNN   L+++Q+EL+  +GK+R V+E+D+  L YLQA++KET+RL+PA P
Sbjct  343   VTLTWAISLLLNNLHSLKKVQEELEAQIGKQRHVKEADIASLTYLQAIVKETLRLHPAAP  402

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS P    EDC +  YH+ KGTRLI N  KI  DP+ W  P EFRPERFL+ HKDVDV+ 
Sbjct  403   LSAPRLFTEDCTVGEYHVPKGTRLILNIWKIQTDPETWPDPMEFRPERFLSSHKDVDVKD  462

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
             +NF L+PFG GRR+CPGIS ALE+V   LA  +H FD+  + N P+D++E  G+TN KAT
Sbjct  463   SNFALLPFGGGRRICPGISFALEMVHFLLAKFLHAFDISTVDNLPVDMSEIFGMTNLKAT  522

Query  216   PLQALLIPRLESNLY  172
             PL+ +L PRL    Y
Sbjct  523   PLEVILKPRLGPEFY  537



>ref|XP_007151147.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
 gb|ESW23141.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
Length=524

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 226/336 (67%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQRASRRLFE---LFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E +++ K QR  R + E   LFG   V +F+PWLRW D GGHEKA
Sbjct  194   NMVLRMVVGKRYFGGENLQDEKAQRCVRAVEEFMRLFGVFTVGEFVPWLRWFDFGGHEKA  253

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M+ TA E++S     +EEH++++      +E  DFMD M+SL + T           G D
Sbjct  254   MKATAKELDSIIGEELEEHRKRKGLGEKVDEAQDFMDVMISLLDGTTIE--------GID  305

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST LA++   TDT++  L WA+SL+L N  VLE++++ELD H+GKE+ V ESD+
Sbjct  306   ADTMIKSTVLAVVSGGTDTSNTVLTWAISLILRNPSVLEKVKEELDIHIGKEKCVSESDI  365

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L Y+QA++KE++RLYP  PLS P E  E+C +  Y+I+KGTRLITN  KIH D  VW 
Sbjct  366   SKLTYVQAIVKESLRLYPPGPLSGPREFTENCTLRGYNIKKGTRLITNLWKIHTDSNVWE  425

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFLT HKD+D++G++FEL+PFG GRRMCPG S  L++V   LAS +H F++ 
Sbjct  426   DPLEFKPERFLTTHKDIDIKGHHFELLPFGGGRRMCPGASFGLQMVHFILASFLHSFEII  485

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S +PID+ E+ GLTN KATPL  L+ PRL  N Y
Sbjct  486   SSSPDPIDMIETFGLTNTKATPLDILIKPRLSLNCY  521



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 237/333 (71%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+  + V+  ++     R  E+ G  VV+D +P+LRWLDIGG E++M++ 
Sbjct  200   IRNVVLRMIVGKGCDSVDGEEWIELLTRFSEMSGKFVVSDALPFLRWLDIGGDERSMKKI  259

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W+EEHKRKR S+  KEEE DFM  MLS+   T   S       G D D I
Sbjct  260   AKELDIVVQGWLEEHKRKRDSQEIKEEELDFMSVMLSILGDTKQYS-------GRDVDTI  312

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL ++LAATD T +TL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+
Sbjct  313   NKATCLGLVLAATDNTKMTLTWVISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLV  372

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KE MRLYP  PL +PH+++E+C I+ Y++   T+LI N  K+ RDP VW +P +
Sbjct  373   YLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCK  432

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD+DVRG NFEL+PFGSGRR+CPG+S AL++++  LASL+HGFD    SN
Sbjct  433   FQPERFLTRHKDIDVRGQNFELLPFGSGRRICPGVSFALQVMEFTLASLLHGFDFATPSN  492

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GL+  KA PL+ L+ PRL ++LYG
Sbjct  493   EPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  525



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 233/340 (69%), Gaps = 17/340 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + Q+A  + F L G   ++D  P L W D+ GH
Sbjct  189   NMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGH  248

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             EK M++T  E++   ERW+E H+++RK   +KE ++DF+D MLSL E    S  Q     
Sbjct  249   EKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQ-----  303

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
              YD +  IKSTCLA++L  +DTT+ TL WA++L+LNN ++L++ QDE+D  VG +R VE+
Sbjct  304   -YDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVED  362

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD++ L+YLQA+IKET+RLYPA PL  P EAMEDC +  YH+  GTRLI N  KI RDPK
Sbjct  363   SDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPK  422

Query  468   VWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
             VW +P+EFRPERFLT   K+ DVRG NFELIPFGSGRR CPG SLA++++ L LA  +H 
Sbjct  423   VWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHS  482

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             FD++   +  +D++ES GLT  KATPL+ ++ PRLE +L+
Sbjct  483   FDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLH  522



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 226/316 (72%), Gaps = 7/316 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E + +Q+   +   L G  VV+D +P+LRWLDIGG+E+ M +TA   +   + W++EHK 
Sbjct  220   EVNDWQQQITKFTALSGQFVVSDALPFLRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  279

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S  +K +E DFM  +LSL +  A      +LP   D D +IK+ C+ +++AA DT+ 
Sbjct  280   KRDSGDAKGDE-DFMYVLLSLLDDNAE-----QLPD-RDADAVIKAICVTLIVAAADTSV  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L++NN +VL++ QDELD  VG ER V ESD + L+YLQA+IKETMRLYPA P
Sbjct  333   VTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAP  392

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE +E+CI+N YH+  GT+L  N  KI RDP VW +P +F+PERFLT HKD+DV G
Sbjct  393   LLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG  452

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRRMCP +S  L+++QL LASLVHGFD    S+EP+D+ E+ GLT  KAT
Sbjct  453   QDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKAT  512

Query  216   PLQALLIPRLESNLYG  169
             PL+ L+ PR  ++LYG
Sbjct  513   PLEVLVSPRHSASLYG  528



>gb|KHG29695.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 223/320 (70%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  ++++A R  F L G  V+ D +P+LRWLDIGG+EK M+ TA E++  +  W+
Sbjct  211   EEDQKEVLRYRKALRDFFHLTGMFVLGDAVPFLRWLDIGGYEKRMKITAKELDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++  +   +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKSGRWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   +L++ Q+ELDTH+GK+R V E+D+ +L+Y+QA++KET+RL
Sbjct  322   SDTTTVTLIWGLSLMLNKPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRL  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSETCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDVRG +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    SN  IDLT + GLT
Sbjct  442   VDVRGLHFELMPFGSGRRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPL+AL+ PRL   LY
Sbjct  502   NIKSTPLEALVSPRLAPELY  521



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 236/333 (71%), Gaps = 8/333 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRET  988
             + N+++ M+ G+  + V+  ++     R  E+ G  VV+D +P+LRWLDIGG E++M++ 
Sbjct  200   IRNVVLRMIVGKGCDSVDGEEWIELLTRFSEMSGKFVVSDALPFLRWLDIGGDERSMKKI  259

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A E++   + W+EEHKRKR S+  KEE+ DFM  MLS+   T   S       G D D I
Sbjct  260   AKELDIVVQGWLEEHKRKRDSQEIKEEDLDFMSVMLSILGDTKQYS-------GRDVDTI  312

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
              K+TCL ++LAATD T +TL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+
Sbjct  313   NKATCLGLVLAATDNTKMTLTWVISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLV  372

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA++KE MRLYP  PL +PH+++E+C I+ Y++   T+LI N  K+ RDP VW +P +
Sbjct  373   YLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCK  432

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT HKD+DVRG NFEL+PFGSGRR CPG+S AL++++  LASL+HGFD    SN
Sbjct  433   FQPERFLTRHKDIDVRGQNFELLPFGSGRRTCPGVSFALQVMEFTLASLLHGFDFATPSN  492

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             EP+D+ E  GL+  KA PL+ L+ PRL ++LYG
Sbjct  493   EPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  525



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   333 bits (853),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 224/311 (72%), Gaps = 9/311 (3%)
 Frame = -3

Query  1101  QRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrksk  922
             Q+  R    LFG  V++D IP+L WLD+ G++KAM+ TA E++S    W++EHK KR   
Sbjct  440   QKVIRDFAHLFGVFVLSDAIPFLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKEKRLLG  499

Query  921   sskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTLIW  742
                +++ DFMD ML++ E    S        G+D D + K+TCL ++LA +DTT VTL W
Sbjct  500   GEGKDDQDFMDVMLTVLEDVNFS--------GFDADTVNKATCLNLILAGSDTTKVTLTW  551

Query  741   ALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSVPH  562
             ALSL+LN+  VL++ Q ELD  VGK+R+V+ESD+K L+YLQA+IKET+RLYPA P+   H
Sbjct  552   ALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLH  611

Query  561   EAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNFE  385
              AMEDC +   Y+I  GT+++ N  KIHRD +VW  P EF+PERF+T HKD DVRG +FE
Sbjct  612   AAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFE  671

Query  384   LIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQA  205
             LIPFGSGRR CPGISLAL++V  ALASL+H +++ + S+  +D+TES GLTN KATPL+ 
Sbjct  672   LIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEV  731

Query  204   LLIPRLESNLY  172
             LL PRL++ LY
Sbjct  732   LLSPRLKAELY  742



>gb|KHN00733.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 218/325 (67%), Gaps = 14/325 (4%)
 Frame = -3

Query  1137  FGEDEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FG+  VV+E + QR   A R    L G   VAD +PWLRWLD   HEKAM+E   E++  
Sbjct  207   FGDTAVVDEDEAQRCLKALREYMRLLGVFAVADAVPWLRWLDFK-HEKAMKENFKELDVV  265

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
                W+EEHKRK+          D +D MLS+   T           G+D D +IK+T +A
Sbjct  266   VTEWLEEHKRKKDLNGGNS--GDLIDVMLSMIGGTTIH--------GFDADTVIKATAMA  315

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+L  TDT+S T IW L L+LNN   LE++++E+DTH+GKER V E D+ +L+YLQAV+K
Sbjct  316   MILGGTDTSSATNIWTLCLLLNNPHTLEKVKEEIDTHIGKERIVTEEDISKLVYLQAVLK  375

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             E++RLYPA PLS P E  EDC +  YH++KGTRLITN  KI  DP +W +P EF+PERFL
Sbjct  376   ESLRLYPATPLSGPREFREDCKVGEYHVKKGTRLITNLWKIQTDPSIWPEPLEFKPERFL  435

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T HKD+DV+G +FELIPFGSGRR+CPGIS  L    L LA+ +H F++ + S+EPID+T 
Sbjct  436   TTHKDIDVKGRHFELIPFGSGRRICPGISFGLRTSLLTLANFLHCFEVSKTSSEPIDMTA  495

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
             +  +TN K TPL+ L+ PRL  +LY
Sbjct  496   AVEITNVKVTPLEVLIKPRLSPSLY  520



>gb|AES74584.2| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   327 bits (837),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 229/340 (67%), Gaps = 19/340 (6%)
 Frame = -3

Query  1158  NMLVSMLFGED------EVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N+++ ML G+        V+ E + QR   A ++L  L G   + D IP L+W D GGH 
Sbjct  197   NIVLPMLVGKQYFGHPTNVINEEEGQRCVKALKKLMHLLGVFTIGDAIPLLKWFDFGGHV  256

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksske--eEADFMDTMLSLFETTASSSHQSRLP  832
             KAM+ T+ E++      +EEH+ KR   + +      DFMD MLSLF+ T          
Sbjct  257   KAMKATSKELDKILGDLLEEHRHKRSLGAKEVDRNHQDFMDVMLSLFDGTTIE-------  309

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
              G+D+D IIK+T L ++    DTTSVTL WA+ L+L N  +LE+ ++ELDT VGKER V 
Sbjct  310   -GFDSDTIIKATVLNLIAGGVDTTSVTLTWAICLLLRNPLILEKAKEELDTQVGKERCVR  368

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             E+D+ +L+YLQA++KET+RLYPA PLS P E  E+C ++ Y ++KGTRLI N  KIH DP
Sbjct  369   ETDIDKLVYLQAIVKETLRLYPAGPLSAPREFSENCNLDGYDVRKGTRLILNLRKIHTDP  428

Query  471   KVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHG  292
              +W+ P EF+PERFLT HKDVDVRG++FEL+PFG GRR+CPG+S  L++V L LAS +H 
Sbjct  429   NIWSNPLEFKPERFLTTHKDVDVRGHHFELLPFGGGRRICPGMSFGLQMVHLTLASFLHS  488

Query  291   FDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             F++   S+EPID+TE+ GLTN K TPL+ L+ PRL SN Y
Sbjct  489   FEILNPSSEPIDMTETFGLTNTKTTPLEILIKPRLSSNCY  528



>ref|XP_006573615.1| PREDICTED: cytochrome P450 82A3-like isoform X2 [Glycine max]
Length=530

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 224/316 (71%), Gaps = 9/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++  R    LFG  V++D IP+L W+D  G++KAM++TA E+++    W+EEHKR
Sbjct  221   EARRYKKTMRDFMRLFGVFVLSDAIPFLGWIDNNGYKKAMKKTASEIDTLVAGWLEEHKR  280

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR + ++ +EE D M  ML++ +    S        GYD+D IIK+TCL ++LA  D+  
Sbjct  281   KRATSTNGKEEQDVMGVMLNVLQDLKVS--------GYDSDTIIKATCLNLILAGGDSIM  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V L WALSL+LNN   L++ QDELDT +GK+R+VEESD+K+L YLQA++KETMRLYP  P
Sbjct  333   VALTWALSLLLNNEIELKKAQDELDTQIGKDRKVEESDIKKLAYLQAIVKETMRLYPPSP  392

Query  576   LSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             +     AME+C  +  YHI  GT LI N  KIHRD  VW  P +F+PERFLT HKDVDV+
Sbjct  393   VITLRAAMEECTFSCGYHIPAGTHLIVNTWKIHRDGCVWPDPHDFKPERFLTSHKDVDVK  452

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G N+ELIPFGSGRR+CPG SLAL +V + LA L+H F++   SN+ +D+TES GLTN KA
Sbjct  453   GQNYELIPFGSGRRVCPGSSLALRVVHMVLARLLHSFNVASPSNQAVDMTESIGLTNLKA  512

Query  219   TPLQALLIPRLESNLY  172
             TPL+ LL PRL++ LY
Sbjct  513   TPLEVLLTPRLDTKLY  528



>ref|XP_003519977.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   326 bits (836),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 218/325 (67%), Gaps = 14/325 (4%)
 Frame = -3

Query  1137  FGEDEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FG+  VV+E + QR   A R    L G   VAD +PWLRWLD   HEKAM+E   E++  
Sbjct  209   FGDTAVVDEDEAQRCLKALREYMRLLGVFAVADAVPWLRWLDFK-HEKAMKENFKELDVV  267

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
                W+EEHKRK+          D +D MLS+   T           G+D D +IK+T +A
Sbjct  268   VTEWLEEHKRKKDLNGGNS--GDLIDVMLSMIGGTTIH--------GFDADTVIKATAMA  317

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             M+L  TDT+S T IW L L+LNN   LE++++E+DTH+GKER V E D+ +L+YLQAV+K
Sbjct  318   MILGGTDTSSATNIWTLCLLLNNPHTLEKVKEEIDTHIGKERIVTEEDISKLVYLQAVLK  377

Query  606   ETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFL  427
             E++RLYPA PLS P E  EDC +  YH++KGTRLITN  KI  DP +W +P EF+PERFL
Sbjct  378   ESLRLYPATPLSGPREFREDCKVGEYHVKKGTRLITNLWKIQTDPSIWPEPLEFKPERFL  437

Query  426   THHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTE  247
             T HKD+DV+G +FELIPFGSGRR+CPGIS  L    L LA+ +H F++ + S+EPID+T 
Sbjct  438   TTHKDIDVKGRHFELIPFGSGRRICPGISFGLRTSLLTLANFLHCFEVSKTSSEPIDMTA  497

Query  246   SCGLTNFKATPLQALLIPRLESNLY  172
             +  +TN K TPL+ L+ PRL  +LY
Sbjct  498   AVEITNVKVTPLEVLIKPRLSPSLY  522



>gb|AJD25201.1| cytochrome P450 CYP82D71 [Salvia miltiorrhiza]
Length=516

 Score =   326 bits (835),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 210/315 (67%), Gaps = 9/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + +R  R  F + G  V +D  P+L WLDIGGHE+ M+  A EM+     W+ EH+R
Sbjct  207   EARRCRRVMRDFFHMAGLFVPSDAFPYLEWLDIGGHERRMKRAAEEMDEIVGEWLAEHRR  266

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             K  S   K +  DFMD MLS+ +     S        YD D IIK+TC  ++   TDTTS
Sbjct  267   KEYSGEDKAQ--DFMDVMLSVVKGEDFGSE-------YDVDTIIKATCGTLIAGGTDTTS  317

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V  IWA++L+LNN  VLE+ Q+ELD HVGKERRVEESD+  L+YLQA++KET+RLYP  P
Sbjct  318   VVFIWAIALLLNNRRVLEKAQEELDKHVGKERRVEESDIANLVYLQAIVKETLRLYPPGP  377

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L       +DC I  Y+I KGT LI N  K+HRDP+VW  P EFRPERFL    + DV+G
Sbjct  378   LGGARRVTQDCSIGGYNIPKGTWLIVNLWKLHRDPRVWQDPSEFRPERFLNGESNADVKG  437

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFG+GRR+CPGI+  ++++ L LASL+  FD+  +S+E +D++ES GLTN KAT
Sbjct  438   QDFELIPFGAGRRICPGINFGVQMLHLVLASLLQAFDLNTVSDEGVDMSESAGLTNIKAT  497

Query  216   PLQALLIPRLESNLY  172
             PL  ++ PRL  NLY
Sbjct  498   PLDVVIAPRLPPNLY  512



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   326 bits (836),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 233/342 (68%), Gaps = 19/342 (6%)
 Frame = -3

Query  1158  NMLVSMLFGE------------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIG  1015
             NM+V M+ G+            ++  E  + + A  + F L G   V+D  P LRW D  
Sbjct  189   NMIVRMVAGKRYFGGVVGSESSEDTEEARQCKMAISKFFHLIGIFTVSDAFPRLRWFDFQ  248

Query  1014  GHEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRL  835
             GHEK M++T  E++   ERW++ H+++RK   +KE ++DF+D MLSL E    S  Q   
Sbjct  249   GHEKEMKQTGSELDVILERWIDNHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQ---  305

Query  834   PGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRV  655
                YD +  IKSTCLA++L  ++TTS TL WA++L+LNN E+L++ QDE+D HVG++R V
Sbjct  306   ---YDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNV  362

Query  654   EESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRD  475
             E+SD+  L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RD
Sbjct  363   EDSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRD  422

Query  474   PKVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLV  298
             PKV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +
Sbjct  423   PKVYKEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFL  482

Query  297   HGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             H F+++ + + P+D+TES GLT  KATPL+ L+ PRL  + +
Sbjct  483   HSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLNEHFF  524



>ref|XP_011005663.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=520

 Score =   326 bits (835),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 230/337 (68%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEE--SKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEK  1003
             N++V ML     FG D   +E   +FQ+A    F + G  +V+D +P+L WLD + G   
Sbjct  190   NIIVRMLAGKRYFGTDTNGDEESGRFQKALGDFFYIVGLFLVSDAVPFLGWLDYVRGFAG  249

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
              M+ TA E++     W+E+H+R R + S KEEE DF+  +LS  E    S+         
Sbjct  250   KMKRTATEIDRVFSSWVEDHRRDRLNGSIKEEERDFIHVLLSNLEDGKIST--------V  301

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D  IK TCL+++L   DTT VTL WALSL+LNN  VLE+ QDELD  VGK R+V+E+D
Sbjct  302   DADTAIKGTCLSLILGGHDTTFVTLTWALSLILNNRNVLEKAQDELDIQVGKHRQVDETD  361

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +K L+YLQA++KETMRLYPA PLS P +AMEDC +  +HI  GTRL+ N  K+HRDP +W
Sbjct  362   IKSLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVAGFHIPAGTRLLVNLWKLHRDPNIW  421

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFL  H ++DVRG +FE +PFGSGRRMCPGISLAL+++ L+LA L+HGF+M
Sbjct  422   SNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPGISLALQVLHLSLARLLHGFEM  481

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               +S+  ID++E  G+T  K TPL+ +L PRL SNLY
Sbjct  482   GTVSDALIDMSEGPGITITKETPLEVILRPRLHSNLY  518



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   326 bits (836),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 224/327 (69%), Gaps = 13/327 (4%)
 Frame = -3

Query  1137  FGEDEVVEES---KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FG +   EE+   + Q+  R    LFG  V++D IP+L WLD  G+EK+M+ TA +++S 
Sbjct  209   FGPNADCEEADARRCQKVMRDFVYLFGVFVLSDAIPFLGWLDFQGYEKSMKRTAKQLDSL  268

Query  966   AERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
              ERW+EEHK+KR S     EE DFMD ML++ E    +        G+D D I K+TCL 
Sbjct  269   VERWLEEHKQKRLSGGGVIEEQDFMDVMLNILEDGKIT--------GFDADTINKATCLN  320

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             ++LA +DTT VTL WALSL+LNN  VL+R QDELD HVGK+R +EESD+  L+YLQ+++K
Sbjct  321   LILAGSDTTMVTLTWALSLLLNNPRVLKRAQDELDMHVGKDRPLEESDISNLVYLQSIVK  380

Query  606   ETMRLYPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERF  430
             ET+RLYP  P+     A+EDC ++  YHI  GTRL+ N  KI RD +VW  P +F+PERF
Sbjct  381   ETLRLYPPSPIIGLRAALEDCTLSTGYHIPSGTRLMVNAWKIQRDERVWPDPHDFQPERF  440

Query  429   LTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN-EPIDL  253
             LT HKD+D RG  FELIPFGSGRR CPG SLAL++V   L   +H FD+ + S  E +D+
Sbjct  441   LTSHKDMDFRGQTFELIPFGSGRRSCPGTSLALKMVHFILGRFLHSFDVAKPSKLEDVDM  500

Query  252   TESCGLTNFKATPLQALLIPRLESNLY  172
             TES GLTN KATPL+ L+ PRL S LY
Sbjct  501   TESAGLTNLKATPLEVLVTPRLNSQLY  527



>gb|AII31758.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   326 bits (835),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 224/320 (70%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  ++++A R  F L G  V+ D +P+LRWLDIGG+EK M++TA E++  +  W+
Sbjct  211   EEDQKEVLRYRKALRDFFHLTGMFVLGDAVPFLRWLDIGGYEKWMKKTAKELDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++  +   +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKGGRWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   +L++ Q+ELDT++G++R V E+D+ +L+Y+QA++KET+R+
Sbjct  322   SDTTTVTLIWGLSLMLNKPHILKKAQEELDTYIGRDRFVNETDIGKLVYIQAIVKETLRM  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VDVRG +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    SN  IDLT + GLT
Sbjct  442   VDVRGQHFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPL+AL+ PRL   LY
Sbjct  502   NIKSTPLEALVSPRLAPELY  521



>gb|KDP38429.1| hypothetical protein JCGZ_04354 [Jatropha curcas]
Length=498

 Score =   325 bits (832),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 232/322 (72%), Gaps = 8/322 (2%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             G  E  + S ++ A R   EL G   V+D +P+LRWLD+GG EK M+E   +++   E W
Sbjct  184   GCSEGQDSSTWRDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKENVKKIDHVLENW  243

Query  954   Meehkrkrkskssk-eeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLL  778
             ++EHK+K++      +EE DFM  +LS+ +     S +       D D I K+TCL ++L
Sbjct  244   LQEHKQKKEDSGDLPKEEEDFMSALLSILDDAKELSSR-------DADTINKATCLTLIL  296

Query  777   AATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETM  598
             AA+DTT++TL W LSL+LNN +VL++ Q+ELD HVGKER+V+ESD+  L++LQA+IKE++
Sbjct  297   AASDTTAITLTWTLSLLLNNRDVLKKAQEELDIHVGKERQVKESDMANLVFLQAIIKESL  356

Query  597   RLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHH  418
             RLYPA PLSV HE++EDC +  Y+I  GTRL+ N  KIHRD  VW  P  F+PERFLT H
Sbjct  357   RLYPAAPLSVTHESIEDCTVGGYYIPAGTRLVVNVSKIHRDESVWLNPSAFQPERFLTTH  416

Query  417   KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCG  238
             K++D +G NFELIPF SGRRMCPGIS AL+++ L LA+L+H F++   SN+P+D+TES G
Sbjct  417   KNIDFKGQNFELIPFSSGRRMCPGISFALQVLNLTLATLLHSFEIETPSNQPVDMTESAG  476

Query  237   LTNFKATPLQALLIPRLESNLY  172
             +TN KATP++ALLIPRL + LY
Sbjct  477   ITNLKATPVEALLIPRLPAYLY  498



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 222/318 (70%), Gaps = 8/318 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A  + F L G  V +D  P L W DI GHEKAM+ TA E++S  E W++EH+ 
Sbjct  211   EARRCQKAINQFFHLIGIFVPSDAFPILGWFDIQGHEKAMKRTAKELDSILESWLQEHRE  270

Query  936   krksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             KR+    K E A DF+D MLSL E    S+ Q      YD D  IKSTCLA++L  +DTT
Sbjct  271   KRRLSEGKNEGAQDFIDVMLSLQEEGRLSNFQ------YDADTSIKSTCLALILGGSDTT  324

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             + TL WA+SL+LNN E+L + Q+E+D HVGK+R+V+ESD++ L Y+QA+IKET+RLYPA 
Sbjct  325   AGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAG  384

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PL  P EAM++C +  Y I  GTRLI N  KI RDP++W  PD F+P+RFL  + +VDV+
Sbjct  385   PLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWEDPDSFKPDRFLMSNSNVDVK  444

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR-ISNEPIDLTESCGLTNFK  223
             G +FELIPFGSGRR CPG+SLAL+++ L LA  +  F+  + + ++ IDLTES GLT  K
Sbjct  445   GQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKPVGDQLIDLTESPGLTIPK  504

Query  222   ATPLQALLIPRLESNLYG  169
             ATPL  L+ PRL +NLYG
Sbjct  505   ATPLDVLITPRLNANLYG  522



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 222/316 (70%), Gaps = 11/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + + A R  F L G  +V D IP+LRWLD+GG+EKAM++T  E+ES  E W+EEH++
Sbjct  219   EARRCKEAMREFFRLTGLFLVGDAIPFLRWLDLGGYEKAMKKTHDELESIVEEWLEEHRQ  278

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R S +   E  DFMD MLS  E +   S       GYD D + K+TC+ ++   TDTT+
Sbjct  279   RRGSGNFGGE-KDFMDVMLSKLEESTDLS-------GYDADIVNKATCMNIISGGTDTTA  330

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL+LNN  VL+++Q+ELD HVGKER V+ESD+  L+YLQAV+KET+RLYPA P
Sbjct  331   VTLTWALSLLLNNKSVLQKVQEELDLHVGKERPVKESDISNLVYLQAVVKETLRLYPAGP  390

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA-KPDEFRPERFLTHHKDVDVR  400
             LS   E  EDC I  YH+ KGTRLITN  KI  DPK W+  P EF+P+RFLT HKDVDV+
Sbjct  391   LSGIREFSEDCTIGGYHVPKGTRLITNLWKIQTDPKTWSDDPLEFKPDRFLTTHKDVDVK  450

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G +FELIPFG+GRR CPG++  L++  L +A L+  FD+   ++ P+D+T   GLTN KA
Sbjct  451   GKHFELIPFGAGRRSCPGMTYGLQMTHLVIACLLQAFDV--FTDGPVDMTAIFGLTNAKA  508

Query  219   TPLQALLIPRLESNLY  172
             TPL+ L+ PRL  +LY
Sbjct  509   TPLEVLVKPRLSISLY  524



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 228/338 (67%), Gaps = 18/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G        E +  E  +FQ+A R  F L G  VV+D IP+L WLD+GGH K
Sbjct  196   NVILKMVVGKRYFGYAAESKEKEAQQFQKAIREFFRLMGLFVVSDAIPFLGWLDVGGHVK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++TA E++   + W+EEH+R++ S  +  ++ DFMD MLS+     ++         Y
Sbjct  256   AMKKTAKELDGITQEWLEEHRRRKDSGEADGDQ-DFMDVMLSILGGRDTTD--------Y  306

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L M+    DTTS TL WA+SL+LNN  +L + Q+ELD HVGKER V E D
Sbjct  307   DADTINKATSLVMIGGGADTTSGTLTWAVSLLLNNPHILRKAQEELDAHVGKERLVNEMD  366

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RL P  PLS P + ++D I+  YHI KGTRLI N  KI RDP+VW
Sbjct  367   ISKLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRVW  426

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P EF+P+RFLT HKDVDVRG +FEL PFG GRR+CPGI  AL+++ L LA+ +H F +
Sbjct  427   LNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGIVFALQVLHLTLANFLHRFQL  486

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLES-NLY  172
                S+ P+D++E  GLTN K+TPL+ L+ PRL S +LY
Sbjct  487   STPSDAPVDMSEGFGLTNIKSTPLEVLISPRLASYDLY  524



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 211/321 (66%), Gaps = 9/321 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             G D+  E  + +R  R  F L G  V++D  P+L WLD+GGHE+ M+ TA EM+     W
Sbjct  204   GGDDAEEARRCRRVMREFFHLAGLFVLSDAFPYLGWLDLGGHERRMKRTAEEMDELVGEW  263

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             + EH+RK  S   K +  DFMD MLS  +              YD D IIK+TC  ++  
Sbjct  264   LAEHRRKEYSGEGKAQ--DFMDVMLSEVKGANFECE-------YDVDTIIKATCGTLIAG  314

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
              TDTT+V  IWAL+L+LNN  VL++ Q ELDTHVGK+RRV ESDL  L+YLQA+ KET+R
Sbjct  315   GTDTTAVVFIWALALLLNNPHVLQKAQHELDTHVGKQRRVNESDLNNLVYLQAITKETLR  374

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYP  PL       +DC +  YHI K T LI N  K+HRDP+VW+ P EFRPERFL   K
Sbjct  375   LYPPGPLGGTRRLTQDCHVGGYHIPKETWLIVNLWKLHRDPRVWSDPSEFRPERFLNGEK  434

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
              +DV+G +FELIPF +GRR+CPG +  L+++ L LASL+  FD+ R+SNE ID++ES GL
Sbjct  435   SMDVKGQDFELIPFSAGRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGL  494

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN KATPL  L+ PRL  +LY
Sbjct  495   TNIKATPLDVLIAPRLPPSLY  515



>ref|XP_008343493.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=532

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 242/338 (72%), Gaps = 16/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGEDEV-VEESKFQRA---SRRLF----ELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++  M+ G+  +   +SK+ +    +R+ F     L G  V++D IP+LRWLD+GGHEK
Sbjct  202   NIIFRMIVGKSFLEATDSKYSQGRYLARKTFLEFLRLSGTFVISDSIPFLRWLDLGGHEK  261

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGG  826
             AM++ A  +E   + W+EEHK KRK       +  DFMD MLS+ +    ++        
Sbjct  262   AMKKIAKALEVVFKGWLEEHKHKRKILGGLISDELDFMDVMLSILDNNEVTT-------S  314

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I  +T L +LL   +TT+VT+ WAL+L++N+ E L+++Q+ELD +VGK+R+V+ES
Sbjct  315   YDADTINIATSLTLLLGGAETTTVTMSWALALLVNHPETLKKVQEELDENVGKDRQVKES  374

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D  +L++LQAVIKE+MRL+PA PL++PH + ++C++ +YH+  GTRL+ N  KIHRDPKV
Sbjct  375   DADKLVFLQAVIKESMRLHPAGPLAIPHLSTDECMVGDYHVPSGTRLLVNISKIHRDPKV  434

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W++P+EF+PERFLT HK +DV+G +FEL+PFGSGRRMCP ISLAL+I + ALASL+HGF+
Sbjct  435   WSEPNEFKPERFLTTHKGLDVKGRDFELLPFGSGRRMCPAISLALKITEFALASLLHGFE  494

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   +++PIDL+E+ GLTN  +  L+ LL PRL + LY
Sbjct  495   IETPTDDPIDLSETAGLTNNMSALLEVLLTPRLPAELY  532



>gb|KFK29810.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=370

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 229/341 (67%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + ++A  + F L G   V+D  P L W D+ GH
Sbjct  35    NMIVRMVAGKRYFGCGSVSSEDTDEARQCKKAIAKFFHLIGIFTVSDAFPTLTWFDLQGH  94

Query  1008  EKAMRETAMEMESFAERWMee-hkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             EK M+ T  E++   ERW+E   +++  S + +  ++DF+D MLSL E    S  Q    
Sbjct  95    EKKMKRTGSELDVILERWIENHKQQRNDSGTKENNDSDFIDVMLSLAEQGKLSHLQ----  150

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD D  IKSTCLA++L  +DTT+ TL WA++L+LNN E+L++ QDE+D  VG +R VE
Sbjct  151   --YDADTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVE  208

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL  P EA+E+C +  Y++ +G RLI N  KI RDP
Sbjct  209   DSDIENLVYLQAIIKETLRLYPAGPLLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDP  268

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFELIPFGSGRR CPG SLAL+++ L LA  +H
Sbjct  269   KVYMEPNEFRPERFITGEAKEFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLH  328

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ I + P+D++ES GLT  KATP + L+ PRLE  L+
Sbjct  329   SFEVKTILDLPVDMSESPGLTIPKATPFEVLISPRLEKQLF  369



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 216/317 (68%), Gaps = 9/317 (3%)
 Frame = -3

Query  1119  VEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehk  940
              E    Q+  R  F L G  ++ D +P+L W D+ G++K M+ TA E++S  +RW+EEH 
Sbjct  203   TEARTCQKGMRDFFRLLGLFIIEDALPYLSWFDLQGYKKEMKNTAKELDSVFQRWLEEHN  262

Query  939   rkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             R R++     E+ DFMD ++S+ E T  S         YD D IIKSTCL+++    DTT
Sbjct  263   RMRQTGELNREQ-DFMDVLMSILEDTRISE--------YDNDTIIKSTCLSIVTGGGDTT  313

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
              VTL W LSL+LNN   L++ QDELD+HVGK+R+VEESD+K L+YLQA+ KE +RLYPA 
Sbjct  314   MVTLTWILSLLLNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQAITKEALRLYPAG  373

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PLS P  A  DC +  YH+  GTRLI N  KI RDP VW++P EFRPERFLT H ++DV+
Sbjct  374   PLSGPRVADADCTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPERFLTSHVNMDVK  433

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G ++ELIPFG+GRR CPG+S  L++V L LA  +H FD +   + P+D+TE+ GLTN KA
Sbjct  434   GLHYELIPFGAGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVDMTETAGLTNAKA  493

Query  219   TPLQALLIPRLESNLYG  169
             TPL+ ++ PRL   +YG
Sbjct  494   TPLEVVITPRLHPEIYG  510



>ref|XP_008351399.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=526

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 226/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R  F+  G  +V D +P+LRWLD GGHEK
Sbjct  198   NVILTMVXGKRXSVAATXDEKKEARRVQTALREFFDYLGMFLVGDAVPYLRWLDWGGHEK  257

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A EM +    W+EEHK++R    +K E  DF+D +LS+ +            G +
Sbjct  258   AMKKSATEMHAIIAEWLEEHKQRRAKGDAKGE-KDFIDXLLSVLDGADJ--------GSF  308

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++    DTT V LIWA+SL++NN +VL++  +ELDT +GK+R V E D
Sbjct  309   DADTITKATSLNIIAGGGDTTMVPLIWAISLLVNNPQVLKKAVNELDTKIGKQRVVSEED  368

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA++KET+RLYP  PLS P    EDC I  YHI+KGTRLI NF KI  DPK W
Sbjct  369   ISNLVYIQAIVKETLRLYPVGPLSGPRLFTEDCTIAGYHIRKGTRLIPNFWKIQTDPKNW  428

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EF+PERFLT HKDVD++G +F+ +PF SGRR CPG++  L++VQ  LAS +H F++
Sbjct  429   PEPFEFKPERFLTTHKDVDLKGRHFQFLPFSSGRRSCPGLTFGLQLVQFTLASFLHAFEI  488

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ PID+TES G+TN KATPL  L+ PRL S LYG
Sbjct  489   SNPSSAPIDMTESFGITNVKATPLNVLIKPRLSSELYG  526



>ref|NP_001240972.1| cytochrome P450 82A3 [Glycine max]
 sp|O49858.1|C82A3_SOYBN RecName: Full=Cytochrome P450 82A3; AltName: Full=Cytochrome 
P450 CP6 [Glycine max]
 emb|CAA71876.1| putative cytochrome P450 [Glycine max]
 gb|KHN13273.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 220/337 (65%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+ G+        +   +  +F +  R    L G   VAD +P LRWLD+GGHEK
Sbjct  196   NMVVRMVVGKRYFGVMHVEGKDKAQRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+  A E++     W+EEH++K+    + E + DFMD M+S               G +
Sbjct  256   AMKANAKEVDKLLSEWLEEHRQKKLLGENVESDRDFMDVMISALNGAQI--------GAF  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++L  TD+T+VTL WALSL+L N   L + ++E+D  +GK+  + ESD
Sbjct  308   DADTICKATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYP  P S P E  E+CI+  YHI+KGTRLI N  KIHRDP VW
Sbjct  368   ISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HKDVD+RG+NFEL+PFGSGRR+C G+SL L +V   LA+L+H FD+
Sbjct  428   SDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFDI  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S EP+D+TE  G TN KATPL+ L+ PR   N Y
Sbjct  488   LNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPNYY  524



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 232/330 (70%), Gaps = 9/330 (3%)
 Frame = -3

Query  1158  NMLVSMLFGED-EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAM  982
             N+++ M+ G+    V+  +++    R FE+ G  VV+D +P++RWLDIGG E++M++ A 
Sbjct  202   NVVLRMVVGKGCNSVDSEEWKELLTRFFEMSGKFVVSDALPFMRWLDIGGDERSMKKIAK  261

Query  981   EMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIK  802
             E++  A+ W+EEHKRKR S+  K+EE DFM  MLS+   T           G D D I K
Sbjct  262   ELDVVAQGWLEEHKRKRDSQEIKKEE-DFMYVMLSILGDTEQYL-------GRDVDTINK  313

Query  801   STCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYL  622
             + CLA++L A DTT+VTL W +SL+LN+ ++L + Q+ELD  VG +R+V ESD+K L+YL
Sbjct  314   AICLALILGAADTTTVTLTWVMSLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYL  373

Query  621   QAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFR  442
             QA++KE MRLYPA PL VPHE++E+C +N YH+   T+L  N  KI RDP VW +P +F+
Sbjct  374   QAILKEAMRLYPAGPLLVPHESIEECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQ  433

Query  441   PERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEP  262
             PERFLT HKD+DV+G NFEL+PF SGRRMCPG+S AL+++Q  LASL+ GF+    SNEP
Sbjct  434   PERFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEP  493

Query  261   IDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +D+ E  GLT  K+ P + L+ PRL + +Y
Sbjct  494   VDMGEGLGLTMEKSQPFEVLVTPRLSAAVY  523



>ref|XP_008378426.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=523

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 208/313 (66%), Gaps = 12/313 (4%)
 Frame = -3

Query  1107  KFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkrkrk  928
             + Q   R +F   G  V+ D +PWLRWLDIGGHEKAMR TA E++S    W+EEHK++R 
Sbjct  223   RCQNVIRDMFHYIGLFVLGDAVPWLRWLDIGGHEKAMRRTAKELDSIVMEWLEEHKQRRT  282

Query  927   sksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTSVTL  748
                 +    DFMD MLS+               G+D D + K+TCLA++   +DT  VT+
Sbjct  283   QGQEQ----DFMDVMLSVLNGADVV--------GFDADTVNKATCLAVIAGGSDTPMVTM  330

Query  747   IWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVPLSV  568
              WALSL+LNN   L + Q+ELD HVG+ R V ESD+  L YLQA+ KET+R+YP  PLS 
Sbjct  331   TWALSLLLNNRHTLVKAQEELDKHVGRGRLVNESDISNLEYLQAIFKETLRMYPPAPLSG  390

Query  567   PHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRGNNF  388
               +  EDC I  YH+ K T L+ N  KIH DP+VW  P EF+PERFLT HKD+DV+G+NF
Sbjct  391   IRKFSEDCTIGGYHVPKDTWLMMNLWKIHSDPRVWVDPMEFKPERFLTTHKDIDVKGHNF  450

Query  387   ELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKATPLQ  208
             ELIPFG GRR+CPG+  AL+++QL LAS +H +D+    N  +D+T S GL+N K+TPL+
Sbjct  451   ELIPFGGGRRICPGMGFALQVIQLTLASFLHAYDISTPENAAVDMTGSLGLSNVKSTPLR  510

Query  207   ALLIPRLESNLYG  169
              L+ PRL  N+YG
Sbjct  511   VLVKPRLSENIYG  523



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 223/316 (71%), Gaps = 9/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRETAMEMESFAERWMeehk  940
             E  + ++A      L G  +V+D IP+L WLD + G+   M++ A E++    RW+EEH+
Sbjct  215   EPKRGKKALDDFMLLVGLFMVSDAIPFLGWLDTVKGYTTDMKKIAKELDYLLGRWVEEHR  274

Query  939   rkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             ++R S ++   E DF+  MLS+ +    S        G D D +IK+TCL ++LA  DTT
Sbjct  275   QQRLSANNNRAEVDFLHVMLSVIDDGQFS--------GRDPDTVIKATCLNLILAGYDTT  326

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             S+TL WALSL+LNN   L++ Q EL+ HVGK R+V+ SD+K L+YLQA++KET+RLYP  
Sbjct  327   SITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPG  386

Query  579   PLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             PLSVPHEAMEDC +  +HIQ GTRL+ N  K+HRDP+VW  P EF+PERFLT+H  +DVR
Sbjct  387   PLSVPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVR  446

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G N+EL+PFGSGRR+CPGIS ALE+  LALA L+HGF++  +++ P+D+TE  GL+  KA
Sbjct  447   GKNYELLPFGSGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKA  506

Query  219   TPLQALLIPRLESNLY  172
             TPL+  ++PRL   LY
Sbjct  507   TPLEVTIVPRLPFELY  522



>ref|XP_006431673.1| hypothetical protein CICLE_v10003405mg [Citrus clementina]
 gb|ESR44913.1| hypothetical protein CICLE_v10003405mg [Citrus clementina]
Length=370

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 234/320 (73%), Gaps = 12/320 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E ++ ++A R+L EL GA  +AD +P+LRWLD+ G EK+M+ TA E++   E W+EEHK+
Sbjct  57    ENNRCRKAIRKLMELTGAFAIADSVPFLRWLDLDGIEKSMKRTAKELDQILEGWLEEHKQ  116

Query  936   krksk--sskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDT  763
             K  S      ++E DFMD MLS        +    LP  +D D I K+TCLA++L  TDT
Sbjct  117   KSISSDDQVVKDENDFMDVMLSAL------ADAEELPS-FDADTITKATCLALILGGTDT  169

Query  762   TSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPA  583
             T+ TL WAL+L LN+ +VL+++Q+ELDTH+G+ER+V ESD+K L+YLQA++KET+RL PA
Sbjct  170   TTFTLTWALTLTLNHLDVLKKVQNELDTHIGRERQVIESDIKNLVYLQAIVKETLRLCPA  229

Query  582   VPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
              P+S+PHE+MEDC I  YH+  GTRL  N  KIHRDP +W +P+EFRPERFLT HKD+DV
Sbjct  230   APISIPHESMEDCTIAGYHVPAGTRLFVNIAKIHRDPNIWEEPNEFRPERFLTTHKDIDV  289

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRIS---NEPIDLTESCGLT  232
             RG NFELIPFGSGRR CPGIS AL+++ L LASL+HGF+         EP+DL+E  GLT
Sbjct  290   RGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFEFATPGPGDTEPLDLSEGVGLT  349

Query  231   NFKATPLQALLIPRLESNLY  172
             N KATPLQ LL PRL + L+
Sbjct  350   NLKATPLQVLLTPRLHAPLF  369



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   324 bits (830),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 228/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  K Q A R LF+  G  +V D +P+LRWLD GGHEK
Sbjct  203   NVILTMVAGKRYSVAAAGDEKKEARKVQTALRELFDYLGMFLVGDAVPYLRWLDWGGHEK  262

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A EM +    W+EEHK++R   ++K E+ DF+D MLS+ +            G +
Sbjct  263   AMKKSATEMHAIVAEWVEEHKQRRAKGNAKGEQ-DFIDAMLSVLDGADL--------GSF  313

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I+K+T L ++    DTT VTL WA+SL+LNN  V+++  +ELDT +G++R V E D
Sbjct  314   DADTIVKATSLNVIAGGGDTTMVTLTWAISLLLNNPHVMKKALNELDTKIGRQRVVSEED  373

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             L  L+Y+QA++KET+RLYP  PLS P    EDCII  Y I+KGTR + N  KI  DPK W
Sbjct  374   LSNLVYIQAIVKETLRLYPVGPLSGPRVFNEDCIIAGYPIRKGTRFLPNLWKIQIDPKFW  433

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P +F+PERFLT HKDVD++G +F+ IPFGSGRR CPG++  L++VQ  LAS +H F++
Sbjct  434   PEPLKFKPERFLTTHKDVDLKGQHFQFIPFGSGRRSCPGLAFGLQMVQFTLASFLHAFEI  493

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ P+D+TES G+TN KATPL  L+ PRL S LYG
Sbjct  494   SNPSSAPVDMTESFGMTNVKATPLNVLIKPRLSSELYG  531



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   323 bits (829),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 216/315 (69%), Gaps = 7/315 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  +F  A  R+ EL GA VV+D +P+LRW+D+GG+E+AMR TA EM+     W+ EH+ 
Sbjct  219   EARRFTGAMHRMMELLGAFVVSDVVPFLRWMDLGGYERAMRRTAAEMDGIIGGWLREHRE  278

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             +R     + +E DFMD MLS  E       +  L   +D D +IK+  LA+++  TDTTS
Sbjct  279   RRSEGRGEGKE-DFMDVMLSTIEK------EGELFSDHDPDTVIKANSLALIIGGTDTTS  331

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VT+ W L+L+LN+  VL + ++ELD+ VGKER V+ESD+++L+YLQA++KET+RLYP  P
Sbjct  332   VTMTWVLALLLNHPNVLRKAREELDSRVGKERNVDESDVEKLVYLQAIVKETLRLYPPGP  391

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             + +PH+AME+C +  + +  GTR++ N   I  DP+VW  P  FRPERFLT HKDVD+RG
Sbjct  392   VLIPHQAMEECQVRGFDVPAGTRVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRG  451

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FEL+PFGSGRR CPG S AL+++ L LA ++HGF MR     P+D+TE  G T  KAT
Sbjct  452   RHFELLPFGSGRRACPGASFALQVLHLTLARVIHGFHMRTPGGGPVDMTEGKGATLPKAT  511

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL   LY
Sbjct  512   PLHVLVAPRLSPELY  526



>ref|XP_007133366.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
 gb|ESW05360.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
Length=527

 Score =   323 bits (829),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 224/336 (67%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E ++  K QR   A      L G   V D +PWLRW D GGHEKA
Sbjct  193   NMVLRMVVGKRYFGGENLDNEKAQRCVKAVEEFMRLLGVFAVGDAVPWLRWFDFGGHEKA  252

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M+ETA E++S     +EEH++++      +E  DFM+ M+SL +         R   G D
Sbjct  253   MKETAKELDSIIGEELEEHRKRKGLGEKDDEAQDFMEVMISLLD--------GRTIDGID  304

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST LA++ A TDT +  L W +SL+L N  VLE+++DELDTH+GK++ V ESD+
Sbjct  305   ADTMIKSTVLAVIAAGTDTNNTVLTWTISLILRNPLVLEKVKDELDTHIGKQKCVNESDI  364

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L YLQA++KET+RLYP  PLS P E  E+C + +Y+I+KGTRLITN  KIH D  VW 
Sbjct  365   SKLTYLQAIVKETLRLYPPGPLSAPREFTENCTLRDYNIKKGTRLITNLWKIHTDSNVWE  424

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFLT HKD+DV+G++FEL+PFG GRR+CP +SL L++V   LA  +H F++ 
Sbjct  425   DPLEFKPERFLTTHKDIDVKGHHFELLPFGGGRRICPAVSLGLQMVHFTLARFLHSFEIL  484

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S +PID+TE+ GLTN KATPL  L+ PRL  + Y
Sbjct  485   SPSPDPIDMTETFGLTNTKATPLDILIKPRLSLSCY  520



>ref|XP_007151896.1| hypothetical protein PHAVU_004G085000g [Phaseolus vulgaris]
 gb|ESW23890.1| hypothetical protein PHAVU_004G085000g [Phaseolus vulgaris]
Length=524

 Score =   323 bits (828),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 221/326 (68%), Gaps = 12/326 (4%)
 Frame = -3

Query  1137  FGEDEVVEESKFQ---RASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FGE  VVEE + +    A +    L G   V D +PWLRW D GGHE+ M+E   E+++ 
Sbjct  204   FGETAVVEEGEARICLAAFKEYMRLLGVFAVGDAVPWLRWFDFGGHERDMKENFKELDAV  263

Query  966   AERWMeehkrkrksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCL  790
                W+EEHKRKR     K E+  DFM+ MLS  E   ++ H      G+D+D +IK+T +
Sbjct  264   VGEWLEEHKRKRNLNGEKGEKGEDFMEMMLS--EIDGTNIH------GFDSDTVIKATAM  315

Query  789   AMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVI  610
             A++L  TDT+S + IW LSL+LNN   LE++++E+D H+GK++ V ESD  +L+YL AV+
Sbjct  316   ALILGGTDTSSASNIWTLSLLLNNPRTLEKVKEEIDAHIGKDKLVTESDTNKLVYLHAVV  375

Query  609   KETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERF  430
             KE++RLYP  PLS P E  EDC +  YH++KGTRLITN  KI  DP +W +P EF+PERF
Sbjct  376   KESLRLYPPSPLSGPREFREDCKLGEYHVKKGTRLITNLWKIQTDPSIWPEPLEFKPERF  435

Query  429   LTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLT  250
             LT HKDVDV+G +FELIPFGSGRR+CPGI+  L    L LA+ +H FD+ + S EPID+T
Sbjct  436   LTTHKDVDVKGKHFELIPFGSGRRICPGITFGLRSSYLTLANFLHCFDVSKTSTEPIDMT  495

Query  249   ESCGLTNFKATPLQALLIPRLESNLY  172
              +  +TN K TPLQ L+ PRL  +LY
Sbjct  496   AAMEMTNVKVTPLQVLIKPRLAPSLY  521



>ref|NP_194923.1| cytochrome P450, family 82, subfamily C, polypeptide 3 [Arabidopsis 
thaliana]
 sp|O49396.3|C82C3_ARATH RecName: Full=Cytochrome P450 82C3 [Arabidopsis thaliana]
 emb|CAA16594.2| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79913.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAN13076.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE85982.1| cytochrome P450, family 82, subfamily C, polypeptide 3 [Arabidopsis 
thaliana]
Length=512

 Score =   323 bits (827),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 237/343 (69%), Gaps = 18/343 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFGE----------DEVVEESK-FQRASRRLFELFGAAVVADFIPWLRWLDI  1018
             + NM++ M+ G+           E  EE++ +++   + F L G   V+D  P L WLD+
Sbjct  175   IANMIMRMVAGKRYFGGGGAESSEHTEEARQWRKGIAKFFHLVGIFTVSDAFPKLGWLDL  234

Query  1017  GGHEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSR  838
              GHEK M++T  E++   ERW+E H+++RK   +K  ++DF+D MLSL E    S  Q  
Sbjct  235   QGHEKEMKQTRRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKLSHLQ--  292

Query  837   LPGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERR  658
                 YD +  IK+TCLA++L  ++T+  TL WA+SL+LNN ++L+++QDE+D HVG++R 
Sbjct  293   ----YDANTCIKTTCLALILGGSETSPSTLTWAISLLLNNKDMLKKVQDEIDIHVGRDRN  348

Query  657   VEESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHR  478
             VE+SD+K L+YLQA+IKET+RLYPA PL    EAMEDC +  Y++  GTRLI N  KI R
Sbjct  349   VEDSDIKNLVYLQAIIKETLRLYPAAPLLGHREAMEDCTVAGYNVPCGTRLIVNVWKIQR  408

Query  477   DPKVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASL  301
             DPKV+ +P+EFRPERF+T   KD DVRG NFEL+PFGSGRR CPG SLA++++ L LA  
Sbjct  409   DPKVYMEPNEFRPERFITGEAKDFDVRGQNFELMPFGSGRRSCPGPSLAMQMLHLGLARF  468

Query  300   VHGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +H F+++ + + P+D++ES GLT  KATPL+ L+ PRL+  L+
Sbjct  469   LHSFEVKTVLDRPVDMSESPGLTITKATPLEVLINPRLKRELF  511



>gb|AII31760.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 220/320 (69%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  +++ A R  F L G  V+ D +P+LRWLD GG+EK M++TA  ++  +  W+
Sbjct  211   EEDQKEVLRYRTALRDFFHLTGMFVLGDAVPFLRWLDFGGYEKKMKKTAKALDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++      +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKGGHWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   VL++ Q+ELDTH+G++R V E+D+ +L+Y+QA++KET+R+
Sbjct  322   SDTTTVTLIWGLSLMLNKPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRM  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +DV+G +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    SN  IDLT + GLT
Sbjct  442   IDVKGQHFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTDGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPLQAL+ PRL   LY
Sbjct  502   NIKSTPLQALVSPRLAPELY  521



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 217/319 (68%), Gaps = 10/319 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A  + F L G  VVAD +P+L WLD+ GHEKAM++TA E++     W+EEH++
Sbjct  216   EARRCQKAIGQFFHLIGIFVVADALPFLWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQ  275

Query  936   krksksske----eEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAAT  769
             +R +   K      + DF+D MLSL E    S+ Q      Y +D  IKSTCLA++L  +
Sbjct  276   RRGASHGKAEDEGGDEDFIDVMLSLEEEGQLSNFQ------YSSDTSIKSTCLALILGGS  329

Query  768   DTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLY  589
             DTT+ TL WA+SL++NN   +++ Q+ELD HVG ER+VEESD+  L+YLQA+IKET+RLY
Sbjct  330   DTTAGTLTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLY  389

Query  588   PAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDV  409
             PA PL  P EA+EDC +  Y +  GTRL+ N  KI RDP+VW  P  F PERFL  H  V
Sbjct  390   PAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERFLESHSHV  449

Query  408   DVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTN  229
             DVRG  F L+PFG GRR CPG+S A++++ L LA L+HGF +   S + IDLTES GLT 
Sbjct  450   DVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPGLTI  509

Query  228   FKATPLQALLIPRLESNLY  172
              KATPL+ALL PRL S LY
Sbjct  510   PKATPLEALLSPRLPSELY  528



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 228/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N++  M+ G         E++  +  + + A +  FEL G  V +D +P+ RWLDIGG+ 
Sbjct  199   NLIFKMVVGKQYDGTTASEEDEGQNDRCRIALKSFFELGGQFVASDVLPFFRWLDIGGYV  258

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+ TA E++     W++EHKRKR    ++ +  DFMD MLS+  T         LP  
Sbjct  259   KAMKRTAKELDDVVGGWLDEHKRKRACGEAEGDR-DFMDVMLSILGTA------DVLPS-  310

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I K+TCLA++   TDTT+VTL WALSL+LNN  VL++ Q ELD+ +G+ERRV ES
Sbjct  311   YDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKQAQQELDSQIGRERRVTES  370

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K  +Y+QA+IKET+RLYPA PLSVPHE+++DC I +Y +  GTRL+ N  K+H +P V
Sbjct  371   DIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTIGSYRVPAGTRLLLNISKLHWNPLV  430

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EFRPERFLT HKD+ V G NFE +PFGSGRRMCPG+S AL+++ + LA+L+H F+
Sbjct  431   WPAPLEFRPERFLTTHKDLGVWGQNFEYLPFGSGRRMCPGVSFALQVLHIVLATLLHSFE  490

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   S  P D+    G+T+ K TPL+ +L PRL  +LY
Sbjct  491   IETASVGPADMRAGMGITSPKVTPLEVVLTPRLPPHLY  528



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 218/321 (68%), Gaps = 10/321 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E +  E  + Q++ R  F L G  VV+D +P+L WLD+GGH KA ++TA EM+  A+ W+
Sbjct  213   ESQEKETQRCQKSIREFFRLLGLFVVSDALPFLGWLDVGGHLKATKKTAKEMDGIAQEWL  272

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             EEH+R++ S  +   + D MD MLS+   T         P GYD D I K+T L ++   
Sbjct  273   EEHRRRKDSGEASGNQ-DLMDVMLSILAGTD--------PTGYDADTINKATSLILIAGG  323

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTTSVTL W +SL+LNN  +L + Q+ELDTHVGK R V E DL +L+YLQA++KET+RL
Sbjct  324   SDTTSVTLTWVISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRL  383

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA+PLS P +  +D I+  Y I  GTRL+ N  KI RDP VW  P EF+PERFLT HKD
Sbjct  384   YPALPLSGPRQFNQDSILGGYRIPNGTRLVLNLTKIQRDPSVWLNPTEFQPERFLTTHKD  443

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VD+RG NFE  PFG GRR+CPG + AL+++ L LA+ +H F +   SN  +D++ES G+T
Sbjct  444   VDMRGKNFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSNATVDMSESLGIT  503

Query  231   NFKATPLQALLIPRLES-NLY  172
             N K+TPL+ L+ PRL S +LY
Sbjct  504   NIKSTPLEVLISPRLSSCDLY  524



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 222/322 (69%), Gaps = 8/322 (2%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             G  +  E  ++Q+A  + F L G  VV+D +P+LRWLD+ GHEKAM++TA ++++    W
Sbjct  207   GSSDDDEARQYQKAISQFFHLMGIFVVSDALPFLRWLDLEGHEKAMKKTAKDLDAVLAGW  266

Query  954   MeehkrkrksksskeeE-ADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLL  778
             ++EH+R+R S   K E   DF+D MLSL E    S  Q      YD D  IKSTCLA++ 
Sbjct  267   LDEHRRRRVSGEVKSEGDQDFIDVMLSLEEKGHLSGFQ------YDADTSIKSTCLALIA  320

Query  777   AATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETM  598
              A+DTT+ TL+WA+SL+LNN   L+  ++EL+ H+G ER+V+ESDLK L+YLQAVIKET+
Sbjct  321   GASDTTTTTLVWAISLLLNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQAVIKETL  380

Query  597   RLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHH  418
             RLYP  PL +P E +EDC +  YH+  GTRL+ N  KI RDP +W K   F+PERFLT H
Sbjct  381   RLYPVAPL-IPREFVEDCRVGGYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPERFLTSH  439

Query  417   KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCG  238
              D+DVRG++FEL+PFGSGRR CPG S AL  + L LA  +H FD+    ++P+D+TE  G
Sbjct  440   ADIDVRGHHFELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTERSG  499

Query  237   LTNFKATPLQALLIPRLESNLY  172
              T  KATPL+ LL PRL + LY
Sbjct  500   TTLPKATPLEVLLSPRLPAKLY  521



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/341 (49%), Positives = 224/341 (66%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE---------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N++V M+ G+         D+  E  + Q+A  + F L G  VV+D +P+L WLD+ GHE
Sbjct  183   NVVVRMVAGKRYFGASAKCDDGDEARRCQKAIGQFFHLIGIFVVSDALPFLWWLDLQGHE  242

Query  1005  KAMRETAMEMESFAERWM---eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRL  835
             KAM++TA ++++    W+    + +     K   E + DF+D MLSL E    S+ Q   
Sbjct  243   KAMKKTAKDLDAILGGWLDEHRQRRVLSHEKGKTEADEDFIDVMLSLQEEGQLSNFQ---  299

Query  834   PGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRV  655
                + +D  IKSTCLA++L  +DTT+ TL WA+SL+LNN  V+++ Q+EL+  VG ER+V
Sbjct  300   ---HSSDTSIKSTCLAIILGGSDTTAGTLTWAISLLLNNPHVMKKAQEELELQVGTERQV  356

Query  654   EESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRD  475
             +ESD+K L+YLQA+IKET+RLYPA PL  P EA+EDC +  YH+  GTRL+ N  KI RD
Sbjct  357   DESDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYHVPAGTRLVVNVWKIQRD  416

Query  474   PKVWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             P VW  P  F PERFLT H  VDVRG  FEL+PFGSGRR CPG+S A++++ L LA L+H
Sbjct  417   PSVWENPSAFEPERFLTSHGHVDVRGQQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLH  476

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+      + ID+TES GLT  KATPL+ LL PRL  NLY
Sbjct  477   AFEFETPLGQRIDMTESPGLTIPKATPLEVLLTPRLPGNLY  517



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 236/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+           ++  E  + ++A  + F L G   V+D  P L + D+ G
Sbjct  189   NMIVRMVAGKRYFGGGGSVSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPTLSFFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW+E H+++RK   +KE ++DF+D M+SL E    S  Q    
Sbjct  249   HEKEMKQTGSELDVILERWIENHRQQRKFSGTKENDSDFIDVMMSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCLA++L  +DT++ TL WA+SL+LNN E+L++ QDE+D HVG++R VE
Sbjct  305   --YDANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              FD++ + + P+D++E+ GLT  KATPL+ L+ PR++  L+
Sbjct  483   SFDVKTVMDMPVDMSENPGLTIPKATPLEVLISPRIKEELF  523



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 233/342 (68%), Gaps = 19/342 (6%)
 Frame = -3

Query  1158  NMLVSMLFGE------------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIG  1015
             NM+V M+ G+            ++  E  + + A  + F L G   V+D  P LRW D  
Sbjct  191   NMIVRMVAGKRYFGGVVGSESSEDTEEGRQCKTAISKFFHLIGIFTVSDAFPSLRWFDFQ  250

Query  1014  GHEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRL  835
             GHEK M++T  E++   E+W++ H+++RK   ++E ++DF+  MLSL E    S  Q   
Sbjct  251   GHEKEMKQTGSELDVILEKWIDNHRQERKVSGTEEIDSDFIHVMLSLAEQGKLSHLQ---  307

Query  834   PGGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRV  655
                YD +  IKSTCLA++L  ++TTS TL WA++L+LNN E+L++ QDE+D HVG++R V
Sbjct  308   ---YDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNV  364

Query  654   EESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRD  475
             E SD+  L+YLQAV+KET+RLYPA PL  P EAMEDC +  Y++ +GTRLI N  KI RD
Sbjct  365   EVSDINNLVYLQAVVKETLRLYPAGPLLGPREAMEDCTVAGYNVTRGTRLIVNVWKIQRD  424

Query  474   PKVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLV  298
             PKV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +
Sbjct  425   PKVYKEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFL  484

Query  297   HGFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             H F+++ + + P+D+TES GLT  KATPL+ L+ PRL  +L+
Sbjct  485   HSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLNEHLF  526



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 228/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG---------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHE  1006
             N++  M+ G         E++  +  + + A +  FEL G  V +D +P+ RWLDIGG+ 
Sbjct  194   NLIFKMVVGKQYDGTTASEEDEGQNDRCRIALKSFFELGGQFVASDVLPFFRWLDIGGYV  253

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+ TA E++     W++EHKRKR    ++ +  DFMD MLS+  T         LP  
Sbjct  254   KAMKRTAKELDDVVGGWLDEHKRKRACGEAEGDR-DFMDVMLSILGTA------DVLPS-  305

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
             YD D I K+TCLA++   TDTT+VTL WALSL+LNN  VL++ Q ELD+ +G+ERRV ES
Sbjct  306   YDADTINKATCLALISGGTDTTAVTLTWALSLLLNNRHVLKQAQQELDSQIGRERRVTES  365

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+K  +Y+QA+IKET+RLYPA PLSVPHE+++DC I +Y +  GTRL+ N  K+H +P V
Sbjct  366   DIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTIGSYRVPAGTRLLLNISKLHWNPLV  425

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EFRPERFLT HKD+ V G NFE +PFGSGRRMCPG+S AL+++ + LA+L+H F+
Sbjct  426   WPAPLEFRPERFLTTHKDLGVWGQNFEYLPFGSGRRMCPGVSFALQVLHIVLATLLHSFE  485

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             +   S  P D+    G+T+ K TPL+ +L PRL  +LY
Sbjct  486   IETASVGPADMRAGMGITSPKVTPLEVVLTPRLPPHLY  523



>gb|KHN16362.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 219/337 (65%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+ G+        +   +  +F +  R    L G   VAD +P LRWLD+GG+EK
Sbjct  196   NMVVRMVVGKRYFGVMHVEGKDKAERFMKNIREFMNLMGTFTVADGVPCLRWLDLGGYEK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+ TA E++     W+EEH +K+      E + DFMD M+S    +           G+
Sbjct  256   AMKGTAKEIDKLLSEWLEEHLQKKLLGEKVESDRDFMDVMISALNGSQID--------GF  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++L  TDTT+VTL WALSL+L N   L + ++E+D  +GK+  + ESD
Sbjct  308   DADTICKATTLELILGGTDTTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYP  P S P E  E+CI+  YHI+KGTRLI N  KIHRDP VW
Sbjct  368   ISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P +F+PERFLT HK VD+RG+NFEL+PFGSGRR+C G+SL L +V   LA+L+H FD+
Sbjct  428   SNPLDFKPERFLTTHKHVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFDI  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S EPID+TE  G TN KATPL+ L+ PR   N Y
Sbjct  488   LNPSAEPIDMTEFFGFTNTKATPLEILVKPRQSPNYY  524



>ref|XP_003554074.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=527

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 219/337 (65%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             NM+V M+ G+        +   +  +F +  R    L G   VAD +P LRWLD+GG+EK
Sbjct  196   NMVVRMVVGKRYFGVMHVEGKDKAERFMKNIREFMNLMGTFTVADGVPCLRWLDLGGYEK  255

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+ TA E++     W+EEH +K+      E + DFMD M+S    +           G+
Sbjct  256   AMKGTAKEIDKLLSEWLEEHLQKKLLGEKVESDRDFMDVMISALNGSQID--------GF  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++L  TDTT+VTL WALSL+L N   L + ++E+D  +GK+  + ESD
Sbjct  308   DADTICKATTLELILGGTDTTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYP  P S P E  E+CI+  YHI+KGTRLI N  KIHRDP VW
Sbjct  368   ISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P +F+PERFLT HK VD+RG+NFEL+PFGSGRR+C G+SL L +V   LA+L+H FD+
Sbjct  428   SNPLDFKPERFLTTHKHVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFDI  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S EPID+TE  G TN KATPL+ L+ PR   N Y
Sbjct  488   LNPSAEPIDMTEFFGFTNTKATPLEILVKPRQSPNYY  524



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 233/341 (68%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+           ++  E  + ++A  + F L G   V+D  P L W D+ G
Sbjct  189   NMIVRMVAGKRYFGGGGSQSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPRLGWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW+E H+++R+   +KE ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGSELDVILERWIENHRQQRQVSGTKENDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCLA++L  +DT++ TL WA+SL+LNN E+L++ QDE+D HVG ++ VE
Sbjct  305   --YDANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDLHVGTDKNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL  P EAMEDC +  Y++  GTRLI N  KI RDP
Sbjct  363   DSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPCGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYTEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+ + + + P+D++ES GLT  KATPL+ L+ PRL   L+
Sbjct  483   SFEAKTVLDLPVDMSESPGLTIPKATPLEVLISPRLNEELF  523



>ref|XP_007151145.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
 gb|ESW23139.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
Length=530

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 222/336 (66%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQRASRRLFE---LFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E +E+ K QR  R + E   LFG   V D +PWLRW D GGHEKA
Sbjct  196   NMVLRMVVGKRHFGGENLEDEKAQRYVRAVEEFMRLFGVFTVGDAVPWLRWFDFGGHEKA  255

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M+ETA E++S     +EEH++++      +E  DFMD M+SLF+ T           G D
Sbjct  256   MKETAKELDSIIGEELEEHRKRKGLGEKVDEAQDFMDVMISLFDGTTIE--------GID  307

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST LA+++   DT +  L W +SL+L N  VLE ++DELDTH+GKE+ V E D+
Sbjct  308   ADTMIKSTLLAVIVGGIDTNNTILTWTISLILRNPLVLENVKDELDTHIGKEKCVNEYDI  367

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L YLQA++KET+RLYP  PL  P E  E+C +  Y+I+KGTRLI N  KIH D  VW 
Sbjct  368   SKLTYLQAIVKETLRLYPPTPLFGPREFTENCTLRGYNIKKGTRLIPNLWKIHTDSNVWE  427

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFLT  KD+DV+G++FEL+PFG GRR+CP +S  L++V   LA  +H F++ 
Sbjct  428   DPLEFKPERFLTTRKDIDVKGHHFELLPFGGGRRICPAVSFGLQMVHFTLARFLHSFEIL  487

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S +PID++E+CGLTN KATPL  L+ PRL  + Y
Sbjct  488   SSSPDPIDMSETCGLTNTKATPLDILIKPRLSLSCY  523



>ref|XP_003516592.1| PREDICTED: cytochrome P450 82A3-like isoform X1 [Glycine max]
Length=530

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 226/326 (69%), Gaps = 13/326 (4%)
 Frame = -3

Query  1134  GEDEVVEESK-FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAER  958
             G+D    E++ ++R  R    LFG  V +D  P+L WLDI G+EK M+ TA E+++  E 
Sbjct  211   GDDHAEGEARRYRRVMRDWVCLFGVFVWSDSFPFLGWLDINGYEKDMKRTASELDTLVEG  270

Query  957   WMeehkrkrksksskeeEA---DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             W+EEHKRK+K   S   +    DFMD ML++ + T  S        GYD+D IIK+TCL 
Sbjct  271   WLEEHKRKKKRGLSVNGKEEQDDFMDVMLNVLQGTEIS--------GYDSDTIIKATCLN  322

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             ++LA TD T VTL WALSL+LN+   L+R Q EL T +GK R+V+ESD+K+L+YLQAV+K
Sbjct  323   LILAGTDPTMVTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVK  382

Query  606   ETMRLYPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERF  430
             ET+RLYP  P+     AMEDC  +  YHI  GT+L+ N  KIHRD +VW+ P++F+PERF
Sbjct  383   ETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERF  442

Query  429   LTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLT  250
             LT HKDVDV+G N+EL+PF SGRR CPG SLAL +V L LA L+H F++   SN+ +D+T
Sbjct  443   LTSHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMT  502

Query  249   ESCGLTNFKATPLQALLIPRLESNLY  172
             ES GLTN KATPL+ LL PR ++  Y
Sbjct  503   ESFGLTNLKATPLEVLLTPRQDTKFY  528



>ref|XP_007226806.1| hypothetical protein PRUPE_ppa017795mg, partial [Prunus persica]
 gb|EMJ28005.1| hypothetical protein PRUPE_ppa017795mg, partial [Prunus persica]
Length=440

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 208/315 (66%), Gaps = 12/315 (4%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A R  F L G  V+ D +PWL WLD+GG +KAM+ TA E++S    W+EEHK+
Sbjct  137   EARRRQKAMREFFHLVGLFVLGDAVPWLSWLDLGGQQKAMKRTAEELDSIVSEWLEEHKQ  196

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR     +    DFMD MLS  +    +        G+D D IIK+TCLAM+   +DTT 
Sbjct  197   KRTKGKDQ----DFMDVMLSAIDGADIA--------GFDADTIIKATCLAMISGGSDTTR  244

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V L W LSL+LNN ++L+++ +ELD HVGK R++ ESD+  L+YLQA +KE MRL P  P
Sbjct  245   VALTWTLSLLLNNRQILKKVYEELDQHVGKGRQLNESDINNLVYLQATVKEAMRLCPPGP  304

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS   E  EDC +  YH+ KGT L+ N  KI  DP+VWA P EF+PERFLT HKDVDVRG
Sbjct  305   LSFQREFTEDCTVGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHKDVDVRG  364

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
               FEL+PFGSGRR CPGI+L L+   L LAS +H FD+    N P+D+T S GLTN K +
Sbjct  365   QQFELMPFGSGRRACPGINLGLQTTLLTLASFLHWFDVTTRGNAPVDMTGSAGLTNMKLS  424

Query  216   PLQALLIPRLESNLY  172
             PL  L+ PRL  NLY
Sbjct  425   PLDVLVKPRLSPNLY  439



>gb|KHN36187.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   322 bits (824),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 226/326 (69%), Gaps = 13/326 (4%)
 Frame = -3

Query  1134  GEDEVVEESK-FQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAER  958
             G+D    E++ ++R  R    LFG  V +D  P+L WLDI G+EK M+ TA E+++  E 
Sbjct  211   GDDHAEGEARRYRRVMRDWVCLFGVFVWSDSFPFLGWLDINGYEKDMKRTASELDTLVEG  270

Query  957   WMeehkrkrksksskeeEA---DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLA  787
             W+EEHKRK+K   S   +    DFMD ML++ + T  S        GYD+D IIK+TCL 
Sbjct  271   WLEEHKRKKKRGLSVNGKEEQDDFMDVMLNVLQGTEIS--------GYDSDTIIKATCLN  322

Query  786   MLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIK  607
             ++LA TD T VTL WALSL+LN+   L+R Q EL T +GK R+V+ESD+K+L+YLQAV+K
Sbjct  323   LILAGTDPTMVTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVK  382

Query  606   ETMRLYPAVPLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERF  430
             ET+RLYP  P+     AMEDC  +  YHI  GT+L+ N  KIHRD +VW+ P++F+PERF
Sbjct  383   ETLRLYPPSPIITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERF  442

Query  429   LTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLT  250
             LT HKDVDV+G N+EL+PF SGRR CPG SLAL +V L LA L+H F++   SN+ +D+T
Sbjct  443   LTSHKDVDVKGQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMT  502

Query  249   ESCGLTNFKATPLQALLIPRLESNLY  172
             ES GLTN KATPL+ LL PR ++  Y
Sbjct  503   ESFGLTNLKATPLEVLLTPRQDTKFY  528



>gb|KHG01290.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 221/320 (69%), Gaps = 9/320 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E++  E  +++ A R  F L G  V+ D +P+LRWLD GG+EK M++TA E++  +  W+
Sbjct  211   EEDQKEVLRYRTALRDFFHLTGMFVLGDAVPFLRWLDFGGYEKKMKKTAKELDEISGGWL  270

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             ++H++      +K+E  DFMD M S+ +  + +        GYD D I K+T L M+LA 
Sbjct  271   DDHRKGGHWDENKKE-KDFMDVMNSVLKGASLA--------GYDADTINKATSLNMILAG  321

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTT+VTLIW LSL+LN   VL++ Q+ELDTH+G++R V E+D+ +L+Y+QA++KET+R+
Sbjct  322   SDTTTVTLIWGLSLMLNKPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRM  381

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLS P E  E C I  Y I KGTRLI N  KI RDPK W +P EF+PERFLT HKD
Sbjct  382   YPPAPLSAPRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHKD  441

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +DV+G +FEL+PFGSGRR CPG S AL ++ L +++ +H FD    S+  IDLT + GLT
Sbjct  442   IDVKGQHFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSDGLIDLTGTDGLT  501

Query  231   NFKATPLQALLIPRLESNLY  172
             N K+TPL+AL+ PRL   LY
Sbjct  502   NIKSTPLEALVSPRLAPELY  521



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 224/338 (66%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R LF+  G  +V D +P+LRWLD GGHEK
Sbjct  198   NVILTMVAGKRYSVAAAGDEKKEARRVQTALRELFDYLGMFLVGDAVPYLRWLDWGGHEK  257

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++ A EM +    W+EEHK++R    +K E+ DF+D +LS+ +            G +
Sbjct  258   AMKKGATEMHAIIAEWVEEHKQRRAKGDAKGEQ-DFIDALLSVLDGADL--------GSF  308

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I ++T L ++    DTT VTL WALSL+LNN  V+++  +ELDT +GK+R V E D
Sbjct  309   DADTITRATSLNVIAGGGDTTMVTLTWALSLLLNNPHVMKKALNELDTKIGKQRVVSEED  368

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA++KET+RLYP  PLS P    EDC I  YHI+KGTR I NF KI  DPK W
Sbjct  369   ISNLVYIQAIVKETLRLYPVGPLSGPRIFTEDCTIAGYHIRKGTRFIPNFWKIQTDPKNW  428

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EF+PERFLT HKDVD++G +F+ IPF SGRR CPG++  L++VQ  LAS +H F++
Sbjct  429   PEPFEFKPERFLTTHKDVDLKGQHFQFIPFSSGRRSCPGLAFGLQMVQFTLASFLHAFEI  488

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ PID+TES G+TN KA PL  L+ PRL S LYG
Sbjct  489   SNPSSAPIDMTESFGMTNVKAAPLNVLIKPRLSSELYG  526



>ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=526

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 223/339 (66%), Gaps = 18/339 (5%)
 Frame = -3

Query  1164  VTNMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             + NM++ M+ G+        DE  E  K  +A      L G   V D IP+LRWLD GG+
Sbjct  195   IFNMVLRMVVGKRFLSATATDEKAE--KCVKAVDEFMRLAGVFTVGDAIPYLRWLDFGGY  252

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             EKAM+ETA E++     W+EEH++KR      +   DFM+ MLS        S   +   
Sbjct  253   EKAMKETAKELDVMISEWLEEHRQKRALGEGVDGAQDFMNVMLS--------SLDGKTID  304

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
             G D D +IKST L ++ A T+ +  T+IWA+ L+L N  +LE+I+ ELD  VGK+R + E
Sbjct  305   GIDADTLIKSTVLTIIQAGTEASITTIIWAMCLILKNPLILEKIKAELDIQVGKDRCICE  364

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD+  L+YLQAV+KET RLY   PLS P E  EDC +  YH++KGTRLITN  KIH DP 
Sbjct  365   SDISNLVYLQAVVKETFRLYAPGPLSSPREFAEDCTLGGYHVKKGTRLITNIWKIHTDPN  424

Query  468   VWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
             VW+ P EF+P+RFLT HKD+DV+G++F+L+PFGSGRR+CPGIS  L+ V LALAS +H F
Sbjct  425   VWSDPFEFKPDRFLTTHKDIDVKGHHFQLLPFGSGRRVCPGISFGLQTVHLALASFLHSF  484

Query  288   DMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++   S EP+D+TE+ G+TN KATPL+ L+ PRL  + Y
Sbjct  485   EILNPSTEPLDMTEAFGVTNTKATPLEVLVKPRLSPSCY  523



>ref|XP_003554118.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=548

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 225/337 (67%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+       +++ K QR   A +    L G   VAD IP+LRW D GG+EKA
Sbjct  219   NMVLRMVVGKRLFGARTMDDEKAQRCVEAVKEFMRLMGVFTVADAIPFLRWFDFGGYEKA  278

Query  999   MRETAMEMESFAERWMeehkrkrksksske-eEADFMDTMLSLFETTASSSHQSRLPGGY  823
             M+ETA +++     W+EEHK+ R    +      DF+D MLSLF+    + H      G 
Sbjct  279   MKETAKDLDEIFGEWLEEHKQNRAFGENNVDGIQDFVDAMLSLFD--GKTIH------GI  330

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D IIKS  L ++   T++ + TL WA+ L+L N  VLE++  ELD  VGKER + ESD
Sbjct  331   DADTIIKSNLLTVISGGTESITNTLTWAVCLILRNPIVLEKVIAELDFQVGKERCITESD  390

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L YLQAV+KET+RLYP+VPLS P E +EDC +  Y+++KGTRLITN  KIH D  VW
Sbjct  391   ISKLTYLQAVVKETLRLYPSVPLSSPREFIEDCTLGGYNVKKGTRLITNIWKIHTDLSVW  450

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HKD+DVRG++FEL+PFG GRR+CPGIS +L++V L LASL H F  
Sbjct  451   SNPLEFKPERFLTTHKDIDVRGHHFELLPFGGGRRVCPGISFSLQMVHLILASLFHSFSF  510

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                SNEPID+TE+ GL   KATPL+ L+ PRL SN Y
Sbjct  511   LNPSNEPIDMTETVGLGKTKATPLEILIKPRLSSNCY  547



>ref|XP_008391540.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=531

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/337 (49%), Positives = 225/337 (67%), Gaps = 17/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R  F+  G  +V D +P+LRWLD GGHEK
Sbjct  203   NVILTMVTGKRYSVAATADEKKEARRVQTALREFFDYLGMFLVGDAVPYLRWLDWGGHEK  262

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A EM +    W+EEHK++R    +K E+ DF+D +LS+ +            G +
Sbjct  263   AMKKSATEMHAIIAEWLEEHKQRRAKGDAKGEK-DFIDALLSVLDGADL--------GSF  313

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++    DTT V LIWA+SL++NN +VL++  +ELDT +GK+R V E D
Sbjct  314   DADTITKATSLNIIAGGGDTTMVPLIWAISLLVNNPQVLKKAVNELDTKIGKQRVVSEED  373

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA++KET+RLYP  PLS P    EDC I  YHI+KGTRLI NF KI  DPK W
Sbjct  374   ISNLVYIQAIVKETLRLYPVGPLSGPRLFTEDCTIAGYHIRKGTRLIPNFWKIQTDPKNW  433

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EF+PERFLT HKDVD++G +F+ +PF SGRR CPG+   L++VQ  LAS +H F++
Sbjct  434   PEPFEFKPERFLTTHKDVDLKGRHFQFLPFSSGRRSCPGLXFGLQLVQFTLASFLHAFEI  493

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S+ PID+TES G+TN KATPL  L+ PRL S LY
Sbjct  494   SNPSSAPIDMTESFGITNVKATPLNVLIKPRLSSELY  530



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 235/341 (69%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+            +  E  + ++A  + F L G   V+D  P L W D+ G
Sbjct  189   NMVVRMVAGKRYFGGAGSESSKDTEEARQCKKAIAKFFHLIGIFTVSDAFPTLGWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T +E++   ERW+E H+++RK    KE ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGIELDVILERWVENHRQQRKVSGPKENDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCLA++L  ++TTS TL WA++L+LNN E+L++ QDE+D HVG ER VE
Sbjct  305   --YDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGTERNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+Y+QA+IKET+RLYPA PL  P EAMEDC +  +++ +GTRLI N  KI RDP
Sbjct  363   DSDIENLVYVQAIIKETLRLYPAGPLLGPREAMEDCTVAGHNVSRGTRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             +V+ +P+EFRPERF+T   K  DVRG NFEL+PFGSGRR CPG SLA++++ L LA ++ 
Sbjct  423   RVYMEPNEFRPERFVTGEAKKFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARILQ  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              FD++ +S+  +D++ES GLT  KATPL+ L+ PRL+ +L+
Sbjct  483   SFDVKTVSDMAVDMSESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 228/338 (67%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R LF+  G  ++ D +P+LRWLD GGHEK
Sbjct  203   NVILTMVAGKRYSVAAAGDEKKEARRVQTALRELFDYLGMFLLGDAVPYLRWLDWGGHEK  262

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A EM +    W+EEHK++R   ++K E+ DF+D MLS+ +            G +
Sbjct  263   AMKKSATEMHAIVAEWVEEHKQRRAKGNAKGEQ-DFIDAMLSVLDGADL--------GSF  313

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I+K+T L ++    DTT VTL WA+SL+LNN  V+++  +ELDT +G++R V E D
Sbjct  314   DADTIVKATSLNVIAGGGDTTMVTLTWAISLLLNNPHVMKKALNELDTKIGRQRVVSEED  373

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             L  L+Y+QA++KET+RLYP  PLS P    EDCII  Y I+KGTR + N  KI  DPK W
Sbjct  374   LSNLVYIQAIVKETLRLYPVGPLSGPRVFNEDCIIAGYPIRKGTRFLPNLWKIQIDPKFW  433

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P +F+PERFLT HKDVD++G +F+ IPFGSGRR CPG++  L++VQ  LAS +H F++
Sbjct  434   PEPLKFKPERFLTTHKDVDLKGQHFQFIPFGSGRRSCPGLAFGLQMVQFTLASFLHAFEI  493

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ P+D+TES G+TN KATPL  L+ PRL S LYG
Sbjct  494   SNPSSAPVDMTESFGMTNVKATPLNVLIKPRLSSELYG  531



>ref|XP_010026987.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=454

 Score =   318 bits (816),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 203/315 (64%), Gaps = 8/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             ++ + Q+A R  F  FG  + AD  P+LRW D+GGHEKAM+ TA E++     W+E+HKR
Sbjct  148   KKQQCQKALREFFHFFGLVLPADVFPFLRWFDLGGHEKAMKRTAEELDEIMGGWLEDHKR  207

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
               K         DFMD MLS+              GGYD D +IK+TCLAM+   +DT  
Sbjct  208   DNKDLGETNSSGDFMDVMLSVLNDDEV--------GGYDADTVIKATCLAMIAGGSDTAM  259

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA+S +LNN  +L++ Q ELD  +GK R+V+E D+  L YLQA++KET+RL+PA P
Sbjct  260   VTLTWAISQLLNNLHILKKAQKELDAQIGKHRQVKEGDIASLTYLQAIVKETLRLHPAAP  319

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS P    EDC +  YH+ KGT LI N  K+  DP+ W  P EFRPERFL+ HKD+DV+ 
Sbjct  320   LSGPRLFTEDCTVGEYHVSKGTWLILNIWKVQTDPRTWPDPLEFRPERFLSSHKDIDVKD  379

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
             +NF L+PFG GRR+CPGIS  LE+V   LA  +H F++  + + P+D++E  G T  KAT
Sbjct  380   SNFALLPFGGGRRICPGISFGLEMVHFLLARFLHAFEISTVDDSPVDMSEIFGPTILKAT  439

Query  216   PLQALLIPRLESNLY  172
             PL+ +L PRL   LY
Sbjct  440   PLEIMLKPRLTQELY  454



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 219/321 (68%), Gaps = 10/321 (3%)
 Frame = -3

Query  1125  EVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMee  946
             +V E    Q+  +  F+L G  V  D IP+L WLD+GG EKAM++TA  ++     W+EE
Sbjct  222   DVKEARLVQKEIKEFFKLLGLFVPGDAIPYLGWLDLGGCEKAMKKTAKALDGIVGEWLEE  281

Query  945   hkrkrkskss--keeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             HK+ R   ++  K+E+ DFMD MLS+        H S   GG+D D IIK+T L M+   
Sbjct  282   HKQNRAEMNNDEKKEQDDFMDVMLSVL-------HGSDF-GGFDADTIIKATILNMIAGG  333

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DT   TL WA+SL+LNN+ VL++ Q+EL+ +VGK R V ESD+ +L Y+ A++KET+RL
Sbjct  334   SDTIPATLTWAVSLLLNNHHVLKKAQEELENNVGKNRVVSESDIGKLTYIFAIVKETLRL  393

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YP  PLSVPH  ++DC I  YH+ KGTRLITN  KI  +P +W  P EF+PERFLT +KD
Sbjct  394   YPVAPLSVPHVFLKDCTIGGYHVAKGTRLITNIWKIQTNPILWPDPFEFKPERFLTTNKD  453

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             VD+RG +FELIPFGSGRR CPG S AL++VQ  LAS +  FD+    N P+D+TES GLT
Sbjct  454   VDIRGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNAPVDMTESFGLT  513

Query  231   NFKATPLQALLIPRLESNLYG  169
             N KATPL+ L+ PRL + LY 
Sbjct  514   NTKATPLEVLITPRLPAELYA  534



>ref|XP_006573616.1| PREDICTED: cytochrome P450 82A3-like isoform X3 [Glycine max]
Length=530

 Score =   321 bits (822),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 224/316 (71%), Gaps = 9/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  ++++  R    LFG  V++D IP+L W+D  G++KAM++TA E+++    W+EEHKR
Sbjct  221   EARRYKKTMRDFMRLFGVFVLSDAIPFLGWIDNNGYKKAMKKTASEIDTLVAGWLEEHKR  280

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR + ++ +EE D M  ML++ +    S        GYD+D IIK+TCL ++LA TD T 
Sbjct  281   KRATSTNGKEEQDVMGVMLNVLQDLKVS--------GYDSDTIIKATCLNLILAGTDPTM  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WALSL+LN+   L+R Q EL T +GK R+V+ESD+K+L+YLQAV+KET+RLYP  P
Sbjct  333   VTLTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSP  392

Query  576   LSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             +     AMEDC  +  YHI  GT+L+ N  KIHRD +VW+ P++F+PERFLT HKDVDV+
Sbjct  393   IITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHKDVDVK  452

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G N+EL+PF SGRR CPG SLAL +V L LA L+H F++   SN+ +D+TES GLTN KA
Sbjct  453   GQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKA  512

Query  219   TPLQALLIPRLESNLY  172
             TPL+ LL PR ++  Y
Sbjct  513   TPLEVLLTPRQDTKFY  528



>gb|KHN04536.1| Cytochrome P450 82A1, partial [Glycine soja]
Length=490

 Score =   319 bits (818),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 223/335 (67%), Gaps = 15/335 (4%)
 Frame = -3

Query  1158  NMLVSMLFG-------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             N+++ M+ G       ED++ +  + +R  R  F L G  VV D IP+L WLD+GG  K 
Sbjct  158   NVILRMISGKRYSAKSEDDLQQVRRIRRVFREFFRLTGLFVVGDAIPFLGWLDLGGEVKE  217

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M++TA+EM++    W+EEHK++       + E DF+D +L + +    +        GYD
Sbjct  218   MKKTAIEMDNIVSEWLEEHKQQITDSGDTKTEQDFIDVLLFVLKGVDLA--------GYD  269

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IK+TC  ++  ATDTT+VT+ WALSL+LNN+  L++++DELD HVGKER V ESD+
Sbjct  270   FDTVIKATCTMLIAGATDTTAVTMTWALSLLLNNHHALKKVKDELDEHVGKERLVNESDI  329

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L+YLQAV+KET+RLYPA P S P E  E+C +  Y I+ GTR + N  K+HRDP+VW+
Sbjct  330   NKLVYLQAVVKETLRLYPAGPFSGPREFTENCTLGGYKIEAGTRFMLNIWKLHRDPRVWS  389

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFL  HK+VDV+G +FEL+PFG GRR CPGIS  L++  LALAS +  F++ 
Sbjct  390   NPLEFQPERFLNTHKNVDVKGQHFELLPFGGGRRSCPGISFGLQMSHLALASFLQAFEIT  449

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNL  175
               SN  +D++ + GLTN K TPL+ L+ P L   L
Sbjct  450   TPSNAQVDMSATFGLTNMKTTPLEVLVRPVLSHQL  484



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 221/327 (68%), Gaps = 15/327 (5%)
 Frame = -3

Query  1137  FGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAER  958
             F E+EV    K ++A      L G  VV+D +P+L WLD+ GHE+AM+ TA +++   E 
Sbjct  213   FSEEEV---QKCKKAITEFMHLVGIFVVSDALPFLGWLDLQGHERAMKRTAKQLDHMLES  269

Query  957   WMeehkrkrksksskeeE--ADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAM  784
             W++EH+ K+++          DFMD +LS+ +      HQ     GY TD ++K+TCL +
Sbjct  270   WLKEHRCKKRASEGIATADERDFMDVLLSILD-----DHQCI---GYGTDTVVKATCLGL  321

Query  783   LLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKE  604
             +L  +DTTSVTL WALSL+LNN + L++ QDELDT VG++  VEESD++ L+YLQA++KE
Sbjct  322   ILGGSDTTSVTLTWALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKE  381

Query  603   TMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLT  424
             T+RLYPA  +S P EAMEDC +  +HI  GT+L+ N  K+ RDP +W  P EF PERFLT
Sbjct  382   TLRLYPAAAVSAPREAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLT  441

Query  423   HH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR-ISNEPIDLT  250
              H  D+DVRG +FEL+PFGSGRR CPGIS A++++ L LA L+ GFD+     +  +D+T
Sbjct  442   SHAADIDVRGQHFELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMT  501

Query  249   ESCGLTNFKATPLQALLIPRLESNLYG  169
             +  GLTN K TPL  LL PRL   LYG
Sbjct  502   QGIGLTNHKKTPLDVLLTPRLHPLLYG  528



>ref|XP_007151143.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
 gb|ESW23137.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
Length=520

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 222/338 (66%), Gaps = 19/338 (6%)
 Frame = -3

Query  1164  VTNMLVSMLFGE----DEVVEESKFQRASR---RLFELFGAAVVADFIPWLRWLDIGGHE  1006
             + NM++ M+ G+       V++ K QR  R    L  L G   V D +PWLR  D+GG+E
Sbjct  192   IFNMVLQMITGKRYFSAATVDDEKAQRCVRTVEELMRLMGVFTVGDAVPWLRRFDLGGNE  251

Query  1005  KAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGG  826
             KAM+E A E++      + E   + + +    E  DF+D M+SLF+ T +         G
Sbjct  252   KAMKEIAKELDII----LGEELEEHRKRKGLGEAKDFIDVMISLFDGTITD--------G  299

Query  825   YDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEES  646
              D D +IKST L ++   TDT+SV L+WA+ L+L N  VLE++Q ELD H+GKE+ V ES
Sbjct  300   VDADTVIKSTILTLIAGGTDTSSVVLVWAMCLILGNPLVLEKVQAELDIHIGKEKCVSES  359

Query  645   DLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKV  466
             D+ +L YLQA++KET+RLYP  PL+ P E  E+C +  Y+I+KGTRLITN  KIH D  V
Sbjct  360   DMSKLTYLQAIVKETLRLYPPGPLATPREFTENCTLGGYNIKKGTRLITNLWKIHTDKNV  419

Query  465   WAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFD  286
             W  P EF+PERFLT +KD+DV+G++FELIPFG GRRMCPGIS  LE+VQ +LAS++H F+
Sbjct  420   WEDPLEFKPERFLTTYKDLDVKGHHFELIPFGGGRRMCPGISFGLEVVQFSLASILHSFE  479

Query  285   MRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                 S +PID+TE+ GL N KATPL+ L+ P L  + Y
Sbjct  480   FLSSSPDPIDMTENFGLANTKATPLEILIKPHLSFSCY  517



>ref|XP_010026403.1| PREDICTED: cytochrome P450 82C4-like [Eucalyptus grandis]
Length=470

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 219/316 (69%), Gaps = 9/316 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + QR+ R+ F+LFG   ++D I  L WLD+GG++++M ETA E++  A+ W+EEH+R
Sbjct  159   EARRCQRSIRKFFDLFGVVTLSDAISSLGWLDLGGYKRSMNETAKELDVLAQGWLEEHRR  218

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S    + E DFMD ML++ E    S         +D D +IK+TCL +++A TDT  
Sbjct  219   KRLSCPGGDREQDFMDLMLNVIEGVKCSD--------FDADTVIKATCLNIIIAGTDTLI  270

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             V + WALSL++NN   LE+ Q ELD HVGK R VEESD+K LIYLQA++KET+RLYP VP
Sbjct  271   VAITWALSLLMNNPHALEKAQQELDAHVGKRRHVEESDVKNLIYLQAIVKETLRLYPPVP  330

Query  576   LSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVR  400
             ++    +ME+C  +  + I  GTRL+ N  KI RD +VW+ PD F PERFLT H+ VDVR
Sbjct  331   VNGLKSSMEECTFSVGFRIPAGTRLLLNAWKIQRDERVWSDPDRFEPERFLTTHEKVDVR  390

Query  399   GNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKA  220
             G NFELIPFG+GRR C G SLAL  + L LASL+  F++  +S EP+D+TES GL N KA
Sbjct  391   GQNFELIPFGAGRRSCAGTSLALHTMHLTLASLLQSFEIDTVSGEPVDMTESPGLLNLKA  450

Query  219   TPLQALLIPRLESNLY  172
             +PL+ +L+PRL+  +Y
Sbjct  451   SPLEVVLVPRLDQKVY  466



>emb|CBI32505.3| unnamed protein product [Vitis vinifera]
Length=1019

 Score =   332 bits (851),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRET  988
             V N+++  + G+     ES++ +A      L G  +V+D +P+L WLD + G+   M+ T
Sbjct  693   VANLVMRTVAGKRCGNGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGT  752

Query  987   AMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQI  808
             A +++    RW+EEH++KR S S  E E DF+  MLS+ +    S H       +D D +
Sbjct  753   ARQLDQVIGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQFSGHD------HDHDTV  806

Query  807   IKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELI  628
             IK+TCL ++LA+ DT ++TL WALSL++NN   L++ Q+ELD HVG+ ++V ESD+K+L+
Sbjct  807   IKATCLTVMLASNDTIAITLTWALSLLMNNPHALKKAQEELDFHVGRNQQVYESDIKKLV  866

Query  627   YLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDE  448
             YLQA+IKET+RLYPA PL++PHEAMEDC I  +HIQ GTRL+ N  K+HRDP +W+ P E
Sbjct  867   YLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLE  926

Query  447   FRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISN  268
             F+PERFLT H  +DVRG +FEL+PFGSGRRMCPGIS ALEI+QL LA L+HGF++  +++
Sbjct  927   FQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISFALEILQLTLARLLHGFELGVVAD  986

Query  267   EPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              P+D+TE  GL   KATPL+  L+PRL S LY
Sbjct  987   SPLDMTEGVGLALPKATPLEVTLVPRLPSELY  1018



>gb|KHN34164.1| Cytochrome P450 82A4 [Glycine soja]
Length=525

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/337 (50%), Positives = 223/337 (66%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+       +++ K QR   A +    L G   VAD IP+LRW D GG+EKA
Sbjct  196   NMVLRMVVGKRLFGARTMDDEKAQRCVEAVKEFMRLMGVFTVADAIPFLRWFDFGGYEKA  255

Query  999   MRETAMEMESFAERWMeehkrkrksksske-eEADFMDTMLSLFETTASSSHQSRLPGGY  823
             M+ETA +++     W+EEHK+ R    +      DFMD MLSLF+         +   G 
Sbjct  256   MKETAKDLDEIFGEWLEEHKQNRAFGENNVDGIQDFMDVMLSLFD--------GKTIYGI  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D IIKS  L ++   T++ + TL WA+ L+L N  VLE++  ELD  VGKER + ESD
Sbjct  308   DADTIIKSNLLTIISGGTESITNTLTWAVCLILRNPIVLEKVIAELDFQVGKERCITESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L YLQAV+KET+RLYP+VPLS P E +EDC +  Y+++KGTRLITN  KIH D  VW
Sbjct  368   ISKLTYLQAVVKETLRLYPSVPLSSPREFIEDCTLGGYNVKKGTRLITNIWKIHTDLSVW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HKD+DVRG++FEL+PFG GRR CPGIS +L++V L LASL H F  
Sbjct  428   SNPLEFKPERFLTTHKDIDVRGHHFELLPFGGGRRGCPGISFSLQMVHLILASLFHSFSF  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                SNEPID+TE+ GL   KATPL+ L+ PRL S+ Y
Sbjct  488   LNPSNEPIDMTETFGLAKTKATPLEILIKPRLSSSCY  524



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   333 bits (853),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 232/338 (69%), Gaps = 18/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFG--------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G        E +  E  + Q+A R  F L G  VV+D +P+L WLD+GGH K
Sbjct  724   NVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLGLFVVSDALPFLGWLDVGGHVK  783

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM++TA E++  A+ W+EEH+R++ S  +  ++ DFMD MLS+   T         P GY
Sbjct  784   AMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQ-DFMDVMLSILGATD--------PNGY  834

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++   TDTTSVTL WA+SL+LNN  VL + Q+ELDTHVGKER V E D
Sbjct  835   DADTINKATSLILIAGGTDTTSVTLTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEMD  894

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYPA PLS   + ++D ++  YHI KGTRL+ N  KI RDP+VW
Sbjct  895   ISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRVW  954

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
               P +F+P RFLT +KDVDV+G +F L PFG GRR+CPG + AL+++ L LA+ +H F +
Sbjct  955   LNPTKFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQL  1014

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLES-NLY  172
                SN PID++ES G+TN K+TPL+ L+ PRL S NLY
Sbjct  1015  STPSNSPIDMSESFGITNIKSTPLEVLISPRLASYNLY  1052


 Score =   324 bits (831),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/344 (49%), Positives = 228/344 (66%), Gaps = 18/344 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N+++ M+ G+         E  +  + +R  R  F L G  VVAD IP+L WLD G HEK
Sbjct  197   NVILRMVAGKRYFSASDASENKQAQRCRRVFREFFHLSGLFVVADAIPFLGWLDWGRHEK  256

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
              +++TA+EM+S A+ W+EEH+R++ S      + DFMD M S+ +         +  GGY
Sbjct  257   TLKKTAIEMDSIAQEWLEEHRRRKDSGDDNSTQ-DFMDVMQSVLD--------GKNLGGY  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+TCL ++   +DTT V+L WALSLVLNN + L++ Q+ELD  VGKER V E D
Sbjct  308   DADTINKATCLTLISGGSDTTVVSLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNEQD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQA++KET+RLYP  PL    +  EDC +  YH+ KGTRLI N  KI +DP++W
Sbjct  368   ISKLVYLQAIVKETLRLYPPGPLGGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPRIW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HKDVD RG +FE IPFG+GRR CPGI+  L+++ L LAS +H F+ 
Sbjct  428   SDPTEFQPERFLTTHKDVDPRGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFEF  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLES-NLYG*TKTF  154
                SNE +++ ES GLTN K+TPL+ L+ PRL S +LY  T  F
Sbjct  488   STPSNEQVNMRESLGLTNMKSTPLEVLISPRLSSCSLYNSTMDF  531



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 216/319 (68%), Gaps = 10/319 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E  + Q+A  + F L G  VVAD +P+L WLD+ GHEKAM++TA E++     W+EEH++
Sbjct  216   EARRCQKAIGQFFHLIGIFVVADALPFLWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQ  275

Query  936   krksksske----eEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAAT  769
             +R +   +      + DF+D MLSL E    S+ Q      Y +D  IKSTCLA++L  +
Sbjct  276   RRGASHGEAEDEGGDEDFIDVMLSLEEEGQLSNFQ------YSSDTSIKSTCLALILGGS  329

Query  768   DTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLY  589
             DTT+ TL WA+SL+LNN + ++  Q+ELD HVG ER+VEESD+  L+YLQA+IKET+RLY
Sbjct  330   DTTAGTLTWAISLLLNNPDAMKMAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLY  389

Query  588   PAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDV  409
             PA PL  P EA+EDC +  Y +  GTRL+ N  KI RDP+VW  P  F PERFL  H  V
Sbjct  390   PAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWENPSAFVPERFLESHSHV  449

Query  408   DVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTN  229
             DVRG  F L+PFG GRR CPG+S A++++ L LA L+HGF +   S + +DLTES GLT 
Sbjct  450   DVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTI  509

Query  228   FKATPLQALLIPRLESNLY  172
              KATPL+ LL PRL S LY
Sbjct  510   PKATPLEVLLSPRLPSELY  528



>ref|XP_003523886.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=526

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 223/335 (67%), Gaps = 15/335 (4%)
 Frame = -3

Query  1158  NMLVSMLFG-------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             N+++ M+ G       ED++ +  + +R  R  F L G  VV D IP+L WLD+GG  K 
Sbjct  194   NVILRMISGKRYSAKSEDDLQQVRRIRRVFREFFRLTGLFVVGDAIPFLGWLDLGGEVKE  253

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M++TA+EM++    W+EEHK++       + E DF+D +L + +    +        GYD
Sbjct  254   MKKTAIEMDNIVSEWLEEHKQQITDSGDTKTEQDFIDVLLFVLKGVDLA--------GYD  305

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IK+TC  ++  ATDTT+VT+ WALSL+LNN+  L++++DELD HVGKER V ESD+
Sbjct  306   FDTVIKATCTMLIAGATDTTAVTMTWALSLLLNNHHALKKVKDELDEHVGKERLVNESDI  365

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L+YLQAV+KET+RLYPA P S P E  E+C +  Y I+ GTR + N  K+HRDP+VW+
Sbjct  366   NKLVYLQAVVKETLRLYPAGPFSGPREFTENCTLGGYKIEAGTRFMLNIWKLHRDPRVWS  425

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFL  HK+VDV+G +FEL+PFG GRR CPGIS  L++  LALAS +  F++ 
Sbjct  426   NPLEFQPERFLNTHKNVDVKGQHFELLPFGGGRRSCPGISFGLQMSHLALASFLQAFEIT  485

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNL  175
               SN  +D++ + GLTN K TPL+ L+ P L   L
Sbjct  486   TPSNAQVDMSATFGLTNMKTTPLEVLVRPVLSHQL  520



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 219/332 (66%), Gaps = 9/332 (3%)
 Frame = -3

Query  1164  VTNMLVSMLFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETA  985
             V     S+    DE  E  + Q A R LF+  G  ++ D +P+LRWLD GGHEKAM+++A
Sbjct  204   VAGKRYSVAAAGDEKKEARRVQTALRELFDYLGMFLLGDAVPYLRWLDWGGHEKAMKKSA  263

Query  984   MEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQII  805
              EM++    W+EEHK++R    +K ++ D MD +LS  +            GG+D D I 
Sbjct  264   TEMDAIIAEWVEEHKQRRAKGDAKGKQ-DLMDALLSALDGEDL--------GGFDADTIT  314

Query  804   KSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIY  625
             K+T +A++    DTT V + WA+SL+LNN  V+++  +ELDT +GK+R V E D+  L+Y
Sbjct  315   KATSVAIIAGGGDTTMVAVTWAISLLLNNPHVMKKALNELDTKIGKQRVVSEEDITNLVY  374

Query  624   LQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEF  445
             +QA++KET+RLYP  PL+ P    EDC I  YHI KGTR I NF KI  DPK W +P EF
Sbjct  375   IQAIVKETLRLYPGGPLAGPRIFTEDCTIAGYHIPKGTRFIPNFWKIQTDPKYWPEPFEF  434

Query  444   RPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNE  265
             +PERFLT HKDVD++G++F+ IPF SGRR CPG++  L++VQ  LAS +H F++   S+ 
Sbjct  435   KPERFLTTHKDVDLKGHHFQFIPFSSGRRSCPGLAFGLQVVQFTLASFLHAFEISNPSSA  494

Query  264   PIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
             PID+TES G+TN KA PL  L+ PRL S LYG
Sbjct  495   PIDMTESFGMTNVKAAPLNVLIKPRLSSELYG  526



>ref|XP_007151149.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
 gb|ESW23143.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
Length=544

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 223/336 (66%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E +++ K +R   A      L G   V D +PWLRW D GGHEKA
Sbjct  210   NMVLRMVVGKRYFGGENLQDEKTKRCVKAVEEFMRLLGVFTVGDAVPWLRWFDFGGHEKA  269

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M+ETA E++S     +EEH++++      +E  DFMD M+SL + T           G D
Sbjct  270   MKETAKELDSIIGEELEEHRKRKGLGEKVDEAQDFMDVMISLLDGTTID--------GID  321

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST L ++   TDT++  LIW +SL+L N  VLE++++ELD H+GKE+ V E D+
Sbjct  322   ADTMIKSTLLTVIAGGTDTSNTVLIWTISLILRNPLVLEKVKEELDIHIGKEKCVREYDI  381

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L YLQA++KET+RLYP VPLSVP E +++C +  Y+I KGTRLITN  KIH D  VW 
Sbjct  382   SKLTYLQAIVKETLRLYPPVPLSVPREFIKNCTLQGYNINKGTRLITNLWKIHTDGNVWE  441

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFLT HKD+D++G++FEL+PFG GRRMCPG+S  L++V   LAS +H F++ 
Sbjct  442   DPLEFKPERFLTTHKDIDIKGHHFELLPFGGGRRMCPGVSFGLQMVHFILASFLHSFEIL  501

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S   ID+TE+ GLTN KATPL  L+ PRL  + Y
Sbjct  502   SSSPYTIDMTETFGLTNTKATPLDILIKPRLFLSCY  537



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 230/341 (67%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM+V M+ G+          ++  E  + ++A  + F L G   V+D  P L W D+ GH
Sbjct  189   NMIVRMVAGKRYFGCGSVSSEDTDEARQCKKAIAKFFHLIGIFTVSDAFPTLTWFDLQGH  248

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeE-ADFMDTMLSLFETTASSSHQSRLP  832
             EK M+ T  E++   ERW+E HK++R    +KE   +DF+D MLSL E    S  Q    
Sbjct  249   EKKMKRTGSELDVILERWIENHKQQRNDSGTKENNDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD D  IKSTCLA++L  +DTT+ TL WA++L+LNN E+L++ QDE+D  VG +R VE
Sbjct  305   --YDADTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL  P EA+E+C +  Y++ +G RLI N  KI RDP
Sbjct  363   DSDIENLVYLQAIIKETLRLYPAGPLLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +P+EFRPERF+T   K+ DVRG NFELIPFGSGRR CPG SLAL+++ L LA  +H
Sbjct  423   KVYMEPNEFRPERFITGEAKEFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ I + P+D++ES GLT  KATP + L+ PRLE  L+
Sbjct  483   SFEVKTILDLPVDMSESPGLTIPKATPFEVLISPRLEKQLF  523



>gb|KCW60845.1| hypothetical protein EUGRSUZ_H03582 [Eucalyptus grandis]
Length=520

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 203/315 (64%), Gaps = 8/315 (3%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             ++ + Q+A R  F  FG  + AD  P+LRW D+GGHEKAM+ TA E++     W+E+HKR
Sbjct  214   KKQQCQKALREFFHFFGLVLPADVFPFLRWFDLGGHEKAMKRTAEELDEIMGGWLEDHKR  273

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
               K         DFMD MLS+              GGYD D +IK+TCLAM+   +DT  
Sbjct  274   DNKDLGETNSSGDFMDVMLSVLNDDEV--------GGYDADTVIKATCLAMIAGGSDTAM  325

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA+S +LNN  +L++ Q ELD  +GK R+V+E D+  L YLQA++KET+RL+PA P
Sbjct  326   VTLTWAISQLLNNLHILKKAQKELDAQIGKHRQVKEGDIASLTYLQAIVKETLRLHPAAP  385

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             LS P    EDC +  YH+ KGT LI N  K+  DP+ W  P EFRPERFL+ HKD+DV+ 
Sbjct  386   LSGPRLFTEDCTVGEYHVSKGTWLILNIWKVQTDPRTWPDPLEFRPERFLSSHKDIDVKD  445

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
             +NF L+PFG GRR+CPGIS  LE+V   LA  +H F++  + + P+D++E  G T  KAT
Sbjct  446   SNFALLPFGGGRRICPGISFGLEMVHFLLARFLHAFEISTVDDSPVDMSEIFGPTILKAT  505

Query  216   PLQALLIPRLESNLY  172
             PL+ +L PRL   LY
Sbjct  506   PLEIMLKPRLTQELY  520



>ref|XP_003619137.1| Cytochrome P450 [Medicago truncatula]
 gb|AES75355.1| cytochrome P450 family protein [Medicago truncatula]
Length=521

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 218/327 (67%), Gaps = 13/327 (4%)
 Frame = -3

Query  1137  FGEDEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FGE  +V+E +  R   A R    L G   +AD +P+LRW D GGHEK M++   E++  
Sbjct  203   FGESVMVKEEEANRCLNALRDYMRLTGVFPIADAVPFLRWFDFGGHEKNMKQNFKELDGV  262

Query  966   AERWMeehkrkrksksskeeEA-DFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCL  790
                W++EHK+K+     K +E  DFMD MLS  + T           G+ +D +IK+T +
Sbjct  263   ITEWLDEHKKKKSEGVDKSKEGQDFMDVMLSTIDGTNIH--------GFHSDTVIKATTM  314

Query  789   AMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERR-VEESDLKELIYLQAV  613
             A++L ATDT+SVT  WAL L+LNN   LE++++E+D H+GKER  + ESD+ +L+YLQAV
Sbjct  315   ALVLGATDTSSVTHTWALCLLLNNPHTLEKVKEEIDLHIGKERLCILESDINKLVYLQAV  374

Query  612   IKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPER  433
             +KET+RLYPA PLS   E  EDC I  Y ++KGTRL TN  KI  DP VW  P EF+PER
Sbjct  375   VKETLRLYPASPLSGIREFREDCQIGGYDVKKGTRLFTNLWKIQTDPSVWPDPLEFKPER  434

Query  432   FLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDL  253
             FLT HKDVDVRGN+FEL+PFGSGRRMCPGIS AL    L LA+ +H F++ + SNEPID+
Sbjct  435   FLTTHKDVDVRGNHFELLPFGSGRRMCPGISFALRSAYLTLANFLHSFEVSKTSNEPIDM  494

Query  252   TESCGLTNFKATPLQALLIPRLESNLY  172
             T     TN K TPL+ L+ PRL  N Y
Sbjct  495   TAVVETTNIKVTPLEVLIKPRLSPNYY  521



>ref|XP_010070481.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59276.1| hypothetical protein EUGRSUZ_H01952 [Eucalyptus grandis]
Length=525

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 221/317 (70%), Gaps = 9/317 (3%)
 Frame = -3

Query  1119  VEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehk  940
              E  + +R+ RR F LFG  V++D IP L WLD+GG+E++M+ETA E++  A+ W+EEH+
Sbjct  213   AEADRCKRSIRRFFHLFGVLVLSDAIPALSWLDLGGYERSMKETAKELDVLAQGWLEEHR  272

Query  939   rkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTT  760
             RKR S    + E DFMD M++  E    S         +D D  IK+TCL M++  TDT 
Sbjct  273   RKRLSCPEGDREQDFMDLMINALEGRNFSD--------FDEDTDIKATCLNMIIGGTDTL  324

Query  759   SVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAV  580
             +V + WALSL++NN   L++ Q ELDTHVGK R VEESD+K L YLQA++KE MRLYP  
Sbjct  325   TVAMTWALSLLMNNRAALKKAQQELDTHVGKSRPVEESDVKNLTYLQAIVKEAMRLYPPA  384

Query  579   PLSVPHEAMEDCIIN-NYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDV  403
             P+S    +ME+C ++  + +  GTRL+ N  KI RD ++W+ PDEF+PERFLT H++VD+
Sbjct  385   PISGLRRSMEECTLSTGFRVPAGTRLMLNVSKIQRDGRIWSNPDEFQPERFLTTHENVDL  444

Query  402   RGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFK  223
             RG NFE IPF +GRR C GISLAL+ V L LASL+  F++  +S+E +D+TES GL N K
Sbjct  445   RGQNFEFIPFSAGRRSCAGISLALQTVHLTLASLLQSFEISTVSDEAVDMTESPGLLNEK  504

Query  222   ATPLQALLIPRLESNLY  172
             A+PL+ +LIPRL+  +Y
Sbjct  505   ASPLEVMLIPRLDQKVY  521



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 218/321 (68%), Gaps = 10/321 (3%)
 Frame = -3

Query  1131  EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWM  952
             E +  E  + Q++ R  F L G  VV+D +P+L WLD+GGH KA ++TA EM+  A+ W+
Sbjct  213   ESQEKETQRCQKSIREFFRLLGLFVVSDALPFLGWLDVGGHLKATKKTAKEMDGIAQEWL  272

Query  951   eehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAA  772
             EEH++++ S  +   + D MD MLS+   T         P GYD D I K+T L ++   
Sbjct  273   EEHRQRKDSGEANGNQ-DLMDVMLSILAGTD--------PTGYDADTINKATSLILIAGG  323

Query  771   TDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRL  592
             +DTTSVTL WA+SL+LNN  +L + Q+ELDTHVGK R V E DL +L+YLQA++KET+RL
Sbjct  324   SDTTSVTLTWAISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRL  383

Query  591   YPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKD  412
             YPA PLS P +  +D I+  Y I KGTRL+ N  KI RDP +W  P EF+PERFLT HKD
Sbjct  384   YPAFPLSGPRQFNQDSILGGYRIPKGTRLVLNLTKIQRDPSIWLNPTEFQPERFLTTHKD  443

Query  411   VDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLT  232
             +D+R  NFE  PFG GRR+CPG + AL+++ L LA+ +H F +   S+  +D++ES G+T
Sbjct  444   IDMRVKNFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSDATVDMSESLGIT  503

Query  231   NFKATPLQALLIPRLES-NLY  172
             N K+TPL+ L+ PRL S +LY
Sbjct  504   NIKSTPLEVLISPRLSSCDLY  524



>ref|XP_008388075.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=531

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 224/338 (66%), Gaps = 17/338 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R LF+  G  +V D +P+LRWLD GGHEK
Sbjct  203   NVILTMVAGKRFSVAAAGDEKKEARRVQTALRELFDYLGMFLVGDAVPYLRWLDWGGHEK  262

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A EM +    W+ EHK++R    +K E+ DF+D +LS+              G +
Sbjct  263   AMKKSATEMHAIIAEWVVEHKQRRAKGDAKGEQ-DFIDALLSVLNGADL--------GSF  313

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I ++T LA++    DTT+V + WA+SL+LNN  V+++  +ELDT +G++R V + D
Sbjct  314   DADTITQATSLAIIAGGADTTTVAVTWAISLLLNNPHVMKKALNELDTKIGRQRVVSDED  373

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+QA++KET+RLYP  PLS P    EDC I  YHI+KGTR I NF KI  DP+ W
Sbjct  374   ISNLVYIQAIVKETLRLYPGGPLSGPRIFTEDCTIAGYHIRKGTRFIPNFWKIQTDPQNW  433

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EF+PERFLT HKDVD++G +F+ +PF SGRR CPG++  L++VQ  LAS +H F++
Sbjct  434   PEPFEFKPERFLTTHKDVDLKGQHFQFLPFSSGRRACPGLAFGLQLVQFTLASFLHAFEI  493

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
                S+ PID+TES G+TN KA PL  L+ PRL S LYG
Sbjct  494   SNPSSAPIDMTESFGMTNLKAAPLNVLIKPRLSSKLYG  531



>ref|XP_010248151.1| PREDICTED: cytochrome P450 82C4-like, partial [Nelumbo nucifera]
Length=464

 Score =   317 bits (811),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 219/336 (65%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAM  997
             N++  M+ G+      DE  +  + Q+A R  F L G  ++ D IP+L WLD+ G+++AM
Sbjct  137   NIITRMVAGKRVAGVTDEGDDALRCQKAIRDFFHLMGLFILPDAIPFLGWLDLQGYKRAM  196

Query  996   RETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDT  817
             R TA E++ F E W++EHK +  S  + +E  DFMD MLS+ E        S+LP  ++ 
Sbjct  197   RRTAKELDCFLEVWLQEHKHRILSSDAIDE-KDFMDIMLSILE-------DSKLPD-HNL  247

Query  816   DQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLK  637
               IIKSTCL ++L   DTT+VTL W +SL+LNN   +++ Q+ELD  VG+ER VEESD++
Sbjct  248   GTIIKSTCLNLILGGNDTTAVTLTWCISLLLNNRHAMKKAQEELDIQVGRERIVEESDIE  307

Query  636   ELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAK  457
              L YLQA+IK T RLYPA PLS P    EDC +  +++  GTRL+TN  KI RDP VW  
Sbjct  308   NLKYLQAIIKXTFRLYPAAPLSAPQITTEDCTVAGFYVPSGTRLVTNIWKIQRDPAVWMD  367

Query  456   PDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRR  277
             P  F PERFLT H ++DV G +FELI FG GRR CPGI+LAL +V L L  L+ GF+   
Sbjct  368   PSNFNPERFLTRHTNLDVWGQHFELITFGLGRRSCPGINLALRVVNLTLXRLLQGFEFAT  427

Query  276   ISNEPIDLTESCGLTNFKATPLQALLIPRLESNLYG  169
              S+ P+D+TE  GLTN KATPLQ LL PR  S  YG
Sbjct  428   PSDAPVDMTEKAGLTNLKATPLQILLTPRFPSKFYG  463



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   318 bits (816),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 224/316 (71%), Gaps = 7/316 (2%)
 Frame = -3

Query  1116  EESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERWMeehkr  937
             E + +Q+   ++  LFG  VV+D +P+LR LDIGG+E+ M +TA   +   + W++EHK 
Sbjct  220   EANDWQQQITKIAALFGQFVVSDALPFLRRLDIGGYERLMSKTAKYFDIILQEWLDEHKM  279

Query  936   krksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLAATDTTS  757
             KR S   K +E DF+  +LSL +  A      +LP   D D +IK+ CL++++A T TT 
Sbjct  280   KRVSGEVKGDE-DFIYVLLSLLDDNAE-----QLPD-RDADTVIKAICLSLIVAGTQTTV  332

Query  756   VTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMRLYPAVP  577
             VTL WA++L+LNN EVL++ +DE+D  VG ER V ESD + L+YLQA+IKETMRLYPA P
Sbjct  333   VTLTWAIALLLNNPEVLKKARDEIDIQVGTERPVNESDTRNLVYLQAIIKETMRLYPAGP  392

Query  576   LSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHKDVDVRG  397
             L +PHE++E+CI+N YH+  GT+L  N  KI RDP VW +P +F+PERFLT HKD+DV G
Sbjct  393   LLLPHESIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG  452

Query  396   NNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGLTNFKAT  217
              +FELIPFGSGRRMCP +S  L+++ L LASLV GFD    S EP+D+ ES GL+  KAT
Sbjct  453   QDFELIPFGSGRRMCPAVSYGLQVMPLMLASLVRGFDFTTPSGEPVDMGESMGLSIAKAT  512

Query  216   PLQALLIPRLESNLYG  169
             PL+ LL PRL ++ YG
Sbjct  513   PLEVLLSPRLSASSYG  528



>ref|XP_009365936.1| PREDICTED: cytochrome P450 82A3-like, partial [Pyrus x bretschneideri]
Length=341

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 224/337 (66%), Gaps = 17/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE--------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEK  1003
             N++++M+ G+        DE  E  + Q A R LF+  G  +V D +P+LRWLD GGHEK
Sbjct  13    NVILTMVAGKRYSVAAAGDEKKEARRVQTALRELFDYLGMFLVGDAVPYLRWLDWGGHEK  72

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+++A E+ +    W+EEHK++R    +K E+ DF+D +LS+ +            G +
Sbjct  73    AMKKSATEIHAIIAEWVEEHKQRRAKGDAKGEQ-DFIDALLSVLDGADL--------GSF  123

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I ++T L ++    DTT VTL WALSL+LNN  V+++  +ELDT +GK+R V E D
Sbjct  124   DADTIARATSLNVIAGGGDTTMVTLTWALSLLLNNPHVMKKALNELDTKIGKQRVVSEED  183

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             +  L+Y+Q ++KET+RLYP  PLS P    EDC I  YHI+KGTR I NF KI  +PK W
Sbjct  184   ISNLVYIQVIVKETLRLYPVGPLSGPRIFSEDCTIAGYHIRKGTRFIPNFWKIQTNPKNW  243

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
              +P EF+PERFLT HKDVD++G++F+ IPF SGRR CPG++  L++VQ  LAS +H F++
Sbjct  244   PEPFEFKPERFLTTHKDVDLKGHHFQYIPFSSGRRSCPGLAFGLQMVQFTLASFLHAFEI  303

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S+ PID+TES G+TN KA+PL  L+ PRL   LY
Sbjct  304   SNPSSAPIDMTESFGITNVKASPLNVLIKPRLSYELY  340



>gb|KDO84377.1| hypothetical protein CISIN_1g009899mg [Citrus sinensis]
Length=523

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 227/321 (71%), Gaps = 8/321 (2%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
              E++  E  +++ A R  F L G  +V D +P+L WLDIGG+EKAM++TA E++S  E W
Sbjct  210   AENDETEVRRYRAAIRNFFLLGGVFLVRDALPFLGWLDIGGYEKAMKKTAKELDSLIEEW  269

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEH+RK++S ++ +   DF+D +LS+ E              +D D +IK+T + +++ 
Sbjct  270   IEEHRRKKESGANLDL--DFIDVLLSVLEGEGVDLSD------FDVDTVIKATTMTIIVG  321

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             ATDTT+V L WALSL+LNN   LE+++ ELD+ VGKER + ESD+++L+YLQAVIKET+R
Sbjct  322   ATDTTTVNLTWALSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLR  381

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PL+   +  EDC +  YH+ KGTRL+ N  K+  DP+VW+ P EF+PERFLT HK
Sbjct  382   LYPAGPLAGARQFTEDCTVAEYHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTAHK  441

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVDV+G +FEL+PFG GRR CPGIS AL++  LALA+ +H FD+       +D+T + GL
Sbjct  442   DVDVKGQHFELLPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGL  501

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN +ATPL+ LL PRL S+LY
Sbjct  502   TNIRATPLEILLKPRLPSSLY  522



>ref|XP_006473406.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=523

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 227/321 (71%), Gaps = 8/321 (2%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
              E++  E  +++ A R  F L G  +V D +P+L WLDIGG+EKAM++TA E++S  E W
Sbjct  210   AENDETEVRRYRAAIRNFFLLGGVFLVRDALPFLGWLDIGGYEKAMKKTAKELDSLIEEW  269

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEH+RK++S ++ +   DF+D +LS+ E              +D D +IK+T + +++ 
Sbjct  270   IEEHRRKKESGANLDL--DFIDVLLSVLEGEGVDLSD------FDVDTVIKATTMTIIVG  321

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
             ATDTT+V L WALSL+LNN   LE+++ ELD+ VGKER + ESD+++L+YLQAVIKET+R
Sbjct  322   ATDTTTVNLTWALSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLR  381

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             LYPA PL+   +  EDC +  YH+ KGTRL+ N  K+  DP+VW+ P EF+PERFLT HK
Sbjct  382   LYPAGPLAGARQFTEDCTVAEYHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTTHK  441

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVDV+G +FEL+PFG GRR CPGIS AL++  LALA+ +H FD+       +D+T + GL
Sbjct  442   DVDVKGQHFELLPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGL  501

Query  234   TNFKATPLQALLIPRLESNLY  172
             TN +ATPL+ LL PRL S+LY
Sbjct  502   TNIRATPLEILLKPRLPSSLY  522



>ref|XP_007151141.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
 gb|ESW23135.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
Length=529

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 164/337 (49%), Positives = 220/337 (65%), Gaps = 23/337 (7%)
 Frame = -3

Query  1158  NMLVSML-----FGEDEVVEESKFQRASRRLFE---LFGAAVVADFIPWLRWLDIGGHEK  1003
             N++V M+     FG   V  + K +R  + L E   L G   VAD +P LRW D GG+EK
Sbjct  205   NIIVRMVVGKRYFGVVHVEGKEKAERFLKNLEEFMNLMGTFTVADGVPCLRWFDFGGYEK  264

Query  1002  AMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGY  823
             AM+ TA EM+     W+EEH+ K+          DFMD M+S                G+
Sbjct  265   AMKATAKEMDKLLSEWLEEHREKKGD-------GDFMDVMISALNGAQLE--------GF  309

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D I K+T L ++L  TDT +VTL WALSL+L N   +E+ ++E+D H+GK+  V+ESD
Sbjct  310   DADTICKATSLELILGGTDTAAVTLTWALSLLLRNPLAMEKAKEEIDMHIGKDGHVKESD  369

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L+YLQAV+KET+RLYP  PLS P E +E+C +  YHI+KGTRL+ N  KIHRDP VW
Sbjct  370   ISKLVYLQAVVKETLRLYPPAPLSSPREFIENCTLGGYHIKKGTRLMHNLWKIHRDPSVW  429

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HK VD+RG +FEL+PFGSGRR+C G+SL L ++  +LA+++H FD+
Sbjct  430   SDPLEFKPERFLTTHKHVDLRGRHFELLPFGSGRRICAGMSLGLNVIHFSLANMLHCFDI  489

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                S EPID+TE  G TN +ATPL+ L+ PRL  N Y
Sbjct  490   SNPSAEPIDMTEFFGFTNTRATPLEVLVKPRLSPNYY  526



>gb|KEH33015.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=532

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 224/328 (68%), Gaps = 14/328 (4%)
 Frame = -3

Query  1137  FGEDEVVEESKFQ---RASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESF  967
             FG   V+++ + +   +A + +  L G   V D +P+L+W D GGH KAM++   EM+  
Sbjct  210   FGSTNVIDKEEVEICVKAIKEMLRLMGVFTVGDALPFLKWFDFGGHVKAMKKATKEMDKI  269

Query  966   AERWMeehkrkrksksskeeEAD---FMDTMLSLFETTASSSHQSRLPGGYDTDQIIKST  796
                 +EEH+RKR     KE + D   FMD MLSL + T           G+D+D +IK+T
Sbjct  270   IGDLLEEHQRKRSLSDQKEVDGDHQDFMDVMLSLLDGTTIE--------GFDSDTVIKAT  321

Query  795   CLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQA  616
              L ++    DTTSVTLIWA+ L+L N  V+E+ Q+ELD  VGKER V+ESD+ +L+YLQA
Sbjct  322   ILTLIAGGVDTTSVTLIWAMCLLLENPLVIEKAQEELDIQVGKERCVKESDIDKLVYLQA  381

Query  615   VIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPE  436
             ++KET+RL P  PLS P E  E+  +  Y ++KGTRLI N  KIH DPKVW +P EF+PE
Sbjct  382   IVKETLRLCPPAPLSGPREFTENSNLGGYDVKKGTRLIMNLWKIHTDPKVWLEPLEFKPE  441

Query  435   RFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPID  256
             RFLT HK VDV+G++FEL+PFGSGRR+CPGIS  L++V L+LAS +H F++ + S EPID
Sbjct  442   RFLTTHKGVDVKGHHFELLPFGSGRRICPGISYGLQMVHLSLASFLHSFEISKASAEPID  501

Query  255   LTESCGLTNFKATPLQALLIPRLESNLY  172
             +TE+ G+TN KATPL+ L+ PRL SN Y
Sbjct  502   MTEAFGITNHKATPLEILIKPRLPSNCY  529



>ref|XP_007151148.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
 gb|ESW23142.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
Length=545

 Score =   318 bits (816),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 224/336 (67%), Gaps = 15/336 (4%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+     E +++ K +R   A      L G   V D +PWLRW D GGHEKA
Sbjct  211   NMVLRMVVGKRYFGGENLQDEKTKRCVKAVEEFMRLLGVFAVGDAVPWLRWFDFGGHEKA  270

Query  999   MRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYD  820
             M++TA +++S     +EEH++++      +E  DFMD M+SL +         R   G D
Sbjct  271   MKKTAKDLDSIISEELEEHRKRKGLGEKVDEAKDFMDVMISLLD--------GRTIEGID  322

Query  819   TDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDL  640
              D +IKST L ++   TDT +  L W +SL+L N  VLE+++DELDTH+GKE+ V ESD+
Sbjct  323   ADTMIKSTVLNVIAGGTDTNNTVLTWTISLILRNPLVLEKVKDELDTHIGKEKCVNESDI  382

Query  639   KELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWA  460
              +L YLQA++KET+RLYP  PLS P E  E+CI+ +Y+I+KGTRLITN  KIH D  VW 
Sbjct  383   SKLTYLQAIVKETLRLYPPGPLSAPREFTENCILRDYNIKKGTRLITNLWKIHTDSNVWE  442

Query  459   KPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMR  280
              P EF+PERFL++HK +DV+G++FEL+PFGSGRR+CP IS  L++V   LA  +H F++ 
Sbjct  443   DPLEFKPERFLSNHKYIDVKGHHFELLPFGSGRRICPAISFGLQMVHFTLARFLHSFEIV  502

Query  279   RISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
               S +PID+TE+ GLTN KATPL  L+ PRL  + Y
Sbjct  503   SPSPDPIDMTETFGLTNTKATPLDILIKPRLSLSCY  538



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   318 bits (815),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 230/341 (67%), Gaps = 18/341 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE-----------DEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGG  1012
             NM+V M+ G+           ++  E  + ++     F L G   V+D  P L W D+ G
Sbjct  189   NMMVRMVAGKRYFGGGGSLSSEDTEEARQCRKGVANFFHLVGIFTVSDAFPKLGWFDLQG  248

Query  1011  HEKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLP  832
             HEK M++T  E++   ERW+E H+++RK   +K  ++DF+D MLSL E    S  Q    
Sbjct  249   HEKEMKQTGRELDVILERWIENHRQQRKVSGTKHNDSDFIDVMLSLAEQGKLSHLQ----  304

Query  831   GGYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVE  652
               YD +  IKSTCLAM+L  T+T+  TL WA+SL+LNN E+L++ Q+E+D HVG++R VE
Sbjct  305   --YDANTSIKSTCLAMILGGTETSPATLTWAISLLLNNKEMLKKAQEEIDIHVGRDRNVE  362

Query  651   ESDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDP  472
             +SD++ L+YLQA+IKET+RLYPA PL    EAMEDC +  Y++  GTR++ N  KI RDP
Sbjct  363   DSDIENLVYLQAIIKETLRLYPAGPLLGHREAMEDCTVAGYNVPCGTRMLVNVWKIQRDP  422

Query  471   KVWAKPDEFRPERFLTHH-KDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVH  295
             KV+ +PDEFRPERF+T   K+ DVRG NFEL+PFGSGRR CPG SLA++++ L LA  +H
Sbjct  423   KVYMEPDEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGASLAMQVLHLGLARFLH  482

Query  294   GFDMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
              F+++ + + P+D++ES GLT  K TPL+ L+ PRL+  L+
Sbjct  483   SFEVKTVMDMPVDMSESPGLTIPKGTPLEVLISPRLKEELF  523



>ref|XP_007017406.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14631.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=1044

 Score =   330 bits (847),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 225/324 (69%), Gaps = 9/324 (3%)
 Frame = -3

Query  1140  LFGEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAE  961
             L G D+  E  + QRA R  F L G  V+ D +P L +LD+GG EKAM+ETA EM+S A 
Sbjct  730   LKGHDK--EARRCQRALREWFHLLGVFVLKDAVPLLGFLDLGGQEKAMKETAKEMDSIAS  787

Query  960   RWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAML  781
              W++EHK+K+     KE   DFMD +LSL E  +++ + S    G++ D I K+TCL ++
Sbjct  788   EWLKEHKQKKTLGEVKE--KDFMDVLLSLVEAESTNPNLS----GWNVDTITKTTCLNLI  841

Query  780   LAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKET  601
                +DTT VTLIWALSL+LNN   L+++Q+ELD HVGKER V +SDL  LIYLQAV+KET
Sbjct  842   GGGSDTTKVTLIWALSLLLNNRHCLKKVQEELDIHVGKERLVNDSDLSNLIYLQAVVKET  901

Query  600   MRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTH  421
             +RLYP   L  P    +D  +N YH+ KGT +  N  KI  DP+VW+ P EF+PERFL+ 
Sbjct  902   LRLYPPA-LLFPRLCTQDITLNGYHVSKGTWIFLNLWKIQTDPRVWSDPYEFKPERFLSS  960

Query  420   HKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESC  241
             HK+VDVRG +FE+IPFG GRR+CPGIS  L+++ L LA L+HGFD+   SN  +D+TES 
Sbjct  961   HKEVDVRGRHFEMIPFGCGRRVCPGISFGLQVLNLTLAGLLHGFDISTPSNARVDMTESP  1020

Query  240   GLTNFKATPLQALLIPRLESNLYG  169
             GLT+ KATPL+ L+ PRL  N YG
Sbjct  1021  GLTSIKATPLEVLITPRLSPNSYG  1044


 Score =   275 bits (704),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 207/309 (67%), Gaps = 13/309 (4%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             G+D+  E  + QRA R  F L G   + D +P+L +LD+GGHEKA++ETA E+ES A  W
Sbjct  104   GDDK--EARRCQRAMREWFHLLGVFALKDAVPFLGFLDLGGHEKAVKETAKELESIASEW  161

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             ++EHK+KR S  +K++  DFMD +LSL E T  +S        +D D I K+ CL+M+  
Sbjct  162   LKEHKQKRASGGAKDQ--DFMDVLLSLLEGTNLASE-------FDVDTINKANCLSMITG  212

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
              +DT  VTL W LSL+LNN   L ++Q+ELD HVGKER V ESDL +L  LQAV+KET+R
Sbjct  213   GSDTPKVTLTWILSLLLNNLHWLRKVQEELDIHVGKERLVNESDLSKLECLQAVVKETLR  272

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             L+P V L  P    ++ I++ YH+ + + +  N  KI  DP+VW+ P EF PERFLT +K
Sbjct  273   LHPPV-LLFPRFCTDEIIVSGYHVPRDSWIFLNLWKIQTDPRVWSDPLEFMPERFLTTNK  331

Query  414   DVDVRGNN-FELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCG  238
             D DV G+  FELIPFG GRR+CPG+S  L++V + LASL+  FD+   SN  +D+TE  G
Sbjct  332   DFDVGGDQYFELIPFGFGRRVCPGMSFGLQMVHVTLASLLQAFDISTPSNAMVDMTEGAG  391

Query  237   LTNFKATPL  211
             L+N KAT L
Sbjct  392   LSNMKATAL  400


 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = -3

Query  615  VIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPE  436
             + E++RLYPA PLS   E  EDC I  YH+ KGTRLI N  KI   P+ W  P EF+PE
Sbjct  399  ALDESLRLYPAGPLSGAREFTEDCTIGGYHVPKGTRLIVNLWKIQTAPQFWFDPLEFKPE  458

Query  435  RFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPID  256
            RF+T H DVDV+G +FELIPFG+ RR+CPGI+   +   L LA L+H FD+   SNEP+D
Sbjct  459  RFVTGHLDVDVKGQHFELIPFGACRRLCPGINFGPQTTHLVLALLLHAFDIWTPSNEPVD  518

Query  255  LTESCGLTNFKATPLQALLIPRLESNLY  172
            +T S GLTN KATPL+ L+ PR   NLY
Sbjct  519  MTGSPGLTNIKATPLEVLVKPRSSPNLY  546



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   318 bits (815),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 218/324 (67%), Gaps = 10/324 (3%)
 Frame = -3

Query  1137  FGEDEVVEESK-FQRASRRLFELFGAAVVADFIPWLRWLD-IGGHEKAMRETAMEMESFA  964
             FG     +E K  ++A      L G  +V+D IP+L WLD + G    M+  A E++   
Sbjct  207   FGTHACGDEPKRXKKAFEDFIILLGLFMVSDVIPFLGWLDTMKGFTAEMKRVAKEVDYVL  266

Query  963   ERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAM  784
               W+EEH++ R S +    E DF+  MLS+ +    S        G D D IIK TC  +
Sbjct  267   GSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS--------GRDPDTIIKGTCSNL  318

Query  783   LLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKE  604
             +LA  DTTS+TL WALSL+LNN   L++ Q EL+ HVGK R+V+ SD+K L+YLQA++KE
Sbjct  319   ILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKE  378

Query  603   TMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLT  424
             T+RLYP  PLS+PHEAMEDC +  +HIQ GTRL+ N  K+HRDP+VW  P EF+PERFLT
Sbjct  379   TLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLT  438

Query  423   HHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTES  244
              H  +DVRG N+EL+PFGSGRR+CPGIS ALE+  L LA L+HGF++  +++ P+D+TES
Sbjct  439   KHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTES  498

Query  243   CGLTNFKATPLQALLIPRLESNLY  172
              GLT  KATPL+  ++PRL   LY
Sbjct  499   PGLTAPKATPLEVTIVPRLPFELY  522



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 219/322 (68%), Gaps = 10/322 (3%)
 Frame = -3

Query  1134  GEDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGHEKAMRETAMEMESFAERW  955
             GE +  E  + ++A R  F L+G  VV+D IP+  WLD+GGH KAM++TA E++  A+ W
Sbjct  212   GESKEKEAQQCRKAIREFFRLWGLFVVSDAIPFFGWLDVGGHLKAMKKTAKELDGIAQEW  271

Query  954   MeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPGGYDTDQIIKSTCLAMLLA  775
             +EEH++++ S  +   + DFMD  LS+           R    YD D I K+T L ++  
Sbjct  272   LEEHRQRKDSGEADGNQ-DFMDVTLSIL--------GGRDITDYDADTINKATALILIGG  322

Query  774   ATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESDLKELIYLQAVIKETMR  595
              TDTTS TL W +SL+LNN +VL + Q+ELD HVGKER V E D+ +L+YLQA++KET+R
Sbjct  323   GTDTTSATLTWVISLLLNNPDVLRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLR  382

Query  594   LYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVWAKPDEFRPERFLTHHK  415
             + P  PLS P + ++D I+  YHI KGTRLI N  KI RDP+VW  P EF+P+RFLT HK
Sbjct  383   INPTAPLSGPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHK  442

Query  414   DVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDMRRISNEPIDLTESCGL  235
             DVDVRG  FEL PFG GRR+CPG   AL+++ L LA+ +H F +   S+ P+D++ES GL
Sbjct  443   DVDVRGKQFELTPFGGGRRICPGAVFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGL  502

Query  234   TNFKATPLQALLIPRLES-NLY  172
             TN K+TPL+ L+ PRL S +LY
Sbjct  503   TNIKSTPLEVLISPRLASYDLY  524



>ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
 gb|KHN19616.1| Cytochrome P450 82A4 [Glycine soja]
Length=528

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 221/339 (65%), Gaps = 18/339 (5%)
 Frame = -3

Query  1158  NMLVSMLFG----------EDEVVEESKFQRASRRLFELFGAAVVADFIPWLRWLDIGGH  1009
             NM++ M+ G          +D+V +  +   A +    LFG   VAD IP+LR  D GGH
Sbjct  195   NMVLRMVVGKRYFGATTVDDDDVEKAQRCVNAIKDFMRLFGVFPVADAIPYLRCFDFGGH  254

Query  1008  EKAMRETAMEMESFAERWMeehkrkrksksskeeEADFMDTMLSLFETTASSSHQSRLPG  829
             EKAM+ETA +++S    W+EEH++ R    + +   DFMD M+SL +         +   
Sbjct  255   EKAMKETAKDLDSIISEWLEEHRQNRALDENVDRVQDFMDVMISLLD--------GKTID  306

Query  828   GYDTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEE  649
             G D D +IKST L +++   DTTS +L WA+ L+L N  VLE+++ E D  VGKE  + E
Sbjct  307   GIDADTMIKSTVLTVIVGGADTTSTSLTWAMCLILKNPYVLEKVKAEFDIQVGKENCISE  366

Query  648   SDLKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPK  469
             SD+ +L YLQA++KET+RLYP  PLS P E  E+C ++ Y+I+KGTRLITN  KIH D  
Sbjct  367   SDISKLTYLQAMVKETLRLYPPGPLSGPREFTENCTLSGYNIEKGTRLITNLWKIHTDLN  426

Query  468   VWAKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGF  289
             VW+ P EF+PERFLT HKD+D+RG++FEL+PFGSGRR+CPGIS  L ++   LAS +H F
Sbjct  427   VWSDPLEFKPERFLTTHKDIDIRGHHFELLPFGSGRRICPGISFGLRMLHFPLASFLHSF  486

Query  288   DMRRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
             ++   S EP+D+TES GL N KATPL+  + PRL  + Y
Sbjct  487   EILNPSTEPLDMTESFGLVNAKATPLEIFIKPRLSPSCY  525



>ref|XP_003554125.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 221/337 (66%), Gaps = 16/337 (5%)
 Frame = -3

Query  1158  NMLVSMLFGE----DEVVEESKFQR---ASRRLFELFGAAVVADFIPWLRWLDIGGHEKA  1000
             NM++ M+ G+       +++ K QR   A +    L G   VAD IP+LRW D GG+EKA
Sbjct  196   NMVLRMVVGKRLFGARTMDDEKAQRCVEAVKEFMRLMGVFTVADAIPFLRWFDFGGYEKA  255

Query  999   MRETAMEMESFAERWMeehkrkrksksske-eEADFMDTMLSLFETTASSSHQSRLPGGY  823
             M+ETA +++     W+EEHK+ R    +      DFMD MLSLF+         +   G 
Sbjct  256   MKETAKDLDEIFGEWLEEHKQNRAFGENNVDGIQDFMDVMLSLFD--------GKTIYGI  307

Query  822   DTDQIIKSTCLAMLLAATDTTSVTLIWALSLVLNNYEVLERIQDELDTHVGKERRVEESD  643
             D D IIKS  L ++   T++ + TL WA+ L+L N  VLE++  ELD  VGKER + ESD
Sbjct  308   DADTIIKSNLLTIISGGTESITTTLTWAVCLILRNPIVLEKVIAELDFQVGKERCITESD  367

Query  642   LKELIYLQAVIKETMRLYPAVPLSVPHEAMEDCIINNYHIQKGTRLITNFVKIHRDPKVW  463
             + +L YLQAV+KET+RLYP  PLS P E +EDC +  Y+++KGTRLITN  KIH D  VW
Sbjct  368   ISKLTYLQAVVKETLRLYPPGPLSAPREFIEDCTLGGYNVKKGTRLITNVWKIHTDLSVW  427

Query  462   AKPDEFRPERFLTHHKDVDVRGNNFELIPFGSGRRMCPGISLALEIVQLALASLVHGFDM  283
             + P EF+PERFLT HKD+DVRG++FEL+PFG GRR CPGIS +L++V L LASL H F  
Sbjct  428   SNPLEFKPERFLTTHKDIDVRGHHFELLPFGGGRRGCPGISFSLQMVHLILASLFHSFSF  487

Query  282   RRISNEPIDLTESCGLTNFKATPLQALLIPRLESNLY  172
                SNEPID+TE+ GL   KATPL+ L+ PRL S+ Y
Sbjct  488   LNPSNEPIDMTETFGLAKTKATPLEILIKPRLSSSCY  524



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2845066247358