BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21902_g1_i1 len=1181 path=[1287:0-303 1591:304-322 1610:323-349
1636:350-389 130:390-449 1735:450-490 1776:491-764 2050:765-985
2271:986-1180]

Length=1181
                                                                      Score     E

ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    321   3e-104   
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             319   1e-103   
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    319   2e-103   
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    317   1e-102   
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    316   3e-102   
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        314   1e-101   Ricinus communis
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    314   2e-101   
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             311   1e-100   
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    311   2e-100   
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             311   2e-100   
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    310   4e-100   
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             311   5e-100   
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    310   6e-100   
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             310   7e-100   
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    309   8e-100   
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    309   1e-99    Vitis vinifera
ref|XP_006388114.1|  alcohol dehydroge family protein                   309   2e-99    
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    309   2e-99    
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    308   3e-99    
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    308   3e-99    
emb|CDP06870.1|  unnamed protein product                                306   2e-98    
emb|CDP06868.1|  unnamed protein product                                306   2e-98    
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             305   3e-98    
emb|CDP06872.1|  unnamed protein product                                306   8e-98    
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      303   2e-97    
emb|CDP06869.1|  unnamed protein product                                303   2e-97    
gb|ACU18308.1|  unknown                                                 303   2e-97    Glycine max [soybeans]
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    303   2e-97    
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    302   1e-96    
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    300   3e-96    
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                299   7e-96    
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    299   1e-95    
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      298   1e-95    
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         298   3e-95    
gb|AFK35915.1|  unknown                                                 297   5e-95    
gb|AFK46966.1|  unknown                                                 296   2e-94    
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    296   2e-94    
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             295   3e-94    
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    295   3e-94    
emb|CBI28275.3|  unnamed protein product                                312   3e-94    
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     294   7e-94    
gb|AEC10992.1|  alcohol dehydrogenase                                   295   7e-94    
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         294   1e-93    
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             293   2e-93    
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    292   4e-93    
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    292   5e-93    Vitis vinifera
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    292   6e-93    
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    291   9e-93    
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             291   1e-92    
gb|AFK37606.1|  unknown                                                 289   7e-92    
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             289   8e-92    
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             289   1e-91    
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      288   2e-91    
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    288   2e-91    
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    286   1e-90    
ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    285   2e-90    Vitis vinifera
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    285   2e-90    
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    285   3e-90    
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             285   4e-90    
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     285   5e-90    
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    284   6e-90    
gb|KHN21175.1|  Momilactone A synthase                                  285   6e-90    
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    284   8e-90    
ref|XP_006384780.1|  alcohol dehydroge family protein                   283   1e-89    
emb|CBI28276.3|  unnamed protein product                                285   2e-89    
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         283   3e-89    
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         282   3e-89    
gb|KHN11533.1|  Momilactone A synthase                                  282   3e-89    
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    282   4e-89    
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    282   4e-89    
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       281   8e-89    
ref|NP_001239862.1|  uncharacterized protein LOC100794412               281   1e-88    
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    281   2e-88    
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    280   2e-88    
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             280   4e-88    
gb|ACU18273.1|  unknown                                                 280   4e-88    Glycine max [soybeans]
gb|ADK56099.1|  alcohol dehydrogenase                                   279   4e-88    
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  280   4e-88    
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       279   6e-88    
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         279   7e-88    
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    278   7e-88    
gb|KHN21177.1|  Momilactone A synthase                                  281   8e-88    
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        279   8e-88    Ricinus communis
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    278   9e-88    
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    278   9e-88    
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    278   2e-87    
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       277   3e-87    
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    277   3e-87    
gb|KHN21176.1|  Momilactone A synthase                                  277   3e-87    
gb|ACU19531.1|  unknown                                                 277   3e-87    Glycine max [soybeans]
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     276   1e-86    
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     275   3e-86    
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  273   1e-85    
ref|XP_010104810.1|  Momilactone A synthase                             273   1e-85    
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    272   3e-85    
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    272   5e-85    
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    273   6e-85    
dbj|BAA13541.1|  CPRD12 protein                                         271   7e-85    Vigna unguiculata
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    271   7e-85    
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 271   8e-85    
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    271   8e-85    
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             271   1e-84    
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             271   1e-84    
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       271   1e-84    
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    271   1e-84    Vitis vinifera
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    271   1e-84    Forsythia x intermedia [cultivated forsythia]
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    270   2e-84    
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    270   2e-84    
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     270   3e-84    
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      270   3e-84    Cucumis sativus [cucumbers]
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    270   3e-84    
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         269   4e-84    
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    269   6e-84    Lactuca sativa [cultivated lettuce]
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    269   6e-84    Populus trichocarpa [western balsam poplar]
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    269   6e-84    
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             269   8e-84    
ref|XP_010104809.1|  Momilactone A synthase                             268   9e-84    
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     269   1e-83    
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       268   1e-83    
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    269   2e-83    
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    268   2e-83    
emb|CAN78993.1|  hypothetical protein VITISV_001799                     271   3e-83    Vitis vinifera
gb|AAK83035.1|AF286650_1  CTA                                           267   3e-83    Cucumis sativus [cucumbers]
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    268   3e-83    
ref|XP_010104811.1|  Momilactone A synthase                             267   3e-83    
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             268   3e-83    
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    267   4e-83    
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             266   4e-83    
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   5e-83    
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   266   6e-83    
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             266   6e-83    
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    267   6e-83    
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             266   7e-83    
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   8e-83    
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    267   9e-83    
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             265   2e-82    
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    265   2e-82    
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            265   2e-82    
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    265   2e-82    
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   2e-82    
ref|XP_010931582.1|  PREDICTED: LOW QUALITY PROTEIN: zerumbone sy...    265   3e-82    
dbj|BAC53872.1|  alcohol dehydroge                                      264   5e-82    Phaseolus lunatus
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         264   6e-82    
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            263   1e-81    
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    263   1e-81    Populus trichocarpa [western balsam poplar]
ref|XP_006424146.1|  hypothetical protein CICLE_v10030340mg             263   2e-81    
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             262   2e-81    
emb|CDP06416.1|  unnamed protein product                                263   3e-81    
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    262   4e-81    
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    261   7e-81    
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         261   8e-81    
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    261   8e-81    
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            261   8e-81    
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            261   9e-81    
ref|XP_002527336.1|  short chain alcohol dehydrogenase, putative        261   1e-80    Ricinus communis
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             259   1e-80    
sp|F1SWA0.1|ZERSY_ZINZE  RecName: Full=Zerumbone synthase               260   2e-80    
ref|XP_010104812.1|  Momilactone A synthase                             260   2e-80    
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    260   2e-80    
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    260   2e-80    
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    260   2e-80    
ref|XP_008808776.1|  PREDICTED: zerumbone synthase                      260   2e-80    
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    259   3e-80    
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            259   3e-80    
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    260   4e-80    
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    259   4e-80    
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         259   4e-80    
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    259   5e-80    
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             259   6e-80    
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    259   7e-80    
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   9e-80    
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    259   1e-79    
gb|AFV30207.1|  borneol dehydrogenase                                   257   1e-79    
ref|XP_009605329.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   1e-79    
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   1e-79    
emb|CAA11153.1|  short chain alcohol dehydrogenase                      258   1e-79    Nicotiana tabacum [American tobacco]
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    259   1e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    258   2e-79    
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   2e-79    Vitis vinifera
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   2e-79    Vitis vinifera
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   2e-79    
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             257   2e-79    
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          258   2e-79    
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     257   3e-79    
ref|XP_008643649.1|  PREDICTED: short chain alcohol dehydrogenase...    257   3e-79    
emb|CBI18081.3|  unnamed protein product                                257   4e-79    
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   4e-79    
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   5e-79    
gb|ABR18410.1|  unknown                                                 257   5e-79    Picea sitchensis
ref|XP_002513092.1|  short chain alcohol dehydrogenase, putative        256   5e-79    Ricinus communis
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     256   7e-79    
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             256   8e-79    
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      256   8e-79    
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            256   8e-79    
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    256   9e-79    
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    255   1e-78    
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        256   1e-78    Ricinus communis
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         255   1e-78    
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        255   1e-78    Ricinus communis
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    255   2e-78    
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            255   2e-78    
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    256   2e-78    
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    256   2e-78    Vitis vinifera
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    255   2e-78    
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    256   2e-78    
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    256   2e-78    
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    256   2e-78    
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          254   2e-78    
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         254   2e-78    
ref|XP_002323403.1|  alcohol dehydroge family protein                   254   3e-78    Populus trichocarpa [western balsam poplar]
ref|XP_010922188.1|  PREDICTED: zerumbone synthase-like                 254   3e-78    
ref|XP_010040330.1|  PREDICTED: secoisolariciresinol dehydrogenas...    253   3e-78    
gb|ABK22745.1|  unknown                                                 254   3e-78    Picea sitchensis
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             254   4e-78    
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        254   4e-78    Ricinus communis
gb|KDO58269.1|  hypothetical protein CISIN_1g044485mg                   253   4e-78    
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    254   5e-78    
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          254   5e-78    
ref|XP_006338966.1|  PREDICTED: short-chain dehydrogenase reducta...    254   6e-78    
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    254   6e-78    
gb|KHN33174.1|  Momilactone A synthase                                  254   7e-78    
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       253   9e-78    
gb|ACG37730.1|  sex determination protein tasselseed-2                  253   1e-77    Zea mays [maize]
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             254   1e-77    
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         253   1e-77    
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    252   1e-77    
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              254   1e-77    
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    253   1e-77    
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    254   1e-77    
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    253   1e-77    
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    253   1e-77    
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 253   2e-77    
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         253   2e-77    
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    253   2e-77    Populus trichocarpa [western balsam poplar]
gb|KEH24173.1|  short-chain dehydrogenase/reductase                     252   2e-77    
ref|XP_002323404.1|  alcohol dehydroge family protein                   252   2e-77    Populus trichocarpa [western balsam poplar]
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 252   2e-77    
emb|CDP02837.1|  unnamed protein product                                254   2e-77    
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             252   2e-77    
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    253   3e-77    
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         251   3e-77    
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    252   3e-77    
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    253   3e-77    
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         251   3e-77    
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        251   4e-77    
ref|XP_003623493.1|  Sex determination protein tasselseed-2             252   4e-77    
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             252   5e-77    
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        251   5e-77    
ref|XP_010683578.1|  PREDICTED: short-chain dehydrogenase reducta...    251   6e-77    
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        251   7e-77    Ricinus communis
gb|KHN40676.1|  Sex determination protein tasselseed-2                  251   8e-77    
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    252   8e-77    
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     249   8e-77    
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    252   8e-77    
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    250   9e-77    
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    251   1e-76    
ref|XP_009395947.1|  PREDICTED: zerumbone synthase                      251   1e-76    
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            250   1e-76    
gb|KHN33244.1|  Sex determination protein tasselseed-2                  251   1e-76    
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    250   1e-76    
gb|ABK23507.1|  unknown                                                 251   1e-76    Picea sitchensis
gb|EAY92297.1|  hypothetical protein OsI_14018                          250   1e-76    Oryza sativa Indica Group [Indian rice]
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         250   1e-76    
gb|ABK24336.1|  unknown                                                 251   1e-76    Picea sitchensis
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    250   1e-76    
ref|NP_001051666.1|  Os03g0810800                                       250   1e-76    Oryza sativa Japonica Group [Japonica rice]
gb|KHG10215.1|  hypothetical protein F383_13541                         250   1e-76    
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    250   2e-76    
ref|XP_004139590.1|  PREDICTED: short-chain dehydrogenase reducta...    249   2e-76    
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             249   2e-76    
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  249   2e-76    
ref|XP_006651946.1|  PREDICTED: zerumbone synthase-like                 250   2e-76    
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          249   2e-76    
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    250   2e-76    
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             250   2e-76    
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 249   3e-76    
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             249   3e-76    
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             249   4e-76    Lactuca sativa [cultivated lettuce]
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   4e-76    
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    249   4e-76    
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   4e-76    
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   5e-76    
ref|XP_002308448.2|  alcohol dehydroge family protein                   249   5e-76    
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    249   5e-76    
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   5e-76    
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   5e-76    
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   5e-76    
ref|XP_004166485.1|  PREDICTED: LOW QUALITY PROTEIN: xanthoxin de...    248   6e-76    
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            248   7e-76    
gb|EYU18091.1|  hypothetical protein MIMGU_mgv1a011664mg                248   8e-76    
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    248   9e-76    
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    248   9e-76    
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   1e-75    
ref|XP_002309405.1|  alcohol dehydroge family protein                   248   1e-75    
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    249   1e-75    
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             248   1e-75    
ref|XP_009417972.1|  PREDICTED: sex determination protein tassels...    248   1e-75    
ref|XP_006361625.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   1e-75    
ref|XP_010671863.1|  PREDICTED: zerumbone synthase-like                 248   1e-75    
ref|XP_009618506.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   1e-75    
gb|KHN29548.1|  Sex determination protein tasselseed-2                  249   2e-75    
ref|XP_006361611.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   2e-75    
ref|XP_004143748.1|  PREDICTED: xanthoxin dehydrogenase-like            247   2e-75    
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             247   2e-75    
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    247   2e-75    
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   2e-75    
ref|XP_004981321.1|  PREDICTED: zerumbone synthase-like                 247   2e-75    
ref|XP_008351500.1|  PREDICTED: secoisolariciresinol dehydrogenas...    247   3e-75    
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            247   3e-75    
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    246   3e-75    
emb|CAN68176.1|  hypothetical protein VITISV_014635                     246   3e-75    
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   3e-75    
ref|XP_010922187.1|  PREDICTED: zerumbone synthase-like                 247   4e-75    
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             246   4e-75    
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    246   4e-75    
ref|XP_007140172.1|  hypothetical protein PHAVU_008G089900g             247   5e-75    
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         246   5e-75    
ref|XP_002325666.2|  hypothetical protein POPTR_0019s14650g             246   5e-75    
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             245   5e-75    
ref|XP_010106398.1|  Xanthoxin dehydrogenase                            246   6e-75    
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                246   6e-75    
ref|XP_002466226.1|  hypothetical protein SORBIDRAFT_01g003880          246   6e-75    
ref|XP_010529113.1|  PREDICTED: short-chain dehydrogenase reducta...    246   6e-75    
ref|XP_010104807.1|  Momilactone A synthase                             245   8e-75    
ref|XP_003554453.1|  PREDICTED: secoisolariciresinol dehydrogenas...    245   9e-75    
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    246   9e-75    
gb|ACU19262.1|  unknown                                                 245   1e-74    
ref|XP_009349369.1|  PREDICTED: secoisolariciresinol dehydrogenas...    245   1e-74    
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         245   1e-74    
gb|ABK21151.1|  unknown                                                 246   1e-74    
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            245   1e-74    
gb|ACU23500.1|  unknown                                                 245   1e-74    
gb|ABK26167.1|  unknown                                                 245   1e-74    
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        245   1e-74    
emb|CDY29039.1|  BnaC07g32450D                                          245   1e-74    
ref|XP_010094675.1|  Sex determination protein tasselseed-2             248   1e-74    
gb|ABK26187.1|  unknown                                                 245   1e-74    
ref|XP_010102621.1|  Sex determination protein tasselseed-2             246   1e-74    
gb|KHG08861.1|  Xanthoxin dehydrogenase -like protein                   245   1e-74    
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    245   2e-74    
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    246   2e-74    
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    244   2e-74    
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    244   3e-74    
emb|CDX78027.1|  BnaA09g32220D                                          244   3e-74    
ref|XP_010937967.1|  PREDICTED: sex determination protein tassels...    244   3e-74    
emb|CDO98188.1|  unnamed protein product                                244   3e-74    
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    244   4e-74    
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 244   4e-74    
gb|KHN02192.1|  Momilactone A synthase                                  259   5e-74    
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    244   5e-74    
ref|XP_004981317.1|  PREDICTED: zerumbone synthase-like                 245   5e-74    
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    244   6e-74    
gb|ABK24197.1|  unknown                                                 243   7e-74    
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   7e-74    
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    244   8e-74    
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    244   8e-74    
emb|CDX90636.1|  BnaA03g41450D                                          243   8e-74    
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    244   9e-74    
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        243   1e-73    
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         243   1e-73    
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   1e-73    
emb|CDP16984.1|  unnamed protein product                                243   1e-73    
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               243   1e-73    
ref|XP_010104808.1|  Momilactone A synthase                             244   1e-73    
gb|AFK45740.1|  unknown                                                 242   2e-73    
gb|ABK26305.1|  unknown                                                 243   2e-73    
ref|XP_004975524.1|  PREDICTED: momilactone A synthase-like             242   2e-73    
gb|ACN40590.1|  unknown                                                 242   2e-73    
ref|XP_008465699.1|  PREDICTED: xanthoxin dehydrogenase                 242   2e-73    
gb|KCW45306.1|  hypothetical protein EUGRSUZ_L01036                     240   2e-73    
ref|XP_008808791.1|  PREDICTED: zerumbone synthase-like                 242   3e-73    
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 241   5e-73    
gb|ABK25445.1|  unknown                                                 241   5e-73    
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   5e-73    
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   6e-73    
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    241   6e-73    
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      240   9e-73    
gb|EMT02624.1|  Xanthoxin dehydrogenase                                 240   9e-73    
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         242   1e-72    
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             240   1e-72    
gb|ABK22004.1|  unknown                                                 240   1e-72    
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 239   1e-72    
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    240   2e-72    
ref|XP_002275768.1|  PREDICTED: tropinone reductase-like 1              239   2e-72    
gb|EMS67256.1|  Xanthoxin dehydrogenase                                 241   2e-72    
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    239   2e-72    
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    239   2e-72    
gb|KHG07244.1|  Sex determination tasselseed-2                          239   3e-72    
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    239   3e-72    
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            239   3e-72    
ref|XP_002265724.1|  PREDICTED: xanthoxin dehydrogenase                 239   4e-72    
ref|XP_010227919.1|  PREDICTED: zerumbone synthase isoform X1           239   4e-72    
ref|XP_010671865.1|  PREDICTED: zerumbone synthase-like                 239   4e-72    
emb|CDP20435.1|  unnamed protein product                                238   5e-72    
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             238   5e-72    
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    238   5e-72    
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    239   6e-72    
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        240   6e-72    
ref|XP_010277608.1|  PREDICTED: xanthoxin dehydrogenase                 238   9e-72    
ref|XP_006292209.1|  hypothetical protein CARUB_v10018415mg             238   1e-71    
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 237   1e-71    
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    237   1e-71    
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        237   1e-71    
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        237   1e-71    
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    237   2e-71    
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 237   2e-71    
ref|XP_006392929.1|  hypothetical protein EUTSA_v10011636mg             239   2e-71    
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         237   2e-71    
ref|XP_008809990.1|  PREDICTED: sex determination protein tassels...    237   2e-71    
ref|XP_004959906.1|  PREDICTED: sex determination protein tassels...    238   2e-71    
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   2e-71    
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      237   3e-71    
ref|XP_002877816.1|  short-chain dehydrogenase/reductase family p...    237   3e-71    
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             237   3e-71    
ref|XP_010671866.1|  PREDICTED: xanthoxin dehydrogenase-like            236   3e-71    
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 236   3e-71    
gb|EEC82732.1|  hypothetical protein OsI_27430                          238   3e-71    
ref|XP_003563948.1|  PREDICTED: zerumbone synthase isoform X2           236   4e-71    
ref|NP_001060718.1|  Os07g0691600                                       237   4e-71    
gb|KDO36906.1|  hypothetical protein CISIN_1g040531mg                   236   4e-71    
emb|CDX73704.1|  BnaC08g22990D                                          236   5e-71    
ref|XP_002446247.1|  hypothetical protein SORBIDRAFT_06g009610          236   5e-71    
ref|XP_002526345.1|  short chain alcohol dehydrogenase, putative        236   6e-71    
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             235   7e-71    
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 234   1e-70    
gb|KDP36170.1|  hypothetical protein JCGZ_08814                         234   1e-70    
ref|XP_004136499.1|  PREDICTED: zerumbone synthase-like                 234   2e-70    
ref|XP_010503863.1|  PREDICTED: short-chain dehydrogenase reducta...    235   2e-70    
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                235   2e-70    
ref|XP_008229683.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   3e-70    
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   3e-70    
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                233   4e-70    
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      233   5e-70    
ref|XP_009147691.1|  PREDICTED: xanthoxin dehydrogenase                 233   5e-70    
ref|NP_190736.1|  short-chain dehydrogenase reductase 2a                234   5e-70    
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         233   6e-70    
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   6e-70    
ref|XP_010101928.1|  Momilactone A synthase                             233   7e-70    
ref|XP_002309404.1|  alcohol dehydroge family protein                   233   7e-70    
gb|AFL56690.1|  ADH1                                                    233   7e-70    
ref|XP_007148995.1|  hypothetical protein PHAVU_005G031600g             232   8e-70    
ref|XP_010314459.1|  PREDICTED: uncharacterized protein LOC100750...    233   8e-70    
emb|CDY52974.1|  BnaA06g01590D                                          233   9e-70    
emb|CAH66124.1|  OSIGBa0109M01.2                                        232   1e-69    
dbj|BAA89230.1|  wts2L                                                  232   1e-69    
ref|XP_008442887.1|  PREDICTED: tropinone reductase-like 1              232   1e-69    
gb|KFK34412.1|  hypothetical protein AALP_AA5G141400                    233   2e-69    
ref|XP_006843399.1|  hypothetical protein AMTR_s00053p00124300          232   2e-69    
gb|ADB82907.1|  secoisolariciresinol dehydrogenase                      231   2e-69    
ref|NP_001049848.1|  Os03g0299200                                       233   3e-69    
gb|EPS74091.1|  hypothetical protein M569_00663                         232   3e-69    
ref|NP_001052173.1|  Os04g0179100                                       231   3e-69    
gb|ABD65462.1|  short chain alcohol dehydrogenase                       231   5e-69    
ref|XP_006855389.1|  hypothetical protein AMTR_s00057p00137740          231   6e-69    
emb|CAH66125.1|  OSIGBa0109M01.3                                        230   7e-69    
ref|XP_002308449.1|  hypothetical protein POPTR_0006s22330g             230   8e-69    
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             229   8e-69    
ref|XP_006339318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   1e-68    
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             229   1e-68    
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         229   1e-68    
ref|NP_001052709.1|  Os04g0405300                                       229   1e-68    
ref|NP_001052174.1|  Os04g0179200                                       229   2e-68    
ref|XP_008812964.1|  PREDICTED: short-chain dehydrogenase reducta...    228   2e-68    
ref|XP_008383844.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      229   2e-68    
emb|CDY61086.1|  BnaC06g41140D                                          229   2e-68    
ref|NP_175644.1|  Xanthoxin dehydrogenase                               229   2e-68    
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       229   2e-68    
ref|XP_003598766.1|  Short-chain dehydrogenase/reductase                229   3e-68    
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       229   3e-68    
ref|XP_002447766.1|  hypothetical protein SORBIDRAFT_06g015240          228   3e-68    
ref|XP_004984897.1|  PREDICTED: sex determination protein tassels...    230   3e-68    
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   3e-68    
gb|ACB87357.1|  secoisolariciresinol dehydrogenase                      228   3e-68    
ref|XP_008443590.1|  PREDICTED: tropinone reductase-like 1              228   3e-68    
ref|XP_010905491.1|  PREDICTED: secoisolariciresinol dehydrogenas...    228   4e-68    
ref|XP_006431968.1|  hypothetical protein CICLE_v10003833mg             228   4e-68    
ref|XP_008383845.1|  PREDICTED: xanthoxin dehydrogenase isoform X3      228   5e-68    
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 228   6e-68    
ref|XP_008383843.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      228   6e-68    
gb|KDP40503.1|  hypothetical protein JCGZ_24502                         228   8e-68    
ref|XP_011046908.1|  PREDICTED: tropinone reductase-like 1              228   1e-67    
ref|XP_002530513.1|  short chain alcohol dehydrogenase, putative        225   1e-67    
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   1e-67    
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  227   1e-67    
gb|AAC35341.1|  short-chain alcohol dehydrogenase                       226   2e-67    
emb|CDP20942.1|  unnamed protein product                                226   3e-67    
gb|KDP34947.1|  hypothetical protein JCGZ_09235                         224   5e-67    
gb|AAC35343.1|  short-chain alcohol dehydrogenase                       225   5e-67    
ref|XP_011024778.1|  PREDICTED: zerumbone synthase-like isoform X1      226   6e-67    
gb|KDO58270.1|  hypothetical protein CISIN_1g044923mg                   223   6e-67    
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            225   7e-67    
ref|XP_003579668.1|  PREDICTED: momilactone A synthase-like             225   7e-67    
ref|XP_008669542.1|  PREDICTED: momilactone A synthase-like             224   1e-66    
ref|XP_010683629.1|  PREDICTED: secoisolariciresinol dehydrogenas...    225   1e-66    
ref|NP_001150890.1|  sex determination protein tasselseed-2             227   1e-66    
ref|XP_006430114.1|  hypothetical protein CICLE_v10012444mg             224   2e-66    
ref|XP_006361624.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   3e-66    
ref|XP_008660233.1|  PREDICTED: sex determination protein tassels...    224   4e-66    
gb|EAZ29934.1|  hypothetical protein OsJ_13988                          223   4e-66    
gb|AHL21380.1|  secoisolariciresinol reductase                          223   6e-66    



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ + +A RRLEGKVA++TGG + IGE   +LF KHGAKV   D  D L E +C+DL 
Sbjct  5     NFSLLAAAA-RRLEGKVAVITGGASGIGESAARLFSKHGAKVVIADVQDDLAESVCRDLS  63

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P++  + HC++ +E DVE+AV     K+GKLDIM N A  +G+TKP+IL NDK EFEQV+
Sbjct  64    PSSTSFVHCDVTKEEDVENAVKTATNKYGKLDIMFNNAGVVGMTKPNILDNDKVEFEQVI  123

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIP G GSI+N  SV ST  G  PH+YTS+KH ++GL +NTAV
Sbjct  124   RVNLVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCAPHAYTSSKHGLVGLVRNTAV  183

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+IV  P+  +   L  D+ L   Y+NLKG VLKAED+ EAALYL S
Sbjct  184   ELGQHGIRVNCVSPYIVSTPLAKEFFKL-DDDKLHGAYSNLKGGVLKAEDIVEAALYLGS  242

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GHNL++DGGF+ +N+  C+F
Sbjct  243   DESKYVSGHNLLVDGGFTIVNAGFCMF  269



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 195/269 (72%), Gaps = 2/269 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ + +A RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D L E +C+DL 
Sbjct  3     NFSLLAAAA-RRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDLS  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
              ++  + HC++ +E DVE+AV    +K+GKLDIM N A   G+ K +IL NDK+EFEQV+
Sbjct  62    SSSTSFVHCDVTKEEDVENAVKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
             GVN+VG FLG KHAAR MIP G GSI+N  S  ST  G   H+YTS+KH VLGL +NTA+
Sbjct  122   GVNLVGVFLGIKHAARVMIPAGQGSIINTASACSTIGGCASHAYTSSKHGVLGLMRNTAI  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+IV  P+      L  D+ +  +Y+NLKG VLKAED+AEAALYL S
Sbjct  182   ELGQHGIRVNCVSPYIVATPLAKDFFKL-DDDGVHGVYSNLKGGVLKAEDIAEAALYLGS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIFPP  273
             DESKYV+GHNL++DGGF+ +N+  CIF  
Sbjct  241   DESKYVSGHNLLVDGGFTIVNARFCIFEQ  269



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 198/262 (76%), Gaps = 1/262 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG++ IGE   +LF+KHGAKV   D  D+LG  +C++L+P  A +
Sbjct  8     SAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E DVE+AV+  V+K+GKLDIM N A   G  K +IL+NDK+EFE+++ VN+VG
Sbjct  68    IHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKIICVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   GSI+   SV +   G   H+YTS+KH VLGLT+NTAVELG  G
Sbjct  128   AFLGTKHAARVMIPARRGSIITTASVCAIIGGGLSHAYTSSKHGVLGLTRNTAVELGHYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP+ V  P+  K      D++LK +Y+NLKGAVL+AED+AEAALYL SDESKYV
Sbjct  188   IRVNCVSPYAVPTPL-FKNFFKMNDDELKCIYSNLKGAVLQAEDIAEAALYLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIFP  276
             +GHNLV+DGGF+ +N   CIFP
Sbjct  247   SGHNLVVDGGFTIVNRGFCIFP  268



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 195/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ + +A RRLEGKVAL+TGG + IGE   +LF KHGA+V   D  D L E +C+DL 
Sbjct  3     NFSLLAAAA-RRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDDLAESVCRDLS  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
              ++  + HC++ +E DVE+AV     K+GKLDIM N A   G+ KP+IL NDK+EFEQV+
Sbjct  62    SSSTSFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGIAKPNILDNDKAEFEQVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIP G GSI+N  SV ST  G + H+YTS+KH ++GL +NTAV
Sbjct  122   RVNLVGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLVRNTAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+IV  P+      L  D+ +   Y+NLKGAVLKAED+A+AALYL S
Sbjct  182   ELGQHGIRVNCVSPYIVATPLAKNFFKL-DDDGVHGAYSNLKGAVLKAEDIAQAALYLGS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GHNLV+DGGF+ +N   C+F
Sbjct  241   DESKYVSGHNLVVDGGFTIVNPRFCMF  267



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 192/261 (74%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             T+A RRLEGKVAL+TGG + IGE   ++F KHGAKV   D  D LGE +C+DL+ ++A +
Sbjct  8     TAAARRLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCRDLNSSSASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E D+E+AV    +K+GKLDIM N A  +G  KP+IL N K+EFEQV+ VN+VG
Sbjct  68    VHCDVTKEEDIENAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAAR MIP G GSI+N  SV ST  G   H+YTS+KH V+GL KN AVELG+ G
Sbjct  128   AFLGIKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+      L  D+ +  +Y+NLKG VL+ EDVAEAALYL SDESKYV
Sbjct  188   IRVNCVSPYLVATPLAKHFFNL-EDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNL++DGGFS +N   C+F
Sbjct  247   SGHNLLVDGGFSIVNPRFCMF  267



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 194/263 (74%), Gaps = 2/263 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PAAAV  885
             + A RRLEGKVAL+TG  + IGE   +LF KHGA +   D  D+LG  +C++LD P++  
Sbjct  8     SGALRRLEGKVALITGAASGIGECAARLFSKHGANLVIADVQDELGHSVCRELDSPSSVS  67

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             Y HCN+  E DVE+AV+  V+K+GKLDIM N A  +G+ KP+IL NDK+EFE+++ VN+V
Sbjct  68    YIHCNVTREEDVENAVNTAVSKYGKLDIMFNNAGVVGIAKPNILDNDKAEFEKIISVNLV  127

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FLGTKHAAR MIPN  GSI+N  SV S   G   H+YTS+KH V+GLT+NTAVELGR 
Sbjct  128   GAFLGTKHAARVMIPNRKGSIINTASVCSIIGGVASHAYTSSKHGVVGLTRNTAVELGRH  187

Query  524   GIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             GIRVNCVSP++V  P+      L  D+ + ++Y+ LK AVL  EDVAEAALYL SDESKY
Sbjct  188   GIRVNCVSPYLVATPLAKDFFKL-DDDGVYRVYSVLKEAVLGPEDVAEAALYLGSDESKY  246

Query  344   VNGHNLVIDGGFSTMNSTLCIFP  276
             V+GHNLV+DGGF+ +N   C+FP
Sbjct  247   VSGHNLVVDGGFTKVNPGFCMFP  269



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 195/262 (74%), Gaps = 1/262 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG++ IGE   +LF KHGAKV   D  D+LG  +C++L   +A +
Sbjct  8     SAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKNESASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E DVE+AV+  V+K GKLDIM N A  +G  KP+IL NDK+EFE+V+ VN+VG
Sbjct  68    VHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKVISVNIVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   GSI++  SV  T  G   H+YTS+KH V+GL +NTAVELG+ G
Sbjct  128   AFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+      L  D  + ++Y+NLK AVLKAEDVAEAAL+L SDESKYV
Sbjct  188   IRVNCVSPYLVSTPLAKDFFKL-DDNKVNRVYSNLKEAVLKAEDVAEAALFLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIFP  276
             +GHNL++DGGF+ +N   C+FP
Sbjct  247   SGHNLIVDGGFTIVNPGFCMFP  268



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 193/267 (72%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ + +A RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D L E +C+DL 
Sbjct  5     NFSLLAAAA-RRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLS  63

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P+  ++ HC++ +E DVE+AV  T  K+G+LDIM N A  +G  KP+IL NDK EFEQV+
Sbjct  64    PSPTLFVHCDVTKEEDVENAVQTTTNKYGELDIMFNNAGIIGTNKPNILDNDKVEFEQVI  123

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIP G GSI+N  SV ST  G   H+YTS+KH ++GL +NTAV
Sbjct  124   RVNLVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAV  183

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+ V   +  K      D+ +   Y+NLKG VLKAED+AEAALYL S
Sbjct  184   ELGQHGIRVNCVSPYAVATKLA-KEFFKIDDDGVHGAYSNLKGRVLKAEDIAEAALYLGS  242

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GHNL++DGG++ MN+  C+F
Sbjct  243   DESKYVSGHNLLVDGGYTIMNAGFCMF  269



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 195/262 (74%), Gaps = 1/262 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG++ IGE   +LF KHGAKV   D  D+LG  +C++L   +A +
Sbjct  8     SAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEELKNESASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E DVE+AV+  V+K GKLDIM N A A    KP+IL NDK+EFE+V+ VN+VG
Sbjct  68    VHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEKVLSVNIVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   GSI++  SV  T  G   H+YTS+KH V+GL +NTAVELG+ G
Sbjct  128   AFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+ +K      D ++ + Y+NL+ AVLKAED+AEAAL+L SDESKYV
Sbjct  188   IRVNCVSPYVVLTPL-VKDFFKLDDNEVNRFYSNLREAVLKAEDIAEAALFLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIFP  276
             +GHNL++DGGF+ +N   C+FP
Sbjct  247   SGHNLIVDGGFTIVNPGFCMFP  268



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 188/260 (72%), Gaps = 1/260 (0%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             +A RRLEGKVAL+TGG + IGE   +LF KHGA+V   D  D L E +C+DL  ++  + 
Sbjct  9     AAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDGLAESVCRDLSSSSISFV  68

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGT  699
             HC++ +E DVE+AV     K+GKLDIM N A   GV KP+IL NDK+EFEQV+ VN++G 
Sbjct  69    HCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGVAKPNILDNDKAEFEQVIRVNLIGA  128

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
             FLG KHAAR MIP G GSI+N  SV ST  G + H+YTS+KH ++GL +NTAVELG+ GI
Sbjct  129   FLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLMRNTAVELGQHGI  188

Query  518   RVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             RVNCVSP+IV  P+      L  D  +   Y+NLKG VLK ED+AEAALYL SDESKYV+
Sbjct  189   RVNCVSPYIVATPLAKNFFKL-DDNGVHGAYSNLKGGVLKVEDIAEAALYLGSDESKYVS  247

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL++DGGF+ +N   C+F
Sbjct  248   GHNLLVDGGFTIVNPRFCMF  267



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 186/257 (72%), Gaps = 1/257 (0%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             LEGKVAL+TGG + IGE  ++LF KHGAKV   D  D L E +C+DL  ++  + HC++ 
Sbjct  1     LEGKVALITGGASGIGESTVRLFSKHGAKVVIADVQDDLAESICRDLSSSSTSFVHCDVT  60

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTK  684
             +E DVE+AV    +K+GKLDIM N A   G  K +IL NDK+EFEQV+GVN+VG FLG K
Sbjct  61    KEEDVENAVKTATSKYGKLDIMFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIK  120

Query  683   HAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCV  504
             HAAR MI  G GSI+N  S  ST  G   H+YTS+KH VLGL +NTA+ELG+ GIRVNCV
Sbjct  121   HAARVMISAGQGSIINTASACSTIGGCASHAYTSSKHGVLGLVRNTAIELGQHGIRVNCV  180

Query  503   SPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLV  324
             SP+IV  P+      L  D+ +  +Y+NLKG VLKAED+AEAALYL SDESKYV+GHNL+
Sbjct  181   SPYIVATPLAKDFFKL-DDDGVHGVYSNLKGEVLKAEDIAEAALYLGSDESKYVSGHNLL  239

Query  323   IDGGFSTMNSTLCIFPP  273
             +DGGF+ +N+  CIF  
Sbjct  240   VDGGFTNVNARFCIFEQ  256



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 194/257 (75%), Gaps = 1/257 (0%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVAL+TGG++ IGE   +LF KHGAKV   D  D+LG  +C++L   +A + HC++
Sbjct  47    RLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDV  106

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
              +E DVE+AV+  V+K GKLDIM N A  +G  KP+IL NDK+EFE+V+ VNVVG FLGT
Sbjct  107   TQEKDVENAVNTAVSKHGKLDIMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGT  166

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAAR MIP   GSI++  SV  T  G   H+YTS+KH V+GL +NTAVELG+ GIRVNC
Sbjct  167   KHAARVMIPVRRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNC  226

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNL  327
             VSP++V  P+ +K      D+++ +LY+NLK AVLKAED+AEAAL+L SDESKYV+GHNL
Sbjct  227   VSPYVVLTPL-VKDFFKLDDDEVNRLYSNLKEAVLKAEDIAEAALFLGSDESKYVSGHNL  285

Query  326   VIDGGFSTMNSTLCIFP  276
             ++DGGF+ +N   C+FP
Sbjct  286   IVDGGFTIVNPGFCMFP  302



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 194/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ + +A RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D   E +C+DL 
Sbjct  5     NFSLLAAAA-RRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDFAESVCRDLS  63

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P++  + HC++ +E DVE+AV     K+G+LDIM N A  +G  KP+IL ND+ EFEQV+
Sbjct  64    PSSTSFVHCDVTKEEDVENAVQTATNKYGELDIMFNNAGIIGTNKPNILDNDRVEFEQVI  123

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIP G GSI+N  SV ST  G   H+YTS+KH ++GL +NTAV
Sbjct  124   RVNLVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAV  183

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP++V  P+  +   L  D+ +   Y+NLKG VL+AED+AEAALYL S
Sbjct  184   ELGQHGIRVNCVSPYVVPTPLAKEFFKL-DDDGVHGAYSNLKGGVLRAEDIAEAALYLGS  242

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GHNL++DGG++ +N+  C+F
Sbjct  243   DESKYVSGHNLLVDGGYTIVNAGFCMF  269



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 193/257 (75%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVAL+TGG + IGE  ++LF KHGA+V   D  D++G  +C+DL+ ++A + HC+
Sbjct  12    KRLEGKVALITGGASGIGEATVRLFSKHGAQVVIADIQDEMGHSICKDLNNSSASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
               +E+DVE+AV+ TV+K+GKLDIM N A   GV K +IL+N  SEFE+V+ VN++G FLG
Sbjct  72    TTKETDVENAVNTTVSKYGKLDIMFNNAGISGVNKTNILENKLSEFEEVIKVNLIGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHA+R MIP   GSI+N  SV  +  G  PH+YTS+KHAVLGL +NTAVELG  GIRVN
Sbjct  132   TKHASRVMIPARRGSIINTASVGGSIGGAAPHAYTSSKHAVLGLMRNTAVELGPYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K L +  DE +  +Y+NLKG  L  EDVAEAALYL SDESKYV+GHN
Sbjct  192   CVSPYLVATPLAKKFLKI-DDEGILAVYSNLKGVNLVPEDVAEAALYLGSDESKYVSGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             L++DGGF+  NS  CIF
Sbjct  251   LIVDGGFTAGNSGFCIF  267



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 189/257 (74%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             + LEGKVAL+TGG + IGE   ++F KHGAKV   D  D LGE + +DL+ ++A + HC+
Sbjct  5     KWLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVFRDLNSSSASFVHCD  64

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+AV    +K+GKLDIM N A   G  KP+IL NDK+EFEQV+ VN+VG+FLG
Sbjct  65    VTKEEDIENAVKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLG  124

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP G GSI+N  SV ST  G  PH+YTS+KH V+GL KN AVELG+ GIRVN
Sbjct  125   IKHAARVMIPAGQGSIINTASVCSTIGGGAPHAYTSSKHGVVGLMKNAAVELGQYGIRVN  184

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+      L  D+ +  +Y+NLKG VL+ EDVAEAALYL SDESKYV+GHN
Sbjct  185   CVSPYLVATPLAKDFFNL-DDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHN  243

Query  329   LVIDGGFSTMNSTLCIF  279
             L++DGGFS +N   C+F
Sbjct  244   LLVDGGFSIVNPRFCMF  260



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 193/262 (74%), Gaps = 2/262 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PAAAV  885
             ++A RRL+GKVAL+TGG + IGE   +LF +HGAKV   D  D LG+ +C++L  P +A 
Sbjct  8     SAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSAS  67

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             + HC++  E DVE+A++  VAK+GKLDIM N A  +G +KP+IL NDK+EFE+++ VNVV
Sbjct  68    FVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVV  127

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FLGTKHAAR MIP G GSI+   SV ST  G   H+YTS+KHAV+GL +N AVELG+ 
Sbjct  128   GAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNAAVELGKY  187

Query  524   GIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             GIRVNCVSP++V  P+      L  D+    +Y+NLKG VL  EDVAEAALYLAS+ESKY
Sbjct  188   GIRVNCVSPYLVVTPLAKDFFKL-DDDGASGVYSNLKGKVLNPEDVAEAALYLASEESKY  246

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+GHNL+IDGGF+ +N    IF
Sbjct  247   VSGHNLLIDGGFTIVNPAFGIF  268



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 196/262 (75%), Gaps = 1/262 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG++ IGE   +LF+KHGAKV   D  D+LG  +C++L+P  A +
Sbjct  8     SAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E DVE+AV+  V+K+GKLDIM N A   G  K +I++NDK+EFE+++  N+VG
Sbjct  68    IHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKIICANLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   GSI+   SV +   G + H+YTS+KH VLGL +NTAVELG+ G
Sbjct  128   AFLGTKHAARVMIPARRGSIITTASVCAIIGGGSSHAYTSSKHGVLGLMRNTAVELGQYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP+ V  P+  K      D+++  +Y+NLK AVL+AED+AEAALYL SDESKYV
Sbjct  188   IRVNCVSPYAVPTPL-FKNFFKMNDDEVSCIYSNLKEAVLEAEDIAEAALYLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIFP  276
             +GHNLV+DGGF+ +N   C+FP
Sbjct  247   SGHNLVVDGGFTIVNPGFCMFP  268



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 188/255 (74%), Gaps = 1/255 (0%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             LEGKVAL+TGG + IGE   ++F KHGAKV   D  D LGE +C DL+ ++  + HC++ 
Sbjct  17    LEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCTDLNSSSVSFVHCDVT  76

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTK  684
             +E D+E+AV    +K+GKLDIM N A   G  KP+IL NDK+EFEQV+ VN+VG+FLGTK
Sbjct  77    KEEDIENAVKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTK  136

Query  683   HAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCV  504
             HAAR MIP G GSI+N  SV ST  G + H+YTS+KH V+GL KN AVELG+ GIRVNCV
Sbjct  137   HAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  196

Query  503   SPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLV  324
             SP++V  P+      L  D+ +  +Y+NLKG VL+ EDVAEAALYL SDESKYV+GHNL+
Sbjct  197   SPYLVATPLAKDFFNL-DDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLL  255

Query  323   IDGGFSTMNSTLCIF  279
             +DGGFS +N   C+F
Sbjct  256   VDGGFSIVNPMFCMF  270



>ref|XP_009340878.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=274

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 187/257 (73%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   ++F K GAKV   D  D LGE +C+DL+ ++A + HC+
Sbjct  16    RRLEGKVALITGGASGIGESTARVFSKLGAKVVIADVQDDLGESVCRDLNSSSASFVHCD  75

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E AV    +K+GKLDIM N A  +G  KP+IL N K+EFEQV+ VN+VG FLG
Sbjct  76    VTKEEDIEHAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLG  135

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP G GSI+N  SV ST  G   H+YTS+KH V+GL KN AVELG+ GIRVN
Sbjct  136   IKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYGIRVN  195

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+      L  D+ +  +Y+NLKG VL+ EDVAEAALYL SDESKYV+GHN
Sbjct  196   CVSPYLVATPLAKHFFNL-EDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHN  254

Query  329   LVIDGGFSTMNSTLCIF  279
             L++DGGFS +N   C+F
Sbjct  255   LLVDGGFSIVNPRFCMF  271



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 190/261 (73%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRL+GKVAL+TGG + IGE   +LF +HGAKV   D  D LG  +C+DL P +A +
Sbjct  8     SAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  E +VE+AV+  VA  GKLDIM N A   G  KP IL NDK+EFE+V+ VNVVG
Sbjct  68    VHCDVTNEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP G GSI+   SV ST  G   H+YTS+KHAV+GL +N AVELG+ G
Sbjct  128   AFLGTKHAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+  K L    D+ +  +Y+NLKG VL AEDVAEAALYLA DESKYV
Sbjct  188   IRVNCVSPYLVATPLA-KDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNL++DGGF+ +N +  IF
Sbjct  247   SGHNLLVDGGFTVVNPSFGIF  267



>emb|CDP06870.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 193/257 (75%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RL+GKVAL+TG  + IGE   +LF+K+GAKV   D  D L +K+CQDLDP++A + HC+
Sbjct  9     KRLQGKVALITGAASGIGESTARLFVKYGAKVVIADIQDDLAKKVCQDLDPSSASHVHCD  68

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
               +ESD+E+AV+ TV+K+GKLDIM N A   G    +IL + KS+FE+V+ VN+VG FLG
Sbjct  69    TTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFLG  128

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIPN  GSI+N  SV ST  G  PH+Y S+KHAV+GLT+NTA++LGR GIRVN
Sbjct  129   TKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLGRYGIRVN  188

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             C+SP+ V  P+    +       + K+Y  L GA LKAEDVA+AALYLASD+SKYV+GHN
Sbjct  189   CLSPYFVPTPLAADVVERIYG-GVSKVYKFLDGAELKAEDVADAALYLASDDSKYVSGHN  247

Query  329   LVIDGGFSTMNSTLCIF  279
             LV+DGG+S +NS +C+F
Sbjct  248   LVVDGGYSIVNSAMCMF  264



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 198/267 (74%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N+++AS    +RL+GKVAL+TG  + IGE   +LF+KHGAKV   D  D L +K+CQDLD
Sbjct  3     NMAIASNIM-KRLQGKVALITGAASGIGESAARLFVKHGAKVVIADIQDDLAKKVCQDLD  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P++A + HC+  +ESD+E+AV+ TV+K+GKLDIM N A   G    +IL + KS+FE+V+
Sbjct  62    PSSASHVHCDTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLGTKHAAR MIPN  GSI+N  S  ST  G  PH+Y S+KHAV+GLT+NTA+
Sbjct  122   SVNLVGVFLGTKHAARVMIPNRCGSIINTASSCSTLGGGAPHAYVSSKHAVVGLTRNTAI  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             +LGR GIRVNC+SP+ V  P+    +       + K+Y  L GA LKAEDVA+AALYLAS
Sbjct  182   DLGRYGIRVNCLSPYYVPTPLAADVVERIYG-GVSKVYKFLDGAELKAEDVADAALYLAS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             D+SKYV+GHNLV+DGG+S +NS +C+F
Sbjct  241   DDSKYVSGHNLVVDGGYSIVNSAVCMF  267



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 189/257 (74%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   +LF KHGA+V   D  D++G  +C+DL+ + A Y HC+
Sbjct  12    RRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDEMGHSICKDLNKSTASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
               +E D+E+AV+ TV+K+GKLDIM N A  +GV K +IL+N  SEFE+V+ VN++G FLG
Sbjct  72    TTKEKDIENAVNTTVSKYGKLDIMFNNAGIVGVNKTNILENKLSEFEEVIKVNLIGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHA+R MIP   GSI+N  SV  +  G   H+ TS+KHAVLGL KNTAVELG  GIRVN
Sbjct  132   TKHASRVMIPARRGSIINTASVCGSIGGGASHACTSSKHAVLGLMKNTAVELGPYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K   L  DE ++ +Y+NLKG  L  EDVAEAALYL SDESKYV+GHN
Sbjct  192   CVSPYVVATPLAKKFFKL-DDEGIQGVYSNLKGVNLVPEDVAEAALYLGSDESKYVSGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             LV+DGGF+  NS  CIF
Sbjct  251   LVVDGGFTVGNSGFCIF  267



>emb|CDP06872.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 198/265 (75%), Gaps = 2/265 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N+++AS    +RL+GKVAL+TGG + IGE   +LF+KHGAKV   D  D L +K+CQDLD
Sbjct  3     NMAIASNIM-KRLQGKVALITGGASGIGESTARLFVKHGAKVVIADIQDDLAKKVCQDLD  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P++A + HC+  +ESD+E+AV+  V+K+GKLDIM N A   G    +IL + KS FE+V+
Sbjct  62    PSSASHVHCDTTQESDIENAVNTAVSKYGKLDIMFNNAGIAGSGTSNILDDKKSGFERVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIPN  GSI+N  SV ST  G  PH+Y S+KHAV+GLT+NTAV
Sbjct  122   SVNLVGVFLGAKHAARVMIPNRCGSIINTASVCSTIVGAAPHAYVSSKHAVVGLTRNTAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             +LGR GIRVNC+SP+ V  P+ +  +    +  + K+Y  L GAVLKA+DVA+AALYLAS
Sbjct  182   DLGRYGIRVNCLSPYFVPTPMAVDFIE-RINGGVSKVYTYLDGAVLKADDVADAALYLAS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLC  285
             D+SKYV+GHNLV+DGG+S +NS +C
Sbjct  241   DDSKYVSGHNLVVDGGYSIVNSAMC  265



>ref|XP_003539841.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN21178.1| Momilactone A synthase [Glycine soja]
Length=273

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 186/254 (73%), Gaps = 1/254 (0%)
 Frame = -1

Query  1040  EGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIVE  861
             EGKVAL+TGG + IGE   +LF KHGAKV   D  D+LG  +C+DLD ++A Y HC++ +
Sbjct  17    EGKVALITGGASGIGECTARLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTK  76

Query  860   ESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTKH  681
             E ++E AV+ TV+K+GKLDIM ++A  +G   PSIL N KS FEQV+ VN+VGTFLG KH
Sbjct  77    EENIEHAVNTTVSKYGKLDIMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKH  136

Query  680   AARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCVS  501
             AAR MIP+G GSIV + S+     G   H+YTS+KH ++GL +NTAVELG  GIRVN VS
Sbjct  137   AARVMIPSGRGSIVAMASICGRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVS  196

Query  500   PFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLVI  321
             P+ V  P+    L  T DE +  LY+NLKG VLK +DVAEA LYL SDESKYV+GH+LV+
Sbjct  197   PYAVPTPMSKTFLN-TDDEGIAALYSNLKGTVLKPQDVAEAVLYLGSDESKYVSGHDLVV  255

Query  320   DGGFSTMNSTLCIF  279
             DGGF+ +N  LC+F
Sbjct  256   DGGFTVVNPGLCVF  269



>emb|CDP06869.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 196/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N+++AS    +RL+GKVAL+TG  + IGE   +LF+KHGAKV   D  D L +K+CQDLD
Sbjct  3     NMAVASNVM-KRLQGKVALITGAASGIGESAARLFVKHGAKVVVADIQDDLAQKVCQDLD  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P++A + HC++ +ESD+E+AV+  V+K+GKLDIM N A   G    +IL + KS+FE+V+
Sbjct  62    PSSASHVHCDVTQESDIENAVNTAVSKYGKLDIMFNNAGIGGSRTSNILDDKKSDFERVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLG KHAAR MIPN  GSI+N  SV ST  G  PH+Y S+KHAV+GLT+NTAV
Sbjct  122   SVNLVGIFLGAKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             +LGR GIRVNC+SP+ V  P     +       + K+Y  L GA LKAEDVA+AALYLAS
Sbjct  182   DLGRYGIRVNCLSPYFVSTPSAADFVERIYG-GVSKVYTYLDGAELKAEDVADAALYLAS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             D+SKYV+GHNLV+DGG S +NS +C++
Sbjct  241   DDSKYVSGHNLVVDGGHSIVNSAMCMY  267



>gb|ACU18308.1| unknown [Glycine max]
Length=273

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 186/254 (73%), Gaps = 1/254 (0%)
 Frame = -1

Query  1040  EGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIVE  861
             EGKVAL+TGG + IGE   +LF KHGAKV   D  D+LG  +C+DLD ++A Y HC++ +
Sbjct  17    EGKVALITGGASGIGECTARLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTK  76

Query  860   ESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTKH  681
             E ++E AV+ TV+K+GKLDIM ++A  +G   PSIL N KS FEQV+ VN+VGTFLG KH
Sbjct  77    EENIEHAVNTTVSKYGKLDIMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKH  136

Query  680   AARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCVS  501
             AAR MIP+G GSIV + S+     G   H+YTS+KH ++GL +NTAVELG  GIRVN VS
Sbjct  137   AARVMIPSGRGSIVAMASICGRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVS  196

Query  500   PFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLVI  321
             P+ V  P+    L  T DE +  LY+NLKG VLK +DVAEA LYL SDESKYV+GH+LV+
Sbjct  197   PYAVPTPMSKTFLN-TDDEGIAALYSNLKGTVLKPQDVAEAVLYLGSDESKYVSGHDLVV  255

Query  320   DGGFSTMNSTLCIF  279
             DGGF+ +N  LC+F
Sbjct  256   DGGFTAVNPGLCVF  269



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 186/258 (72%), Gaps = 1/258 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLE KVALVT G + +G    KLF +HGAKV   D  D+LG  +C++L P++A + HC+
Sbjct  13    RRLEAKVALVTDGASGLGRSCAKLFSQHGAKVVIADIQDELGHSVCKELGPSSASFIHCD  72

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDVE+AV+  VA+ GKLDIM+  A  +G    +IL ND+ +F+QV+ VNV+G FLG
Sbjct  73    VTNESDVENAVNGAVARHGKLDIMLINAGIIGSPTVNILANDRGDFQQVLNVNVIGPFLG  132

Query  689   TKHAARAMI-PNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             TKHAAR MI  NG GSI+N+ S+ S   G TPH+YTS+KHAVLGLT+NTAVELGR GIRV
Sbjct  133   TKHAARVMILANGGGSIINMASICSIIGGATPHAYTSSKHAVLGLTRNTAVELGRFGIRV  192

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGH  333
             NC+SP+ V  P   K L L  D  +   Y+NLKG  LK EDVAEAALYL S++S YV+GH
Sbjct  193   NCISPYAVATPQSRKFLKLEEDAAIVDAYSNLKGVALKPEDVAEAALYLGSEDSSYVSGH  252

Query  332   NLVIDGGFSTMNSTLCIF  279
             NLV+DG F+ +N   C+F
Sbjct  253   NLVLDGAFTVLNQGFCMF  270



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 185/255 (73%), Gaps = 1/255 (0%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             LEGKVAL+TGG + IGE   +LF +HGAKV   D  D LG  +C+DL P +A + HC++ 
Sbjct  35    LEGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVT  94

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTK  684
              E +VE+AV+  VA  GKLDIM N A   G  KP IL NDK+EFE+V+ VNVVG FLGTK
Sbjct  95    NEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTK  154

Query  683   HAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCV  504
             HAAR MIP G GSI+   SV ST  G   H+YTS+KHAV+GL +N AVELG+ GIRVNCV
Sbjct  155   HAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  214

Query  503   SPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLV  324
             SP++V  P+  K L    D+ +  +Y+NLKG VL AEDVAEAALYLA DESKYV+GHNL+
Sbjct  215   SPYLVATPLA-KDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLL  273

Query  323   IDGGFSTMNSTLCIF  279
             +DGGF+ +N +  IF
Sbjct  274   VDGGFTVVNPSFGIF  288



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 190/262 (73%), Gaps = 3/262 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             + A RRLEGKVA++TGG   IGE   +LF KHGA+V   D  D LG+ +C+DL P  A +
Sbjct  8     SQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGKSVCKDLGPETASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  ESD+++A+   V K GKLDIMVN A     +K SIL NDK++FE+V+ VN+ G
Sbjct  68    VHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAARAMIP+  GSI+NLGSV S+  G   H+YTS+KHAVLGLT+N A ELGR G
Sbjct  128   VFLGTKHAARAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRNVAAELGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLK-KLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             +R+NC+SP+ +  P+  KA+    DED   ++Y+N+ G  L+ EDVAEAALYL SDESKY
Sbjct  188   VRINCLSPYFILTPL-TKAI-FQIDEDAGVRVYSNMDGVTLRQEDVAEAALYLGSDESKY  245

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+GHNL +DGGF+T+N    +F
Sbjct  246   VSGHNLAVDGGFTTINPAFGLF  267



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 188/267 (70%), Gaps = 1/267 (0%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S+ S  A +RLEGKVAL+TGG   +G    KLF +HGAK+   D  D LG ++C+ L 
Sbjct  3     NTSLLSAVA-KRLEGKVALITGGAGRLGSATAKLFHEHGAKILIADVQDDLGRRICKTLS  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
             P  A Y HC+I  ES VE+AV+  ++K GKLDIM N A  +G T   +L   KS+FE+V+
Sbjct  62    PQTASYIHCDITNESHVENAVEEAISKHGKLDIMFNNAGVMGPTNTDMLVETKSDFERVL  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+ GTFLGTKHAAR M P   G+I+N  SV+S   G   H+YTS+KHAVLGLT+NTAV
Sbjct  122   NVNITGTFLGTKHAARVMKPAHRGTIINTASVSSVIGGACTHAYTSSKHAVLGLTRNTAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELGR GIRVNCVSP+   +P+   ALG   D+ +  +Y+NL G+ L AEDVA+A LYLAS
Sbjct  182   ELGRYGIRVNCVSPYAFASPMSRGALGRDKDDPMVDIYSNLDGSNLTAEDVAQAVLYLAS  241

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DES+YV+G NLV+DGGFS  NS+L +F
Sbjct  242   DESRYVSGSNLVVDGGFSVTNSSLSMF  268



>ref|XP_006481514.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=276

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 193/266 (73%), Gaps = 6/266 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             ++A RRL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  +++  
Sbjct  8     SAAARRLQGKVALITGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSA  67

Query  884   ----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
                 Y HC++ +E D+E+AV+  V+++GKLDIM N A  +   KP+IL ND++EFE+++ 
Sbjct  68    NGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILS  127

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN+VG FLGTKHAAR M P G GSI++  SV     G T H+YTS+KH V+GL KNTAVE
Sbjct  128   VNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVE  187

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LGR GIRVNCVSP+ V +P+    L L  D+ +  +Y+NL GAVLK EDVAEAALYL SD
Sbjct  188   LGRFGIRVNCVSPYAVSSPMAKGFLKL-DDDGMSGIYSNLSGAVLKPEDVAEAALYLGSD  246

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESK V+GHNLV+DGGF+ +N  LC+F
Sbjct  247   ESKCVSGHNLVVDGGFTIVNEGLCMF  272



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 189/268 (71%), Gaps = 7/268 (3%)
 Frame = -1

Query  1070  MASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS S      RRLEGKVA++TGG + IGE   +LF KHGA V   D  D LG  +C+ L
Sbjct  1     MASVSLVSATGRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSICKHL  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             + A+  Y HC++  E+DVE+ V+ TV+K GKLDIM N A   GV K SIL N KSEFE+V
Sbjct  61    ESAS--YVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEV  118

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN+VG FLGTKHAAR MIP   GSIVN  SV  +  G   H+YTS+KHAV+GLTKNTA
Sbjct  119   INVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTA  178

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             VELG  G+RVNCVSP++V  P+      L  D+ ++ +Y+NLKG  L   DVAEAALYLA
Sbjct  179   VELGAFGVRVNCVSPYVVATPLAKNFFKL-DDDGVQGIYSNLKGTDLVPNDVAEAALYLA  237

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             SDESKYV+GHNLV+DGGF+ +NS  C+ 
Sbjct  238   SDESKYVSGHNLVVDGGFTVVNSGFCVL  265



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 190/260 (73%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV--YFH  876
             RRLEGKVAL+TG  + IGE   +LF KHGA+V   D  D+LG  LC+++D       + H
Sbjct  9     RRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCSFVH  68

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++ +E DVE+A+++ V+K+GKLDIM N A  +GV KP+IL N+K+EFE+++ VN+VG F
Sbjct  69    CDVTKEEDVENALNSAVSKYGKLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAF  128

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LGTKHAAR MIPN  GSI+   S+ ST  G   H+YTS+KH V+GL +NTAVELG+ GIR
Sbjct  129   LGTKHAARVMIPNRKGSIITTASICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQHGIR  188

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VNCVSP++V  P+      L  D  +  +Y+NLK AVL+ EDVA+AALYL SD+SKY++G
Sbjct  189   VNCVSPYVVNTPLARDFFKL-DDNGIYDVYSNLKEAVLQPEDVAQAALYLGSDDSKYISG  247

Query  335   HNLVIDGGFSTMNSTLCIFP  276
             HN++IDGGF+ +N    IFP
Sbjct  248   HNMIIDGGFTIVNPAFSIFP  267



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 190/261 (73%), Gaps = 0/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG + IGE   +LF +HGA+V   D  D  G  +C++L  +++ Y
Sbjct  8     SNALRRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
               C++ +E D+E+AV+ TV K+GKLDIM N A   GV K  IL+N  SEFE V+ VN+ G
Sbjct  68    VRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHA+R MIP   GSI+N  SV  +  G  PH+YTSAKHAV+GL +NTA+ELGR G
Sbjct  128   VFLGTKHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP+IV  P+  K   L  D+D+  +Y+NLKGA L  +DVAEAALYL SDESKYV
Sbjct  188   IRVNCVSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSDESKYV  247

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNLVIDGGF+ +N+  C+F
Sbjct  248   SGHNLVIDGGFTVVNNGFCVF  268



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 183/261 (70%), Gaps = 2/261 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG + IGE   +LF KHGA+V   D  D LG  +C+DL+ A+  +
Sbjct  8     SAALRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDLESAS--F  65

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HCN+ +E +VE+AV+  V+K GKLDIM N A   G    SIL N KSEFEQV  VNV G
Sbjct  66    VHCNVTKEDEVETAVNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQVFSVNVSG  125

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   GSI+N  S +    G  PH YTS+KHAV+GL +NTAVEL   G
Sbjct  126   AFLGTKHAARVMIPARRGSIINTASTSGVIGGGAPHPYTSSKHAVVGLMRNTAVELEAYG  185

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             +RVNCVSP+ V  P+      L  ++++ K Y+NLKGA L  EDVAEA LYL SDESKYV
Sbjct  186   VRVNCVSPYFVPTPMVKNFFKLGEEDEVPKFYSNLKGADLVPEDVAEAVLYLGSDESKYV  245

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNLV+DGGF+ +N+  C+F
Sbjct  246   SGHNLVVDGGFTVLNNGFCVF  266



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 190/264 (72%), Gaps = 2/264 (1%)
 Frame = -1

Query  1067  ASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             A T+A RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D LG+ +C++L P+ A
Sbjct  6     ALTAAARRLEGKVALITGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNLGPSVA  65

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG-VTKPSILQNDKSEFEQVMGVN  711
              Y HC++  E+ V++AVD+TVAK+ KLDIM N A   G   K +IL   +SEFE+++ VN
Sbjct  66    SYIHCDVTNEAHVQNAVDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEEIIKVN  125

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             ++G FLGTKHAAR MIP   GSI+   S  S   G  PH+YTS+KH ++GLT+NTAVELG
Sbjct  126   LIGPFLGTKHAARVMIPAKQGSIITTASTCSVIGGGAPHAYTSSKHGIVGLTRNTAVELG  185

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             + GIRVNCVSP ++  P+    L L  DE + K Y+NLKGA  K EDVA AAL+LASD+S
Sbjct  186   KYGIRVNCVSPHVISTPLVKNFLKL-DDEGVSKFYSNLKGASCKVEDVANAALFLASDDS  244

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             K+++GHNLV+DGGF+ MN   C+F
Sbjct  245   KFISGHNLVVDGGFTIMNPGFCMF  268



>ref|XP_006424148.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37388.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=276

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 192/266 (72%), Gaps = 6/266 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             ++A RRL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  +++  
Sbjct  8     SAAARRLQGKVALITGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSA  67

Query  884   ----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
                 Y HC++ +E D+E+AV+  V+++GKLDIM N A  +   KP+IL ND++EFE+++ 
Sbjct  68    NGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILS  127

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN+VG FLGTKHAAR M P G GSI++  SV     G T H+YTS+KH V+GL KNTAVE
Sbjct  128   VNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVE  187

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LGR GIRVN VSP+ V +P+    L L  D+ +  +Y+NL GAVLK EDVAEAALYL SD
Sbjct  188   LGRFGIRVNSVSPYAVSSPMAKGFLKL-DDDGMSGIYSNLSGAVLKPEDVAEAALYLGSD  246

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESK V+GHNLV+DGGF+ +N  LC+F
Sbjct  247   ESKCVSGHNLVVDGGFTIVNEGLCMF  272



>ref|XP_006481515.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=273

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 192/269 (71%), Gaps = 6/269 (2%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             + + S   RL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  ++
Sbjct  2     LQANSMSPRLQGKVALITGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDISSSS  61

Query  890   AV-----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQ  726
             +      Y HC++ +E D+E+AV+  V+++GKLDIM N A  +   KP+IL ND++EFE+
Sbjct  62    SSANGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFER  121

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             ++ VN+VG FLGTKHAAR M P G GSI++  SV     G T H+YTS+KH V+GL KNT
Sbjct  122   ILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGLMKNT  181

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYL  366
             AVELGR GIRVNCVSP+ V +P+    L L  D+ +  +Y+NL GAVLK EDVAEAALYL
Sbjct  182   AVELGRFGIRVNCVSPYAVSSPMAKGFLKL-DDDGMSGIYSNLSGAVLKPEDVAEAALYL  240

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              SDESK V+GHNLV+DGGF+ +N  LC+F
Sbjct  241   GSDESKCVSGHNLVVDGGFTIVNEGLCMF  269



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   312 bits (800),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 200/274 (73%), Gaps = 6/274 (2%)
 Frame = -1

Query  1085  NLNLSMAS----TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEK  918
             N +LSMAS    ++A RRL+GKVAL+TGG + IGE   +LF +HGAKV   D  D LG+ 
Sbjct  589   NSHLSMASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQS  648

Query  917   LCQDLD-PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDK  741
             +C++L  P +A + HC++  E DVE+A++  VAK+GKLDIM N A  +G +KP+IL NDK
Sbjct  649   VCKELSSPTSASFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDK  708

Query  740   SEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLG  561
             +EFE+++ VNVVG FLGTKHAAR MIP G GSI+   SV ST  G   H+YTS+KHAV+G
Sbjct  709   TEFEKILNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVG  768

Query  560   LTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAE  381
             L +N AVELG+ GIRVNCVSP++V  P+      L  D+    +Y+NLKG VL  EDVAE
Sbjct  769   LARNAAVELGKYGIRVNCVSPYLVVTPLAKDFFKL-DDDGASGVYSNLKGKVLNPEDVAE  827

Query  380   AALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             AALYLAS+ESKYV+GHNL+IDGGF+ +N    IF
Sbjct  828   AALYLASEESKYVSGHNLLIDGGFTIVNPAFGIF  861


 Score =   296 bits (758),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 182/252 (72%), Gaps = 1/252 (0%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             L GKVAL+TGG + IGE   +LF +HGAKV   D  D LG  +C+DL P +A + HC++ 
Sbjct  285   LNGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVT  344

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTK  684
              E +VE+AV+  VA  GKLDIM N A   G  KP IL NDK+EFE+V+ VNVVG FLGTK
Sbjct  345   NEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTK  404

Query  683   HAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCV  504
             HAAR MIP G GSI+   SV ST  G   H+YTS+KHAV+GL +N AVELG+ GIRVNCV
Sbjct  405   HAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  464

Query  503   SPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLV  324
             SP++V  P+  K L    D+ +  +Y+NLKG VL AEDVAEAALYLA DESKYV+GHNL+
Sbjct  465   SPYLVATPLA-KDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLL  523

Query  323   IDGGFSTMNSTL  288
             +DGGF+ +N + 
Sbjct  524   VDGGFTVVNPSF  535


 Score =   293 bits (750),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 177/247 (72%), Gaps = 0/247 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IG    KLF +HGAKV   D   + G  +C+DL P +A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DV +A+D  ++K+GKLDIM N A  LG  +P+IL ND  EFE  M VNV+GTFLG
Sbjct  72    VTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M P G GSI+N  SV S   G   HSYTS+KHA+LGLT+NTAVELG+ GIRVN
Sbjct  132   TKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V   +  K + L  D+   K+Y+NLKG  L+ EDVAEA LY+ SD+SKYV+GHN
Sbjct  192   CVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKYVSGHN  251

Query  329   LVIDGGF  309
             LV+DG F
Sbjct  252   LVLDGSF  258



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 186/256 (73%), Gaps = 0/256 (0%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVAL+TGG + IGE   +LF +HGA+V   D  D  G  +C++L  +++ Y  C++
Sbjct  7     RLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDV  66

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
              +E D+E+AV+ TV K+GKLDIM N A   GV K  IL+N  SEFE V+ VN+ G FLGT
Sbjct  67    TKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGT  126

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHA+R MIP   GSI+N  SV  +  G  PH+YTSAKHAV+GL +NTA+ELGR GIRVNC
Sbjct  127   KHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFGIRVNC  186

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNL  327
             VSP+IV  P+  K   L  D+D+  +Y+NLKGA L  +DVAEAALYL SDESKYV+GHNL
Sbjct  187   VSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSDESKYVSGHNL  246

Query  326   VIDGGFSTMNSTLCIF  279
             VIDGGF+ +N+  C+F
Sbjct  247   VIDGGFTVVNNGFCVF  262



>gb|AEC10992.1| alcohol dehydrogenase [Camellia sinensis]
Length=277

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 186/261 (71%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D LG  +C+DLD  +  +
Sbjct  8     SAAARRLEGKVALITGGASGIGECTARLFSKHGAKVMIADIQDDLGLSVCKDLDEKSVSF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  E+ V +AVDA VA+FGKLDIM N A  +G+ KP+IL NDK EFE+++ VN+VG
Sbjct  68    VHCDVTNETHVMNAVDAAVAQFGKLDIMYNNAGIVGLAKPNILDNDKDEFEKIIRVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTK AAR MI N  G+I+   SV S   G   H+YTS+KH V GLTKN AVE G+ G
Sbjct  128   AFLGTKQAARVMILNRRGTIITTASVCSPIGGVASHAYTSSKHGVAGLTKNVAVEFGQHG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+      L  DE +  +Y+NLKGAVL+ EDVA+AALYL SD+S YV
Sbjct  188   IRVNCVSPYLVGTPLAKDFYKL-DDEGVYGVYSNLKGAVLRPEDVAQAALYLGSDDSMYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHN ++DGGF+ +N   C+F
Sbjct  247   SGHNFIVDGGFTIVNPGFCMF  267



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 190/260 (73%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV--YFH  876
             RRLEGKVAL+TG  + IGE   +LF KHGA+V   D  D+LG  + +++D       + H
Sbjct  9     RRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSVRKEIDRDGKYCSFVH  68

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++ +E DVE+AV++ V+K+G+LDIM N A  +G  KP+IL N+K+EFE+++ VN+VG F
Sbjct  69    CDVTKEEDVENAVNSAVSKYGELDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLVGAF  128

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LGTKHAAR MIPN  GSI+   SVAST  G  PH+YTS+KH V+GL +NTAVELG+ GIR
Sbjct  129   LGTKHAARVMIPNRKGSIMTTASVASTIGGLAPHAYTSSKHGVVGLMRNTAVELGQHGIR  188

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VNC+SP++V  P+      L  D  +  +Y+NLK AVL+ EDVA+AALYL SD+SKY++G
Sbjct  189   VNCISPYVVNTPLARDFFKL-DDHGVYDVYSNLKEAVLEPEDVAQAALYLGSDDSKYISG  247

Query  335   HNLVIDGGFSTMNSTLCIFP  276
             HN++IDGGF+ +N    IFP
Sbjct  248   HNMIIDGGFTIVNPAFSIFP  267



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 185/261 (71%), Gaps = 3/261 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVA++TGG + IGE   +LF KHGA V   D  D LG  L ++L+ A+  Y
Sbjct  8     SAAGKRLEGKVAMITGGASGIGEATARLFSKHGAHVVIADIQDHLGLSLSKELESAS--Y  65

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  E  VE+AV+  V+K GKLD M N A   G  K SIL N KSEFE V+ VN+VG
Sbjct  66    IHCDVTNEDHVENAVNTVVSKHGKLDTMFNNAGITGANKTSILDNTKSEFEAVINVNLVG  125

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP G GSIVN  SV  +  G   H+YTS+KH V+GLT+NTAVELG  G
Sbjct  126   VFLGTKHAARVMIPAGRGSIVNTASVCGSIGGVASHAYTSSKHGVVGLTRNTAVELGAFG  185

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             +RVNCVSP++V  P+      L  D+ +  +Y NLKGAVL+ +DVAEAALYLASDESKYV
Sbjct  186   VRVNCVSPYVVATPLAKNFFKL-DDKGVHGVYTNLKGAVLEPKDVAEAALYLASDESKYV  244

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNLV+DG F+ +N+  C+F
Sbjct  245   SGHNLVVDGAFTVVNNGFCVF  265



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 185/264 (70%), Gaps = 2/264 (1%)
 Frame = -1

Query  1067  ASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             A T+A RRLEGKVAL+TGG + IG    KLF KHGAKV   +  D LG  +C+ LDP+ A
Sbjct  6     AFTAAARRLEGKVALITGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSLDPSVA  65

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGV-TKPSILQNDKSEFEQVMGVN  711
              Y HC++  E  V++AVD+TVAK+ KLDIM N A   G   KP+IL   +S+FE+ +  N
Sbjct  66    SYIHCDVTNEDHVQNAVDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEETVKTN  125

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             ++G FLGTKHAAR MIP   GSI+   SV S   G  PH+YTS+KH VLGLT++T VE G
Sbjct  126   LIGPFLGTKHAARVMIPARQGSIITTASVCSIIGGVAPHAYTSSKHGVLGLTRSTTVEFG  185

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             + GIRVNCVSP  V  P+  K L L  DE + K+Y+NLKG   K EDVA AAL+LASD+S
Sbjct  186   QYGIRVNCVSPHAVPTPLFNKFLQL-DDEGISKIYSNLKGTWCKVEDVANAALFLASDDS  244

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             KYV+GHNL +DGGF+ MNS  C+F
Sbjct  245   KYVSGHNLTVDGGFTIMNSGFCMF  268



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 180/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IG    KLF +HGAKV   D   + G  +C+DL P +A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DV +A+D  ++K+GKLDIM N A  LG  +P+IL ND  EFE  M VNV+GTFLG
Sbjct  72    VTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M P G GSI+N  SV S   G   HSYTS+KHA+LGLT+NTAVELG+ GIRVN
Sbjct  132   TKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V   +  K + L  D+   K+Y+NLKG  L+ EDVAEA LY+ SD+SKYV+GHN
Sbjct  192   CVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKYVSGHN  251

Query  329   LVIDGGFSTMNST  291
             LV+DGG + +  +
Sbjct  252   LVLDGGVTILTPS  264



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 180/258 (70%), Gaps = 3/258 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVAL+TGG + IGE  ++LF +HGAKV   D  D LG  +C D+   AA + HC+
Sbjct  13    KRLEGKVALITGGASGIGESTVRLFCRHGAKVVIADVQDDLGHSVCNDIGSKAASFVHCD  72

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ES +  AVD TVAK+GKLDIM N A  +G   P+IL NDK EFEQV+ VN+ G FLG
Sbjct  73    VTNESHIRKAVDTTVAKYGKLDIMFNNAGIVGTPNPNILDNDKGEFEQVLAVNITGPFLG  132

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI++  SV S   G   H+YT +KHAV+GLTKN AVELG+ G+RVN
Sbjct  133   TKHAARVMIPARRGSIISTASVCSLVGGVASHAYTCSKHAVVGLTKNAAVELGKFGVRVN  192

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKK-LYNNLKGAVLKAEDVAEAALYLASDESKYVNGH  333
             CVSP++V  P+  K   L  DE+    +Y+NLKG +L  EDVAEA LYL SD+S YV+GH
Sbjct  193   CVSPYLVVTPLTKKFFNL--DENGSPGIYSNLKGRMLWPEDVAEAVLYLGSDDSLYVSGH  250

Query  332   NLVIDGGFSTMNSTLCIF  279
             NLV+DGGF+ +N    I 
Sbjct  251   NLVVDGGFTIVNPAFGII  268



>ref|XP_006481516.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   291 bits (746),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 190/266 (71%), Gaps = 6/266 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             ++A RRL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  +++  
Sbjct  8     SAAARRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIGSSSSSA  67

Query  884   ----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
                 Y HC++ +E D+E+AV+  V ++GKLDIM N A  +   KP+IL ND++EFE+++ 
Sbjct  68    SGCSYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILS  127

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             +N+VG FLGTKHAAR M P G GSI++  SV     G   H+Y S+KH +LGL KNTAVE
Sbjct  128   INLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVE  187

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LGR GIRVNCVSP++V  P+    L L  D+ L  +Y+NLKGAVL+ ED+AEAALYL SD
Sbjct  188   LGRFGIRVNCVSPYVVSTPLAKDFLKL-ADDGLGGMYSNLKGAVLEPEDIAEAALYLGSD  246

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESK V+GHNLV+DGGF+ +N+   +F
Sbjct  247   ESKCVSGHNLVVDGGFAIVNAGFSVF  272



>ref|XP_006424147.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37387.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=273

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 191/269 (71%), Gaps = 6/269 (2%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             + + S   RL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  ++
Sbjct  2     LQANSMSPRLQGKVALITGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDISSSS  61

Query  890   AV-----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQ  726
             +      Y HC++ +E D+E+AV+  V+++GKLDIM N A  +   KP+IL ND++EFE+
Sbjct  62    SSANGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFER  121

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             ++ VN+VG FLGTKHAAR M P G GSI++  SV     G T H+YTS+KH V+GL KNT
Sbjct  122   ILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGLMKNT  181

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYL  366
             AVELGR GIRVN VSP+ V +P+    L L  D+ +  +Y+NL GAVLK EDVAEAALYL
Sbjct  182   AVELGRFGIRVNSVSPYAVSSPMAKGFLKL-DDDGMSGIYSNLSGAVLKPEDVAEAALYL  240

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              SDESK V+GHNLV+DGGF+ +N  LC+F
Sbjct  241   GSDESKCVSGHNLVVDGGFTIVNEGLCMF  269



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 185/261 (71%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A RRLEGKVAL+TGG + IGE   +LF  HGA+V   D  D +G  +CQ+L  ++A Y
Sbjct  8     SAALRRLEGKVALITGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQELHKSSATY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E D+E+AV+ TV+K GKLDIM N A   G+ K +IL+N  SEF++V+ +N+ G
Sbjct  68    VHCDVTKEKDIENAVNTTVSKHGKLDIMFNNAGITGINKTNILENKLSEFQEVIDINLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR M P   GSI+N  SV     G   H+YTS+KHAV+GL KNTA+ELG  G
Sbjct  128   VFLGTKHAARVMTPVRRGSIINTASVCGCIGGVASHAYTSSKHAVVGLMKNTAIELGPYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+      L  D+ +  +Y+NLKGA L  +DVAEAALYL SDESKYV
Sbjct  188   IRVNCVSPYVVGTPLAKNFFKL-DDDGVLDVYSNLKGANLLPKDVAEAALYLGSDESKYV  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNLV+DGG +  N+  CIF
Sbjct  247   SGHNLVVDGGLTVGNNGFCIF  267



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 192/267 (72%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             ++S+ ST A RRLEGKVAL+TGG   IGE   + F KHGAKV   DT D+L   +C+DL+
Sbjct  3     SVSLLSTVA-RRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLN  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
               +A + HC+I +E+DVE+AV+  +++ GKLD+M N A  +GV K +++    SEFE+V+
Sbjct  62    SESASFIHCDITKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLGTKHAAR M P   GSI+   SV     G   H+YTS+KH VLGL +NTAV
Sbjct  122   RVNLVGPFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNTAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+ V   +    L +T DE ++  Y+NLKGA+L  EDVAEAALYLAS
Sbjct  182   ELGQFGIRVNCVSPYTVATEMSRNFLKMTDDE-IRSGYSNLKGAILTPEDVAEAALYLAS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             D+S+YV+GHNLV+DGG++ +N+  C++
Sbjct  241   DDSRYVSGHNLVVDGGYTIVNNGSCMY  267



>ref|XP_004136701.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004164972.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=278

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 190/270 (70%), Gaps = 3/270 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQD-L  903
             N  +++T+  RRLEGKVAL+TGG + IGE   KLF+ HGAKV   D  D LG  LC + L
Sbjct  4     NEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCANVL  63

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
                 ++Y HC++ EES V+ AV A V  FGKLDIM+N A     +KP I+ NDK +F++V
Sbjct  64    GSTNSLYVHCDVTEESQVQEAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDFDRV  123

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + +NV G FLG KHAA+AMIP   GSI++  SVAS T G+  H+YT +KHAV+GLTKN A
Sbjct  124   LSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTKNAA  183

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEAALY  369
             VELG+ GIRVNC+SPF +  P+  K +GL   E  K + +  NLKG  LKAEDVA AAL+
Sbjct  184   VELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANAALF  243

Query  368   LASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             LASDES+YV+GHNL IDGGFS +N  + IF
Sbjct  244   LASDESRYVSGHNLFIDGGFSIVNPNIDIF  273



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 188/268 (70%), Gaps = 7/268 (3%)
 Frame = -1

Query  1070  MASTSA----DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS S     DRRLEGKVAL++GG + IGE   +LF KHGA V   D  D LG  LC+ L
Sbjct  1     MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             + A+  Y HC++  E+DV++AV+  ++K+G LDIM N A  +   K SIL N K +FE+V
Sbjct  61    ESAS--YVHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERV  118

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN+VG FLGTKHAAR MIP   GSI+N  SVA T +G   H+YTS+KHA++GL KNTA
Sbjct  119   ISVNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTA  178

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             VELG+ GIRVNC+SP++V  P+  K   L  D +  ++Y+NLKG  L   DVAEAALYLA
Sbjct  179   VELGQFGIRVNCLSPYVVATPLTKKCFNLDEDRN-GEIYSNLKGVHLVPNDVAEAALYLA  237

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              DESKYV+GHNLV+DGGF+ +N    +F
Sbjct  238   GDESKYVSGHNLVLDGGFTNLNVGFSVF  265



>ref|XP_009605454.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nicotiana tomentosiformis]
Length=263

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 187/264 (71%), Gaps = 2/264 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             MAS  A RRL+GKVA++TG  + IGE   +LF  HGAKV   D  D+L +K+C+DLDP +
Sbjct  1     MASNVA-RRLKGKVAIITGAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTS  59

Query  890   AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVN  711
               + HC+I +E D+E+A +  V K+GKLDIM N A  +G+ K +IL+++K EFE+V  VN
Sbjct  60    TTFVHCDITKEEDLENAANTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVN  119

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             +VGTFLGTK AAR MIPNG GSI+   S+ +T  G+  H+YT +KH VLGLT+N AV+LG
Sbjct  120   LVGTFLGTKQAARVMIPNGRGSIITTASITATIGGSGSHAYTCSKHGVLGLTRNAAVDLG  179

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             R GIRVNCVSP++V  P+ +  L +   +    +Y+ L GA L  +DVAE AL+LASDES
Sbjct  180   RFGIRVNCVSPYLVLTPLALDYLKM-NGKKASDVYSTLNGATLTPKDVAETALFLASDES  238

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             KYV+G N ++DGGF+  N  L IF
Sbjct  239   KYVSGQNFIVDGGFTAENPGLSIF  262



>ref|XP_006362152.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 181/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRL+GKVA++TG  + IGE   KLF ++GAKV   D  D L  K+C+DLDP++  + HC+
Sbjct  7     RRLKGKVAIITGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCD  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+ V+  V K+GKLDIM N A  +G  K +IL+N+KS+FE+V+  N+VGTFLG
Sbjct  67    VTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP G GSI+  GSV S+  G  PH+YTS+KH +LGLT+N AV+LGR GIRVN
Sbjct  127   IKQAARVMIPRGQGSIITTGSVCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+++     +  L     ED   +Y++LKGA L   DVAE A++LASDESKYVNG +
Sbjct  187   CVSPYVILTASALNTLKKMGKED-SDVYSSLKGATLTPNDVAETAVFLASDESKYVNGQD  245

Query  329   LVIDGGFSTMNSTLCIF  279
              +IDGGF+  N    +F
Sbjct  246   FIIDGGFTIENRGFSMF  262



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG   IG    KLF +HGAKV   D  D+ G  +C+DL P++A + HC+
Sbjct  12    RRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSASFIHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DV +A+D  VAK GKLDIM N A  LG    +IL ND +EFE  M VNV+G FLG
Sbjct  72    VTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M+P G G ++N  SV S   G   HSY S+KHA+LGLT+NTAVELG+ GIRVN
Sbjct  132   TKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTAVELGKFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K L    D+ L+ +Y+NLKG  L  +DVAEA LYL SD+SKYV+G+N
Sbjct  192   CVSPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLYLGSDDSKYVSGNN  251

Query  329   LVIDGGFS  306
             LVIDGG +
Sbjct  252   LVIDGGVT  259



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 188/261 (72%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             + A RRLEGKVA++TGG   IGE   +LF KHGA+V   D  D LGE +C+DL P  A +
Sbjct  8     SRAARRLEGKVAMITGGAGDIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  ESDVE A++  V K GKLDIMVN A      K +IL NDK++FE+V+ VN+ G
Sbjct  68    VHCDVSSESDVEKAINTAVEKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAARAMIP+  GSI+N+GSV+S+  G  PH+YTS+KH VLGLT+N A ELGR G
Sbjct  128   VFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVLGLTRNVAAELGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNC+SP+ + +P+  +   +  +  +  +Y+NL G  L+ EDVAEAA++L SDESKY+
Sbjct  188   IRVNCLSPYFILSPLTREFFNVVRNGGV-GVYSNLDGVSLQKEDVAEAAVFLGSDESKYI  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNL +DGGF+T+N    +F
Sbjct  247   SGHNLAVDGGFTTINPAFGLF  267



>ref|XP_006367118.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 180/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRL+GKVA++TG  + IGE   KLF ++GAKV   D  D L  K+C+DLDP++  + HC+
Sbjct  7     RRLKGKVAIITGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCD  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+ V+  V K+GKLDIM N A  +G  K +IL+N+KS+FE+V+  N+VGTFLG
Sbjct  67    VTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP G GSI+  GSV S+  G  PH+YTS+KH +LGLT+N AV+LGR GIRVN
Sbjct  127   IKQAARDMIPRGQGSIITTGSVCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+++     +  L     ED   +Y+ LKGA L   DVAE  ++LASDESKYVNG +
Sbjct  187   CVSPYVILTASALNTLKKMGKED-SDVYSTLKGATLTPNDVAETTVFLASDESKYVNGQD  245

Query  329   LVIDGGFSTMNSTLCIF  279
              +IDGGF+  N  L +F
Sbjct  246   FIIDGGFTIENRGLSMF  262



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 185/267 (69%), Gaps = 3/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             ++S  S++  RRLEGKVAL+TGG + IGE   +LF KHGAKV   D  D+LG  +C+D+D
Sbjct  3     SISGVSSAVARRLEGKVALITGGASGIGECTARLFAKHGAKVVIADIQDELGHSVCKDID  62

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
               ++ Y HC++ +E  VE AV+  V++FGKLDIM N A  +GV  P+I+ N KS+FE+V+
Sbjct  63    --SSFYVHCDVTKEEHVERAVNTAVSRFGKLDIMHNNAGIIGVWNPNIIHNKKSDFEEVI  120

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
               N+VG FLG KHAAR M P+  GSI+   S      G   H+YT +KH ++GL +N AV
Sbjct  121   RTNLVGVFLGMKHAARVMAPSRRGSIIATASTCGRIGGMASHAYTCSKHGIVGLVRNAAV  180

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG  GIRVNCVSP+ V  P+    L  T DE +  LY+NLKG  LK +DVAEA +YL S
Sbjct  181   ELGPLGIRVNCVSPYAVPTPMSKSFLN-TDDEGIAALYSNLKGVTLKPQDVAEAVVYLGS  239

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GH+LV+DGGF+ +N+ +C F
Sbjct  240   DESKYVSGHDLVVDGGFTVVNAGMCSF  266



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 181/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   +LF +HGA+V   D  D  G  +C+DL  ++A Y HC+
Sbjct  12    RRLEGKVALITGGASGIGEATARLFTEHGAQVIIADIQDDKGYSVCKDLHKSSASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+AV+ T++ +GKLDIM N A  +G  K +IL+   SEFE+V+ VN+VG FLG
Sbjct  72    VTKEKDIENAVNTTISMYGKLDIMFNNAGIVGANKTNILEYKLSEFEEVINVNLVGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHA+R MIP   GSI+N  SV  +  G   H+YTS+KHAVLGL +NTA+ELG   IRVN
Sbjct  132   TKHASRVMIPARRGSIINTASVCGSIGGMASHAYTSSKHAVLGLMRNTAIELGPFSIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+IV  P+    L L  DE L  LY+NLKG  L  +DVAEA+LYL SDESKYV+GHN
Sbjct  192   CVSPYIVATPMAKNFLKL-DDEGLLGLYSNLKGTNLVPKDVAEASLYLGSDESKYVSGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             LV+DG  S  N+   +F
Sbjct  251   LVVDGAVSVSNNGFSVF  267



>ref|XP_006481517.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 187/266 (70%), Gaps = 6/266 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             ++A RRL GKVAL+TGG +  GE   +LF +HGAKV   D  D LGE +C+D+  +++  
Sbjct  8     SAAARRLLGKVALITGGASGFGECTARLFSRHGAKVLIADIKDDLGESVCKDIGSSSSSA  67

Query  884   ----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
                 Y HC++ +E ++E+AV+  V+++GKLDIM N A  +   K +IL ND++EFE V+ 
Sbjct  68    NGCSYVHCDVTKEKEIENAVNTAVSQYGKLDIMFNNAGIVDEAKHNILDNDQAEFELVLS  127

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN+VG FLGTKHAAR M P G GSI++  SV     G   H+YTS+KH V+GL KN AVE
Sbjct  128   VNLVGVFLGTKHAARVMKPAGRGSIISTASVCGVIGGVASHAYTSSKHGVVGLMKNAAVE  187

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LGR GIRVNCVSP++V  P+      L  D+ L  +Y+NL GAVLK EDVAEAALYL SD
Sbjct  188   LGRFGIRVNCVSPYVVATPLAKDFYKL-DDDGLSAIYSNLSGAVLKPEDVAEAALYLGSD  246

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESK V+GHNLV+DGGF+ +N  LC+F
Sbjct  247   ESKCVSGHNLVVDGGFTIVNEGLCMF  272



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 183/262 (70%), Gaps = 11/262 (4%)
 Frame = -1

Query  1070  MASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS S      RRLEGKVA++TGG     E   +LF KHGA V   D  D LG  +C+ L
Sbjct  1     MASVSLVSATGRRLEGKVAIITGG----AEATARLFSKHGAHVVIADIQDDLGLSICKHL  56

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             + A+  Y HC++  E+DVE+ V+ TV+K GKLDIM N A   GV K SIL N KSEFE+V
Sbjct  57    ESAS--YVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEV  114

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN+VG FLGTKHAAR MIP   GSIVN  SV  +  G   H+YTS+KHAV+GLTKNTA
Sbjct  115   INVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTA  174

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             VELG  G+RVNCVSP++V  P+      L  D+ ++ +Y+NLKG  L   DVAEAALYLA
Sbjct  175   VELGAFGVRVNCVSPYVVATPLAKNFFKL-DDDGVQGIYSNLKGTDLVPNDVAEAALYLA  233

Query  362   SDESKYVNGHNLVIDGGFSTMN  297
             SDESKYV+GHNLV+DGGF+ +N
Sbjct  234   SDESKYVSGHNLVVDGGFTVVN  255



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   284 bits (726),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 188/261 (72%), Gaps = 1/261 (0%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             + A RRLEGKVA++TGG   IGE   +LF KHGA+V   D  D LGE +C+DL P  A +
Sbjct  8     SRAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  ESDVE A++  V K GKLDIMVN A      K +IL NDK++FE+V+ VN+ G
Sbjct  68    VHCDVSSESDVEKAINTAVDKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAARAMIP+  GSI+N+GSV+S+  G  PH+YTS+KH V+GLT+N A ELGR G
Sbjct  128   VFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVVGLTRNVAAELGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNC+SP+ + +P+  +   +  +  +  +Y+NL G  L+ EDVAEA+L+L SDESKY+
Sbjct  188   IRVNCLSPYFILSPLSREFFNVVRNGRV-GVYSNLDGVSLQKEDVAEASLFLGSDESKYI  246

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +GHNL +DGGF+T+N    +F
Sbjct  247   SGHNLAVDGGFTTINPAFGLF  267



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 190/267 (71%), Gaps = 2/267 (1%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             ++S+ ST A RRLEGKVAL+TGG   IGE   + F KHGAKV   DT D+L   +C+DL+
Sbjct  3     SVSLLSTVA-RRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLN  61

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
               +A + HC++ +E+DVE+AV+  +++ GKLD+M N A  +GV K +++    SEFE+V+
Sbjct  62    SESASFIHCDVTKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVI  121

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VN+VG FLGTKHAAR M P   GSI+   SV     G   H+YTS+KH VLGL +N AV
Sbjct  122   RVNLVGAFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNAAV  181

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             ELG+ GIRVNCVSP+ V   +    L +T DE ++  Y+NLKGA+L  EDVAEAALYLAS
Sbjct  182   ELGQFGIRVNCVSPYTVATEMSRNFLKMTDDE-IRSGYSNLKGAILTPEDVAEAALYLAS  240

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ++S+YV+GHNLV+DGG + +N+  C++
Sbjct  241   EDSRYVSGHNLVVDGGHTIVNNGSCMY  267



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 175/246 (71%), Gaps = 0/246 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG   IG    KLF +HGAKV   D  D+ G  +C+DL P++A + HC+
Sbjct  47    RRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSASFIHCD  106

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DV +A+D  VAK GKLDIM N A  LG    +IL ND +EFE  M VNV+G FLG
Sbjct  107   VTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLG  166

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M+P G G ++N  SV S   G   HSY S+KHA+LGLT+NTAVELG+ GIRVN
Sbjct  167   TKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTAVELGKFGIRVN  226

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K L    D+ L+ +Y+NLKG  L  +DVAEA LYL SD+SKYV+G+N
Sbjct  227   CVSPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLYLGSDDSKYVSGNN  286

Query  329   LVIDGG  312
             LVIDGG
Sbjct  287   LVIDGG  292



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 182/264 (69%), Gaps = 6/264 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   K+F  HGAK+   D  D+LG+ + Q L P+ + Y HCN
Sbjct  11    RRLEGKVALITGGASGIGECTAKVFAHHGAKIVIADVQDELGQAVSQALGPSNSTYVHCN  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  E+ +++AVD  VA +GKLDIM N A  +   KP I+ N+K +FE+V+ VNV G FLG
Sbjct  71    VTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLG  130

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   GSI+   S++S       H+YT +KHAVLGLT+N A+ELG+ G+RVN
Sbjct  131   IKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAIELGQFGVRVN  190

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+  K +GL  DE L+ L +   +LKG  LKAEDVA AALYLASDE +Y+N
Sbjct  191   CLSPYALATPLATKFVGL-DDEGLENLMDSLASLKGVTLKAEDVANAALYLASDEGRYIN  249

Query  338   GHNLVIDGGFSTMNSTLCIF--PP  273
             GHNL IDGGFS  N +  +F  PP
Sbjct  250   GHNLAIDGGFSIHNPSFQLFQYPP  273



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 177/257 (69%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG   IG  I++ F KHGAKV   D  D LG+ L ++L    A++ HC+
Sbjct  12    RRLEGKVALITGGATSIGASIVRTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAIFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESD+E+AVD  +  F KLDIMVN A      KPSI+ ND ++FE+V+ VN++G FLG
Sbjct  72    VTIESDIENAVDTAIFIFKKLDIMVNNAAIGDPRKPSIVDNDIADFERVVKVNLIGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI+ LGSV S+  G   H+YTS KH V+GL KN A ELGR GIRVN
Sbjct  132   TKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGVVGLAKNAAAELGRFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             C+SP+ +  P+ M    +  D     +Y+NL+G  L  EDVA+AA+YL SDESKYV+GHN
Sbjct  192   CLSPYFIETPLSMNFFKMKEDGK-SGVYSNLEGVKLTEEDVAQAAIYLGSDESKYVSGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             L +DGGF+T+N    +F
Sbjct  251   LALDGGFTTINPAFGLF  267



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 192/266 (72%), Gaps = 4/266 (2%)
 Frame = -1

Query  1073  SMASTSAD-RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP  897
             S++S SA  RRL+GKVA++TGG + +G    +LF KHGA V   D  D LG  + ++L+ 
Sbjct  3     SVSSVSAPFRRLDGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES  62

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
             A+  Y HC++  E+DVE+ V+  V+K+GKLDIM N A  +   K SI+ N KS+FE+V+G
Sbjct  63    AS--YVHCDVTNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIG  120

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN+VG FLGTKHAAR MIP   G I+N  SVA    G   H+YTS+KHA++GLTKNTAVE
Sbjct  121   VNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVE  180

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LG+ GIRVNC+SP++V  P+  K   +  D+ ++++Y+NLKGA L   DVAEAALYLA D
Sbjct  181   LGQHGIRVNCLSPYLVVTPLSKKYFNIDEDK-IREIYSNLKGAHLVPNDVAEAALYLAGD  239

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESKYV+GHNLVIDGG++ +N+   +F
Sbjct  240   ESKYVSGHNLVIDGGYTDVNAGFTVF  265



>ref|XP_004244887.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=263

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 180/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TG  + IGE   KLF ++G+KV   D  D L + +C+DLDP++  + HC+
Sbjct  7     RRLEGKVAIITGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCD  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+ V+  V K+GKLDIM N A  +G  K +IL+N+KS+FE+V+  N+VGTFLG
Sbjct  67    VTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP G GSI+  GSV ++  G  PHSYTS+KH +LGLT+N A++LGR GIRVN
Sbjct  127   IKQAARVMIPRGQGSIITTGSVCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+++     +  L     ED   +Y+ L G  L   DVAEAA++LASDESKYVNG +
Sbjct  187   CVSPYVIRTTSALDTLKKMGKED-SDVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQD  245

Query  329   LVIDGGFSTMNSTLCIF  279
              VIDGGF+  N  L +F
Sbjct  246   FVIDGGFTIENPGLSMF  262



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 191/266 (72%), Gaps = 4/266 (2%)
 Frame = -1

Query  1073  SMASTSAD-RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP  897
             S++S SA  RRLEGKVA++TGG + +G    +LF KHGA V   D  D LG  + ++L+ 
Sbjct  3     SVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES  62

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
             A+  Y HC+   E+DVE+ V+  V+K+GKLDIM N A  +   K SI+ N KS+FE+V+G
Sbjct  63    AS--YVHCDATNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIG  120

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN+VG FLGTKHAAR MIP   G I+N  SVA    G   H+YTS+KHA++GLTKNTAVE
Sbjct  121   VNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVE  180

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             LG+ GIRVNC+SP++V  P+  K   +  D+ ++++Y+NLKGA L   DVAEAALYLA D
Sbjct  181   LGQHGIRVNCLSPYLVVTPLSKKYFNIDEDK-IREIYSNLKGAHLVPNDVAEAALYLAGD  239

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESKYV+GHNLVIDGG++ +N+   +F
Sbjct  240   ESKYVSGHNLVIDGGYTDVNAGFTVF  265



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 186/264 (70%), Gaps = 4/264 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             +S  RRLEGKVAL+TGG   IGE   KLF KHGAKVA  D  D+LG  + + + P+ + Y
Sbjct  8     SSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNSTY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  E DV +AVD TV+ +GKLDIM N A      K  I+ N+K +FE+V+ VNV G
Sbjct  68    IHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAAR MIP   G+I++  S+AS   G   H+YT +KHAV+GLT+N+A+ELG+ G
Sbjct  128   VFLGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             IRVNC+SP+ + + +  K LG+  DE+L+++ N   NLKG  LKA+D+A AAL+LASD++
Sbjct  188   IRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAALFLASDDA  246

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             KYV+G NL IDGGF+  NS + +F
Sbjct  247   KYVSGQNLFIDGGFTIFNSAMQVF  270



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 186/257 (72%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRL+GKVA++TGG + +G    +LF KHGA V   D  D LG  + ++L+ A+  Y HC+
Sbjct  12    RRLDGKVAIITGGASGLGAATARLFSKHGAYVVIADIQDDLGLSVAKELESAS--YVHCD  69

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DVE+ V+ TV+K+GKLDIM N A      K SIL N+KS+FE+V+ VN+VG FLG
Sbjct  70    VTKEEDVENCVNTTVSKYGKLDIMFNNAGVSDEIKTSILDNNKSDFERVISVNLVGPFLG  129

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   G I+N  SVA    G   H+YTS+KHA++GLTKNTAVELG+ GIRVN
Sbjct  130   TKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVN  189

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             C+SP++V  P+  K   +  D+ ++++Y+NLKGA L   DVAEAALYLA DESKYV+GHN
Sbjct  190   CLSPYLVVTPLSKKYFNIDEDK-IREIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHN  248

Query  329   LVIDGGFSTMNSTLCIF  279
             LVIDGG++ +N+   +F
Sbjct  249   LVIDGGYTDVNAGFTVF  265



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 182/260 (70%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IG+   K+F  HGAKV   D  D+LG  +C+ + P+   Y HCN
Sbjct  12    RRLEGKVALITGGASGIGKCTAKVFAHHGAKVVIADIQDELGHSVCEAVGPSNCSYVHCN  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E  +++AVD  VA  GKLDIM N A      K  I+ N+KS+FE+V+ VNV G FLG
Sbjct  72    VTDEDQIKNAVDKAVATHGKLDIMFNNAGITDPIKARIIDNEKSDFERVLSVNVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR M+P  +GSI++  SV+ST      H+Y ++KHAVLGLT+N AVELG+ GIRVN
Sbjct  132   IKHAARVMVPARSGSIISTASVSSTVGAAATHAYCASKHAVLGLTRNAAVELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKK---LYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SPF +  P+  + LG+  DE+L+K   L  NLKG  LKAED+A AALYLAS+E +YV+
Sbjct  192   CLSPFALATPLATEVLGI-NDEELEKGMGLVANLKGVTLKAEDIANAALYLASEEGRYVS  250

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL +DGGF+  N +L +F
Sbjct  251   GHNLFVDGGFTIFNPSLSMF  270



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 184/257 (72%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG + IGE   +LF KHGA V   D  D LG  LC+ L+ A+  Y HC+
Sbjct  12    RRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHLESAS--YVHCD  69

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DVE+ V+  V+K+GKLDIM+N A      K SIL N+KS+FE V+ VN+VG FLG
Sbjct  70    VTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLG  129

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MI    GSI+N  SVA T  G   H+YTS+KHA++GL K+TAVELG+ GIRVN
Sbjct  130   TKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVN  189

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K   +  +E ++++Y+NLKG  L   DVAEAALYLA DESKYV+GHN
Sbjct  190   CVSPYVVPTPLTKKHANI-DEEGVREIYSNLKGVHLVPNDVAEAALYLAGDESKYVSGHN  248

Query  329   LVIDGGFSTMNSTLCIF  279
             LV+DGG++ +N    +F
Sbjct  249   LVLDGGYTDVNIGFSVF  265



>ref|XP_007132474.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
 gb|ESW04468.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
Length=268

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 186/260 (72%), Gaps = 3/260 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVA++TGG + IGE   +LF +HGA V   D  D LG  LC +L+  +AVY
Sbjct  8     SAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNELE--SAVY  65

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +E DVE  V+  V+K+GKLDI++N A      K SI++N K +FE+V+ VN+VG
Sbjct  66    VHCDVTKEEDVEKCVNVAVSKYGKLDIVLNNAGTCDEFKRSIVENSKCDFERVINVNLVG  125

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   G I+N  SVA    G  PH+YT +KH ++GLTKNTAVELG+ G
Sbjct  126   PFLGTKHAARVMIPAKRGCIINTSSVAGCIGGGAPHAYTISKHGLVGLTKNTAVELGQFG  185

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP++V  P+  K   L  +E +++ Y+NLKG+ L   DVAEAALYLA DESK+V
Sbjct  186   IRVNCVSPYVVATPLLNKYFNL-DEEGVREAYSNLKGSYLVPNDVAEAALYLAGDESKFV  244

Query  341   NGHNLVIDGGFSTMNSTLCI  282
             +GHNLVIDGGF+T N+   +
Sbjct  245   SGHNLVIDGGFTTTNAGFSV  264



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 185/268 (69%), Gaps = 7/268 (3%)
 Frame = -1

Query  1070  MASTSA----DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS S     DRRLEGKVAL++GG + IGE   +LF KHGA V   D  D LG  LC+ L
Sbjct  1     MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             + A+  Y HC++  E+DV++AV+  ++K+G LDIM N A  +   K SIL N K +FE+V
Sbjct  61    ESAS--YVHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERV  118

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN+VG FLGTKHAAR MIP   GSI+N  SVA T +G   H+YTS+KHA++GL KNTA
Sbjct  119   ISVNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTA  178

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             VELG+ GIRVNC+SP++V  P+  K   L  D +  ++Y+NLK   L   DVAEAALYLA
Sbjct  179   VELGQFGIRVNCLSPYVVATPLTKKCFNLDEDRN-GEIYSNLKSVHLVPNDVAEAALYLA  237

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              DESKYV+G N V+DGGF+ +N    +F
Sbjct  238   GDESKYVSGPNFVLDGGFTNLNVGFFVF  265



>gb|ADK56099.1| alcohol dehydrogenase [Artemisia annua]
Length=265

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 183/267 (69%), Gaps = 3/267 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             MAS +   RLE KVA+VTGG   IGE I++LF+KHGAKV   D +D LG+ LCQDL    
Sbjct  1     MASLTPKARLENKVAIVTGGARGIGECIVRLFVKHGAKVVIADVNDDLGKLLCQDLGSKF  60

Query  890   AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVN  711
             A + HC++  ESD+E+ ++ T+AK G+LDIMVN A  +   K SIL N+KS+F++V+ +N
Sbjct  61    ACFVHCDVTIESDIENLINTTIAKHGQLDIMVNNAGTVDEPKLSILDNEKSDFDRVVSIN  120

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             + G FLGTKHAAR MIP  +GSI+   S+ S T G   H+YTS+KH V+GL KN A ELG
Sbjct  121   LAGVFLGTKHAARVMIPKCSGSIITTASICSVTGGVASHAYTSSKHGVVGLAKNAAAELG  180

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             +  IRVNCVSP+ V   +  K L +   ++    Y+NL+G  L  +D+A A L+LASDES
Sbjct  181   KYNIRVNCVSPYFVPTKLAFKFLNM---DETSSFYSNLQGKTLGPQDIANATLFLASDES  237

Query  350   KYVNGHNLVIDGGFSTMNSTLCIFPPK  270
              YV+GHNLV+DGG+S +N    +F  K
Sbjct  238   GYVSGHNLVVDGGYSVLNPAFGLFSWK  264



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 191/259 (74%), Gaps = 1/259 (0%)
 Frame = -1

Query  1055  ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFH  876
             A RRLEGKVAL+TGG + IGE I +LF +HGAKV   D  D+LG+ +C+D+  A A + H
Sbjct  10    AARRLEGKVALITGGASGIGECIARLFCEHGAKVIIADIQDELGQSVCKDIGLAVASFVH  69

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C+IV+ESDVE AV+  ++  GKLDIMVN A  +   KPSI++N+ ++FE+V+ VN+ G F
Sbjct  70    CDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERVISVNLTGVF  129

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LGTKHAAR MIP   GSI++LGSV+S+  G   H+YTS+KHA+LGLTKN A ELGR GIR
Sbjct  130   LGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHAILGLTKNVAAELGRFGIR  189

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VNC+S + +     M    L  DE   ++Y+NLKG VL+ EDVA+AALYL SDESKYV+G
Sbjct  190   VNCLSSYFIATRSAMNFFKLDGDER-PRVYSNLKGVVLQQEDVADAALYLGSDESKYVSG  248

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNL +DGGF+T+N    +F
Sbjct  249   HNLAVDGGFTTINPAFGLF  267



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 185/264 (70%), Gaps = 4/264 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             +S  RRLEGKVAL+TGG   IGE   KLF KHGAKVA  D  D+LG  + + + P+ + Y
Sbjct  8     SSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNSTY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  E DV +AVD TV+ +GKLDIM N A      K  I+ N+K +FE+V+ VNV G
Sbjct  68    IHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              F G KHAAR MIP   G+I++  S+AS   G   H+YT +KHAV+GLT+N+A+ELG+ G
Sbjct  128   VFQGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             IRVNC+SP+ + + +  K LG+  DE+L+++ N   NLKG  LKA+D+A AAL+LASD++
Sbjct  188   IRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAALFLASDDA  246

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             KYV+G NL IDGGF+  NS + +F
Sbjct  247   KYVSGQNLFIDGGFTIFNSAMQVF  270



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 181/264 (69%), Gaps = 6/264 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   K+F  HGAK+   D  D+LG+ + Q L P+ + Y HCN
Sbjct  11    RRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADVQDELGQAVSQALGPSNSTYVHCN  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  E+ +++AVD  VA +GKLDIM N A  +   KP I+ N+K +FE+V+ VNV G FLG
Sbjct  71    VTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLG  130

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   GSI+   S++S       H+YT +KHAVLGLT+N A+ELG+ G+RVN
Sbjct  131   IKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAIELGQFGVRVN  190

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+  K +GL  DE L+ L +   +LKG  LKAEDVA AALYLASDE +Y+N
Sbjct  191   CLSPYALATPLATKFVGL-DDEGLENLMDSLASLKGVTLKAEDVANAALYLASDEGRYIN  249

Query  338   GHNLVIDGGFSTMNSTLCIF--PP  273
             GHNL IDGG S  N +  +F  PP
Sbjct  250   GHNLAIDGGISIHNPSFQMFQYPP  273



>ref|XP_009605456.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   278 bits (712),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 181/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEG+VA++TG  + IGE   +LF KH AKV   D  D L +K+C++LDP++  + HC+
Sbjct  7     RRLEGRVAIITGAASGIGEAAARLFSKHRAKVVIADIQDDLSQKVCKELDPSSTTFVHCD  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E ++E+AV+  V+K+GKLDIM N A  +G  K +IL N+KSEFE+V+ +N+VGTFLG
Sbjct  67    VTKEEELENAVNIAVSKYGKLDIMYNNAGIMGAVKSNILDNEKSEFEKVISINLVGTFLG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP   GSI+  GSV S+  G  PH+YTS+KH VLGLT+N AV+LGR GIRVN
Sbjct  127   IKQAARVMIPRRQGSIIVTGSVCSSIGGVCPHAYTSSKHGVLGLTRNAAVDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V   +   +L     E    +Y+ L GA+L   DVAE A++LASDESK V+G +
Sbjct  187   CVSPYVVLTQMAFDSLKKMGKEG-SDVYSTLNGAILTPNDVAETAVFLASDESKCVSGQD  245

Query  329   LVIDGGFSTMNSTLCIF  279
              VIDGGF+  NS   +F
Sbjct  246   FVIDGGFTIENSGFSLF  262



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   281 bits (719),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 189/268 (71%), Gaps = 7/268 (3%)
 Frame = -1

Query  1070  MASTSAD----RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS SA     RRLEGKVA++TGG + IGE   +LF KHGA +   D  D LG  LC+ L
Sbjct  70    MASASAVSAHVRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL  129

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             + A+  Y HC++ +E DVE+ V+  V+K+GKLDIM+N A      K SIL N+KS+FE V
Sbjct  130   ESAS--YVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESV  187

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN+VG FLGTKHAAR MI    GSI+N  SVA T  G   H+YTS+KHA++GL K+TA
Sbjct  188   ISVNLVGPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTA  247

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             VELG+ GIRVNCVSP++V  P+  K   +  +E ++++Y+NLKG  L   DVAEAALYLA
Sbjct  248   VELGQFGIRVNCVSPYVVPTPLTKKHANI-DEEGVREIYSNLKGVHLVPNDVAEAALYLA  306

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              DESKYV+GHNLV+DGG++ +N    +F
Sbjct  307   GDESKYVSGHNLVLDGGYTDVNIGFSVF  334



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 187/273 (68%), Gaps = 7/273 (3%)
 Frame = -1

Query  1094  LSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKL  915
             ++TNL L  A+    RRLEGKVAL+TG    IGE I + F KHGAKV   D  D LG+ +
Sbjct  1     MATNLLLPPAA----RRLEGKVALITGAATSIGECIARSFCKHGAKVVIADIQDDLGQSV  56

Query  914   CQDLDPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSE  735
              +D     A++ HC++  ESDV++AVD  V+ FGKLDIMVN A      KPSI+ ND ++
Sbjct  57    AKDHGQDVAMFVHCDVSVESDVKNAVDTAVSIFGKLDIMVNNAATGEPRKPSIVDNDLAD  116

Query  734   FEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLT  555
              E+ + VN++G FLGTKHAAR MIP   GSI+ LGSV S+  G   HSYT AKH ++GL 
Sbjct  117   VERALRVNLIGPFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHSYTIAKHGIVGLA  176

Query  554   KNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKK-LYNNLKGAVLKAEDVAEA  378
             +N A ELGR GIRVN +SP+ +  P+ MK      +ED +  +Y+NL+G  LK EDVAEA
Sbjct  177   RNAAAELGRFGIRVNYLSPYFIETPLSMKL--FEEEEDGRSGVYSNLEGVKLKQEDVAEA  234

Query  377   ALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A+YLASDESK+V+GHNL +DGGF+T+N    +F
Sbjct  235   AIYLASDESKFVSGHNLALDGGFTTINPAFGLF  267



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 186/257 (72%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   +LFLKHGAKV   D  D LG+ +C+DL    A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDVE+A+   V KFGKLDIMVN A      K +IL NDK++FE+V+ VN+ G FLG
Sbjct  72    VSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAARAMIP+ +GSI+N+GSV+S+  G   H+YTS+KHAV+GLT+N A ELGR GIRVN
Sbjct  132   TKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVAAELGRYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+ +  P+  +   +     + ++Y+NL G  L+ EDVA+AA+YL SDESKYV+G N
Sbjct  192   CVSPYFILTPLTKEFFKVDESSGV-RVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             L +DGGF+T+N    +F
Sbjct  251   LAVDGGFTTINPAFGLF  267



>ref|XP_006367119.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 184/257 (72%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TG  + IGE   +LF +HGA V   D  D L +K+C++LDP++  Y HC+
Sbjct  7     RRLEGKVAIITGAASGIGEVAARLFTRHGAVVVIADIQDDLAQKVCENLDPSSITYVHCD  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+++ V+  V+K+GKLDIM N A  +   K +IL N+KSEFE+V+ +N++GTF+G
Sbjct  67    VTKEDDLKNVVNTAVSKYGKLDIMYNNAGIVDEIKSNILDNEKSEFEKVININLIGTFVG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP G GSI++  SV ++  G   H+YTS+KH VLGLT+N AV+LGR GIRVN
Sbjct  127   IKEAARVMIPRGQGSIISTASVCASIGGVCSHAYTSSKHGVLGLTRNAAVDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+ V   +G+  L     +D   +Y+NLKGA L   DVAEAA++LASDESK V+GH+
Sbjct  187   CVSPYTVLTTMGLYTLK-KIGKDSSNVYSNLKGATLTPNDVAEAAVFLASDESKCVSGHD  245

Query  329   LVIDGGFSTMNSTLCIF  279
             L++DGGF+  NS   +F
Sbjct  246   LIVDGGFTVENSGSSMF  262



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 187/259 (72%), Gaps = 1/259 (0%)
 Frame = -1

Query  1055  ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFH  876
             A RRLEGKVA++TGG   IGE   +LF KHGAKV   D +D LG+ +C++L P  A + H
Sbjct  10    AARRLEGKVAVITGGACGIGESTARLFSKHGAKVIIADINDDLGKSVCKNLGPETASFVH  69

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E DVE+AV   V K GKLDIMVN A     TK +IL NDK++FE+V+ VN+ G F
Sbjct  70    CDVSSEPDVENAVATAVDKHGKLDIMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVF  129

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LGTKHAARAMIP+  GSI+N+GSV+S+  G   H+Y S+KHA++GL++N A ELGR GIR
Sbjct  130   LGTKHAARAMIPSQRGSIINVGSVSSSVGGVASHAYASSKHAIVGLSRNAAAELGRYGIR  189

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VNC+SP+ +  P+  +   L  + +  ++Y+NL G  L+ EDVAEAAL+L SDESKY++G
Sbjct  190   VNCLSPYFIRTPLTEEMFKLDENPEF-RVYSNLDGVTLQEEDVAEAALFLGSDESKYISG  248

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNL +DGGF+T+N    +F
Sbjct  249   HNLAVDGGFTTINPAFGVF  267



>gb|KGN59172.1| hypothetical protein Csa_3G778280 [Cucumis sativus]
Length=272

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 186/270 (69%), Gaps = 9/270 (3%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQD-L  903
             N  +++T+  RRLEGKVAL+TGG + IGE   KLF+ HGAKV   D  D LG  LC + L
Sbjct  4     NEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCANVL  63

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
                 ++Y HC++ EES       A V  FGKLDIM+N A     +KP I+ NDK +F++V
Sbjct  64    GSTNSLYVHCDVTEESQ------AAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDFDRV  117

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + +NV G FLG KHAA+AMIP   GSI++  SVAS T G+  H+YT +KHAV+GLTKN A
Sbjct  118   LSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTKNAA  177

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEAALY  369
             VELG+ GIRVNC+SPF +  P+  K +GL   E  K + +  NLKG  LKAEDVA AAL+
Sbjct  178   VELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANAALF  237

Query  368   LASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             LASDES+YV+GHNL IDGGFS +N  + IF
Sbjct  238   LASDESRYVSGHNLFIDGGFSIVNPNIDIF  267



>ref|XP_010324818.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=256

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 178/255 (70%), Gaps = 1/255 (0%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             LEGKVA++TG  + IGE   KLF ++G+KV   D  D L + +C+DLDP++  + HC++ 
Sbjct  2     LEGKVAIITGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCDVT  61

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTK  684
             +E D+E+ V+  V K+GKLDIM N A  +G  K +IL+N+KS+FE+V+  N+VGTFLG K
Sbjct  62    KEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIK  121

Query  683   HAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCV  504
              AAR MIP G GSI+  GSV ++  G  PHSYTS+KH +LGLT+N A++LGR GIRVNCV
Sbjct  122   QAARVMIPRGQGSIITTGSVCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRVNCV  181

Query  503   SPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLV  324
             SP+++     +  L     ED   +Y+ L G  L   DVAEAA++LASDESKYVNG + V
Sbjct  182   SPYVIRTTSALDTLKKMGKED-SDVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQDFV  240

Query  323   IDGGFSTMNSTLCIF  279
             IDGGF+  N  L +F
Sbjct  241   IDGGFTIENPGLSMF  255



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 183/257 (71%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG + IGE   +LF KHGA +   D  D LG  LC+ L+ A+  Y HC+
Sbjct  12    RRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHLESAS--YVHCD  69

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E DVE+ V+  V+K+GKLDIM+N A      K SIL N+KS+FE V+ VN+VG FLG
Sbjct  70    VTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLG  129

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MI    GSI+N  SVA    G   H+YTS+KHA++GL K+TAVELG+ GIRVN
Sbjct  130   TKHAARVMIAAKRGSIINTASVAGILGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVN  189

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP++V  P+  K   +  +E ++++Y+NLKG  L   DVAEAALYLA DESKYV+GHN
Sbjct  190   CVSPYVVPTPLTKKHANI-DEEGVREIYSNLKGVHLVPNDVAEAALYLAGDESKYVSGHN  248

Query  329   LVIDGGFSTMNSTLCIF  279
             LV+DGG++ +N    +F
Sbjct  249   LVLDGGYTDVNIGFSVF  265



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 191/267 (72%), Gaps = 6/267 (2%)
 Frame = -1

Query  1073  SMASTSAD-RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP  897
             S++S SA  RRLEGKVA++TGG + +G    +LF KHGA V   D  D LG  + ++L+ 
Sbjct  3     SVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES  62

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
             A+  Y HC++  E DVE+ V+  V+K+GKLDI+ N A  +   K SI+ N KS+FE+V+G
Sbjct  63    AS--YVHCDVTNEIDVENCVNTAVSKYGKLDIIFNNAGIIDEIKTSIVDNSKSDFERVIG  120

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             V +VG FLGTKHAAR MIP   G I+N  SVA    G   H+YTS+KHA++GLTKNTAVE
Sbjct  121   VILVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVE  180

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDED-LKKLYNNLKGAVLKAEDVAEAALYLAS  360
             LG+ GIRVNC+SP++V  P+  K   +  DED ++++Y+NLKGA L   DVAEAALYLA 
Sbjct  181   LGQHGIRVNCLSPYLVVTPLSKKYFNI--DEDKIREIYSNLKGAHLVPNDVAEAALYLAG  238

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DESKYV+GHNLVIDGG++ +N+   +F
Sbjct  239   DESKYVSGHNLVIDGGYTDVNAGFTVF  265



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 184/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   +LFLKHGAKV   D  D LG+ +C+DL    A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDVE+A+   V KFGKLDIMVN A      K +IL NDK++FE+V+ VN+ G FLG
Sbjct  72    VSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAARAMIP+ +GSI+N+GSV+S+  G   H+YTS+KHAV+GLT+N A ELGR GIRVN
Sbjct  132   TKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVAAELGRYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+ +  P+  +   +     + ++Y+NL G  L+ EDVA+AA+YL SDESKYV+G N
Sbjct  192   CVSPYFILTPLTKEFFKVDESSGV-RVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQN  250

Query  329   LVIDGGFSTMN  297
             L +DGGF+T+N
Sbjct  251   LAVDGGFTTIN  261



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 176/256 (69%), Gaps = 1/256 (0%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVAL+TGG + IGE   +LF +HGA+V   D  D  G  +C++L  +++ Y  C++
Sbjct  7     RLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDV  66

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
              +E D+E+AV+ TV K+GKLDIM N A   GV K  IL+N  SEFE V+ VN+ G FLGT
Sbjct  67    TKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGT  126

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAAR MIP   GSI+N  SV  +  G  PH+YTS+KHAV+GL +NTA+ELG  GIRVNC
Sbjct  127   KHAARVMIPARRGSIINTASVGGSIGGCAPHAYTSSKHAVVGLMRNTAIELGPFGIRVNC  186

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNL  327
             VSP+ +  P+      L  D     +++NLKG  L  +DVAEAALYL SDESKYV+G NL
Sbjct  187   VSPYFLATPMVTNFFKL-DDGGALDIFSNLKGTNLVPKDVAEAALYLGSDESKYVSGLNL  245

Query  326   VIDGGFSTMNSTLCIF  279
             VIDGG S  N+  C+F
Sbjct  246   VIDGGVSVANNGFCVF  261



>ref|XP_007043243.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99074.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 190/259 (73%), Gaps = 1/259 (0%)
 Frame = -1

Query  1055  ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFH  876
             A RRLEGKVAL+TGG + +GE I +LF +HGAKV  TD  D+LG+ +C+D+  A A +  
Sbjct  10    AARRLEGKVALITGGASGLGECIARLFCEHGAKVIITDIQDELGQSVCKDIGLAVASFVL  69

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C+IV+ESDVE AV+  ++  GKLDIMVN A  +   KPSI++N+ ++FE+V+ +N+ G F
Sbjct  70    CDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERVISINLTGVF  129

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LGTKHAAR MIP   GSI++LGSV+S+  G   H+YTS+KH V+GLTKN A ELGR GIR
Sbjct  130   LGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHGVIGLTKNAAAELGRFGIR  189

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VNC+S + +  P+      L  +E   ++Y+NLKG  L+ EDVAEAALYL SDESKYV+G
Sbjct  190   VNCLSSYFIATPLTTNFFKLDRNES-DRVYSNLKGVFLQKEDVAEAALYLGSDESKYVSG  248

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNL +DGGF+T+N    +F
Sbjct  249   HNLAVDGGFTTINPAFGLF  267



>ref|XP_010104810.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01951.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 182/271 (67%), Gaps = 8/271 (3%)
 Frame = -1

Query  1070  MASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MA+TS      RRL+GKV L+TGG + IGE   KLF  HGAKV   D  D LG  +C+ +
Sbjct  1     MATTSLLSAVSRRLDGKVVLITGGASGIGESAAKLFAHHGAKVVIADIQDNLGHSVCESI  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
                 + Y HC++ +ES V++AVD  +  +GKLDIM N A  +  + P I +N+K+ FE V
Sbjct  61    GQTNSKYVHCDVTDESQVKNAVDEAIKTYGKLDIMFNNAGIIDKSSPRITENEKAVFEHV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VNV G FLG KHAAR MIP  +G I++  S++S   GT  H+YT AKHAVLGLTKN A
Sbjct  121   LSVNVTGVFLGIKHAARVMIPARSGCIISTASLSSCIGGTASHAYTCAKHAVLGLTKNAA  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLK---KLYNNLKGAVLKAEDVAEAAL  372
             VELG+ GIRVNCVSPF V  P+ +K  G ++ EDL+       NLK   LKAEDVA AAL
Sbjct  181   VELGQFGIRVNCVSPFGVATPMAIKYAG-SSAEDLENGMSFLANLKNVTLKAEDVANAAL  239

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             +++SDE +Y++GHNL+IDGGF+  N +  +F
Sbjct  240   FISSDEGRYISGHNLLIDGGFAIANPSFNMF  270



>ref|XP_008442883.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=275

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 188/264 (71%), Gaps = 3/264 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQD-LDPAAAV  885
             T+  RRLEGKVAL+TGG + IGE   K+F+ HGAKV   D  D LG  LC + L    ++
Sbjct  10    TTGQRRLEGKVALITGGASGIGECTAKIFVHHGAKVVIADIQDDLGHALCANVLGSTNSL  69

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             Y HC++ +ES V++AV A V  FGKLD+M+N A  +  +KP I+ ND+S+F++V+ +NV 
Sbjct  70    YVHCDVTDESQVQAAVAAAVETFGKLDVMMNNAGIVDPSKPRIIDNDRSDFDRVLNINVT  129

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FLG KHAA+AMIP   GSI++  SVAS   G+  H+YT +KHAV+GLTKN AVELG+ 
Sbjct  130   GVFLGIKHAAQAMIPAKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTKNAAVELGQF  189

Query  524   GIRVNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             GIRVNC+SP+ +  P+  K +GL     E++     NLKG  LKAEDVA AAL+LASDES
Sbjct  190   GIRVNCLSPYALVTPLATKFVGLNGAEFEEVMGSKANLKGVTLKAEDVANAALFLASDES  249

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             +YV+GHNL+IDGGFS +N  + IF
Sbjct  250   RYVSGHNLLIDGGFSIVNPNINIF  273



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 177/259 (68%), Gaps = 2/259 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVALVTGG + IGE   KLF KHGAKVA  D  D+L   +   +  + + Y HC+
Sbjct  12    RRLEGKVALVTGGASGIGECTAKLFSKHGAKVAIADIQDELAHSVVNSIGHSNSTYIHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  E  V++AVD TV+ +GKLDIM N A      KP I+ N+KS+FE+VM +NV G FLG
Sbjct  72    VTNEDHVKNAVDKTVSTYGKLDIMFNNAGIADRPKPRIIDNEKSDFERVMSINVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR M+P  +G+I++  S+ S   G   H+YT +KHAV+GLT+N AVELG+ GIRVN
Sbjct  132   MKHAARVMVPARSGTIISTASLGSGIGGAATHAYTCSKHAVVGLTRNLAVELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             C+SP+ +  P+  K L L  +  E+      NLKG  LKAEDVA AAL+LASDE++YV+G
Sbjct  192   CLSPYALATPLAKKFLELDDEGVENAMSYMANLKGVTLKAEDVANAALFLASDEARYVSG  251

Query  335   HNLVIDGGFSTMNSTLCIF  279
              NL IDGGF  +NS + +F
Sbjct  252   QNLFIDGGFGIVNSAIKLF  270



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 181/268 (68%), Gaps = 4/268 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVAL+TGG + IGE   ++F  HGAKV   D +D LG  +C  L    A +
Sbjct  52    SAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTASF  111

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HCN+ +ES  ++AV   V+ FGKLDIM N A   G+ K  I+ NDK++FE+V+ VNV G
Sbjct  112   VHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTG  171

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAA+AMIP   G I+N  S++S   G   H+YT AKHAVLGLT+N AVELG+ G
Sbjct  172   VFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQFG  231

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKL--YNNLKGAVLKAEDVAEAALYLASDESK  348
             IRVNC+SP+    P+  + +G+   E    +    NLKG  LKAEDVA AAL+LA DE++
Sbjct  232   IRVNCLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALFLAGDEAR  291

Query  347   YVNGHNLVIDGGFSTMNSTLCIF--PPK  270
             YV+GHNL IDGGFS +N +  +F  PP+
Sbjct  292   YVSGHNLFIDGGFSVVNPSFRMFQYPPE  319



>dbj|BAA13541.1| CPRD12 protein [Vigna unguiculata]
Length=267

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 175/257 (68%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVA++TGG + IGE   +LF +HGA V   D  D +G  LC +L   +A+Y HC+
Sbjct  12    KRLEGKVAIITGGASGIGEATARLFSQHGAHVVVADIQDDVGLSLCNELK--SAIYVHCD  69

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E  VD  V+KFGKLDIM N A      K SIL N KS+FE+V+ VN+VG FLG
Sbjct  70    VTKEEDIEKCVDTAVSKFGKLDIMFNNAGTGDEFKKSILDNTKSDFERVISVNLVGPFLG  129

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   G I+N  SVA    G   H+YTS+KHA++GLTKNTAVELG+ GIRVN
Sbjct  130   TKHAARVMIPARRGCIINTASVAGCIGGGATHAYTSSKHALVGLTKNTAVELGQFGIRVN  189

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSPF +  P+  K   L  +E ++K Y NLKG      DVAEAALYLASDESK+V+ HN
Sbjct  190   CVSPFAIVTPLLNKYFNL-DEEGVRKTYMNLKGWYPVPNDVAEAALYLASDESKFVSSHN  248

Query  329   LVIDGGFSTMNSTLCIF  279
             LVIDGG    N    +F
Sbjct  249   LVIDGGLINSNVGFPMF  265



>ref|XP_009773000.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=263

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 176/258 (68%), Gaps = 1/258 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TG  + IGE   +LF +HGAKV   D  D L +K+C++LD ++  + HCN
Sbjct  7     RRLEGKVAVITGAASGIGEAAARLFSRHGAKVVIADIQDDLAQKVCKELDTSSTTFVHCN  66

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E D+E+AV+  V+K+GKLDIM N A  +G  K +IL N+KSEFE+V+ VN+VGTFLG
Sbjct  67    VTKEEDLENAVNIAVSKYGKLDIMYNNAGIMGAIKSNILDNEKSEFEKVISVNLVGTFLG  126

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              K AAR MIP   GSI+  GSV S+  G   H+YTS+KH VLGL +N  V+LGR GIRVN
Sbjct  127   IKQAARVMIPRRQGSIIVTGSVCSSIGGVCSHAYTSSKHGVLGLARNATVDLGRYGIRVN  186

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             CVSP+ V   +   +L     E    +Y+ L GA L  +DVAE A++LASDESK  +G +
Sbjct  187   CVSPYAVLTQMAFDSLKKMGKEGW-DVYSTLNGATLTPKDVAETAVFLASDESKCFSGQD  245

Query  329   LVIDGGFSTMNSTLCIFP  276
              +IDGGF+  NS   +F 
Sbjct  246   FIIDGGFTIENSGFSLFK  263



>ref|XP_004139501.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004159104.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64962.1| TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 179/262 (68%), Gaps = 8/262 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   KLF KHGAKV   D  D LG+ LC+DL  +++V+ HC+
Sbjct  11    RRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCD  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPS----ILQNDKSEFEQVMGVNVVG  702
             + +E DVE+AVD  V+K+GKLDIM+N A   GV + S    IL++D   F++V+ VN+VG
Sbjct  71    VTKEKDVETAVDTAVSKYGKLDIMLNNA---GVFEESPNFDILKDDPLTFQRVVNVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR M P G GSIV   S+ S   G   H+YTS+KH VLGL +N AV+LGR G
Sbjct  128   AFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLK-GAVLKAEDVAEAALYLASDESKY  345
             IRVNCVSP +V   +G K   +    +    Y +LK G +L+ EDV EA +YL SDESK 
Sbjct  188   IRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKC  247

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+G NL++DGGF+ +N  LC F
Sbjct  248   VSGLNLIVDGGFTVVNQALCSF  269



>ref|XP_003632648.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=275

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IG+   + F +HGAKV   D  D+LG  + + L    A Y HC+
Sbjct  12    RRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEALGQTNASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +ES +++AVD T A  GKLDIM N A  +   KP I+ N+K++FE+V+ +NV G FLG
Sbjct  72    VTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERVLSINVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR M+P  +GSI++  SV+S       H+Y  +KHAVLGLT+N A+ELG+ GIRVN
Sbjct  132   MKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAAIELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+    L LT  E+L+   N   NLKG  LKA+DVA AALYLASDES+YV+
Sbjct  192   CLSPYALATPLATNFLNLTA-EELETAMNATANLKGVTLKAQDVANAALYLASDESRYVS  250

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N +  +F
Sbjct  251   GHNLFIDGGFTVANPSFHLF  270



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 179/260 (69%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA +TGG + IG    K+F + GAKV   D  ++LG  + + +  + + Y HC+
Sbjct  12    RRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ES +++A+D TVA  GKLDIM N A   G  K  I+ N+K++FE+V+ VNV G FLG
Sbjct  72    VTNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP  +GSI++  SV+S       H+Y  AKHAVLGLTKN AVELG+ GIRVN
Sbjct  132   IKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+    +G+ TDEDL+   N   NLKG  L+ ED+A AALYLASDE+KYV+
Sbjct  192   CLSPYALATPLATSFVGI-TDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVS  250

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+ +N +L +F
Sbjct  251   GHNLFIDGGFTIVNPSLGMF  270



>ref|XP_007132473.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
 gb|ESW04467.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
Length=269

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 179/261 (69%), Gaps = 3/261 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVA++TGG + IGE   +LF +HGA V   D  D LG  LC +L+  +AVY
Sbjct  8     SAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNELE--SAVY  65

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ EE DVE+ V+  V+K+GKLDIM N A +  + K SIL N KS+FE+V+ VN+VG
Sbjct  66    VHCDVTEEEDVENCVNIAVSKYGKLDIMFNNAGSSDLFKRSILDNTKSDFERVLSVNLVG  125

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR MIP   G I+N  S+A    G   H+YTSAKH +LGL KNTAVELG  G
Sbjct  126   PFLGTKHAARVMIPAKRGCIINTASIAGCIGGGATHAYTSAKHGLLGLMKNTAVELGEFG  185

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             IRVNCVSP +V  P+  K   L  +E  +K Y NLKG    A DVAEAALYLASDESKYV
Sbjct  186   IRVNCVSPHLVVTPLLNKYFNL-NEEGARKSYTNLKGWHPVANDVAEAALYLASDESKYV  244

Query  341   NGHNLVIDGGFSTMNSTLCIF  279
             +  N+V+DGG +  N    +F
Sbjct  245   SSLNIVLDGGLTNSNVGFPMF  265



>gb|AHH81851.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=275

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/259 (52%), Positives = 176/259 (68%), Gaps = 2/259 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG N IGE   KLF KHGAKV   D  D+LGE + + + P  + Y HC+
Sbjct  12    RRLEGKVALITGGANGIGECAAKLFSKHGAKVVIADIQDQLGEAVVRQIGPENSTYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E+DV +AVD  V+ +GKLDIM N A  +      I+ N+K +FE+VM VNV G FLG
Sbjct  72    VTDENDVRNAVDKAVSTYGKLDIMYNNAATIDFGAHPIVDNEKKDFERVMAVNVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   G I++  S+A    GT  H+YT +KHAV+GL+KN A+ELG+ GIRVN
Sbjct  132   MKHAARVMIPVRRGVIISTASIAGHLGGTATHAYTCSKHAVIGLSKNLAIELGQYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             CVSP+ +   +  K L L  +  E +     NL+GA LK +D+A AAL+LASD++KYV+G
Sbjct  192   CVSPYALATKLSKKYLKLDHELFEKMSHDKGNLQGATLKPDDIANAALFLASDDAKYVSG  251

Query  335   HNLVIDGGFSTMNSTLCIF  279
              NL IDGGF+  NS + +F
Sbjct  252   QNLFIDGGFTVFNSAMQVF  270



>ref|XP_002281462.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=275

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IG+   + F +HGAKV   D  D+LG  + + L    A Y HC+
Sbjct  12    RRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEALGQTNASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +ES +++AVD T A  GKLDIM N A  +   KP I+ N+K++FE+V+ +NV G FLG
Sbjct  72    VTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERVLSINVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR M+P  +GSI++  SV+S       H+Y  +KHAVLGLT+N A+ELG+ GIRVN
Sbjct  132   MKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAAIELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+    L LT  E+L+   N   NLKG  LKA+DVA AALYLASDES+YV+
Sbjct  192   CLSPYALATPLATNFLNLTA-EELETAMNATANLKGVTLKAQDVANAALYLASDESRYVS  250

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N +  +F
Sbjct  251   GHNLFIDGGFTVANPSFHLF  270



>sp|Q94KL7.1|SILD_FORIN RecName: Full=Secoisolariciresinol dehydrogenase, partial [Forsythia 
x intermedia]
 gb|AAK38665.1| stem secoisolariciresinol dehydrogenase [Forsythia x intermedia]
Length=277

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 183/268 (68%), Gaps = 3/268 (1%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S   T+  RRLEGKVAL+TGG + IGE   KLF +HGAKVA  D  D+LG  + + +  +
Sbjct  5     SQVLTAIARRLEGKVALITGGASGIGETTAKLFSQHGAKVAIADVQDELGHSVVEAIGTS  64

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
              + Y HC++  E  V++AVD TV+ +GKLDIM + A      +P I+ N+K++FE+V  V
Sbjct  65    NSTYIHCDVTNEDGVKNAVDNTVSTYGKLDIMFSNAGISDPNRPRIIDNEKADFERVFSV  124

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G FL  KHAAR MIP  +G+I++  S++ST  G + H+Y  +KHAVLGLT+N AVEL
Sbjct  125   NVTGVFLCMKHAARVMIPARSGNIISTASLSSTMGGGSSHAYCGSKHAVLGLTRNLAVEL  184

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLA  363
             G+ GIRVNC+SPF +   +G K  G+  +E+ + + N   NLKG     EDVA AALYLA
Sbjct  185   GQFGIRVNCLSPFGLPTALGKKFSGIKNEEEFENVINFAGNLKGPKFNVEDVANAALYLA  244

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             SDE+KYV+GHNL IDGGFS  NS + +F
Sbjct  245   SDEAKYVSGHNLFIDGGFSVCNSVIKVF  272



>ref|XP_011089208.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=278

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 180/269 (67%), Gaps = 8/269 (3%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVAL+TGG   +G    KLF +HGAKV   D  D  G  +CQ+L P  A +
Sbjct  8     SAAAKRLEGKVALITGGAGGLGSVTAKLFHEHGAKVLIADARDDRGHLICQNLSPERASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  ESD+++AV+  V+ +GKLDIM N A  L    P++L   +++FE V+ VNVVG
Sbjct  68    IHCDVTSESDIQNAVETAVSTYGKLDIMFNNAGILDPVIPNVLNYSQADFEHVLRVNVVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAG----TTPHS----YTSAKHAVLGLTKNT  546
              FLGTKHAA  M     GSI+N GSV S   G      P S    Y S+KHAVLGLT+NT
Sbjct  128   AFLGTKHAASFMKQAKRGSIINTGSVCSVIGGDDNKRDPRSRSDHYASSKHAVLGLTRNT  187

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYL  366
             AVELGR GIRVNCVSP++  + +    LG   D+ +  + +NL+G  LK EDVAEA +YL
Sbjct  188   AVELGRYGIRVNCVSPYVFPSSMSRGLLGRDEDDPVDDIGSNLEGVSLKPEDVAEAVVYL  247

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ASDES+Y++GHNLV+DGGF  MNS L +F
Sbjct  248   ASDESRYMSGHNLVVDGGFGVMNSALTMF  276



>ref|XP_009605455.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nicotiana tomentosiformis]
Length=250

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 174/249 (70%), Gaps = 1/249 (0%)
 Frame = -1

Query  1025  LVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIVEESDVE  846
             L+ G  + IGE   +LF  HGAKV   D  D+L +K+C+DLDP +  + HC+I +E D+E
Sbjct  2     LLEGAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTSTTFVHCDITKEEDLE  61

Query  845   SAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGTKHAARAM  666
             +A +  V K+GKLDIM N A  +G+ K +IL+++K EFE+V  VN+VGTFLGTK AAR M
Sbjct  62    NAANTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVM  121

Query  665   IPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNCVSPFIVC  486
             IPNG GSI+   S+ +T  G+  H+YT +KH VLGLT+N AV+LGR GIRVNCVSP++V 
Sbjct  122   IPNGRGSIITTASITATIGGSGSHAYTCSKHGVLGLTRNAAVDLGRFGIRVNCVSPYLVL  181

Query  485   NPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFS  306
              P+ +  L +   +    +Y+ L GA L  +DVAE AL+LASDESKYV+G N ++DGGF+
Sbjct  182   TPLALDYLKM-NGKKASDVYSTLNGATLTPKDVAETALFLASDESKYVSGQNFIVDGGFT  240

Query  305   TMNSTLCIF  279
               N  L IF
Sbjct  241   AENPGLSIF  249



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 177/264 (67%), Gaps = 4/264 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
              RLEGKVAL+TGG + IGE   ++F  HGAKV   D +D LG  +C  L    A + HCN
Sbjct  18    HRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTASFVHCN  77

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +ES  ++AV   V+ FGKLDIM N A   G+ K  I+ NDK++FE+V+ VNV G FLG
Sbjct  78    VTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTGVFLG  137

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAA+AMIP   G I+N  S++S   G   H+YT AKHAVLGLT+N AVELG+ GIRVN
Sbjct  138   VKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQFGIRVN  197

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKL--YNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             C+SP+    P+  + +G+   E    +    NLKG  LKAEDVA AAL+LA DE++YV+G
Sbjct  198   CLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALFLAGDEARYVSG  257

Query  335   HNLVIDGGFSTMNSTLCIF--PPK  270
             HNL IDGGFS +N +  +F  PP+
Sbjct  258   HNLFIDGGFSVVNPSFRMFQYPPE  281



>gb|AAK83036.1|AF286651_1 TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 178/262 (68%), Gaps = 8/262 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   KLF KHGAKV   D  D LG+ LC+DL  +++V+ HC+
Sbjct  11    RRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCD  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPS----ILQNDKSEFEQVMGVNVVG  702
             + +E DVE+AVD  V+K+GKLDIM+N A   GV + S     L++D   F++V+ VN+VG
Sbjct  71    VTKEKDVETAVDTAVSKYGKLDIMLNNA---GVFEESPNFDFLKDDPLTFQRVVNVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHAAR M P G GSIV   S+ S   G   H+YTS+KH VLGL +N AV+LGR G
Sbjct  128   AFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLK-GAVLKAEDVAEAALYLASDESKY  345
             IRVNCVSP +V   +G K   +    +    Y +LK G +L+ EDV EA +YL SDESK 
Sbjct  188   IRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKC  247

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+G NL++DGGF+ +N  LC F
Sbjct  248   VSGLNLIVDGGFTVVNQALCSF  269



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 179/260 (69%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA +TGG + IG    K+F + GAKV   D  ++LG  + + +  + + Y HC+
Sbjct  12    RRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ES +++A+D TVA  GKLDIM N A   G  K  I+ N+K++FE+V+ VNV G FLG
Sbjct  72    VTNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP  +GSI++  SV+S       H+Y  AKHAVLGLTKN AVELG+ GIRVN
Sbjct  132   IKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+    +G+ TDEDL+   N   NLKG  L+ ED+A AALYLASDE+KYV+
Sbjct  192   CLSPYALATPLATSFVGI-TDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVS  250

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+ +N +L +F
Sbjct  251   GHNLFIDGGFTIVNPSLGMF  270



>gb|KDP34955.1| hypothetical protein JCGZ_09243 [Jatropha curcas]
Length=270

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 177/258 (69%), Gaps = 3/258 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG   IG  I   F KHGAKV   D  D LG+ L ++L    A++ HC+
Sbjct  12    RRLEGKVALITGGATGIGASIATTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAIFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESD+++AVD  ++ F KLDIMVN A      K SI+ ND S+FE+V+ VN++G FLG
Sbjct  72    VTIESDIKNAVDIAISIFRKLDIMVNNAAIADPRKLSIVDNDISDFERVVKVNLIGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI+ LGSV S+  G   H+YTS KH V+GL KN A ELGR GIRVN
Sbjct  132   TKHAARVMIPARQGSIITLGSVCSSVGGVAFHAYTSTKHGVVGLAKNAAAELGRFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKK-LYNNLKGAVLKAEDVAEAALYLASDESKYVNGH  333
             C+S + +  P+ M    +  +ED K  +Y+NL+G  LK EDVA+AA+YL SDESKYV+GH
Sbjct  192   CLSCYFIETPLTMNFFKM--EEDGKSGVYSNLEGVKLKEEDVAQAAIYLGSDESKYVSGH  249

Query  332   NLVIDGGFSTMNSTLCIF  279
             NL +DGG +T+N    +F
Sbjct  250   NLALDGGSTTINPAFGVF  267



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 180/267 (67%), Gaps = 6/267 (2%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             MA+T+  RRLEGKVAL+TG  + IGE   KLF +HGAK+   D  D+LG+ +C+ +  + 
Sbjct  1     MATTT--RRLEGKVALITGAASGIGECAAKLFAEHGAKIVIADIQDQLGQAVCEAIGSSN  58

Query  890   AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVN  711
             ++Y HC++  E DV  AVD  +A +GKLDIM   A  +   K  I+ N+KS+FE+V+ VN
Sbjct  59    SIYIHCDVTNEEDVRKAVDIAIATYGKLDIMFCNAGIIDPNKDHIIDNEKSDFERVLSVN  118

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G FL  KHAAR M+P  AGSI++  SV S   G  PH+YT +KHAV GLTKN AVELG
Sbjct  119   VTGVFLSMKHAARVMVPTRAGSIISTASVVSNIGGLCPHAYTCSKHAVAGLTKNLAVELG  178

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLAS  360
             + GIRVNC+SP+ +  P      GL   ED K   N   NLKG  L  +DVA+AA++LAS
Sbjct  179   QFGIRVNCLSPYAIDTPQATGFTGL-KGEDFKNKVNSVANLKGVTLTTDDVAKAAVFLAS  237

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DE+KY++GHNL IDGGFS +N +  +F
Sbjct  238   DEAKYISGHNLFIDGGFSIVNPSFNMF  264



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 178/260 (68%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRL+GKVAL+TGG + IGE   K+F  HGAKV   D  D+LG  + + L P+ + Y  C+
Sbjct  12    RRLQGKVALITGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEALGPSNSTYVRCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + EE+ +++AVD  ++ +GKLDIM+N A     +K  I+ N+ ++FE+V+ +NV G FLG
Sbjct  72    VTEEAQIKNAVDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERVLKINVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP  +G+I++  SV+S       H+Y  +KHAVLGLT+N A ELG+ GIRVN
Sbjct  132   IKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+  K +G+  DE L+   N   NLKG  LK EDVA AALYLASDE++Y++
Sbjct  192   CLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYLASDEARYIS  251

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGFS  N T  +F
Sbjct  252   GHNLFIDGGFSVQNPTFQMF  271



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 180/268 (67%), Gaps = 4/268 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVAL+TGG + IGE   ++F  HGAKV   D +D LG  +   L    A +
Sbjct  8     SAAAKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSIRDSLSRDNASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES V++AV   V+ +GKLDIM N A   G  K  I+ NDK++FE+V+ VNV G
Sbjct  68    VHCDVTDESQVKAAVAEAVSTYGKLDIMFNNAGITGPNKSRIVDNDKADFERVLAVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAA+AMIP   G I+N  S++S  AG T H+YT AKHAVLGLT+N AVELG+ G
Sbjct  128   VFLGMKHAAQAMIPVRRGCIINTASISSGLAGITSHAYTCAKHAVLGLTRNAAVELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKL--YNNLKGAVLKAEDVAEAALYLASDESK  348
             IRVNC+SP     P+  K  G+   E    +    NLKG  LK EDVA AAL+LA DE++
Sbjct  188   IRVNCLSPNACATPLATKFFGMGPAELEAAIDAVTNLKGVTLKVEDVANAALFLAGDEAR  247

Query  347   YVNGHNLVIDGGFSTMNSTLCIF--PPK  270
             YV+GHNL IDGGFS +NS+  +F  PP+
Sbjct  248   YVSGHNLFIDGGFSVVNSSFRLFHYPPE  275



>ref|XP_004136700.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004173253.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=277

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 188/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQD-LDPA  894
             +++T+  RRLEGKVA++TGG + IGE   KLF+ HGAKV   D  D LG  LC + L   
Sbjct  7     ISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCANVLGST  66

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
              ++Y HC++ +ES V++AV A V  FGKLDIM+N A     +KP I+ NDK +F++V+ V
Sbjct  67    NSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKQDFDRVLSV  126

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             N+ G FLG KHAA+AMIP   GSI++  SVAS   G+  H+YT +KHAV+GLTKN AVEL
Sbjct  127   NITGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTKNAAVEL  186

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEAALYLAS  360
             G+ GIRVNC+SP+++  P+  + + L   E  K   +  NLKG  LKAEDVA AAL+LAS
Sbjct  187   GQFGIRVNCLSPYVLATPLATEFVDLDGAEFEKYASSRANLKGVTLKAEDVANAALFLAS  246

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DES+YV+GHNL +DGGFS +N  + IF
Sbjct  247   DESRYVSGHNLFVDGGFSIVNPNIQIF  273



>ref|XP_010104809.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01950.1| Momilactone A synthase [Morus notabilis]
Length=277

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 179/264 (68%), Gaps = 3/264 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++  RRLEGKVAL+TGG + IGE   K+F  HGAK+   D  D LG  + + +   +  Y
Sbjct  8     SAVPRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGYSVVESIGQTSCKY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES V++AVD  V  +GKLDIM+N A      K  I+ N+K++FE+VM VNV G
Sbjct  68    VHCDVTDESHVKNAVDEAVKTYGKLDIMLNNAGIADENKARIIDNEKADFERVMSVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAAR MIP   GSI+   S+ S   G + H+YT++KHAVLGL +N AVELG+ G
Sbjct  128   VFLGIKHAARVMIPARRGSIITTASMCSHIGGGSSHAYTASKHAVLGLARNAAVELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLK---KLYNNLKGAVLKAEDVAEAALYLASDES  351
             IRVNC+SPF +  P+  K  G T  E L+   K + NLK   LKAEDVA AALYLASDE+
Sbjct  188   IRVNCLSPFPLLTPMTSKYFGSTNQEVLENTFKSWGNLKHVTLKAEDVANAALYLASDEA  247

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
              Y++GH+L+IDGGFS +N +L +F
Sbjct  248   NYISGHSLLIDGGFSIVNPSLNLF  271



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 182/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   +LF KHGAKV   D  D LG+ +C DL    A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDLGAETASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDVE+A+   V KFGKLDIMVN A      K +IL NDK++FE+V+ VN+ G FLG
Sbjct  72    VSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAARAMIP+ +GSI+N+GSV+S+  G   H+YTS+KHA++GLT+N A ELGR GIRVN
Sbjct  132   TKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVASELGRYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             C+SP+ +  P+  +   +  +  + ++Y+NL G  L+ EDVA+AA+YL SDESKYV+G N
Sbjct  192   CLSPYFILTPLTKEFFKIDENAGV-RVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQN  250

Query  329   LVIDGGFSTMN  297
             L +D GF+T+N
Sbjct  251   LAVDAGFTTIN  261



>gb|KGN59171.1| hypothetical protein Csa_3G778270 [Cucumis sativus]
Length=277

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 188/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQD-LDPA  894
             +++T+  RRLEGKVA++TGG + IGE   KLF+ HGAKV   D  D LG  LC + L   
Sbjct  7     ISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCANVLGST  66

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
              ++Y HC++ +ES V++AV A V  FGKLDIM+N A     +KP I+ NDK +F++V+ +
Sbjct  67    NSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDFDRVLSI  126

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G FLG KHAA+AMIP   GSI++  SVAS   G+  H+YT +KHAV+GLTKN AVEL
Sbjct  127   NVTGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTKNAAVEL  186

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEAALYLAS  360
             G+ GIRVNC+SP+++  P+  + + L   E  K   +  NLKG  LKAEDVA AAL+LAS
Sbjct  187   GQFGIRVNCLSPYVLATPLATEFVDLDGAEFEKYASSRANLKGVTLKAEDVANAALFLAS  246

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DES+YV+GHNL +DGGFS +N  + IF
Sbjct  247   DESRYVSGHNLFVDGGFSIVNPNIQIF  273



>ref|XP_010051779.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=318

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 182/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   +LF KHGAKV   D  D LG+ +C DL    A + HC+
Sbjct  12    RRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDLGAETASFVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDVE+A+   V KFGKLDIMVN A      K +IL NDK++FE+V+ VN+ G FLG
Sbjct  72    VSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAARAMIP+ +GSI+N+GSV+S+  G   H+YTS+KHA++GLT+N A ELGR GIRVN
Sbjct  132   TKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVASELGRYGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
             C+SP+ +  P+  +   +  +  + ++Y+NL G  L+ EDVA+AA+YL SDESKYV+G N
Sbjct  192   CLSPYFILTPLTKEFFKIDENAGV-RVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQN  250

Query  329   LVIDGGFSTMN  297
             L +D GF+T+N
Sbjct  251   LAVDAGFTTIN  261



>ref|XP_010312220.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=283

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 179/260 (69%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA-AVYFHC  873
             +RLEGKVA+VTGG + IGE I KLF +HGAKV   D  D+LG  +   L  ++ ++Y HC
Sbjct  19    KRLEGKVAIVTGGASGIGEAIAKLFFEHGAKVVIADVQDELGNSVINALGGSSNSIYIHC  78

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E  V+ AVD T+A FGKLDIM+  A     TKP I+ N K++FE+V+ +N+ G FL
Sbjct  79    DVTNEDYVQEAVDRTIATFGKLDIMICNAGICDETKPRIIDNTKADFERVLSINITGVFL  138

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR M+P  +G I++  SV+S       H+Y S+KHAVLGLTKN AVELG+ GIRV
Sbjct  139   SMKHAARVMVPTRSGCIISTASVSSKVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  198

Query  512   NCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             NC+SP+ +  P+  K +GL  +  E+      NLKGA LK +DVA+AAL+LASD+++Y++
Sbjct  199   NCLSPYAMVTPMATKIIGLENEELENAMSTIGNLKGATLKVDDVAKAALFLASDDAQYIS  258

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N  L +F
Sbjct  259   GHNLFIDGGFTVSNPGLGMF  278



>emb|CAN78993.1| hypothetical protein VITISV_001799 [Vitis vinifera]
Length=388

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IG+   + F +HGAKV   D  D+LG  + + L    A Y HC+
Sbjct  125   RRLEGKVALITGGASGIGKXTAETFTQHGAKVVIADIQDELGHSVIEALGQTNASYVHCD  184

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +ES +++AVD T A  GKLDIM N A  +   KP I+ N+K++FE+V+ +NV G FLG
Sbjct  185   VTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERVLSINVTGVFLG  244

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR M+P  +GSI++  SV+S       H+Y  +KHAVLGLT+N A+ELG+ GIRVN
Sbjct  245   MKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAAIELGQFGIRVN  304

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+    L LT  E+L+   N   NLKG  LKA+DVA AALYLASDES+YV+
Sbjct  305   CLSPYALATPLATNFLNLTA-EELETAMNATANLKGVTLKAQDVANAALYLASDESRYVS  363

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N +  +F
Sbjct  364   GHNLFIDGGFTVANPSFHLF  383



>gb|AAK83035.1|AF286650_1 CTA [Cucumis sativus]
Length=271

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 178/262 (68%), Gaps = 8/262 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE   KLF KHGAKV   D  D LG+ LC+DL  +++V+ HC+
Sbjct  11    RRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCD  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPS----ILQNDKSEFEQVMGVNVVG  702
             + +E DVE+AVD  V+K+GKLDIM+N A   GV + S    IL++D   F++V+ VN+VG
Sbjct  71    VTKEKDVETAVDTAVSKYGKLDIMLNNA---GVFEESPNFDILKDDPLTFQRVVNVNLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
               LGT+HAAR M P G GSIV   S+ S   G   H+YTS+KH VLGL +N AV+LGR G
Sbjct  128   ASLGTRHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLK-GAVLKAEDVAEAALYLASDESKY  345
             IRVNCVSP +V   +G K   +    +    Y +LK G +L+ EDV EA +YL SDESK 
Sbjct  188   IRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKC  247

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+G NL++DGGF+ +N  LC F
Sbjct  248   VSGLNLIVDGGFTVVNQALCSF  269



>ref|XP_009618318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 185/273 (68%), Gaps = 7/273 (3%)
 Frame = -1

Query  1076  LSMASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQ  909
             L MAS S      +RLEGKVA+VTGG + IGE   KLF +HGAKV   D  D+LG  +  
Sbjct  13    LVMASASFLSTIGKRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDELGNSVSN  72

Query  908   DL-DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEF  732
              L  P+ ++Y HC++  E  V++AVD T++ FGKLDIM+  A     TKP I+ N K +F
Sbjct  73    ALGSPSHSIYIHCDVTNEDHVQNAVDRTISTFGKLDIMICNAGISDETKPRIIDNMKEDF  132

Query  731   EQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTK  552
             E+V+ +NV G FL  KHAAR M+P  +G I++  SV+S       H+Y S+KHAVLGLTK
Sbjct  133   ERVLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTK  192

Query  551   NTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEA  378
             N AVELG+ GIRVNC+SP+ +  P+ +K +GL  +   K L +  NL+G  LK +DVA+A
Sbjct  193   NLAVELGQFGIRVNCLSPYAMVTPLAVKVVGLENEAFEKALSSAGNLQGVTLKVDDVAKA  252

Query  377   ALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             AL+LASD++KY++GHNL IDGGF+  N +L +F
Sbjct  253   ALFLASDDAKYISGHNLFIDGGFTVYNPSLGMF  285



>ref|XP_010104811.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01952.1| Momilactone A synthase [Morus notabilis]
Length=272

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 183/273 (67%), Gaps = 8/273 (3%)
 Frame = -1

Query  1070  MASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MA+TS      RRLEGKVA++TGG + IGE   K+F  HGAK+   D  D LG  LCQ +
Sbjct  1     MATTSLLSAVSRRLEGKVAVITGGASGIGECTAKVFAHHGAKLIIADIQDALGHSLCQSI  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
             D     Y HC++ +E+ V++AVD  V  +GKLDI+ N A     +   IL++ K++FE+V
Sbjct  61    DETNCKYVHCDVTDETHVKNAVDKAVKAYGKLDIIFNNAGTSDKSYLRILKDQKNDFERV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             M VN  G FLG KHA+R MIP  +GSI++  SV S   G   H+YT++KHAVLGLTK+ A
Sbjct  121   MSVNATGVFLGIKHASRVMIPARSGSIISTASVCSYIGGAASHAYTASKHAVLGLTKSAA  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAAL  372
             VELG+ GIRVNC+SP+ V  P+  K LG     D++ L++   NLK   L+AEDVA AAL
Sbjct  181   VELGQYGIRVNCLSPYGVATPLVEKFLG-RKKGDIENLFSSAANLKNVTLEAEDVANAAL  239

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLCIFPP  273
             YLASDE++Y++GHNL +DGG+S  N +  +F P
Sbjct  240   YLASDEARYISGHNLFVDGGYSIANPSFNMFQP  272



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/259 (52%), Positives = 178/259 (69%), Gaps = 4/259 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVA +TGG + IG    K+F + GAKV   D  ++LG  + + +  + + Y HC++
Sbjct  50    RLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCDV  109

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
               ES +++A+D TVA  GKLDIM N A   G  K  I+ N+K++FE+V+ VNV G FLG 
Sbjct  110   TNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGI  169

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAAR MIP  +GSI++  SV+S       H+Y  AKHAVLGLTKN AVELG+ GIRVNC
Sbjct  170   KHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNC  229

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVNG  336
             +SP+ +  P+    +G+ TDEDL+   N   NLKG  L+ ED+A AALYLASDE+KYV+G
Sbjct  230   LSPYALATPLATSFVGI-TDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSG  288

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNL IDGGF+ +N +L +F
Sbjct  289   HNLFIDGGFTIVNPSLGMF  307



>ref|XP_010312221.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=276

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 179/260 (69%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA-AVYFHC  873
             +RLEGKVA+VTGG + IGE I KLF +HGAKV   D  D+LG  +   L  ++ ++Y HC
Sbjct  12    KRLEGKVAIVTGGASGIGEAIAKLFFEHGAKVVIADVQDELGNSVINALGGSSNSIYIHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E  V+ AVD T+A FGKLDIM+  A     TKP I+ N K++FE+V+ +N+ G FL
Sbjct  72    DVTNEDYVQEAVDRTIATFGKLDIMICNAGICDETKPRIIDNTKADFERVLSINITGVFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR M+P  +G I++  SV+S       H+Y S+KHAVLGLTKN AVELG+ GIRV
Sbjct  132   SMKHAARVMVPTRSGCIISTASVSSKVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             NC+SP+ +  P+  K +GL  +  E+      NLKGA LK +DVA+AAL+LASD+++Y++
Sbjct  192   NCLSPYAMVTPMATKIIGLENEELENAMSTIGNLKGATLKVDDVAKAALFLASDDAQYIS  251

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N  L +F
Sbjct  252   GHNLFIDGGFTVSNPGLGMF  271



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 183/263 (70%), Gaps = 2/263 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             TSA RRLEGKVAL+TGG + IGE   KLF +HGA+V   D  D  G  LC+ L  + A Y
Sbjct  3     TSAARRLEGKVALITGGASGIGEATAKLFTRHGARVMIADVQDDKGRALCESLGSSVASY  62

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES V  AVDA V++ GKLDIM N A  +G     IL+++K++FE+V+G+N+VG
Sbjct  63    VHCDMTDESHVRDAVDAAVSRHGKLDIMFNNAGIIGSPCMQILKSEKADFERVVGINLVG  122

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
             ++LGTKHAAR MIP   GSIV   SVAS     TP +YT +KHAVLGL ++ AVELG+ G
Sbjct  123   SYLGTKHAARVMIPARRGSIVMTASVASVDPAMTPVAYTCSKHAVLGLMRSAAVELGQFG  182

Query  521   IRVNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESK  348
             +RVNCVSP+ +  P+   A G+  +  ED    +  LKG  LKAED+AEA L+L S+E+K
Sbjct  183   VRVNCVSPYALATPLAATAFGMGGEELEDFMHEHAILKGVRLKAEDIAEAVLFLGSEEAK  242

Query  347   YVNGHNLVIDGGFSTMNSTLCIF  279
             YV+G NL++DGGF+T N +  +F
Sbjct  243   YVSGLNLLVDGGFTTANPSHGLF  265



>ref|XP_011088939.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=270

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 178/270 (66%), Gaps = 8/270 (3%)
 Frame = -1

Query  1070  MASTS----ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MA+TS      +RLEGKVAL+TGG   +G    KLF +HGAKV   D  D  G  +CQ+L
Sbjct  1     MATTSLLFAVAKRLEGKVALITGGAGSLGSVTAKLFHEHGAKVLIADVQDDKGHLVCQNL  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
              P +A + HC++  ESD+  AV+  V+  GKLDIM N A  +    P +L  ++++FE+V
Sbjct  61    SPESASFIHCDVTNESDIRKAVETAVSIHGKLDIMFNNAGIVDPVIPDMLNYNQTDFERV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VN VG FLGTKHAA  M     GSI+N  SV S   G   H YTS+KHA++GLTKNTA
Sbjct  121   LRVNAVGAFLGTKHAACFMKQAKRGSIINTASVCSVIGGVATHGYTSSKHAIVGLTKNTA  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDED--LKKLYNNLKGAVLKAEDVAEAALY  369
             VELGR GIRVNCVSP+    P  M       DED  +  + +NL+G  LK EDVAEA +Y
Sbjct  181   VELGRYGIRVNCVSPYAF--PSAMSRGFFERDEDDPIDDIGSNLEGVSLKPEDVAEAVVY  238

Query  368   LASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             LASDES+YV+GHNL++DGGF+ MNS L +F
Sbjct  239   LASDESRYVSGHNLIVDGGFTVMNSALTMF  268



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/259 (52%), Positives = 178/259 (69%), Gaps = 4/259 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVA +TGG + IG    K+F + GAKV   D  ++LG  + + +  + + Y HC++
Sbjct  7     RLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCDV  66

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
               ES +++A+D TVA  GKLDIM N A   G  K  I+ N+K++FE+V+ VNV G FLG 
Sbjct  67    TNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGI  126

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAAR MIP  +GSI++  SV+S       H+Y  AKHAVLGLTKN AVELG+ GIRVNC
Sbjct  127   KHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNC  186

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVNG  336
             +SP+ +  P+    +G+ TDEDL+   N   NLKG  L+ ED+A AALYLASDE+KYV+G
Sbjct  187   LSPYALATPLATSFVGI-TDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSG  245

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNL IDGGF+ +N +L +F
Sbjct  246   HNLFIDGGFTIVNPSLGMF  264



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 176/259 (68%), Gaps = 3/259 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             ++LEGKVAL+TGG + IGE   KLF +HGAKV   D  D+LG  +C  L PAA+ + HC+
Sbjct  12    KKLEGKVALITGGASGIGECTAKLFCRHGAKVVVADVQDELGTAVCSGLGPAAS-FIHCD  70

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  E DV +AVD  VAKFG+LDIM N A   G    +ILQ +KS+FE+V+GVN+VG FLG
Sbjct  71    VTSEDDVSAAVDHAVAKFGRLDIMFNNAGITGAACHNILQCEKSDFERVVGVNLVGPFLG  130

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI+   S+A        H+YT +KHAV+GLTKN A ELG+ G+RVN
Sbjct  131   TKHAARVMIPARKGSIITTSSLAGVIGAAAAHAYTCSKHAVVGLTKNAAAELGQFGVRVN  190

Query  509   CVSPFIVCNPVGMKALGLTTDE-DLK-KLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             CVSP     P+ M+ +GL  +  D+      NLKG  L  EDVA+A LYLASD+SKYV+G
Sbjct  191   CVSPAAAATPLAMRYVGLEGEAFDMAMTAVANLKGVSLGTEDVADAVLYLASDDSKYVSG  250

Query  335   HNLVIDGGFSTMNSTLCIF  279
             HNLV+DGG S    +  +F
Sbjct  251   HNLVLDGGCSVAYPSFNLF  269



>ref|XP_006339148.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum tuberosum]
 ref|XP_006339149.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum tuberosum]
Length=304

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 188/283 (66%), Gaps = 4/283 (1%)
 Frame = -1

Query  1118  QLHFDIILLSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDT  939
             QL + +  L    + S  ST   +RLEGKVA+VTGG + IGE I KLF +HGAKV   D 
Sbjct  18    QLAYSLPALKVMASASFLST-IGKRLEGKVAIVTGGASGIGEAIAKLFSEHGAKVVIADV  76

Query  938   DDKLGEKLCQDLDPAA-AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKP  762
              D+LG  +   L  ++ ++Y HC++  E  V+ AVD T+A FGKLDIM+  A     TK 
Sbjct  77    QDELGNSVINALGGSSNSIYIHCDVTNEDHVQEAVDRTIATFGKLDIMICNAGICDETKS  136

Query  761   SILQNDKSEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTS  582
              I+ N K++FE+V+ +NV G FL  KHAAR M+P  +G I++  SV+ST      H+Y S
Sbjct  137   RIIDNTKADFERVLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSTVGAAASHAYCS  196

Query  581   AKHAVLGLTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGA  408
             +KHAVLGLTKN AVELG+ GIRVNC+SP+ +  P+  K +GL  +  E+      NLKGA
Sbjct  197   SKHAVLGLTKNLAVELGQFGIRVNCLSPYAMVTPLATKVIGLENEELENAMSAVGNLKGA  256

Query  407   VLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              LK +DVA+AAL+LASD+++Y++GHNL IDGGF+  N  L +F
Sbjct  257   TLKVDDVAKAALFLASDDAQYISGHNLFIDGGFTVCNPGLGMF  299



>ref|XP_007152489.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
 gb|ESW24483.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
Length=270

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 187/257 (73%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RL+GKVAL+TGG   IGE + KLF KHGAKV   D  D+LG+ L  ++    A Y HC+
Sbjct  12    QRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E+DVE+AV+ TV+K+GKLDIMVN A      KP+IL ND ++FE+V+ VN+VG FLG
Sbjct  72    VSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI+ +GSV+S+  G   H+YTS+KHA++GL KNTA ELG+ GIRVN
Sbjct  132   TKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTAAELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
              +S + + N +      L  DE    +Y+NLKG  LK EDVA+AALYLASDESKY++GHN
Sbjct  192   SLSCYCIHNELAKDFFKL-DDEGFSNIYSNLKGVTLKEEDVAQAALYLASDESKYISGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             L +DGGF+T+N +  +F
Sbjct  251   LAVDGGFTTINPSFGLF  267



>ref|XP_006339150.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X3 
[Solanum tuberosum]
 ref|XP_006339151.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X4 
[Solanum tuberosum]
 ref|XP_006339152.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X5 
[Solanum tuberosum]
Length=276

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 179/260 (69%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA-AVYFHC  873
             +RLEGKVA+VTGG + IGE I KLF +HGAKV   D  D+LG  +   L  ++ ++Y HC
Sbjct  12    KRLEGKVAIVTGGASGIGEAIAKLFSEHGAKVVIADVQDELGNSVINALGGSSNSIYIHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E  V+ AVD T+A FGKLDIM+  A     TK  I+ N K++FE+V+ +NV G FL
Sbjct  72    DVTNEDHVQEAVDRTIATFGKLDIMICNAGICDETKSRIIDNTKADFERVLSINVTGVFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR M+P  +G I++  SV+ST      H+Y S+KHAVLGLTKN AVELG+ GIRV
Sbjct  132   SMKHAARVMVPTRSGCIISTASVSSTVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             NC+SP+ +  P+  K +GL  +  E+      NLKGA LK +DVA+AAL+LASD+++Y++
Sbjct  192   NCLSPYAMVTPLATKVIGLENEELENAMSAVGNLKGATLKVDDVAKAALFLASDDAQYIS  251

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N  L +F
Sbjct  252   GHNLFIDGGFTVCNPGLGMF  271



>ref|XP_010685947.1| PREDICTED: sex determination protein tasselseed-2-like [Beta 
vulgaris subsp. vulgaris]
Length=306

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 182/268 (68%), Gaps = 20/268 (7%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGK+A+VTGG   IGE  ++LF++HGAKV   D +D LG  L   L P+A  + HC+
Sbjct  33    RRLEGKIAIVTGGARGIGEATVRLFIRHGAKVVIADVEDTLGNALANALSPSA-TFIHCD  91

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGV---TKPSILQNDKSEFEQVMGVNVVGT  699
             +  E DV + VD  VA  G+LDI+VN A  LG    ++ SIL  D +EF+Q+M +NV G 
Sbjct  92    VSVEDDVCTVVDTAVALHGRLDILVNNAGVLGSQTKSRKSILNFDPNEFDQIMSINVKGM  151

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
              LG KHAAR M+P G+G I+++ SVA    G  PH+YT++KHA++GLTKNTA ELGR GI
Sbjct  152   ALGIKHAARVMMPKGSGCIISISSVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRFGI  211

Query  518   RVNCVSPFIVCNPVGMKA----------LGLTTDEDLKKLYN------NLKGAVLKAEDV  387
             RVNCVSPF V   + + A          LGL   E+++K+         LKGA LK +D+
Sbjct  212   RVNCVSPFGVATSMLINAWRSGEEDDMELGLPNGEEVEKMEEFVRGLATLKGATLKPKDI  271

Query  386   AEAALYLASDESKYVNGHNLVIDGGFST  303
             AEA+LYLASDES+YV+GHNLV+DGGF+T
Sbjct  272   AEASLYLASDESRYVSGHNLVVDGGFTT  299



>ref|XP_007152499.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
 gb|ESW24493.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
Length=270

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 187/257 (73%), Gaps = 1/257 (0%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RL+GKVAL+TGG   IGE + KLF KHGAKV   D  D+LG+ L  ++    A Y HC+
Sbjct  12    QRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E+DVE+AV+ TV+K+GKLDIMVN A      KP+IL ND ++FE+V+ VN+VG FLG
Sbjct  72    VSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP   GSI+ +GSV+S+  G   H+YTS+KHA++GL KNTA ELG+ GIRVN
Sbjct  132   TKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTAAELGQFGIRVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHN  330
              +S + + N +      L  DE    +Y+NLKG  LK EDVA+AALYLASDESKY++GHN
Sbjct  192   SLSCYCIHNELAKDFFKL-DDEGFSNIYSNLKGVTLKEEDVAQAALYLASDESKYISGHN  250

Query  329   LVIDGGFSTMNSTLCIF  279
             L +DGGF+T+N +  +F
Sbjct  251   LAVDGGFTTINPSFGLF  267



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 178/264 (67%), Gaps = 3/264 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             +S  +RL+GKVAL+TGG + IGE   K+F  HGAKV   D  D+LG  + + L P+ + Y
Sbjct  8     SSIAKRLQGKVALITGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEALGPSNSTY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
               C++ EE+ +++ VD  ++ +GKLDIM+N A      K  I+ N+ ++FE+V+ +NV G
Sbjct  68    VRCDVTEEAQIKNVVDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERVLKINVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAAR MIP  +G+I++  SV+S       H+Y  +KHAVLGLT+N A ELG+ G
Sbjct  128   VFLGIKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             IRVNC+SP+ +  P+  K +G+  DE L+   N   NLKG  LK EDVA AALYLASDE+
Sbjct  188   IRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYLASDEA  247

Query  350   KYVNGHNLVIDGGFSTMNSTLCIF  279
             +Y++GHNL IDGGFS  N T  +F
Sbjct  248   RYISGHNLFIDGGFSVQNPTFQMF  271



>ref|XP_006359043.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/274 (51%), Positives = 186/274 (68%), Gaps = 9/274 (3%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL-DP  897
             S  S+ +++RL G+VALVTGG + IGE I++LF KHGAKV   D  D+LG+++C+ L D 
Sbjct  6     SSDSSLSNQRLLGRVALVTGGASGIGESIVRLFHKHGAKVCIVDIQDELGQRVCESLGDE  65

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
              +A + HC++  E+DV +AVD  V KFG LDIMVN A   G    +IL  D S F+ V+ 
Sbjct  66    ESACFIHCDVTSETDVSNAVDFAVEKFGTLDIMVNNAGLTGAPCSNILDYDLSVFDNVLD  125

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VNV G FLG KHAAR MIP   GSIV+L SVA +  G  PH+YT++K AVLGLT+N A E
Sbjct  126   VNVRGVFLGMKHAARIMIPRKRGSIVSLSSVAGSIGGLGPHAYTASKFAVLGLTQNVAAE  185

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALG--LTTDEDLKKL------YNNLKGAVLKAEDVAE  381
             +G+ GIRVNCVSP+ V   +G+  L      D+ +         + NLKG  L A+DVA 
Sbjct  186   MGKHGIRVNCVSPYAVATELGLSHLPPEQRNDDAIADFNSYFGKFANLKGVDLMAQDVAN  245

Query  380   AALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A L+LASDE++Y++GHNL +DGGFS++N +L +F
Sbjct  246   AVLFLASDEARYISGHNLKVDGGFSSVNHSLKVF  279



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 180/268 (67%), Gaps = 4/268 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVAL+TGG + IGE   ++F  HGAKV   D +D LG  +   L    A +
Sbjct  8     SAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES +++AV   V+ +GKLDIM N A   G  +  I+ NDK++FE+V+ VNV G
Sbjct  68    VHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAA+AMIP   G I+N  S++S  AG T H+YT AKHAVLGLT+N AVELG+ G
Sbjct  128   VFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKL--YNNLKGAVLKAEDVAEAALYLASDESK  348
             IRVNC+SP     P+     G++  E    +    NLKG  LK EDVA AAL+LA DE++
Sbjct  188   IRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALFLAGDEAR  247

Query  347   YVNGHNLVIDGGFSTMNSTLCIF--PPK  270
             YV+GHNL IDGGFS +NS+  +F  PP+
Sbjct  248   YVSGHNLSIDGGFSVVNSSFRLFHYPPE  275



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 180/268 (67%), Gaps = 4/268 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++A +RLEGKVAL+TGG + IGE   ++F  HGAKV   D +D LG  +   L    A +
Sbjct  38    SAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTASF  97

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES +++AV   V+ +GKLDIM N A   G  +  I+ NDK++FE+V+ VNV G
Sbjct  98    VHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNVTG  157

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAA+AMIP   G I+N  S++S  AG T H+YT AKHAVLGLT+N AVELG+ G
Sbjct  158   VFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQFG  217

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKL--YNNLKGAVLKAEDVAEAALYLASDESK  348
             IRVNC+SP     P+     G++  E    +    NLKG  LK EDVA AAL+LA DE++
Sbjct  218   IRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALFLAGDEAR  277

Query  347   YVNGHNLVIDGGFSTMNSTLCIF--PPK  270
             YV+GHNL IDGGFS +NS+  +F  PP+
Sbjct  278   YVSGHNLSIDGGFSVVNSSFRLFHYPPE  305



>ref|XP_010931582.1| PREDICTED: LOW QUALITY PROTEIN: zerumbone synthase-like [Elaeis 
guineensis]
Length=277

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 181/276 (66%), Gaps = 15/276 (5%)
 Frame = -1

Query  1064  STSAD------RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             STSAD      RRLEGKVALVTGG   IGE I++LF KHGAK+   D  D LG++LC+ L
Sbjct  2     STSADSVPPLPRRLEGKVALVTGGATGIGESIVRLFRKHGAKICVVDIQDNLGQQLCKSL  61

Query  902   --DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFE  729
               DP    +FHC++  E DV  AVD T  K+G +DIMVN A   G     I   D +EF+
Sbjct  62    GGDPYVC-FFHCDVTIEDDVRRAVDFTADKYGTIDIMVNNAGITGSKVKDIRDADFNEFK  120

Query  728   QVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKN  549
             +V  VNV G FLG KHAAR MIP   GSI++L SVASTT G  PH YT +KHAVLGLTKN
Sbjct  121   KVFDVNVNGVFLGMKHAARIMIPQRKGSIISLASVASTTGGLGPHGYTGSKHAVLGLTKN  180

Query  548   TAVELGRCGIRVNCVSPFIVCNPVGMKALG-LTTDEDLKKL-----YNNLKGAVLKAEDV  387
              A ELG+ GIRVNCVSP+     + M  L      ED   L     + NLKG  L  +DV
Sbjct  181   VAAELGKRGIRVNCVSPYATPTSLSMPHLPEEERQEDAXFLSFVGSHANLKGVDLMVDDV  240

Query  386   AEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A+A LYLASDE++Y++G NL++DGGF+ +N+++ +F
Sbjct  241   AQAVLYLASDEARYISGLNLMVDGGFTCVNNSVRVF  276



>dbj|BAC53872.1| alcohol dehydroge [Phaseolus lunatus]
Length=274

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 180/258 (70%), Gaps = 3/258 (1%)
 Frame = -1

Query  1067  ASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             A ++A +RLEGKVA++TGG + IG    +LF +HGA V   D  D LG  +C +L   +A
Sbjct  6     AVSAAVKRLEGKVAIITGGASGIGAATARLFSEHGAHVVIADIQDDLGLSVCNELK--SA  63

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
             VY HC++ +E DVE  V+ TV+K+GKLDIM+N A      K SI+ N  SEFE+V+ VNV
Sbjct  64    VYVHCDVTKEEDVEKCVNVTVSKYGKLDIMLNNAGTCHELKDSIVDNITSEFERVISVNV  123

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
             VG FLGTKHAAR MIP   G I+N  S+A      +PH+Y  +KH + GLTKNTAVELG+
Sbjct  124   VGPFLGTKHAARVMIPAKRGCIINTSSIAGCRGTGSPHAYVVSKHGLEGLTKNTAVELGQ  183

Query  527   CGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESK  348
              GIRVNCVSP++V  P+  K   L  +E +++ Y+NLKG+ L   DVAEAAL+LA DES 
Sbjct  184   FGIRVNCVSPYLVATPMLKKYFNL-DEEGVREAYSNLKGSYLVPNDVAEAALFLAGDESN  242

Query  347   YVNGHNLVIDGGFSTMNS  294
             YV+GH+L++DGG++  N+
Sbjct  243   YVSGHSLLLDGGYTITNA  260



>gb|KDP36168.1| hypothetical protein JCGZ_08812 [Jatropha curcas]
Length=277

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 179/268 (67%), Gaps = 3/268 (1%)
 Frame = -1

Query  1082  LNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             +N S +   A +RL GKVA++TGG + IG     LF+KHGAKV   D  D LG+ LC+++
Sbjct  1     MNCSSSLAVAAKRLAGKVAIITGGASGIGAATSTLFVKHGAKVVIGDVQDDLGQSLCKEI  60

Query  902   DPAAAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQ  726
             D    V Y HC++ ++SDV++ VD TV+K+GKLDIM N A   G   P IL +D   F++
Sbjct  61    DQNDTVSYLHCDVTDDSDVKNVVDFTVSKYGKLDIMYNNAGITGDVDPKILGSDNENFKR  120

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             V  VNV G FLG KHAAR MIP   G I+   SVAS T G +PH+YT +KHAV+GL KN 
Sbjct  121   VFDVNVYGGFLGAKHAARVMIPKNKGVILFTSSVASKTTGESPHAYTMSKHAVVGLMKNL  180

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAAL  372
              VELG+ GIRVNC+SP  +  P+  KA+G   +  E +     NLKG V + EDVAEAA+
Sbjct  181   CVELGQYGIRVNCISPCAIATPLLRKAMGSDKNFVEQVVCASANLKGVVPQPEDVAEAAV  240

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTL  288
             YL SDESKYV+G NL++DGG+ST N + 
Sbjct  241   YLGSDESKYVSGLNLMVDGGYSTTNQSF  268



>ref|XP_008367851.1| PREDICTED: xanthoxin dehydrogenase-like [Malus domestica]
Length=282

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 181/284 (64%), Gaps = 15/284 (5%)
 Frame = -1

Query  1094  LSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKL  915
             +ST +   + S  + +RL GKVALVTGG   IGE I++LF KHGAKV   D  D LG ++
Sbjct  1     MSTTMTEQVGSLPSFQRLVGKVALVTGGAXGIGESIVRLFHKHGAKVCLVDVQDNLGLQV  60

Query  914   CQDL--DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDK  741
             C+ L  DP    Y HC++  E D+  AVD TV K+G LDIMVN A   G   P I   D 
Sbjct  61    CESLHGDPNIC-YLHCDVTVEDDISRAVDFTVNKYGSLDIMVNNAGVSGSPCPDIRDADL  119

Query  740   SEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLG  561
             SEF++V  +NV G FLG KHAARAMIP   GSIV+L SVAS  AG  PH+YT +KHAVLG
Sbjct  120   SEFQKVFDINVKGVFLGMKHAARAMIPRKKGSIVSLSSVASAVAGLGPHAYTGSKHAVLG  179

Query  560   LTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN----------NLKG  411
             LTKN A ELG  GIRVNCVSP+ V   + +    L  +E  +  +           NL+G
Sbjct  180   LTKNVAAELGNHGIRVNCVSPYAVATNLALAH--LPEEERTEDAWTGFRTFVANNANLQG  237

Query  410   AVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
               L  +DVA A L+LASDESKY++G NL++DGGF+ +N +L +F
Sbjct  238   VELTVDDVANAVLFLASDESKYISGDNLMLDGGFTAVNHSLRVF  281



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 176/260 (68%), Gaps = 4/260 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             + LEGKVAL+TGG + IGE   K+F  HGAKV   D  D+ G  L + L P+ + Y HC+
Sbjct  8     KWLEGKVALITGGASGIGECTAKVFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVHCD  67

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +E+ V++AV+A V  +GKLDIM N A     +K  I+ N+K +FE+V+  NV G FLG
Sbjct  68    VTDEAQVKNAVNAAVTTYGKLDIMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLG  127

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   G+I++  SV+S       H+Y  +KHAVLGLTKN AVELG+ GIRVN
Sbjct  128   IKHAARVMIPGRNGTIISTASVSSKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVN  187

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKL---YNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+  + +GL  DE L+ L   +  LKG  L+AEDVA AALYLASDE++YV+
Sbjct  188   CLSPYALATPLAKQVIGL-DDEQLENLMHAFGTLKGVTLQAEDVANAALYLASDEARYVS  246

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N +  +F
Sbjct  247   GHNLFIDGGFTIQNPSFRMF  266



>ref|XP_006424146.1| hypothetical protein CICLE_v10030340mg, partial [Citrus clementina]
 gb|ESR37386.1| hypothetical protein CICLE_v10030340mg, partial [Citrus clementina]
Length=285

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 190/287 (66%), Gaps = 21/287 (7%)
 Frame = -1

Query  1124  MVQLHFDIILLSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFT  945
             +  LHF + + +  +  +   ++A RRL+GKVAL+TGG   IGE I +LF KHGAKV   
Sbjct  11    ITYLHFLVAVRAIRMGSASVVSAAARRLQGKVALITGGARGIGECIARLFSKHGAKVLIA  70

Query  944   DTDDKLGEKLCQDLDPAAAV-----YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATA  780
             D  D LGE +C+D+  +++      Y HC++ +E D+E+AV+  V+++GKLDIM N A  
Sbjct  71    DIKDDLGESICKDIGSSSSSANGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGT  130

Query  779   LGVTKPSILQNDKSEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTT  600
             +   KP+IL ND++EFE+++ +N+VG FLG     R M+         LG V     G  
Sbjct  131   VDEAKPNILDNDQAEFERILSINLVGAFLG-----RNML---------LG-VCGIIGGAA  175

Query  599   PHSYTSAKHAVLGLTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN  420
              H+YTS+KH +LGL KNTAVELGR GIRVNCVSP+ V  P+    L L  D+ L  +Y+N
Sbjct  176   THAYTSSKHGLLGLMKNTAVELGRFGIRVNCVSPYAVSTPLAKDFLKL-ADDGLGGMYSN  234

Query  419   LKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             LKGAVL+ ED AEAALYL SDESK V+GHNLV+DGGF+ +N+   +F
Sbjct  235   LKGAVLEPEDAAEAALYLGSDESKCVSGHNLVVDGGFAIVNAGFSVF  281



>ref|XP_009387285.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/251 (54%), Positives = 166/251 (66%), Gaps = 3/251 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVAL+TGG + IGE   KLF +HGA+V   D  D  G  LC DL PA A Y HC+
Sbjct  12    RRLEGKVALITGGASGIGECTAKLFAQHGARVVVVDIQDDKGHSLCADLGPAVASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  E+DV+ AVD  V+  GKLDIM N A  +       L  +KS FE V+ VNV+G +LG
Sbjct  72    VTIEADVKHAVDTAVSLHGKLDIMFNNAGVVDDLSSGFLNCEKSAFEMVVAVNVLGAYLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M P  AGSIV   S AS   G    +YT +KHAV+GL +  A ELG   +R N
Sbjct  132   TKHAARVMAPARAGSIVTTASAASVMGGLASPAYTCSKHAVVGLMRCAAAELGPFRVRAN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVN  339
             CVSP  V  P+   ALG T DE+L++L     NLKG +LKA+D+AEA LYL SD+S+YVN
Sbjct  192   CVSPHAVATPMAKTALGFTDDEELERLVEATANLKGTMLKAQDLAEAVLYLGSDKSRYVN  251

Query  338   GHNLVIDGGFS  306
             GHNL++DGGF+
Sbjct  252   GHNLLVDGGFT  262



>emb|CDP06416.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 176/293 (60%), Gaps = 38/293 (13%)
 Frame = -1

Query  1052  DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHC  873
             D RLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P    Y HC
Sbjct  6     DHRLEGKVAVVTGGARGIGEATVRLFARHGAKVVIGDVEDVLGHALAASLSPHGVTYVHC  65

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVMGVNVVG  702
             ++  E DVE  + +TV+ FG+LDIM N A  LG     K SI+  D  EF+++MGVNV G
Sbjct  66    DVSSEGDVEKLIQSTVSGFGRLDIMFNNAGVLGSQAKHKKSIVDFDAEEFDRIMGVNVRG  125

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
               LG KHAARAMIP G G I++  SVAS   G  PHSYT++KHA++GLTKN A ELG+ G
Sbjct  126   VALGMKHAARAMIPRGTGCIISTASVASVLGGLGPHSYTASKHAIVGLTKNAACELGKYG  185

Query  521   IRVNCVSPFIVCNPVGMKAL---------------------------------GLTTDED  441
             IRVNC+SPF V   + + A                                   +   E+
Sbjct  186   IRVNCISPFGVATRMLINAWRNSHIDDDDDEDEDDEDAAAATMMSSSNTTAREAVEKAEE  245

Query  440   LKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             + +   NLKGA L+  D+AEAALYLASDES+YV+GHNLV+DGG +T  S  CI
Sbjct  246   MVRGLANLKGATLRTSDIAEAALYLASDESRYVSGHNLVVDGGITT--SRNCI  296



>ref|XP_008243483.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=293

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 177/258 (69%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP--AAAVYFH  876
             +RLEGKVA++TGG + IGE  ++LF+KHGAKV   D  D+L   LC++LDP   +  Y  
Sbjct  22    KRLEGKVAIITGGASGIGESTVRLFVKHGAKVIIADVQDELSLSLCKELDPDEESVCYIR  81

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  ESDV++ VD  ++K+ KLDIM N A   G  +P+IL      F+QV  VNV G F
Sbjct  82    CDVTVESDVKNVVDLALSKYAKLDIMYNNAGIPGNLEPTILSARAENFKQVFDVNVYGAF  141

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAARAMIP   G I+   SVAS + G +PH+YT +KHAV+GL K+  VELG+ GIR
Sbjct  142   LGAKHAARAMIPAKKGVILFTSSVASASCGESPHAYTMSKHAVVGLMKSLCVELGQHGIR  201

Query  515   VNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             VNC+SP  +  P+    +G+  D  E+L      LKGAV +AEDVAEAA+YLAS+ESK+V
Sbjct  202   VNCISPCAMATPLLTNVMGMERDAVEELICAAAVLKGAVPRAEDVAEAAVYLASEESKFV  261

Query  341   NGHNLVIDGGFSTMNSTL  288
             NG NL++DGG+ST N + 
Sbjct  262   NGLNLLVDGGYSTTNQSF  279



>ref|XP_010246261.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nelumbo nucifera]
Length=281

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 177/261 (68%), Gaps = 7/261 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             RRL+GKVAL+TGG   IGE   +LF++HGAKV   D  D+LG  +C D+     + Y HC
Sbjct  12    RRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEETICYAHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  ++ V  AVD +V+K+GKLDIM N A   G +   IL  D  +F++V+ VN+ G FL
Sbjct  72    DVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVNLYGAFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR M+P   GSI+   SVAS   G TPH+Y++ KHAV+GLTKN  VELGR GIRV
Sbjct  132   GAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNLCVELGRYGIRV  191

Query  512   NCVSPFIVCNPV---GMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLASDES  351
             NC+SP+ V   +    M  LG T +E +++L +    LKG  + AED+AEAALYLASDE+
Sbjct  192   NCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMAEAALYLASDEA  251

Query  350   KYVNGHNLVIDGGFSTMNSTL  288
             +YVNG NL++DGG+ST N + 
Sbjct  252   RYVNGLNLIVDGGYSTTNPSF  272



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 175/267 (66%), Gaps = 4/267 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             MA+TS  RRLEGKVAL+TGG + IGE   +LF++ GAKV   D  D LG  +CQ+ +   
Sbjct  1     MAATSTTRRLEGKVALITGGASGIGECTARLFVEQGAKVLIADVQDDLGHSICQEFNNQE  60

Query  890   AV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
              + Y HCN+  +SDV++AVD  V+++GKLDIM N A   G    +IL +D  EF++V  V
Sbjct  61    IISYIHCNVTSDSDVKNAVDTAVSRYGKLDIMFNNAGVSGSPGANILGSDNEEFKKVFDV  120

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G FLG KHAAR MIP   G I+   S  S   G + H+Y ++KHAV+GL KN +VEL
Sbjct  121   NVFGPFLGAKHAARVMIPEKKGCILFTASAVSVCLGESSHAYAASKHAVVGLAKNLSVEL  180

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTD---EDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             G+ GIRVN +SPF V  P+    LG++     E+      NLK  +L+ ED+A AALYLA
Sbjct  181   GKYGIRVNAISPFTVVTPMMKSLLGISDKRAAEEFISSIGNLKTVLLEPEDIANAALYLA  240

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCI  282
             SDESKYV+G NLV+DGGFS  N +  I
Sbjct  241   SDESKYVSGLNLVVDGGFSLTNPSFAI  267



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 178/259 (69%), Gaps = 2/259 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             TSA  RLEGKVAL+TGG + IGE   KLF +HGA+V   D  D  G  LC+ L  A A Y
Sbjct  8     TSAAGRLEGKVALITGGASGIGEATAKLFTRHGARVMIADIQDDKGRALCESLGSAVASY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++ +ES V  AVDA V++ GKLDIM N A   G     I +++K++FE+VMG+N+VG
Sbjct  68    VHCDVTDESHVRDAVDAAVSRHGKLDIMFNNAGIAGSLCMQIRESEKADFERVMGINLVG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
             ++LGTKHAAR MIP   GSIV  GSVAS   G    +YT +K AV+GL ++ AVELG+ G
Sbjct  128   SYLGTKHAARVMIPARRGSIVMTGSVASAAPGIGSAAYTCSKPAVVGLMRSAAVELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN--LKGAVLKAEDVAEAALYLASDESK  348
             +RVNCVSP+ V  P+   + G+  +E  + ++ +  LKG  LK EDVAEA L+L S+E++
Sbjct  188   VRVNCVSPYGVATPLATTSFGIGVEEVEEFMHKHAILKGVRLKVEDVAEAVLFLGSEEAR  247

Query  347   YVNGHNLVIDGGFSTMNST  291
             YV+G NL++DGGF+T N +
Sbjct  248   YVSGVNLLVDGGFTTTNPS  266



>ref|XP_004303064.1| PREDICTED: xanthoxin dehydrogenase-like [Fragaria vesca subsp. 
vesca]
Length=275

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 176/266 (66%), Gaps = 9/266 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             RRL GKVALVTGG   IGE I++LF KHGAKV   D  D LG ++C+ L   A V YFHC
Sbjct  9     RRLLGKVALVTGGATGIGESIVRLFHKHGAKVCLVDVQDNLGLQVCESLGGDANVSYFHC  68

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++ +E+DV  AVD TV K+G LDIMVN A   G + P I   D SEF++V  +NV G F 
Sbjct  69    DVTKEADVSGAVDFTVDKYGTLDIMVNNAGVSGSSCPDIRNVDLSEFQKVFDINVKGVFH  128

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAA  MIP   GSI++L SV+STT G  PH+YT +KHAVLGLTKN A ELG  GIRV
Sbjct  129   GMKHAAGTMIPRKKGSIISLCSVSSTTGGIGPHAYTGSKHAVLGLTKNVAAELGIHGIRV  188

Query  512   NCVSPFIVCNPVGMKAL---GLTTD-----EDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             NCVSP+ V   + +  L     T D      D      NL+G  L  +DVA A L+LASD
Sbjct  189   NCVSPYAVATNLALAHLIEEERTEDAWAGFRDFVGRNANLQGVELTVDDVANAVLFLASD  248

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ES+Y++G NL+IDGGF+++N +L +F
Sbjct  249   ESRYISGDNLMIDGGFTSVNHSLRVF  274



>ref|XP_009631422.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 178/273 (65%), Gaps = 8/273 (3%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S  S+ +++RL G+VALVTGG + IGE I++LF KHGAKV   D  DKLG+++C+ L   
Sbjct  6     SSESSLSNQRLLGRVALVTGGASGIGEGIVRLFHKHGAKVCIADIQDKLGQRVCESLGDD  65

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
              + + HC++  E+D+  AVD  V KFG LDI+VN A   G T   I   + S F+ V+ V
Sbjct  66    QSAFIHCDVTAEADISQAVDFAVQKFGTLDILVNNAGLTGTTYTDIRDYELSVFDNVIDV  125

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G FLG KHAAR MIP   GSIV+L S AS   G  PH+YT++KHAV GLTKN A EL
Sbjct  126   NVKGVFLGMKHAARIMIPLKKGSIVSLSSAASAIGGLAPHAYTASKHAVSGLTKNVAAEL  185

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTDED--------LKKLYNNLKGAVLKAEDVAEA  378
             G+ GIRVNCVSP+ V   +G+  L     +D            + NL+G  L  EDVA A
Sbjct  186   GQHGIRVNCVSPYAVATGLGLSHLPEDQRDDDAIADFHAYFGKFANLQGVDLLVEDVANA  245

Query  377   ALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              L+LASDE++Y++GHNL++DGGFS +N +  +F
Sbjct  246   VLFLASDEARYISGHNLMVDGGFSCVNHSFKVF  278



>ref|XP_002527336.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35088.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=280

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 182/276 (66%), Gaps = 13/276 (5%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S+AST + +RL GKVALVTGG+  IGE I++LF KHGAKV   D +D LG+ +C+ L   
Sbjct  6     SVASTLSCQRLLGKVALVTGGSTGIGESIVRLFHKHGAKVCLVDLEDNLGQNVCESLGGE  65

Query  893   AAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
               + YFHC++  E +V+ AV+ TV KFG LDIMVN A   G   P I   + S+F++V  
Sbjct  66    PNICYFHCDVTVEDEVQRAVEFTVDKFGTLDIMVNNAGLSGPPCPDIRYTELSDFQKVFD  125

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VNV GTF+G KHAAR MIP   GSI++L SVAST  G  PH YT +KHAVLGLT+N A E
Sbjct  126   VNVKGTFIGMKHAARIMIPLNKGSIISLCSVASTIGGLGPHGYTGSKHAVLGLTRNVAAE  185

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDED----------LKKLYNNLKGAVLKAEDV  387
             LG+ GIRVNCVSP+ V  P  +    L  DE             +   NL+G  L A+DV
Sbjct  186   LGKHGIRVNCVSPYAV--PTNLALAHLHEDERTEDAMAGFKAFARKNANLQGVELTADDV  243

Query  386   AEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A + L+LAS+ES+Y++G NL+IDGGF+  N +L +F
Sbjct  244   ANSVLFLASEESRYISGENLMIDGGFTNSNHSLRVF  279



>ref|XP_009388139.1| PREDICTED: momilactone A synthase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 167/239 (70%), Gaps = 5/239 (2%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             SA +RLEGKVAL+TG  + IGE   KLF +HGA++   D  D  G  LC  L P+ A Y 
Sbjct  9     SAAKRLEGKVALITGAASGIGEATAKLFARHGARIVIADVQDDKGHALCSALGPSVASYV  68

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGT  699
             HC++  ESDV+ AVDATV+  GKLD+M N A  +G     +L+++KS+FE V+  N+VG+
Sbjct  69    HCDVTNESDVQQAVDATVSHHGKLDVMFNNAGIIGEPCLRLLESEKSDFEHVVATNLVGS  128

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
             +LGTKHAARAM+P   GSIV   SVAS  A  TP +YT +KHAVLGL K+ A+ELG+ GI
Sbjct  129   YLGTKHAARAMLPARRGSIVITASVASVIASITPVAYTCSKHAVLGLMKSAALELGQFGI  188

Query  518   RVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             RVNCVSP+ +  P+ MKA G+  +E     +  LKG  LKAEDVAEA +YLASDES+YV
Sbjct  189   RVNCVSPYALPTPLAMKAFGMGEEE-----HATLKGVRLKAEDVAEAVVYLASDESRYV  242



>sp|F1SWA0.1|ZERSY_ZINZE RecName: Full=Zerumbone synthase [Zingiber zerumbet]
 dbj|BAK09296.1| short-chain dehydrogenase/reductase1 [Zingiber zerumbet]
Length=267

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 175/266 (66%), Gaps = 11/266 (4%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFHC  873
             RLEGKVALVTGG + IGE I +LF++HGAK+   D  D+LG+++ Q L  DP A  YFHC
Sbjct  2     RLEGKVALVTGGASGIGESIARLFIEHGAKICIVDVQDELGQQVSQRLGGDPHAC-YFHC  60

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E DV  AVD T  K+G +DIMVN A   G     I   D +EF++V  +NV G FL
Sbjct  61    DVTVEDDVRRAVDFTAEKYGTIDIMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFL  120

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIP   GSIV+L SV+S  AG  PH YT AKHAV+GLTK+ A ELGR GIRV
Sbjct  121   GMKHAARIMIPKMKGSIVSLASVSSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRV  180

Query  512   NCVSPFIVCNPVGMKALGLT-TDEDLKKLY-------NNLKGAVLKAEDVAEAALYLASD  357
             NCVSP+ V   + M  L  +   ED  + +        NLKG  L   DVAEA LYLA++
Sbjct  181   NCVSPYAVPTRLSMPYLPESEMQEDALRGFLTFVRSNANLKGVDLMPNDVAEAVLYLATE  240

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ESKYV+G NLVIDGGFS  N TL +F
Sbjct  241   ESKYVSGLNLVIDGGFSIANHTLQVF  266



>ref|XP_010104812.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01953.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 184/268 (69%), Gaps = 5/268 (2%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             ++  RRLEGKVAL+TGG + IGE   K+F  HGAK+   D  D LG  +C+ L    + Y
Sbjct  8     SAVSRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGHSVCESLGQTNSKY  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HCN+ +ES VE+AVD  V  +G+LDIM N A      K  I+ ++K++FE+VM VNV G
Sbjct  68    VHCNVTDESHVENAVDEAVKTYGRLDIMFNNAGIADENKARIIDSEKADFERVMSVNVTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLG KHAA+AMIP+ +GSI++  S++S   G   H+Y  +KHAV+GLTKN AVELG+ G
Sbjct  128   VFLGIKHAAQAMIPSRSGSIISTASISSYVGGAASHAYCCSKHAVIGLTKNAAVELGQFG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             IRVN +SP+ +  P+  K +GL  DE L+ L N   NLK   LKAEDVA AALYLASDE 
Sbjct  188   IRVNSLSPYALATPLATKFVGL-DDEGLENLMNSLGNLKHVTLKAEDVANAALYLASDEG  246

Query  350   KYVNGHNLVIDGGFSTMNSTLCIFP-PK  270
             +Y++GHNL+IDGGFS +N +  +F  PK
Sbjct  247   RYISGHNLLIDGGFSIVNPSFNMFQYPK  274



>ref|XP_010024677.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=277

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 175/264 (66%), Gaps = 4/264 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEG+VAL+TGG + IGE   ++F  HGAKV   D +D LG+ +   L    A Y HC+
Sbjct  12    RRLEGRVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGQSVRDSLGQDTASYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ES +++AV   V+ +GKLDIM N A      K  I+ NDK++FE+V+ VNV G FLG
Sbjct  72    VTNESQIKAAVAEAVSAYGKLDIMFNNAGITDPNKARIVDNDKADFERVLAVNVTGVFLG  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAA+AMI    G I+N  S++S   G+  H+YT AKHAVLGLT+N AVELG+ GI VN
Sbjct  132   VKHAAQAMIAARRGCIINTASISSNIGGSASHAYTCAKHAVLGLTRNAAVELGQFGIWVN  191

Query  509   CVSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             C+SPF    P+  K +GL     E L     NLKG  LKAEDVA AAL+LASDE++YV+G
Sbjct  192   CLSPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALFLASDEARYVSG  251

Query  335   HNLVIDGGFSTMNSTLCIF--PPK  270
             HNL IDGG + +N +  +F  PP+
Sbjct  252   HNLFIDGGVTVVNPSFHMFQYPPE  275



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 175/256 (68%), Gaps = 3/256 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF-HC  873
             RRLEGKVAL+TGG + IG    +LF  HGAKV   D +D+LG  +C+++     + F HC
Sbjct  12    RRLEGKVALITGGASGIGRSTARLFANHGAKVVIADVEDELGHSICEEVGSEGTICFIHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++ +++DV +AVD+TV K GKLDIM + A   G     IL +D   F +V+ VN  G FL
Sbjct  72    DVTKDADVRNAVDSTVDKHGKLDIMFSNAGITGSPTKKILDSDNENFRKVLEVNTFGAFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHA R MIP   G+I+   SVAS  AG TP++Y ++KHAV+GLTKN +VELG+ GIRV
Sbjct  132   GAKHATRVMIPLKKGTIIFTSSVASVIAGDTPYAYAASKHAVVGLTKNLSVELGQYGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN--NLKGAVLKAEDVAEAALYLASDESKYVN  339
             NC+SP+ +  P+   A GL  ++    L    NLKG VLKAEDVAEAALYLASDES+YV+
Sbjct  192   NCISPYGLATPMLRTATGLEEEKIEAYLSGGANLKGVVLKAEDVAEAALYLASDESRYVS  251

Query  338   GHNLVIDGGFSTMNST  291
             G NLV+DGGFS  N +
Sbjct  252   GLNLVVDGGFSITNPS  267



>ref|XP_009768564.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=280

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 180/261 (69%), Gaps = 5/261 (2%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PA  894
             +A TS  RRLEGKVA++TGG +  GE  ++LFL++GAKV   D  D +G+ LC+ L+ P 
Sbjct  7     LAPTS--RRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCESLNYPN  64

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
                Y HC++  +SDV++ +D T++K+GKLDIM N A   G    +I+ +D   F++V  V
Sbjct  65    DVTYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKRVFDV  124

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G+FLG K+AAR MIP   G I+   S AS  AG +PHSYT +KHAV+GLTKN   EL
Sbjct  125   NVYGSFLGAKYAARVMIPAKKGVILFTSSAASVNAGESPHSYTVSKHAVVGLTKNLCAEL  184

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             G+ GIRVNCVSP  V  P+ +KA+G   +  + +     NLKG V  AEDVAEAALYLAS
Sbjct  185   GQFGIRVNCVSPCAVATPLLVKAMGAGKSVVDGIICSSANLKGVVPTAEDVAEAALYLAS  244

Query  359   DESKYVNGHNLVIDGGFSTMN  297
             DESK+V+G NLVIDGG+ST N
Sbjct  245   DESKFVSGLNLVIDGGYSTTN  265



>ref|XP_008808776.1| PREDICTED: zerumbone synthase [Phoenix dactylifera]
Length=280

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 174/267 (65%), Gaps = 11/267 (4%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             RRLEGKVALVTGG   IGE I++LF +HGAK+   D  D LG++LC+ L  DP   V+FH
Sbjct  14    RRLEGKVALVTGGAMGIGESIVRLFREHGAKICVVDIQDNLGQQLCKSLGGDPYV-VFFH  72

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E DV  AVD TV K+G +DI+VN A   G     I   D  EF++V  VNV G F
Sbjct  73    CDVTIEDDVHRAVDFTVRKYGTIDILVNNAGITGSKVVDIRNVDLKEFKKVFDVNVNGVF  132

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHA+R MIP   GSI++L SVAS   G  PH YT +KHAVLGLT+N A ELGR GIR
Sbjct  133   LGMKHASRVMIPKSKGSIISLASVASVIGGMGPHGYTGSKHAVLGLTRNVAAELGRHGIR  192

Query  515   VNCVSPFIVCNPVGMKALGLTTDED--LKKL------YNNLKGAVLKAEDVAEAALYLAS  360
             VNCVSP+     + M  L      +  LK        + NLKGA L  +DVA+A LYLAS
Sbjct  193   VNCVSPYATPTSLSMPHLPENERREAALKGFLSFAGSHANLKGAELMVDDVAQAVLYLAS  252

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DE+KY++G NL++DGGF+ +N +L  F
Sbjct  253   DEAKYISGLNLMVDGGFTCVNHSLQPF  279



>ref|XP_009802753.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
 ref|XP_009802755.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=276

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 177/260 (68%), Gaps = 3/260 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL-DPAAAVYFHC  873
             +RLEGKVA+VTGG + IGE   KLF +HGAKV   D  D+    +   L  P+ ++Y HC
Sbjct  12    KRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDERSNSVSNALGSPSHSIYIHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E  V++AVD T++ FGKLDI++  A     TKP I+ N K +FE+V+ +NV G FL
Sbjct  72    DVTNEDHVQNAVDRTISTFGKLDIIICNAGISDETKPRIIDNTKEDFERVLSINVTGVFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR M+P  +G I++  SV+S       H+Y S+KHAVLGLTKN AVELG+ GIRV
Sbjct  132   CMKHAARVMVPARSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             NC+SP+ +  P+  K +GL  +  E    +  NLKGA+L+ +DVA+AAL+LA ++SKY++
Sbjct  192   NCLSPYAMVTPLATKVVGLENEMFETALSMAGNLKGAILRVDDVAKAALFLAGEDSKYIS  251

Query  338   GHNLVIDGGFSTMNSTLCIF  279
             GHNL IDGGF+  N +L +F
Sbjct  252   GHNLFIDGGFTVYNPSLGMF  271



>ref|XP_009789920.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana sylvestris]
Length=280

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 178/267 (67%), Gaps = 9/267 (3%)
 Frame = -1

Query  1052  DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL-DPAAAVYFH  876
             ++RL GKVALVTGG + IGE I++LF KHGAKV   D  D+LG+ +C  L +  +A + H
Sbjct  13    NQRLLGKVALVTGGASGIGESIVRLFHKHGAKVCIADIQDELGQNICSTLGNDQSACFVH  72

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E+D+ +AVD T+ KFG LDIMVN A   G   P I   + S FE V+ VN+ GTF
Sbjct  73    CDVTAEADISNAVDLTIQKFGTLDIMVNNAGLSGPPIPDIRDYELSVFESVLDVNLKGTF  132

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MIP   GSIV+L SV S  AG  PH+Y ++KHAVLGLT+N A E+G+ G+R
Sbjct  133   LGIKHAARIMIPQKKGSIVSLCSVGSAIAGIGPHAYIASKHAVLGLTQNVAAEMGKHGVR  192

Query  515   VNCVSPFIVCNPVGMKAL--------GLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLAS  360
             VNCVSP+ V   + +  L         L       +   NL+G  LK +DVA A L+LAS
Sbjct  193   VNCVSPYAVATELALAHLPEDERTNDALAGFRAFTEKNANLQGVELKTQDVANAVLFLAS  252

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DE++Y++GHNL++DGGFS +N +L +F
Sbjct  253   DEARYISGHNLMVDGGFSCVNHSLRVF  279



>ref|XP_004492523.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cicer 
arietinum]
Length=302

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 184/282 (65%), Gaps = 24/282 (9%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             S  + RRLEGK+A+VTGG   IGE  +++F+KHGAKV   D +D++G KL   L P A  
Sbjct  22    SAPSSRRLEGKLAIVTGGARGIGEATVRIFVKHGAKVVIGDVEDEIGTKLANSLSPLAT-  80

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVN  711
             Y HC++  E DVE+ V +T+  +GKLDIM N A  LG      SI+  D  EF++VM VN
Sbjct  81    YVHCDVSVEKDVENLVTSTLFHYGKLDIMFNNAGVLGNQSKNKSIVNFDADEFDRVMSVN  140

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G  LG KHAA+AMIP G G I++  SVA    G  PH+YT++KHA++GLTKNT+ ELG
Sbjct  141   VKGVALGIKHAAKAMIPQGFGCIISSSSVAGVMGGLGPHAYTTSKHAIVGLTKNTSCELG  200

Query  530   RCGIRVNCVSPFIVCNPVGMKA-------------LGLTTDEDLKKLYN------NLKGA  408
             R GIRVNC+SPF V   + + A              GL   E+++K+        NL+GA
Sbjct  201   RFGIRVNCISPFGVATSMLVNAWRKGDEEIDDDINFGLPLHEEVEKMEEFVRGLANLRGA  260

Query  407   VLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
              L+A+D+AEA LYLASDESKYV+GHNLV+DGG ++  S  CI
Sbjct  261   TLRAQDIAEAVLYLASDESKYVSGHNLVVDGGITS--SRNCI  300



>ref|XP_010654129.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 176/257 (68%), Gaps = 4/257 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY-FHC  873
             +RL GKVAL+TGG + IG    KLF+KHGAKV   D  D+LG  LCQ++ PA  V+  HC
Sbjct  9     QRLAGKVALITGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFHVHC  68

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  +SDV++AVD  ++K+GKLDIM + A   G  +  I+ +D + F++V  VNV G FL
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFL  128

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR MIP   G I+   SVAS  +    H+Y ++KHAV+GL  N  VELG+ GIRV
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRV  188

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NC+SPF V  P+  K LG+     +++L +   NLKGAVL+AED+AEAALYL SD+SKYV
Sbjct  189   NCISPFGVATPMLQKGLGIMEKRKVEELVSSAANLKGAVLEAEDIAEAALYLGSDDSKYV  248

Query  341   NGHNLVIDGGFSTMNST  291
             +G NLV+DGG+S  N +
Sbjct  249   SGINLVVDGGYSITNPS  265



>gb|KDP36166.1| hypothetical protein JCGZ_08810 [Jatropha curcas]
Length=281

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 187/278 (67%), Gaps = 11/278 (4%)
 Frame = -1

Query  1094  LSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKL  915
             +S++L++++ +    +RLEGKV L+TGG + IGE   +LF+KHGAKV   D  D LG+ L
Sbjct  1     MSSDLSVTLIT----KRLEGKVVLITGGASGIGECTARLFVKHGAKVLIADIQDDLGQSL  56

Query  914   CQDLD-PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG---VTKPSILQN  747
             CQ+   P    Y HCN+  +SDV++AVD  V+++GKLDIM N A  LG    +   IL  
Sbjct  57    CQEFSSPETISYVHCNVSSDSDVKNAVDLAVSRYGKLDIMFNNAGILGNPDFSNTRILPT  116

Query  746   DKSEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAV  567
             +  +F++V+ VNV G FLGTKHAAR MIPN  G I+   S+ S     +PH+Y ++KHAV
Sbjct  117   ENQDFKKVIDVNVFGAFLGTKHAARIMIPNKKGCILFTASLVSVCCLDSPHAYAASKHAV  176

Query  566   LGLTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKA  396
             +GL KN  VELG+ GIRVN +SPF    P+   A G+   ++ +++ ++   LKG VL+ 
Sbjct  177   VGLAKNLCVELGQYGIRVNSISPFAAATPMLRNAFGMMEKKEAEEVISSIATLKGVVLET  236

Query  395   EDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             ED+A AAL+LASDESKYV+G NLV+DGGFS  N +L I
Sbjct  237   EDIANAALFLASDESKYVSGINLVVDGGFSLTNPSLAI  274



>ref|XP_010246256.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nelumbo nucifera]
Length=281

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/261 (51%), Positives = 177/261 (68%), Gaps = 7/261 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             +RL+GKVAL+TGG   IGE   +LF++HGAKV   D  D+LG  +C D+     + Y HC
Sbjct  12    KRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEETICYAHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  ++ V  AVD +V+K+GKLDIM N A   G +   IL  D  +F++V+ VN+ G FL
Sbjct  72    DVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVNLYGAFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR M+P   GSI+   SVAS   G TPH+Y++ KHAV+GLTKN  VELGR GIRV
Sbjct  132   GAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNLCVELGRYGIRV  191

Query  512   NCVSPFIVCNPV---GMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLASDES  351
             NC+SP+ V   +    M  LG T +E +++L +    LKG  + AED+AEAALYLASDE+
Sbjct  192   NCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMAEAALYLASDEA  251

Query  350   KYVNGHNLVIDGGFSTMNSTL  288
             +YVNG NL++DGG+ST N + 
Sbjct  252   RYVNGLNLIVDGGYSTTNPSF  272



>ref|XP_007204705.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
 gb|EMJ05904.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
Length=283

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 178/258 (69%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP--AAAVYFH  876
             +RL+GKVA++TGG + IGE  ++LF++HGAKV   D  D+L   LC++LDP   +  Y  
Sbjct  12    KRLDGKVAIITGGASGIGESTVRLFVQHGAKVIIADVQDELSLSLCKELDPDEESVCYTR  71

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  ESDV++ VD  ++K+GKLDIM N A   G  +P+IL      F+QV  VNV G F
Sbjct  72    CDVKVESDVKNVVDLALSKYGKLDIMYNNAGIPGNLEPTILSAGAENFKQVFDVNVYGAF  131

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAARAMIP   G I+   SVAS + G +PH+YT +KHAV+GL K+  VELG+ GIR
Sbjct  132   LGAKHAARAMIPAKKGVILFTSSVASASCGESPHAYTMSKHAVVGLMKSLCVELGQHGIR  191

Query  515   VNCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             VNC+SP  +  P+    +G+  D  E+L      LKGAV +AEDVAEAA+YLAS+ESK+V
Sbjct  192   VNCISPCAMATPLLRNVMGMERDAVEELICAAAVLKGAVPRAEDVAEAAVYLASEESKFV  251

Query  341   NGHNLVIDGGFSTMNSTL  288
             NG NL++DGG+ST N + 
Sbjct  252   NGLNLLVDGGYSTTNQSF  269



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/277 (49%), Positives = 181/277 (65%), Gaps = 9/277 (3%)
 Frame = -1

Query  1106  DIILLSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKL  927
             ++I  S  L  SMA     +RLEGKVA++TGG + IGE   +LF++HGAKV   D  D+L
Sbjct  3     ELISTSKELISSMA-----KRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDEL  57

Query  926   GEKLCQDLDPAAAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQ  750
             G+  C+D+  +  + Y HC++  E+DVE+ V+  V+K+GKLDIM + A   G   P IL 
Sbjct  58    GQTACRDIGSSEVISYVHCDVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILA  117

Query  749   NDKSEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHA  570
              D  +  +V  VNV G FL  KHAAR MIP   GSIV   SVAS T G  PH+Y ++KHA
Sbjct  118   TDYEDLRRVFDVNVFGGFLCAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHA  177

Query  569   VLGLTKNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLK  399
             V+GLTKN  +ELG  GIRVNCVSPF V  P+ M+ + L     +++L +   NLKG  ++
Sbjct  178   VVGLTKNLCIELGEYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKME  237

Query  398   AEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTL  288
             A DVAEA ++L+SDE KYV+G NLVIDGG+S  N  L
Sbjct  238   AVDVAEAVIFLSSDEGKYVSGQNLVIDGGYSLTNIAL  274



>ref|XP_009590019.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 178/275 (65%), Gaps = 10/275 (4%)
 Frame = -1

Query  1070  MASTSAD----RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MAS+S      ++LEGKVA +TGG + IG    +LF++HGAKV   D  D LG  L  ++
Sbjct  1     MASSSLQSPIAKKLEGKVAFITGGASGIGAATTRLFVQHGAKVTIADIQDNLGTSLVHEI  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
                 A++ HCN+  ESDV++AVDAT+ KFGKLDIM + A  LG    SIL+ D    + V
Sbjct  61    GTEKAIFIHCNVAIESDVQNAVDATIEKFGKLDIMFSNAGVLGKPISSILEVDYDIIKTV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
               VN++G F   KHAAR MIP   GSI+   SVA+  +G  PH+Y ++K AVLGL+KN  
Sbjct  121   FDVNIIGAFFCAKHAARVMIPFKKGSIIFTASVATVVSGLVPHAYAASKCAVLGLSKNIG  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLY---NNLKGAVLKAEDVAEAAL  372
             VELG+ GI+VNCVSP+ V  P+ +  LG+   E   K      NLKGA+L  E+VA+A L
Sbjct  181   VELGKYGIKVNCVSPYYVGTPLALNMLGIADREMADKWIAEAGNLKGALLNEEEVAKAVL  240

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLC---IFP  276
             YL SD+SKYV+G NLV+DGGFST N  L    +FP
Sbjct  241   YLVSDDSKYVSGMNLVLDGGFSTTNVALAYNKLFP  275



>ref|XP_010256990.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Nelumbo 
nucifera]
Length=304

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 184/280 (66%), Gaps = 24/280 (9%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             N S++ST   RRLEGKVA+VTGG   IGE  ++LF + GAKV   D +D+LG  L + L 
Sbjct  21    NSSLSSTP--RRLEGKVAIVTGGARGIGEATVRLFARQGAKVVIADVEDELGIVLARSLA  78

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQ  726
             P+   Y HC++  E DVE  +++TV++ G+LDI+ N A  LG      SI+  D  EF++
Sbjct  79    PSVT-YVHCDVSLEEDVEKLINSTVSRHGRLDILFNNAGVLGNQSKHKSIINFDADEFDR  137

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             VM VNV G  LG KHAAR M+P G+G I++  SVA    G  PH+YT++KHA++GLTKNT
Sbjct  138   VMRVNVRGVALGMKHAARVMVPRGSGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNT  197

Query  545   AVELGRCGIRVNCVSPFIV-----------CNPVG--MKALGLTTDEDLKKLYN------  423
             A ELGR GIRVNC+SPF V           CN V   M  +G+  +E++ K+        
Sbjct  198   ACELGRYGIRVNCISPFGVATSMLVNAWRRCNDVQDCMDIVGIPCEEEVGKMEEFVRSLA  257

Query  422   NLKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             NLK A L  +D+AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  258   NLKSATLTVKDIAEAALYLASDESKYVSGHNLVVDGGITT  297



>gb|AFV30207.1| borneol dehydrogenase [Lavandula x intermedia]
Length=259

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 184/265 (69%), Gaps = 12/265 (5%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             MAST   RRLEGKVAL+TG  + IGE   +LF +HGAKV   D  D+L   +C+DL    
Sbjct  1     MASTVL-RRLEGKVALITGAASGIGESAARLFSRHGAKVVIADIQDELALNICKDL---G  56

Query  890   AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVN  711
             + + HC++ +E DVE+AV+  V+ +GKLDIM+N A   G  K  I     S+F++V+ VN
Sbjct  57    STFVHCDVTKEFDVETAVNTAVSTYGKLDIMLNNAGISGAPKYKISNTQLSDFKRVVDVN  116

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             +VG FLGTKHAAR MIPN +GSI++  S A+  A  TP+ Y  +KH V+GLT+N AVE+G
Sbjct  117   LVGVFLGTKHAARVMIPNRSGSIISTASAATAAAAGTPYPYICSKHGVVGLTRNAAVEMG  176

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTTDED-LKKLYNNLKGAVLKAEDVAEAALYLASDE  354
               GIRVNCVSP+ V  P       +T D+D ++  ++NLKGAVL AEDVAEAALYLASDE
Sbjct  177   GHGIRVNCVSPYYVATP-------MTRDDDWIQGCFSNLKGAVLTAEDVAEAALYLASDE  229

Query  353   SKYVNGHNLVIDGGFSTMNSTLCIF  279
             SKYV+GHNL++DGG S MN    +F
Sbjct  230   SKYVSGHNLLVDGGVSIMNQGCNMF  254



>ref|XP_009605329.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=284

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 172/257 (67%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVAL+TGG + IG    +LF++HGAKV   D  D LG  L Q++     ++ HCN
Sbjct  12    KRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEIGNEHTIFVHCN  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDV++ VDAT+AKFGKLDIM + A   G +  SIL  D    + V  VN+VG F  
Sbjct  72    VAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTVFDVNIVGAFFC  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   GSI+   S A+  +G  PH+Y+++K AVLG +KN  VELG+ GI+VN
Sbjct  132   AKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIGVELGKYGIKVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLY---NNLKGAVLKAEDVAEAALYLASDESKYVN  339
             CVSP  +  P+ + ALG+   E  +K +    NLKGA+L  E+VA+A LYLASD+SKYV+
Sbjct  192   CVSPHYISTPLVLNALGIAEREMAEKWFAAGGNLKGALLDEEEVAKAVLYLASDDSKYVS  251

Query  338   GHNLVIDGGFSTMNSTL  288
             G NLVIDGGFST N  L
Sbjct  252   GMNLVIDGGFSTTNVAL  268



>ref|XP_009618308.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 181/262 (69%), Gaps = 7/262 (3%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PA  894
             +A TS  RRLEGKVA++TGG +  GE  ++LFL++GAKV   D  D +G+ LC +L+ P 
Sbjct  7     LAPTS--RRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCNNLNYPN  64

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
                Y HC++  +SDV++ +D T++K+GKLDIM N A   G    +I+ +D   F++V  V
Sbjct  65    DVTYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKRVFDV  124

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G+FLG K+AA+ MIP   G I+   SVAS  +G +PHSYT +KHAV+GLTKN   EL
Sbjct  125   NVYGSFLGAKYAAKVMIPAKKGVILFTSSVASVNSGESPHSYTVSKHAVVGLTKNLCAEL  184

Query  533   GRCGIRVNCVSPFIVCNPVGMKALG---LTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
             G+ GIRVNCVSP  V  P+ +KA+G   +  D  +     NLKG V  AEDVAEAALYLA
Sbjct  185   GQYGIRVNCVSPCAVATPLLVKAMGADKIVVDGIICS-SANLKGVVPTAEDVAEAALYLA  243

Query  362   SDESKYVNGHNLVIDGGFSTMN  297
             SDESK+++G NLVIDGG+ST N
Sbjct  244   SDESKFISGLNLVIDGGYSTTN  265



>emb|CAA11153.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
 emb|CAA11154.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
Length=284

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 172/257 (67%), Gaps = 3/257 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVAL+TGG + IG    +LF++HGAKV   D  D LG  L Q++     ++ HCN
Sbjct  12    KRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEIGNEHTIFVHCN  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  ESDV++ VDAT+AKFGKLDIM + A   G +  SIL  D    + V  VN+VG F  
Sbjct  72    VAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTVFDVNIVGAFFC  131

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAAR MIP   GSI+   S A+  +G  PH+Y+++K AVLG +KN  VELG+ GI+VN
Sbjct  132   AKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIGVELGKYGIKVN  191

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKLY---NNLKGAVLKAEDVAEAALYLASDESKYVN  339
             CVSP  +  P+ + ALG+   E  +K +    NLKGA+L  E+VA+A LYLASD+SKYV+
Sbjct  192   CVSPHYISTPLVLNALGIAEREIAEKWFAAGGNLKGALLDEEEVAKAVLYLASDDSKYVS  251

Query  338   GHNLVIDGGFSTMNSTL  288
             G NLVIDGGFST N  L
Sbjct  252   GMNLVIDGGFSTTNVAL  268



>ref|XP_002308240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE91763.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 186/281 (66%), Gaps = 23/281 (8%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             ST +  RLEG+VA+VTGG   IGE  ++LF + GAKV   D +D LG  L   L P+ + 
Sbjct  26    STRSPGRLEGRVAIVTGGARGIGEATVRLFARQGAKVVIADVEDALGTSLVNSLAPSVS-  84

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVN  711
             + HC++  E D+E+ +++T++++GKLDI+ N A  LG      SI+  D  EF++VM VN
Sbjct  85    FVHCDVSLEKDIENLINSTISQYGKLDILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVN  144

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G  LG KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELG
Sbjct  145   VRGMALGIKHAARVMIPRGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELG  204

Query  530   RCGIRVNCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAV  405
             R GIRVNC+SPF V   + + A             GL ++++++K+ +      NLKG  
Sbjct  205   RYGIRVNCISPFGVATSMLVNAWRSSGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPT  264

Query  404   LKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             L+A D+AEAALYLASDESKYV+GHNLV+DGG +T  ST C+
Sbjct  265   LRARDIAEAALYLASDESKYVSGHNLVVDGGITT--STNCV  303



>ref|XP_010039348.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
 gb|KCW88250.1| hypothetical protein EUGRSUZ_A00637 [Eucalyptus grandis]
Length=304

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 180/276 (65%), Gaps = 23/276 (8%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             +T   RRLEGK+A+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+   
Sbjct  23    TTPGPRRLEGKIAIVTGGVKGIGEATVRLFARHGAKVVIADIEDLLGTALANSLSPSV-T  81

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVN  711
             Y HC++  E DVE+ V +TV+++G+LD+M N A  LG    + SI+  D  EFE VM +N
Sbjct  82    YVHCDVSSEEDVENLVTSTVSRYGRLDVMFNNAGLLGNQSKRKSIMDFDVGEFESVMSIN  141

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G+ LG KHAAR M P  +G I++  SVA    G  PH+YT++KHA++GLTKN A ELG
Sbjct  142   VKGSALGIKHAARVMAPRRSGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNAACELG  201

Query  530   RCGIRVNCVSPFIVCNPVGMKA--------------LGLTTDEDLKKLYN------NLKG  411
             R GIRVNC+SPF V   + + A               G+ ++ +++K+        NLKG
Sbjct  202   RYGIRVNCISPFGVATSMLINAWRSSDGEEEDEGMSFGVPSEGEVEKMEEFVRGLANLKG  261

Query  410   AVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             A L+A+D+AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  262   ATLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTT  297



>ref|XP_002281352.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 175/258 (68%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY-FHC  873
             +RL GKVAL+TGG + IG    KLF+KHGAKV   D  D+LG  LCQ++ PA  V+  HC
Sbjct  9     QRLAGKVALITGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFDVHC  68

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  +SDV++AVD  ++K+GKLDIM + A   G  +  I+ +D + F++V  VNV G FL
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFL  128

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR MIP   G I+   SVAS  +    H+Y ++KHAV+GL  N  VELG+ GIRV
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRV  188

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NC+SPF V  P+  K LG+     +++L +   NLKG VL+AED+AEAALYL SD+SKYV
Sbjct  189   NCISPFGVATPMLQKGLGIMEKRKVEELVSSAANLKGVVLEAEDIAEAALYLGSDDSKYV  248

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLV+DGG+S  N + 
Sbjct  249   SGINLVVDGGYSITNPSF  266



>ref|XP_002281290.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=282

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 176/258 (68%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF-HC  873
             +RL GKVAL+TGG + IG    KLF+KHGAKV  TD  D+LG  +C+++ P   V++ HC
Sbjct  9     QRLSGKVALITGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHC  68

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  +SDV++AVD  ++K+GKLDIM + A   G     IL +D + F++V  VN  G FL
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFL  128

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR MIP   G I+   SVAS  +G   H+Y ++KHAV+GL  N  VELG+ G+RV
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRV  188

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NCVSPF V  P+  K +G+     +++L +   NLKGA L+AED+AEAALYL SD+SKYV
Sbjct  189   NCVSPFGVPTPMLQKGVGIMEKRKVEELVSSAANLKGAALEAEDIAEAALYLGSDDSKYV  248

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLV+DGG+S  N +L
Sbjct  249   SGINLVVDGGYSITNPSL  266



>ref|XP_010654128.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=282

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 176/258 (68%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF-HC  873
             +RL GKVAL+TGG + IG    KLF+KHGAKV  TD  D+LG  +C+++ P   V++ HC
Sbjct  9     QRLSGKVALITGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHC  68

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  +SDV++AVD  ++K+GKLDIM + A   G     IL +D + F++V  VN  G FL
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFL  128

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR MIP   G I+   SVAS  +G   H+Y ++KHAV+GL  N  VELG+ G+RV
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRV  188

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NCVSPF V  P+  K +G+     +++L +   NLKGA L+AED+AEAALYL SD+SKYV
Sbjct  189   NCVSPFGVPTPMLQKGVGIMEKRKVEELVSSAANLKGAALEAEDIAEAALYLGSDDSKYV  248

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLV+DGG+S  N +L
Sbjct  249   SGINLVVDGGYSITNPSL  266



>ref|XP_009399160.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 170/261 (65%), Gaps = 10/261 (4%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             +S  RRLEGKVAL+TGG + IGE   KLF +HGA+V   D  D  G  LC  L PA+  Y
Sbjct  8     SSVARRLEGKVALITGGASGIGECTAKLFARHGARVIVADIQDDKGRALCAALGPAS--Y  65

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSI---LQNDKSEFEQVMGVN  711
              HC++ +E+DVE AVD  VA  GKLD+M N A   GV  P +   L +D++ FE+VM  N
Sbjct  66    VHCDVTDEADVERAVDTAVALHGKLDVMFNNA---GVMDPPVNGFLASDRAAFERVMATN  122

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
              +G FLGTKHAAR M+P  AGSIV+  S+ S   G    +YT +KHAV+GL ++ A ELG
Sbjct  123   ALGAFLGTKHAARVMVPARAGSIVSTASLVSAVGGVASAAYTCSKHAVVGLMRSAAAELG  182

Query  530   RCGIRVNCVSPFIVCNPVGMKALGLTT--DEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
             R G+R NCVSP+ V  P+ M  + LTT   E   +   NLKG  LKA DVAEA LYLASD
Sbjct  183   RFGVRANCVSPYGVATPLAMAGMQLTTEEMEAAMEAMGNLKGVRLKAADVAEAVLYLASD  242

Query  356   ESKYVNGHNLVIDGGFSTMNS  294
             ES+YV+G NL +DGG S   S
Sbjct  243   ESRYVSGLNLTVDGGLSVTKS  263



>ref|XP_006828171.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
 gb|ERM95587.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
Length=297

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 179/267 (67%), Gaps = 18/267 (7%)
 Frame = -1

Query  1055  ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFH  876
             + RRLEGKVA++TGG   IGE   +LF +HGAKV   D +D  GE L   L    A+Y H
Sbjct  26    SQRRLEGKVAVITGGARGIGEATARLFSRHGAKVVIADINDVSGEALAASL--PGALYVH  83

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVMGVNVV  705
             C++ +ESDV + +D  + ++G+LDI+ N A  LG     + SIL+ D  EF++VM VNV 
Sbjct  84    CDVSQESDVCNLIDRALTRYGRLDILFNNAGVLGSQSQGRKSILEFDPDEFDRVMSVNVR  143

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G  LG KHAARAM+P G G I++  SVA    G  PHSYT++KHA++GLTKN A ELG+ 
Sbjct  144   GVALGMKHAARAMLPRGCGCIISTASVAGVLGGLGPHSYTASKHAIVGLTKNAACELGKH  203

Query  524   GIRVNCVSPFIVCNPV-------GMKALGLTTDEDLKKLYN------NLKGAVLKAEDVA  384
             GIRVNC+SPF V   +       G++  G    +D++K+        NLKGA L+A+DVA
Sbjct  204   GIRVNCISPFGVATSMLIDAWREGVEMEGCLRGDDVEKMEEFVRGLANLKGANLRAKDVA  263

Query  383   EAALYLASDESKYVNGHNLVIDGGFST  303
             EAALYLASDESKYV+GHNLV+DGG +T
Sbjct  264   EAALYLASDESKYVSGHNLVVDGGVTT  290



>gb|KCW90498.1| hypothetical protein EUGRSUZ_A02616, partial [Eucalyptus grandis]
Length=275

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 174/263 (66%), Gaps = 4/263 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEG+VAL+TGG + IGE   ++F  HGAKV   D +D LG+ +   L    A Y HC++
Sbjct  11    RLEGRVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGQSVRDSLGQDTASYVHCDV  70

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
               ES +++AV   V+ +GKLDIM N A      K  I+ NDK++FE+V+ VNV G FLG 
Sbjct  71    TNESQIKAAVAEAVSAYGKLDIMFNNAGITDPNKARIVDNDKADFERVLAVNVTGVFLGV  130

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAA+AMI    G I+N  S++S   G+  H+YT AKHAVLGLT+N AVELG+ GI VNC
Sbjct  131   KHAAQAMIAARRGCIINTASISSNIGGSASHAYTCAKHAVLGLTRNAAVELGQFGIWVNC  190

Query  506   VSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGH  333
             +SPF    P+  K +GL     E L     NLKG  LKAEDVA AAL+LASDE++YV+GH
Sbjct  191   LSPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALFLASDEARYVSGH  250

Query  332   NLVIDGGFSTMNSTLCIF--PPK  270
             NL IDGG + +N +  +F  PP+
Sbjct  251   NLFIDGGVTVVNPSFHMFQYPPE  273



>ref|XP_008643649.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X2 [Zea 
mays]
 gb|AFW67244.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 173/267 (65%), Gaps = 10/267 (4%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             +RLEGKVALVTGG   IGE I++LF++HGAKV   D  D+ G++L   L  D   A++ H
Sbjct  15    KRLEGKVALVTGGATGIGEAIVRLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVH  74

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E DV  AVDA   +FG LD+MVN A   G     I   D +E  +V+ VNV G F
Sbjct  75    CDVTSEEDVSRAVDAAAERFGALDVMVNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVF  134

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAARAMIP   GSIV+L SVAS   GT PH YT++KHAV+GLTK+ A ELGR G+R
Sbjct  135   LGMKHAARAMIPRKRGSIVSLASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVR  194

Query  515   VNCVSPFIVCNPVGMKAL--GLTTDEDLKKLY------NNLKGAVLKAEDVAEAALYLAS  360
             VNCVSP+ V   + M  L  G   D+ LK          NLKG     EDVA+A LYLAS
Sbjct  195   VNCVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLAS  254

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DE++YV+  NL++DGGF+ +N+ L  F
Sbjct  255   DEARYVSAVNLMVDGGFTAVNNNLRAF  281



>emb|CBI18081.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 174/253 (69%), Gaps = 12/253 (5%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGK+A+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+   + HC++
Sbjct  29    RLEGKIAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGAALASSLAPSVT-FVHCDV  87

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFL  693
               E D+E+ +++TV+++G+LDI+ N A  LG      SI+  D  EF+QVM VNV G  L
Sbjct  88    SLEEDIENVINSTVSRYGRLDILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMAL  147

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR M+P G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRV
Sbjct  148   GIKHAARVMVPRGMGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  207

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NC+SPF      G+    L   E +++  +   NLKG +L+A+D+AEAALYLASDESKYV
Sbjct  208   NCISPF------GVATSMLREVEKMEEFVSGLANLKGHILRAKDIAEAALYLASDESKYV  261

Query  341   NGHNLVIDGGFST  303
             +GHNLV+DGG +T
Sbjct  262   SGHNLVVDGGITT  274



>ref|XP_006577090.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=273

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 177/258 (69%), Gaps = 6/258 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA--AAVYFHC  873
             RLEGKVAL+TGG + IGE   +LFL HGAKV   D  D LG  LCQ+L+ +     Y HC
Sbjct  4     RLEGKVALITGGASGIGEATARLFLCHGAKVIIADIQDNLGHSLCQNLNSSDNNISYVHC  63

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  ++DV++AV+A V++ GKLDI+ + A  +G   PSI   D ++ ++V  VNV G F 
Sbjct  64    DVTNDNDVQNAVNAAVSRHGKLDILFSNAGTVGRVSPSITAFDNADLKRVFEVNVFGAFY  123

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAA+ MIP   GSIV   SVAS T   +PH+YT++KHAV+GL KN  VELG  GIRV
Sbjct  124   AAKHAAKVMIPEKRGSIVLTSSVASVTHAVSPHAYTASKHAVVGLMKNLCVELGNHGIRV  183

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NCVSP+ V  P+  +   +   E ++K+Y+   NLKG VLK ED+AEAAL+LASDESKYV
Sbjct  184   NCVSPYAVATPLMTRGTRM-KKEMVEKVYSEAGNLKGVVLKEEDLAEAALFLASDESKYV  242

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLV+DGG+S  N ++
Sbjct  243   SGVNLVVDGGYSVTNVSV  260



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 173/258 (67%), Gaps = 4/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             +RLEGKVA++TGG + IGE   +LF++HGAKV   D  D+LG+  C+D+  +  + Y HC
Sbjct  13    QRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGSSEVISYVHC  72

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  E+DVE+ V+  V+K+GKLDIM + A   G   P IL  D  +  +V  VNV G FL
Sbjct  73    DVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFL  132

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAAR MIP   GSIV   SVAS T G  PH+Y ++KHAV+GLTKN  +ELG  GIRV
Sbjct  133   CAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGIRV  192

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NCVSPF V  P+ M+ + L     +++L +   NLKG  ++A DVAEA ++L+SDE KYV
Sbjct  193   NCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAVIFLSSDEGKYV  252

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLVIDGG+S  N  L
Sbjct  253   SGQNLVIDGGYSLTNIAL  270



>gb|ABR18410.1| unknown [Picea sitchensis]
Length=291

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 181/273 (66%), Gaps = 15/273 (5%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             S+ RRL GKVA++TGG + IGE I++LF KHGAKV   D  D+ G KL + L P A +Y 
Sbjct  20    SSQRRLNGKVAIITGGASGIGEAIVRLFTKHGAKVIIADIADEAGRKLAESLSPPA-IYL  78

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGT  699
             HC++ +E D+ + V+  + K+G+LDIM N A  +G+   S+ + D  +F++VM VNV G 
Sbjct  79    HCDVSKEQDMSAVVELAMEKYGQLDIMYNNA-GIGIADKSVAEYDMEQFDRVMKVNVRGV  137

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
              LG KHAAR MIP   G I++  SVAS   G TP+SYT++KHAV+GLTKN A ELG+ GI
Sbjct  138   MLGIKHAARVMIPQKKGCIISTASVASIVGGLTPYSYTASKHAVIGLTKNGAAELGKYGI  197

Query  518   RVNCVSPFIVCNPVGMK------ALGLTTDEDLKKLYN-------NLKGAVLKAEDVAEA  378
             RVN VSP+ +   + ++      A    ++ DLK   +       NL+G +LK EDVAEA
Sbjct  198   RVNAVSPYGLATALTVEYFKEGDASSSASEMDLKAAVDAFCSSVANLEGTILKVEDVAEA  257

Query  377   ALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              LYLASDE+KYV+GHNLV+DGG + +N +   +
Sbjct  258   GLYLASDEAKYVSGHNLVVDGGITVVNHSWRTY  290



>ref|XP_002513092.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF49595.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=280

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 180/276 (65%), Gaps = 13/276 (5%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S+ ST   +RL GKVALVTGG+  IGE I++LF KHGAKV   D DD LG+ +C+ L   
Sbjct  6     SVGSTLYCQRLLGKVALVTGGSTGIGESIVRLFHKHGAKVCLVDLDDNLGQNVCKSLGGE  65

Query  893   AAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
               + YFHC++  E +V+ AVD TV KFG LDIMVN A   G     I   + S+F++V  
Sbjct  66    PNICYFHCDVTVEDEVQRAVDFTVDKFGTLDIMVNNAGLSGPPCSDIRCTELSDFQKVFD  125

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VN  GTF+G KHAAR MIP   GSI++L SVAST  G  PH+YT +KHAVLGLT+N A E
Sbjct  126   VNTKGTFIGMKHAARVMIPLNRGSIISLCSVASTIGGLGPHAYTGSKHAVLGLTRNVAAE  185

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDED----------LKKLYNNLKGAVLKAEDV  387
             LG+ GIRVNCVSP+ V  P  +    L  DE             +   N++G  L A+DV
Sbjct  186   LGKHGIRVNCVSPYAV--PTNLALAHLPEDERTEDAMAGFKAFARKNANMQGIELTADDV  243

Query  386   AEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A + L+LAS+ES+Y++G NL+IDGGF+T N +L +F
Sbjct  244   ANSVLFLASEESRYISGANLMIDGGFTTSNHSLRVF  279



>gb|KCW47495.1| hypothetical protein EUGRSUZ_K01263 [Eucalyptus grandis]
Length=279

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 177/270 (66%), Gaps = 22/270 (8%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHCN  870
             RLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LGE L   L P   V Y HC+
Sbjct  3     RLEGKVAIVTGGARGIGEAAVRLFARHGAKVVVADVEDVLGEALASSLAPNYCVTYVHCD  62

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTK---PSILQNDKSEFEQVMGVNVVGT  699
             +  E DVE+ V +TV+++G LDI+ N A  LG       SIL  D  EF+ VM VNV GT
Sbjct  63    VSSEPDVENMVSSTVSRYGHLDILFNNAGVLGSQSGKSKSILNFDAEEFDCVMRVNVRGT  122

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
              LG KHAA AMIP G+G I++  SVA    G  PH+YT++KHA++GLTKN A ELGR GI
Sbjct  123   ALGMKHAAGAMIPRGSGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNAACELGRHGI  182

Query  518   RVNCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAVLKAE  393
             RVNC+SPF V   + + A             G+  +++++K+        NL+G  L+A+
Sbjct  183   RVNCISPFGVATSMLVNAWGGGDREDECMSFGVPCEQEVEKMEEFVSSLANLRGPTLRAK  242

Query  392   DVAEAALYLASDESKYVNGHNLVIDGGFST  303
             DVAEAALYLASDESKY++GHNLV+DGG +T
Sbjct  243   DVAEAALYLASDESKYISGHNLVVDGGITT  272



>ref|XP_007162945.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
 gb|ESW34939.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
Length=273

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 185/269 (69%), Gaps = 6/269 (2%)
 Frame = -1

Query  1070  MASTSA--DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDP  897
             MAS+S+  +RRLEGKVA++TGG + IG+   ++F +HGAKV   D  D+LG  + + + P
Sbjct  1     MASSSSVGNRRLEGKVAVITGGASGIGKRTAEVFAQHGAKVVIADIQDELGHSVAESIGP  60

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
             +   Y HC++ +E  V++A+   V  +GKLDIM N A      K  I+ NDK++FE+V+ 
Sbjct  61    STCCYVHCDVTDEDQVKNAIHRAVETYGKLDIMFNNAGIADPNKHRIIDNDKADFERVLA  120

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VNV G FLG KHAA+AMIP  +GSI++  S++S   G   H+Y  AKHAV GLTKN AVE
Sbjct  121   VNVTGVFLGMKHAAQAMIPGRSGSIISTASISSYVGGAASHAYCCAKHAVAGLTKNAAVE  180

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYL  366
             LG+ GIRVNC+SP+ +  P+    +G   DE L+ + N   NLKG  LKA+DVA AALY 
Sbjct  181   LGQFGIRVNCLSPYALATPLATNFVG-ANDEQLETIMNSLANLKGVTLKADDVANAALYF  239

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ASD+S+YV+GHNL+IDGGFS +N +  +F
Sbjct  240   ASDDSRYVSGHNLLIDGGFSIVNPSFHMF  268



>ref|XP_003554452.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=275

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 186/266 (70%), Gaps = 5/266 (2%)
 Frame = -1

Query  1064  STSA-DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             STSA ++RLEGKVAL+TGG + IG+   ++F + GAKV   D  D+LG  + Q + P+  
Sbjct  4     STSALNKRLEGKVALITGGASGIGKRTAEVFAQQGAKVVIADIQDELGHSVAQSIGPSTC  63

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++ +E+ +++AV   V  +GKLDIM N A  +   K  I+ NDK++FE+V+ VNV
Sbjct  64    CYVHCDVTDENQIKNAVQKAVDAYGKLDIMFNNAGIVDPNKNRIIDNDKADFERVLSVNV  123

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G FLG KHAA+AMIP  +GSI++  S++S   G   H+Y  AKHAV+GLTKN AVELG+
Sbjct  124   TGVFLGMKHAAQAMIPARSGSIISTASISSYVGGAASHAYCCAKHAVVGLTKNAAVELGQ  183

Query  527   CGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASD  357
              GIRVNC+SP+ +  P+  K +G   DE+L+ + N   NLKG  LKAEDVA AALY ASD
Sbjct  184   FGIRVNCLSPYALATPLATKFVG-ANDEELETIMNSLANLKGVTLKAEDVANAALYFASD  242

Query  356   ESKYVNGHNLVIDGGFSTMNSTLCIF  279
             +S+YV+G NL+IDGGFS +N +  +F
Sbjct  243   DSRYVSGQNLLIDGGFSIVNPSFHMF  268



>ref|XP_009631424.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 177/269 (66%), Gaps = 13/269 (5%)
 Frame = -1

Query  1052  DRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL-DPAAAVYFH  876
             ++RL GKVALVTGG   IGE I++LF KHGAKV   D  D+LG+ +C  L +   A + H
Sbjct  13    NQRLLGKVALVTGGAIGIGESIVRLFHKHGAKVCIADIQDELGQNVCGTLGNDQNACFVH  72

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E+D+ +AVD TV KFG LDIMVN A   G   P I   + S FE V+ VN+ GTF
Sbjct  73    CDVTAEADISNAVDLTVQKFGTLDIMVNNAGLSGPPIPDIRNYELSVFESVLDVNLKGTF  132

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MIP   GSIV+L SV S  AG  PH+Y ++KHAVLGLT+N A E+G+ G+R
Sbjct  133   LGIKHAARIMIPQKKGSIVSLCSVGSAIAGIGPHAYIASKHAVLGLTQNVAAEMGKHGVR  192

Query  515   VNCVSPFIVCNPVGMKALGLTTDED----------LKKLYNNLKGAVLKAEDVAEAALYL  366
             VNCVSP+ V    G+    L  DE             +   NL+G  LK +DVA A L+L
Sbjct  193   VNCVSPYAVA--TGLALAHLPEDERTNDALAGFRAFAEKNANLQGVELKTQDVANAVLFL  250

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ASDE++Y++GHNL++DGGFS +N +L +F
Sbjct  251   ASDEARYISGHNLMVDGGFSCVNHSLRVF  279



>ref|XP_010035975.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
Length=307

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 178/271 (66%), Gaps = 22/271 (8%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             +RLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LGE L   L P   V Y HC
Sbjct  30    QRLEGKVAIVTGGARGIGEAAVRLFARHGAKVVVADVEDVLGEALASSLAPNYCVTYVHC  89

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTK---PSILQNDKSEFEQVMGVNVVG  702
             ++  E DVE+ V +TV+++G LDI+ N A  LG       SIL  D  EF+ VM VNV G
Sbjct  90    DVSSEPDVENMVSSTVSRYGHLDILFNNAGVLGSQSGKSKSILNFDAEEFDCVMRVNVRG  149

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
             T LG KHAA AMIP G+G I++  SVA    G  PH+YT++KHA++GLTKN A ELGR G
Sbjct  150   TALGMKHAAGAMIPRGSGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNAACELGRHG  209

Query  521   IRVNCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAVLKA  396
             IRVNC+SPF V   + + A             G+  +++++K+        NL+G  L+A
Sbjct  210   IRVNCISPFGVATSMLVNAWGGGDREDECMSFGVPCEQEVEKMEEFVSSLANLRGPTLRA  269

Query  395   EDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             +DVAEAALYLASDESKY++GHNLV+DGG +T
Sbjct  270   KDVAEAALYLASDESKYISGHNLVVDGGITT  300



>ref|XP_004169912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
Length=274

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 177/262 (68%), Gaps = 2/262 (1%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             +A RRLEGKVA++TGG   IGE I K F  HGAKV   D  D LG  L   L  ++  + 
Sbjct  8     AAARRLEGKVAIITGGARGIGESIAKHFFNHGAKVVIADILDDLGNSLSNHLSSSSTSFV  67

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGT  699
             HCN+ +E+DVE+ V+  V+K+GKLDIM N A   G  K +IL+N+ S+F+ V+ VN+VG 
Sbjct  68    HCNVTKETDVENVVNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVNLVGA  127

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
             FLGTKHAA+AMIP G GSI+   SV S+  G  P++YTS+KH +LGL +N  ++LGR GI
Sbjct  128   FLGTKHAAKAMIPAGQGSIIITASVCSSIGGIGPYAYTSSKHGLLGLMRNATIDLGRYGI  187

Query  518   RVNCVSPFIVCNPVGMKALGLTTDEDLKKLY-NNLK-GAVLKAEDVAEAALYLASDESKY  345
             +VNCVSP +V   +  +   L   ++   +Y +N K G +L+ EDVAE  LYLASD S++
Sbjct  188   KVNCVSPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLYLASDASRF  247

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+GHN V+DGGF+  N  LC +
Sbjct  248   VSGHNFVLDGGFTAGNQGLCSY  269



>ref|XP_002533789.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28591.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=303

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 182/279 (65%), Gaps = 27/279 (10%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA+VTGG   IGE  ++LF KHGAKV   D +D  G  L   L P    + HC+
Sbjct  27    RRLEGKVAIVTGGARGIGEATVRLFAKHGAKVVIADVEDTPGTILANSLSPFVT-FVHCD  85

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKP---SILQNDKSEFEQVMGVNVVGT  699
             + +E D+E+ +++TV+ +G+LDI+ N A  LG  +P   SIL+ D  EF++VM VNV G 
Sbjct  86    VSQEEDIENLINSTVSHYGRLDILFNNAGLLG-NQPKNKSILEFDVDEFDRVMRVNVKGV  144

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
              LG KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GI
Sbjct  145   ALGIKHAARVMIPRGVGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGI  204

Query  518   RVNCVSPFIVCNPVGMKA--------------LGLTTDEDLKKLYN------NLKGAVLK  399
             RVNC+SPF V   + + A               GL  +++++K+        NLKG  L+
Sbjct  205   RVNCISPFGVATSMLVNAWRSSDDQEDDECMNFGLPCEQEVEKMEEFVRGLANLKGTTLR  264

Query  398   AEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
              +D+AEAALYLASDESKYV+GHNLV+DGG +T  S  CI
Sbjct  265   GKDIAEAALYLASDESKYVSGHNLVVDGGITT--SRNCI  301



>gb|KDP32262.1| hypothetical protein JCGZ_14783 [Jatropha curcas]
Length=277

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 175/263 (67%), Gaps = 3/263 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             TS  RRL+GKVAL+TGG + IGE   +LF+K GAKV   D  D+LG+ LC++L     + 
Sbjct  8     TSISRRLDGKVALITGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIIS  67

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             Y HC++  +S+V++AVD  V+K+GKLDIM + A   G   P IL  +K +F++V  VNV 
Sbjct  68    YIHCDVTNDSNVQNAVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVF  127

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FL  KHAA+ MIP   G+I+   S  S T   TPH Y  +KHA++GL KN +VELG  
Sbjct  128   GAFLAAKHAAKVMIPAKKGNIIFNASAVSVTCVGTPHPYVVSKHALVGLAKNLSVELGEY  187

Query  524   GIRVNCVSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             GIRVNC+SPF+V  P   + + L   T E++     NLK A+LK ED+AEAA+YL S+ES
Sbjct  188   GIRVNCISPFLVITPQLKRTMELPEKTIEEVTYAAANLKEAILKQEDIAEAAVYLGSEES  247

Query  350   KYVNGHNLVIDGGFSTMNSTLCI  282
             KY++G NLV+DGGFS  N +  +
Sbjct  248   KYISGINLVVDGGFSLTNPSFAM  270



>ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 177/263 (67%), Gaps = 7/263 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV--YFH  876
             +RL+GKVAL+TGG + +GE   +LF+KHGAKV   D  D+LG  LC++L P   +  Y H
Sbjct  12    KRLQGKVALITGGASGMGESSARLFVKHGAKVVVADVQDELGHSLCRELGPDQEIISYIH  71

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  +SDV++AVD  V+K+GKLDIM + A   G   PSI+  +  +F++V  +NV G F
Sbjct  72    CDVTCDSDVQNAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAF  131

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             L  KHAAR MIP   G I+   S  S +     H Y ++KHA+LGL+KN +VELG+ GIR
Sbjct  132   LAAKHAARVMIPAKKGCILFTCSYLSVSCFQAIHPYVASKHAILGLSKNLSVELGQHGIR  191

Query  515   VNCVSPFIVCNPVGMKALGL--TTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             VNCVSPF+V  P+  KA+G+     E L+++ +   NLK   L+AED+AEAALYL SDES
Sbjct  192   VNCVSPFVVITPMMRKAMGVMEAEKEKLQEVVSASANLKNVTLEAEDIAEAALYLVSDES  251

Query  350   KYVNGHNLVIDGGFSTMNSTLCI  282
             KYV+G NLV+DGG++  N    +
Sbjct  252   KYVSGMNLVVDGGYTLTNPAFAM  274



>ref|XP_009350131.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350149.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=276

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 185/271 (68%), Gaps = 4/271 (1%)
 Frame = -1

Query  1082  LNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             +  S   ++  RRLEGKVAL+TGG + IGE   K+F++HGAKV   D  D LG  + + +
Sbjct  1     MAFSSVLSAVSRRLEGKVALITGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESI  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
              P+   + HC++ +E+ ++ AV  +VA +GKLDIM N A  +   K  I+ N+K++FE+V
Sbjct  61    GPSDCTFVHCDVTDEAQIKDAVHKSVATYGKLDIMFNNAGVVDPNKARIIDNEKADFERV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + +NV G FLG KHAA+AMIP   GSI++  S++S   G   H+Y  +KHAV GLTKN A
Sbjct  121   LSINVTGVFLGIKHAAQAMIPARTGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAAL  372
             VELG+ GIRVNC+SP+ +  P+    +G+  DE+L+ +     NLKG  LKA DVA AAL
Sbjct  181   VELGQFGIRVNCLSPYALATPLARNFVGV-EDEELENVMGSLANLKGVTLKAVDVANAAL  239

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             YLASDE++Y++GHNL+IDGGFS +N +  +F
Sbjct  240   YLASDEARYISGHNLLIDGGFSILNPSFEMF  270



>ref|XP_004237829.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 185/274 (68%), Gaps = 9/274 (3%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL-DP  897
             S  S+ +++RL G+VALVTGG + IGE I++LF KHGAKV   D  D  G+++C+ L D 
Sbjct  6     SSDSSLSNQRLLGRVALVTGGASGIGESIVRLFHKHGAKVCIVDIQDAFGKRVCESLGDE  65

Query  896   AAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
              +A + HC++  E+DV +AVD  V +FG LDI+VN A   G    +IL  D S F+ V+ 
Sbjct  66    DSACFIHCDVTSETDVSNAVDFAVERFGTLDIIVNNAGLTGAPCSNILDYDLSVFDNVLD  125

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             VNV G FLG KHAAR MIP   GSIV+L SVA +  G  PH+YT++K A+LGLT+N A E
Sbjct  126   VNVRGVFLGMKHAARIMIPRKRGSIVSLCSVAGSIGGLGPHAYTASKFALLGLTQNVAAE  185

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALG--LTTDEDLKKL------YNNLKGAVLKAEDVAE  381
             +G+ G+RVNCVSP+ V   +G+  L     TD+ +         + NLKG  L A+DVA+
Sbjct  186   MGKHGVRVNCVSPYAVATELGLLHLPPEQRTDDAIADFNSHFGKFANLKGVDLMAQDVAK  245

Query  380   AALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A L+LASDE+ Y++GH+L +DGGFS++N +L +F
Sbjct  246   AVLFLASDEASYISGHDLKVDGGFSSVNHSLKVF  279



>ref|XP_009782884.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Nicotiana 
sylvestris]
Length=308

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/282 (48%), Positives = 181/282 (64%), Gaps = 27/282 (10%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA  891
             + S S  RRLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+ 
Sbjct  21    ITSPSFTRRLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDNLGNTLSNLLSPSV  80

Query  890   AVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVM  720
               Y HC++  E D+++ +D+T++K+G LDIM N A  LG     K SI+  D  EF++VM
Sbjct  81    T-YIHCDVTSEEDIKNLIDSTISKYGHLDIMFNNAGVLGSQSSHKKSIVNFDPDEFDRVM  139

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              VNV G  LG KHAA  MIP G G I++  SVA    G  PH+YT++KHA++GLTKN A 
Sbjct  140   SVNVRGAALGMKHAAGVMIPQGCGCIISTSSVAGVLGGLGPHAYTASKHAIVGLTKNVAC  199

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKA-----------------LGLTTDEDLKKLYN----  423
             ELGR GIRVNC+SPF V   + + A                  G+ ++++++K+      
Sbjct  200   ELGRYGIRVNCISPFGVATSMLINAWNHCDEDEEEGEINGMNFGVPSEKEVEKIEEFVRN  259

Query  422   --NLKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
               +LKG  L+A+D+AEAALYLASDES+YV+GHNLV+DGG +T
Sbjct  260   LADLKGTTLRAKDIAEAALYLASDESRYVSGHNLVVDGGVTT  301



>ref|XP_002265892.1| PREDICTED: short-chain dehydrogenase reductase 2a [Vitis vinifera]
Length=303

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 178/269 (66%), Gaps = 22/269 (8%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGK+A+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+   + HC++
Sbjct  29    RLEGKIAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGAALASSLAPSVT-FVHCDV  87

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFL  693
               E D+E+ +++TV+++G+LDI+ N A  LG      SI+  D  EF+QVM VNV G  L
Sbjct  88    SLEEDIENVINSTVSRYGRLDILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMAL  147

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR M+P G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRV
Sbjct  148   GIKHAARVMVPRGMGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  207

Query  512   NCVSPFIVCNPVGMKA-------------LGLTTDEDLKKLYN------NLKGAVLKAED  390
             NC+SPF V   + + A              G+  + +++K+        NLKG +L+A+D
Sbjct  208   NCISPFGVATSMLVNAWRSSDEEEEDCMNFGIPCEREVEKMEEFVSGLANLKGHILRAKD  267

Query  389   VAEAALYLASDESKYVNGHNLVIDGGFST  303
             +AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  268   IAEAALYLASDESKYVSGHNLVVDGGITT  296



>ref|XP_004249781.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=285

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 177/259 (68%), Gaps = 8/259 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA------  888
             RRLEGKVA+VTGG +  GE  ++LFL++GAKV   D  D++G+ LC DL           
Sbjct  13    RRLEGKVAIVTGGASGFGESTVRLFLQNGAKVVIADVQDEIGQSLCNDLLNCPKNKNNDF  72

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++ + SDVE+ +DAT++K+GKLDIM N A   G    +I+  D   F++V  VNV
Sbjct  73    TYIHCDVTKVSDVENLIDATISKYGKLDIMFNNAGIPGNLDFNIIDADNENFKKVFDVNV  132

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G+FLG K+AAR MIP   G I+   S+AS ++G +PHSYT++KHAV+GL KN   ELG+
Sbjct  133   YGSFLGAKYAARVMIPEKKGVILFTSSLASVSSGESPHSYTASKHAVVGLMKNLCAELGQ  192

Query  527   CGIRVNCVSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDE  354
              GIRVNCVSP  V  P+ +KA+G+  +  + +     NLKG    AEDVAEAALYLASDE
Sbjct  193   HGIRVNCVSPCAVATPMLVKAMGVDKSVVDGIICSSANLKGVAPTAEDVAEAALYLASDE  252

Query  353   SKYVNGHNLVIDGGFSTMN  297
             SK+V+G NLVIDGG+ST N
Sbjct  253   SKFVSGVNLVIDGGYSTTN  271



>ref|XP_007026536.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY07038.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=304

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 180/276 (65%), Gaps = 23/276 (8%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             S+   +RLEGK+A+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+   
Sbjct  23    SSPHPKRLEGKIAIVTGGARGIGEATVRLFARHGAKVVIADLEDTLGAALANSLSPSV-T  81

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKP--SILQNDKSEFEQVMGVN  711
             + HC++  E D+E+ +++T++++G+LDI+ N A  LG  K   SI+  D  EF+ VM VN
Sbjct  82    FVHCDVRLEEDIENLINSTISRYGRLDILFNNAGVLGNQKKHKSIVDFDVDEFDNVMRVN  141

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G  LG KHAARAMIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELG
Sbjct  142   VRGMALGIKHAARAMIPRGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELG  201

Query  530   RCGIRVNCVSPFIVCNPVGMKA--------------LGLTTDEDLKKLYN------NLKG  411
             R GIRVNC+SPF V   + + A               G+   ++ +K+        NLKG
Sbjct  202   RYGIRVNCISPFGVATSMLVNAWRSHDDDEEEDSINFGIPCQQETEKMEEFVRGLANLKG  261

Query  410   AVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
               L+A+D+AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  262   PTLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTT  297



>ref|XP_011019045.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 183/275 (67%), Gaps = 23/275 (8%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEG+VA+VTGG   IGE  ++LF + GAKV   D +D LG  L   L P+ + + HC++
Sbjct  32    RLEGRVAIVTGGARGIGEATVRLFARQGAKVVIADVEDALGTSLVNSLAPSVS-FVHCDV  90

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFL  693
               E D+E+ +++T++++GKLDI+ N A  LG      SI+  D  EF++VM VNV G  L
Sbjct  91    GLEKDIENLINSTISQYGKLDILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMAL  150

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRV
Sbjct  151   GIKHAARVMIPRGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  210

Query  512   NCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAVLKAEDV  387
             NC+SPF V   + + A             GL ++++++K+ +      NLKG  L+A D+
Sbjct  211   NCISPFGVATSMLVNAWRSCGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDI  270

Query  386   AEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             AEAALYLASDESKYV+GHNLV+DGG +T  ST C+
Sbjct  271   AEAALYLASDESKYVSGHNLVVDGGITT--STNCV  303



>ref|XP_004302582.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 176/272 (65%), Gaps = 24/272 (9%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGK+A+VTG    IGE  +KLF KHGAKV   D +D  G  L   L P+   + HC+
Sbjct  28    RRLEGKIAIVTGAARGIGEATVKLFAKHGAKVVIADVEDSTGTALANSLGPSV-TFVHCD  86

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTF  696
             +  E D+E+ + +TV+++G+LDIM N A  LG      SI+  D  EF++VM VNV GT 
Sbjct  87    VSLEEDIENLIQSTVSRYGQLDIMFNNAGILGNQSKHKSIVNFDVDEFDRVMRVNVRGTA  146

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKN A ELGR GIR
Sbjct  147   LGIKHAARVMIPGGGGCIISTASVAGVAGGLGPHAYTASKHAIVGLTKNAACELGRYGIR  206

Query  515   VNCVSPFIVCNPVGMKA---------------LGLTTDEDLKKLYN------NLKGAVLK  399
             VNCVSPF V  P+ + A                G+  +++++K+        NLKG  L+
Sbjct  207   VNCVSPFGVATPMLVNAWRMSDEDDEEEECMDFGMPCEQEVEKMEEFVRGLANLKGPTLR  266

Query  398   AEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
              +D+AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  267   TKDIAEAALYLASDESKYVSGHNLVVDGGITT  298



>ref|XP_006854737.1| hypothetical protein AMTR_s00030p00244080 [Amborella trichopoda]
 gb|ERN16204.1| hypothetical protein AMTR_s00030p00244080 [Amborella trichopoda]
Length=272

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 175/260 (67%), Gaps = 7/260 (3%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RL+GKV ++TGG   IGE  ++LFL HGAKV   D  D LGE LC +L   A+ Y HC++
Sbjct  6     RLDGKVVIITGGARGIGEATVRLFLAHGAKVVIADIRDNLGESLCHELGEDAS-YIHCDV  64

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
               E DV   VD TV K+GKLDIM N A  L  +   IL  +K+ FE+V+GVN+VG  LG 
Sbjct  65    TNEDDVRKTVDFTVEKYGKLDIMYNNAGTLDASIAEILNTEKAVFERVLGVNLVGALLGA  124

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHAAR MIP   G I+   SVAS   G + ++Y+ +K A++GL K+ A ELGR GIRVNC
Sbjct  125   KHAARVMIPASKGCILFTASVASQIGGFSSYAYSCSKAALVGLMKSAAAELGRFGIRVNC  184

Query  506   VSPFIVCNPVG-----MKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYV  342
             VSP+ V   +      ++A+ + T EDL   + NL+G VLKAED+A+AALYLASD+++YV
Sbjct  185   VSPYGVATHIADGLLPVEAVNMDT-EDLLSKFGNLQGVVLKAEDIAQAALYLASDDARYV  243

Query  341   NGHNLVIDGGFSTMNSTLCI  282
             +G NL +DGG++ +N +L I
Sbjct  244   SGQNLFVDGGYTIVNPSLAI  263



>gb|KDP36156.1| hypothetical protein JCGZ_08800 [Jatropha curcas]
Length=278

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 183/270 (68%), Gaps = 6/270 (2%)
 Frame = -1

Query  1079  NLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             +LS+A T+  +RLEGKVAL+TGG + IGE   +LF+KHGAKV   D  D LG  LCQ+  
Sbjct  4     DLSVALTT--KRLEGKVALITGGASGIGECTARLFVKHGAKVLIADVKDDLGLSLCQEFS  61

Query  899   -PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
              P    Y HC++  +SDV+ AVD  V+++GKLDIM N A  +G+  P IL  +  +F++V
Sbjct  62    SPETISYVHCDVSSDSDVKKAVDLAVSRYGKLDIMYNNAGIVGIPDPRILSTENEDFKKV  121

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
               VN+ G+FLG KHAAR MIPN  G I+   S+ S +     ++YT++KHAV+GL KN  
Sbjct  122   FDVNLFGSFLGAKHAARVMIPNKKGCILFTASLVSVSCLDAAYAYTASKHAVVGLAKNLC  181

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAAL  372
             +ELG+ GIRVN +SPF V  P+ +  LG+   ++ +++ ++   LK  +L+ ED+A AAL
Sbjct  182   IELGQYGIRVNSISPFGVATPLLISGLGMKEKKEAEEVISSIATLKEVILEPEDIANAAL  241

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             +LASDESKYV+G NLV+DGGFS  N +  +
Sbjct  242   FLASDESKYVSGINLVVDGGFSLTNPSFAV  271



>ref|XP_002323403.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05164.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 185/270 (69%), Gaps = 5/270 (2%)
 Frame = -1

Query  1082  LNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             +N   + T A +RLEGKVAL+TGG + IGE   +LF++HGAKV   D  D LGE LC++L
Sbjct  1     MNSDSSVTLATKRLEGKVALITGGASGIGECSARLFVQHGAKVLIADIQDDLGEALCKNL  60

Query  902   DPAAAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTK-PSILQNDKSEFE  729
                 ++ Y HC++  +SDV++AVD  V+K+GKLDIM N A  +G  K P IL  +  +F+
Sbjct  61    GSQESISYIHCDVTCDSDVKNAVDMAVSKYGKLDIMFNNAGIVGTCKAPRILAVEIEDFK  120

Query  728   QVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKN  549
             +V+ VN+ G FLG KHAAR MIP   G I+  GS+ + +  ++PH+Y ++KHAV+GLTKN
Sbjct  121   RVLDVNLFGAFLGAKHAARVMIPAKKGCILFTGSLVTVSCCSSPHAYAASKHAVVGLTKN  180

Query  548   TAVELGRCGIRVNCVSPFIVCNPVGMKALGLTT---DEDLKKLYNNLKGAVLKAEDVAEA  378
              AVELG+ GIRVNC+S F +  P+ ++++G+     +E L      LK  +L+ ED A A
Sbjct  181   LAVELGQHGIRVNCISLFTIATPMVIESMGIEKRKFEEFLSSSSAILKETLLEPEDFANA  240

Query  377   ALYLASDESKYVNGHNLVIDGGFSTMNSTL  288
             A+YLASDESKY +G NLVIDGG+S  N TL
Sbjct  241   AIYLASDESKYTSGINLVIDGGYSLTNPTL  270



>ref|XP_010922188.1| PREDICTED: zerumbone synthase-like [Elaeis guineensis]
Length=280

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 171/269 (64%), Gaps = 15/269 (6%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             +RLEGKVALVTGG   IGE I++LF KHGAK+   D  D LG++LC+ L  DP    +FH
Sbjct  14    QRLEGKVALVTGGATGIGEGIVRLFRKHGAKICVVDIQDNLGQQLCESLGGDPYVC-FFH  72

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             CN+  E DV  A+D TV K+G +DIMVN A   G     I   D +EF++V  VNV G F
Sbjct  73    CNVTIEDDVHHAIDFTVRKYGTIDIMVNNAGITGSKVVDIRDVDFNEFKKVFDVNVNGVF  132

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MIP   GSI++L SVAS   G  PH YT  KHAVLGLT+N A ELG+ GIR
Sbjct  133   LGMKHAARVMIPKKKGSIISLASVASVIGGMGPHGYTGTKHAVLGLTRNVAAELGKHGIR  192

Query  515   VNCVSPFIVCNPVGMKALGLTTDEDLKKLYN----------NLKGAVLKAEDVAEAALYL  366
             VNCVSP+    P  +    L  +E  +   N          NLKG  L  +DVA+A LYL
Sbjct  193   VNCVSPY--ATPTRLSMPHLPENERQEDALNGFLSFVGTHANLKGVDLAVDDVAQAVLYL  250

Query  365   ASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             ASDE+KYV+G NL++DG F+ +N +L  F
Sbjct  251   ASDEAKYVSGLNLMVDGAFTCVNHSLRPF  279



>ref|XP_010040330.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=253

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 168/241 (70%), Gaps = 3/241 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             + A RRLEGKVA++TGG   IGE   +LF KHGA+V   D  D LG+ +C+DL P  A +
Sbjct  8     SQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIGDIRDDLGKSVCKDLGPETASF  67

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVG  702
              HC++  ESD+++A+   V K GKLDIMVN A     +K SIL NDK++FE+V+ VN+ G
Sbjct  68    VHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTG  127

Query  701   TFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCG  522
              FLGTKHA RAMIP+  GSI+NLGSV S+  G   H+YTS+KHAVLGLT+  A ELGR G
Sbjct  128   VFLGTKHATRAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRKVAAELGRYG  187

Query  521   IRVNCVSPFIVCNPVGMKALGLTTDEDLK-KLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             +R+NC+SP+ +  P+  KA+    DED   ++Y+N+ G  L+ EDVAEAAL+   D  ++
Sbjct  188   VRINCLSPYFILTPL-TKAI-FQIDEDAGVRVYSNMDGVTLRQEDVAEAALFDGIDHWRF  245

Query  344   V  342
             +
Sbjct  246   L  246



>gb|ABK22745.1| unknown [Picea sitchensis]
Length=294

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 180/284 (63%), Gaps = 21/284 (7%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S++   +DRRLEGKVA++TGG   IGE I++LF KHGAKV   D  D+ G+ L + L P 
Sbjct  15    SLSFNGSDRRLEGKVAIITGGAMGIGEAIVRLFTKHGAKVIIADFADEAGKNLAEHLSPL  74

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAA----TALGVTKPSILQNDKSEFEQ  726
             A  Y HC++ +E D+ + VD  + K G+LDIM N A    T +G    S+ + D  +F++
Sbjct  75    A-TYVHCDVSKEQDISAVVDLAIEKHGQLDIMYNNAGINDTVMG---KSVAEYDMEQFDR  130

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             VM VNV G  LG KHAAR MIP   G I++ GS+AS   G +P+SYT+AKHAV+GLTKN 
Sbjct  131   VMSVNVRGVMLGIKHAARVMIPRKKGCIISTGSLASMLGGLSPYSYTAAKHAVIGLTKNG  190

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTD------EDLKKLYN-------NLKGAV  405
             A ELG+ GIRVN VSP  V  P   K +    D      E  K L         NL+G  
Sbjct  191   AAELGKYGIRVNAVSPSGVATPFTAKMMRGGADSSSPISEKEKALIEGHSNRIGNLQGPT  250

Query  404   LKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCIFPP  273
             LK ED+A A LYLASDE+KYV+GHNLV+DGGF+ +N +  ++ P
Sbjct  251   LKVEDIAGAGLYLASDEAKYVSGHNLVVDGGFTVVNHSWGLYRP  294



>ref|XP_006428245.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428246.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428251.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428253.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428254.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428256.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006480290.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Citrus sinensis]
 ref|XP_006480291.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Citrus sinensis]
 ref|XP_006480292.1| PREDICTED: xanthoxin dehydrogenase isoform X3 [Citrus sinensis]
 ref|XP_006480293.1| PREDICTED: xanthoxin dehydrogenase isoform X4 [Citrus sinensis]
 gb|ESR41485.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41486.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41491.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41493.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41494.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41496.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|KDO45361.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45362.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45363.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45364.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
Length=280

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 178/274 (65%), Gaps = 9/274 (3%)
 Frame = -1

Query  1073  SMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA  894
             S  S+ A +RL G+VAL+TGG   IGE  ++LF KHGAKV   D  D LG+++CQ L   
Sbjct  6     STDSSPAVQRLVGRVALITGGATGIGESTVRLFHKHGAKVCIADVQDNLGQQVCQSLGGE  65

Query  893   AAVYF-HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMG  717
                +F HC++ +E DV SAVD TV KFG LDIMVN A   G   P I + D SEFE+V  
Sbjct  66    PDTFFCHCDVTKEEDVCSAVDLTVEKFGTLDIMVNNAGISGAPCPDIREADLSEFEKVFD  125

Query  716   VNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVE  537
             +NV G F G KHAAR MIP   G+I+++ SVA    G  PH+YT +KHAVLGL KN A E
Sbjct  126   INVKGVFHGMKHAARIMIPQTKGTIISICSVAGAIGGLGPHAYTGSKHAVLGLNKNVAAE  185

Query  536   LGRCGIRVNCVSPFIVCNPVGMKALG--LTTDEDLKKLYN------NLKGAVLKAEDVAE  381
             LG+ GIRVNCVSP+ V   + +  L     T++ +    N      N++G  L A DVA 
Sbjct  186   LGKYGIRVNCVSPYAVATGLALAHLPEEERTEDAMVGFRNFVARNANMQGTELTANDVAN  245

Query  380   AALYLASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             A L+LASDE++Y++G NL++DGGF+++N +L +F
Sbjct  246   AVLFLASDEARYISGTNLMVDGGFTSVNHSLRVF  279



>ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 177/263 (67%), Gaps = 7/263 (3%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             +RLEGKVAL+TGG + +GE   +LF+KHGAKV   D  D+LG  LC++L  D     Y H
Sbjct  12    KRLEGKVALITGGASGMGESSARLFVKHGAKVVVADVQDELGYSLCKELGSDQEIISYIH  71

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  +SDV++AVD  V+K+GKLDIM + A   G   PSI+  +  +F++V  +NV G F
Sbjct  72    CDVTCDSDVQNAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAF  131

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             L  KHAAR MIP   G I+   S  S +     H Y ++KHA+LGL+KN +VELG+ GIR
Sbjct  132   LAAKHAARVMIPAKKGCILFTCSYLSVSCFQAIHPYVASKHAILGLSKNLSVELGQHGIR  191

Query  515   VNCVSPFIVCNPVGMKALGL--TTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDES  351
             VNCVSPF+V  P+  KA+G+     E L+++ +   NLK  +L+AED+AEAALYL SDES
Sbjct  192   VNCVSPFVVITPMMRKAMGVMEAEKEKLQEVVSASANLKNVMLEAEDIAEAALYLVSDES  251

Query  350   KYVNGHNLVIDGGFSTMNSTLCI  282
             KYV+G NLV+DGG++  N    +
Sbjct  252   KYVSGMNLVVDGGYTLTNPAFAM  274



>gb|KDO58269.1| hypothetical protein CISIN_1g044485mg [Citrus sinensis]
Length=257

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 176/262 (67%), Gaps = 21/262 (8%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-----  885
             RRL+GKVAL+TGG   IGE   +LF KHGAKV   D  D LGE +C+D+  +++      
Sbjct  8     RRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIGSSSSSASGCS  67

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             Y HC++ +E D+E+AV+  V ++GKLDIM N A  +   KP+IL ND++EFE+++ +N+V
Sbjct  68    YVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLV  127

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FLG     R M+         LG V     G   H+YTS+KH +LGL KNTAVELGR 
Sbjct  128   GAFLG-----RNML---------LG-VCGIIGGAATHAYTSSKHGLLGLMKNTAVELGRF  172

Query  524   GIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             GIRVNCVSP+ V  P+    L L  D+ L  +Y+NLKGAVL+ ED AEAALYL SDESK 
Sbjct  173   GIRVNCVSPYAVSTPLAKDFLKL-ADDGLGGMYSNLKGAVLEPEDAAEAALYLGSDESKC  231

Query  344   VNGHNLVIDGGFSTMNSTLCIF  279
             V+GHNLV+DGGF+ +N+   +F
Sbjct  232   VSGHNLVVDGGFAIVNAGFSVF  253



>ref|XP_008243484.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=276

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 186/276 (67%), Gaps = 6/276 (2%)
 Frame = -1

Query  1082  LNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             +  S   ++  RRLEGKVAL+TGG + IGE   K+F +HGAK+   D  D LG  + + +
Sbjct  1     MAFSSVLSAVTRRLEGKVALITGGASGIGECTAKIFAQHGAKIVIADVQDDLGHSVRESI  60

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
              P    + HC++ +E+ +++AV   VA +GKLDIM N A  +   K  I+ N+K++FE+V
Sbjct  61    GPTDCTFVHCDVTDEAQIKNAVHKAVATYGKLDIMFNNAGIVDDNKARIIDNEKADFERV  120

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             + VNV G FLG KHAA+AMIP  AGSI++  S++S   G   H+Y  +KHAV GLTKN A
Sbjct  121   LSVNVTGVFLGIKHAAQAMIPARAGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAAL  372
             VELG+ GIRVNC+SP+ +  P+  K +GL  DE+++   +   NLKG  LKA DVA AAL
Sbjct  181   VELGQFGIRVNCLSPYALVTPLARKFVGL-EDEEMENAMSALANLKGVTLKAVDVANAAL  239

Query  371   YLASDESKYVNGHNLVIDGGFSTMNSTLCIF--PPK  270
             YLASDE++Y++GHNL+IDG FS +N    +F  PP+
Sbjct  240   YLASDEARYISGHNLLIDGAFSIVNPCFNMFQYPPE  275



>ref|XP_006854740.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
 gb|ERN16207.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
Length=276

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 175/257 (68%), Gaps = 6/257 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             +LEGK+AL+TGG + IG    +LF +HGA+V   D  D LG+     +    A Y HC++
Sbjct  18    KLEGKIALITGGASGIGAATARLFSQHGARVIIADIQDDLGQSTASSI--PNATYTHCDV  75

Query  866   VEESDVESAVD-ATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
               E D+  A+D AT    GKLDIM N A  +   KPSIL+   S+F++V+GVN+VG FLG
Sbjct  76    TNEEDICQAIDLATTLGDGKLDIMFNNAGIVDPPKPSILEYSLSDFDRVLGVNLVGAFLG  135

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR MIP  +G I+   SV+S   G   H+Y   KHA+ GLTKN AVELG  GIRVN
Sbjct  136   TKHAARVMIPAQSGCILYTASVSSVIGGAATHAYACTKHALAGLTKNAAVELGEFGIRVN  195

Query  509   CVSPFIVCNPVGMKALGLTTDEDLKKL---YNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             C+SP+ +  P+  K +GL  D++L+++   + NLKG VLK+EDVA AALYLAS++ +YV+
Sbjct  196   CISPYCLATPLAKKFVGLEQDKELEEVMGAHANLKGVVLKSEDVARAALYLASEDGRYVS  255

Query  338   GHNLVIDGGFSTMNSTL  288
             GHNLV+DGGF+ +N++ 
Sbjct  256   GHNLVVDGGFTIVNTSF  272



>ref|XP_006338966.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Solanum 
tuberosum]
Length=309

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 183/278 (66%), Gaps = 26/278 (9%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAA--AV  885
             S  +RLEGKVA+VTGG   IGE  ++LF++HGAKV   D +D LG  L   L  ++    
Sbjct  25    SFTKRLEGKVAIVTGGARGIGEATVRLFVRHGAKVVIADVEDILGNTLANMLSSSSSSVT  84

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVMGV  714
             Y HC++  E ++++ +D+T++KFG +DI+ N A  LG     K SI+  D  EF++VM V
Sbjct  85    YIHCDVTSEDEIKNLIDSTISKFGHIDILFNNAGVLGSQSSQKKSIINFDPDEFDRVMSV  144

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G  LG KHAAR MIP G G I++  SVA    G  PH+YTS+KHA++GLTKN A EL
Sbjct  145   NVRGAALGMKHAARVMIPQGHGCIISTSSVAGVLGGLGPHTYTSSKHAIVGLTKNVACEL  204

Query  533   GRCGIRVNCVSPFIVCNPVGMKA---------------LGLTTDEDLKKLYN------NL  417
             GR GIRVNC+SPF V   + + A               +GL ++++++K+ +      NL
Sbjct  205   GRYGIRVNCISPFGVATSMLVNAWSHGDGDGDEEGEMNIGLPSEKEVEKIEDFVRSLGNL  264

Query  416   KGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             KG  L+A+D+AEAALYLASDES+YV+GHNLV+DGG +T
Sbjct  265   KGTTLRAKDIAEAALYLASDESRYVSGHNLVVDGGVTT  302



>ref|XP_008462605.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=279

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 178/269 (66%), Gaps = 8/269 (3%)
 Frame = -1

Query  1082  LNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             ++ SM S+   +RL GKVAL+TG  +  G+   +LF++HGA+V   D  D L + LC++L
Sbjct  1     MDQSMISS---KRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKEL  57

Query  902   DPAAAV-YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQ  726
                 +V Y HC++  +SDV++AVD  V ++GKLDIM N A   G   P+IL  D   F++
Sbjct  58    GSEESVSYIHCDVTSDSDVKNAVDFAVERYGKLDIMYNNAGITGQMDPTILGTDGENFKK  117

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             V  VNV G FLG KHAAR MIPN +G I+   SVAS  +G +PH+Y  +KHAV+GL +N 
Sbjct  118   VFEVNVYGGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNL  177

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAA  375
              VELG  GIRVN VSP  +  P+   ALG T  E L+++  +   LKG V  AEDVAEAA
Sbjct  178   CVELGEFGIRVNSVSPGAIATPLLRNALGFTKKE-LEEVVRSSAILKGVVATAEDVAEAA  236

Query  374   LYLASDESKYVNGHNLVIDGGFSTMNSTL  288
             LYL SDES+ ++GHNLV+DGG+ST N + 
Sbjct  237   LYLCSDESRVISGHNLVVDGGYSTANRSF  265



>gb|KHN33174.1| Momilactone A synthase [Glycine soja]
Length=306

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 177/258 (69%), Gaps = 6/258 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPA--AAVYFHC  873
             RLEGKVAL+TGG + IGE   +LFL HGAKV   D  D LG  LCQ+L+ +     Y HC
Sbjct  37    RLEGKVALITGGASGIGEATARLFLCHGAKVIIADIQDNLGHSLCQNLNSSDNNISYVHC  96

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  ++DV++AV+A V++ GKLDI+ + A  +G   PSI   D ++ ++V  VNV G F 
Sbjct  97    DVTNDNDVQNAVNAAVSRHGKLDILFSNAGTVGRVSPSITALDNADLKRVFEVNVFGAFY  156

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
               KHAA+ MIP   GSIV   SVAS T   +PH+YT++KHAV+GL KN  VELG  GIRV
Sbjct  157   AAKHAAKVMIPEKRGSIVLTSSVASVTHAVSPHAYTASKHAVVGLMKNLCVELGNHGIRV  216

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NCVSP+ V  P+  +   +   E ++K+Y+   NLKG VLK ED+AEAAL+LASDESKYV
Sbjct  217   NCVSPYAVATPLMTRGTRM-KKEMVEKVYSEAGNLKGVVLKEEDLAEAALFLASDESKYV  275

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLV+DGG+S  N ++
Sbjct  276   SGVNLVVDGGYSVTNVSV  293



>gb|KGN48288.1| hypothetical protein Csa_6G454360 [Cucumis sativus]
Length=279

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 175/263 (67%), Gaps = 5/263 (2%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             ST + +RL GKVAL+TG  +  G+   +LF++HGA+V   D  D L + LC++L     V
Sbjct  4     STISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETV  63

Query  884   -YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++  +SDV+ AVD  V ++GKLDIM N A   G   P+IL  +   F++V  VNV
Sbjct  64    SYIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNV  123

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G FLG KHAAR MIPN +G I+   SVAS  +G +PH+Y  +KHAV+GL +N  VELG 
Sbjct  124   YGGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGE  183

Query  527   CGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLASD  357
              GIRVN VSP  +  P+   ALG  T+++L+++  +   LKG V  AEDVAEAALYL SD
Sbjct  184   FGIRVNSVSPGAIATPLLRNALGF-TEKELEEVVRSSAILKGVVATAEDVAEAALYLCSD  242

Query  356   ESKYVNGHNLVIDGGFSTMNSTL  288
             ES+ ++GHNLV+DGG+ST N + 
Sbjct  243   ESRVISGHNLVVDGGYSTANRSF  265



>gb|ACG37730.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 172/267 (64%), Gaps = 10/267 (4%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             +RLEGKVALVTGG   IGE I++LF++HGAKV   D  D+ G++L   L  D   A++ H
Sbjct  15    KRLEGKVALVTGGATGIGEAIVRLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVH  74

Query  875   CNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTF  696
             C++  E DV  AVDA   +FG LD+MVN A   G     I   D +E  +V+ VNV G F
Sbjct  75    CDVTSEEDVSRAVDAAAERFGALDVMVNNAGVTGTKVTDIRTVDFAEARRVLDVNVHGVF  134

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             L  KHAARAMIP   GSIV+L SVAS   GT PH YT++KHAV+GLTK+ A ELGR G+R
Sbjct  135   LVMKHAARAMIPRKRGSIVSLASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVR  194

Query  515   VNCVSPFIVCNPVGMKAL--GLTTDEDLKKLY------NNLKGAVLKAEDVAEAALYLAS  360
             VNCVSP+ V   + M  L  G   D+ LK          NLKG     EDVA+A LYLAS
Sbjct  195   VNCVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLAS  254

Query  359   DESKYVNGHNLVIDGGFSTMNSTLCIF  279
             DE++YV+  NL++DGGF+ +N+ L  F
Sbjct  255   DEARYVSAVNLMVDGGFTAVNNNLRAF  281



>ref|XP_006429516.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 ref|XP_006481135.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
 gb|ESR42756.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 gb|KDO63299.1| hypothetical protein CISIN_1g021960mg [Citrus sinensis]
Length=305

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 177/272 (65%), Gaps = 23/272 (8%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRLEGKVA++TGG   IGE  ++LF +HGAKV   D +D LG  L   L PA   + HC+
Sbjct  27    RRLEGKVAIITGGARGIGEAAVRLFARHGAKVVIADVEDTLGSVLASTLAPAPVTFVHCD  86

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKP--SILQNDKSEFEQVMGVNVVGTF  696
             +  E D+E+ +++TV+++G+LDI+ N A  LG  +   SI+  D  EF+ VM VNV G  
Sbjct  87    VSLEEDIENLINSTVSRYGRLDILYNNAGVLGNQRKHKSIIDFDADEFDNVMRVNVKGMA  146

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MI  G G I++  SVA    G  PH+YT++KHA++GLTKN A ELGR GIR
Sbjct  147   LGIKHAARVMINRGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNAACELGRYGIR  206

Query  515   VNCVSPFIVCNPVGMKA---------------LGLTTDEDLKKL------YNNLKGAVLK  399
             VNC+SPF V   + + A                G+ + ++++K+        NLKG  L+
Sbjct  207   VNCISPFGVATSMLVNAWRNSGDGEEEDECMNFGIPSQKEVRKMEEFVSGLGNLKGTTLR  266

Query  398   AEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             ++D+AEAALYLASDES+YV+GHNLV+DGG +T
Sbjct  267   SKDIAEAALYLASDESRYVSGHNLVVDGGVTT  298



>gb|KDP36159.1| hypothetical protein JCGZ_08803 [Jatropha curcas]
Length=279

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 172/261 (66%), Gaps = 5/261 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PAAAVYFHC  873
             +RLEGKVAL+TGG + IGE   ++F+KHGAKV   D  D LG+ +CQ+   P    Y HC
Sbjct  12    KRLEGKVALITGGASGIGECTARVFVKHGAKVLIADIQDDLGKSICQEYSSPETISYVHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             ++  +SDV++AVD  V+++GKLDIM N A   G  +  I   D  +F++V+ VNV G FL
Sbjct  72    DVSSDSDVKNAVDLAVSRYGKLDIMFNNAGISGTMEQRISSTDNQDFKKVIDVNVFGAFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIPN  G I+   S  S     +PH+YT++KHAV+GL KN +VELG+ GIRV
Sbjct  132   GAKHAARVMIPNKKGCILFSASAVSVCCVESPHAYTTSKHAVVGLAKNLSVELGQYGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTD----EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKY  345
             N +SPF V  P+   ALG   +    E+      NLK  +L+ ED+A AALYLASDESKY
Sbjct  192   NSISPFGVATPMLRNALGGVVEKKEVEEAVSSSANLKEVILEPEDIAHAALYLASDESKY  251

Query  344   VNGHNLVIDGGFSTMNSTLCI  282
             V+G NLV+DGG+S  N +  I
Sbjct  252   VSGINLVVDGGYSLTNPSFAI  272



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 171/261 (66%), Gaps = 6/261 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             +RLEGKVA++TGG + IGE   +LF +HGAKV   D  D+ G  +C   D   A + HC+
Sbjct  7     KRLEGKVAVITGGASGIGECTARLFSQHGAKVVVADIQDERGRSVC---DTIGATFVHCD  63

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             + +ESDV+ A+D  V   GKLDIM N A  +   KP I     S+F +V+ V V G FLG
Sbjct  64    VTKESDVQKAIDTAVTGHGKLDIMFNNAGIIDAGKP-ITDTALSDFHKVIDVIVTGAFLG  122

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
             TKHAAR M+P G GSI++  SVAS   G   H+YT+AKHAV GLT++ AVELGR G+RVN
Sbjct  123   TKHAARVMVPAGRGSIISTASVASVIGGVGTHAYTAAKHAVAGLTRSAAVELGRFGVRVN  182

Query  509   CVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNG  336
             CVSP+ V   + ++   +     E+    +  L+G +LK EDVA A LYLASDESKYV+G
Sbjct  183   CVSPYAVATRLAVEFARIDEKVFEEAMSKFATLQGTLLKPEDVAMAVLYLASDESKYVSG  242

Query  335   HNLVIDGGFSTMNSTLCIFPP  273
             HNL++DGG+S +N  L  F P
Sbjct  243   HNLMVDGGYSIVNRALLSFDP  263



>gb|AER92598.1| putative short-chain alcohol dehydrogenase [Linum usitatissimum]
Length=314

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 177/270 (66%), Gaps = 19/270 (7%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD---PAAAVYF  879
             +RLEGKVA++TGG   IGE  ++LF KHGAKV   D  D LG  L   L     ++ +  
Sbjct  40    QRLEGKVAIITGGARGIGEATVRLFAKHGAKVVIADIQDSLGHALLHSLTNTTSSSIICV  99

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKP---SILQNDKSEFEQVMGVNV  708
             HC++  E DVE+ V +T++KFG+LDI+VN A  LG   P   SI+  D  EFE+VM VNV
Sbjct  100   HCDVSSEEDVENLVASTLSKFGRLDILVNNAGILGSQAPGAKSIMDFDAEEFERVMRVNV  159

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              GT L  KHAARAM+  G G IV+  SVA    G  PH+YTS+KHAV+GLTKN A +LG+
Sbjct  160   KGTALCMKHAARAMLAAGGGCIVSTASVAGVMGGMGPHAYTSSKHAVVGLTKNAACDLGK  219

Query  527   CGIRVNCVSPFIVCNPVGMKAL------------GLTTDEDLKKLYNNLK-GAVLKAEDV  387
              GIRVNC+SPF V   + + A              +   E+L +   NLK GA LKAEDV
Sbjct  220   YGIRVNCISPFGVATSMLVNAWKDGGGGGAVTEGEVEEMEELVRRLANLKGGATLKAEDV  279

Query  386   AEAALYLASDESKYVNGHNLVIDGGFSTMN  297
             AEAALYLASDESKYV+GHNLV+DGGF++ N
Sbjct  280   AEAALYLASDESKYVSGHNLVVDGGFTSSN  309



>ref|XP_011032578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 179/268 (67%), Gaps = 21/268 (8%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEG+VA+VTGG   IGE  ++LF +HGAKV   D +D LG  +   L P+ + + HC++
Sbjct  32    RLEGRVAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGTLVANSLAPSVS-FVHCDV  90

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFL  693
               E D+E+ +++TV+ +GKLD++ N A  LG      SI+  D  EF++VM VNV G  L
Sbjct  91    SLEGDIENLINSTVSHYGKLDVLFNNAGVLGNQSKNKSIVNFDAEEFDRVMHVNVRGVAL  150

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRV
Sbjct  151   GIKHAARVMIPRGVGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  210

Query  512   NCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAVLKAEDV  387
             NC+SPF V   + + A             GL ++++++K+ +      NLKG  L+A D+
Sbjct  211   NCISPFGVATSMLVNAWRSGGEEEDCLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDI  270

Query  386   AEAALYLASDESKYVNGHNLVIDGGFST  303
             AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  271   AEAALYLASDESKYVSGHNLVVDGGITT  298



>ref|XP_004249651.1| PREDICTED: short-chain dehydrogenase reductase 2a isoform X2 
[Solanum lycopersicum]
Length=308

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 184/286 (64%), Gaps = 32/286 (11%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             S  +RLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L   +  Y 
Sbjct  26    SFTKRLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDILGNTLANML---SVTYI  82

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVMGVNV  708
             HC++  E ++++ +D+T++KFG +DI+ N A  LG     K SI+  D  EF++VM VNV
Sbjct  83    HCDVTSEDEIKNLIDSTLSKFGHIDILFNNAGVLGSQSSQKKSIINFDPDEFDRVMSVNV  142

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G  LG KHAAR MIP G G I++  SVA    G  PH+YTS+KHA++GLTKN A ELGR
Sbjct  143   RGAALGMKHAARVMIPQGHGCIISTSSVAGVLGGLGPHTYTSSKHAIVGLTKNVACELGR  202

Query  527   CGIRVNCVSPFIVCNPVGMKA------------------LGLTTDEDLKKLYN------N  420
              GIRVNC+SPF V   + + A                  +GL ++++++K+ +      N
Sbjct  203   YGIRVNCISPFGVATSMLVNAWSHDGDGDGDGDEGGEMNIGLPSEKEVEKIEDFVRGLGN  262

Query  419   LKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             LKG  L+A+D+AEAALYLASDES+YV+GHNLV+DGG +T  S  CI
Sbjct  263   LKGTTLRAKDIAEAALYLASDESRYVSGHNLVVDGGVTT--SRNCI  306



>ref|XP_010264496.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Nelumbo nucifera]
Length=301

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 177/271 (65%), Gaps = 20/271 (7%)
 Frame = -1

Query  1058  SADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYF  879
             S  RRLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D++G  L   L P    Y 
Sbjct  25    SPPRRLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCV-TYI  83

Query  878   HCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVV  705
             HC++  E DVE+ +++TV+  G+LDI+ N A  LG      SI+  D  EF++VM VNV 
Sbjct  84    HCDVSLEEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVR  143

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G  LG K+AAR M+P G+G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR 
Sbjct  144   GVALGMKYAARVMVPRGSGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRY  203

Query  524   GIRVNCVSPFIVCNPVGMKALGLTTD-----------EDLKKLYN------NLKGAVLKA  396
             GIRVNC+SPF V   + + A     D           E+++K+        NLKG  L+A
Sbjct  204   GIRVNCISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRA  263

Query  395   EDVAEAALYLASDESKYVNGHNLVIDGGFST  303
             +D+AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  264   KDIAEAALYLASDESKYVSGHNLVVDGGVTT  294



>ref|XP_003552289.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Glycine 
max]
Length=298

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 182/278 (65%), Gaps = 21/278 (8%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVY  882
             +S+ +RLEGKVA+VTGG   IGE  +++F+KHGAKV   D +D  G  L + L P+A  Y
Sbjct  22    SSSSKRLEGKVAIVTGGAKGIGEATVRVFVKHGAKVMIADVEDAAGAMLAETLSPSAT-Y  80

Query  881   FHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNV  708
              HC++  E +VE  V +T++++G LDIM N A  LG      SI+  D  EF++VM VNV
Sbjct  81    VHCDVSIEKEVEKLVSSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFDKVMCVNV  140

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G  LG KHAAR MIP G G I++  SVA    G  PH+YT++KHA++G+TKNTA ELGR
Sbjct  141   KGVALGIKHAARVMIPRGIGCIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTACELGR  200

Query  527   CGIRVNCVSPFIVCNPVGMKA----------LGLTTDEDLKKLYN------NLKGAVLKA  396
              GIRVNC+SPF V   + + A           G+   E+++K+        NL+G  L+A
Sbjct  201   YGIRVNCISPFGVATSMLVNAWRPCDDEGTNFGVPFPEEVEKIEEFVRGLANLRGPTLRA  260

Query  395   EDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
              D+AEAALYLASDESKYV+GHNLV+DGG ++  S  CI
Sbjct  261   LDIAEAALYLASDESKYVSGHNLVVDGGVTS--SRNCI  296



>ref|XP_004143392.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
Length=284

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 175/263 (67%), Gaps = 5/263 (2%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             ST + +RL GKVAL+TG  +  G+   +LF++HGA+V   D  D L + LC++L     V
Sbjct  4     STISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETV  63

Query  884   -YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++  +SDV+ AVD  V ++GKLDIM N A   G   P+IL  +   F++V  VNV
Sbjct  64    SYIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNV  123

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G FLG KHAAR MIPN +G I+   SVAS  +G +PH+Y  +KHAV+GL +N  VELG 
Sbjct  124   YGGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGE  183

Query  527   CGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLASD  357
              GIRVN VSP  +  P+   ALG  T+++L+++  +   LKG V  AEDVAEAALYL SD
Sbjct  184   FGIRVNSVSPGAIATPLLRNALGF-TEKELEEVVRSSAILKGVVATAEDVAEAALYLCSD  242

Query  356   ESKYVNGHNLVIDGGFSTMNSTL  288
             ES+ ++GHNLV+DGG+ST N + 
Sbjct  243   ESRVISGHNLVVDGGYSTANRSF  265



>gb|KDP36160.1| hypothetical protein JCGZ_08804 [Jatropha curcas]
Length=278

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 182/267 (68%), Gaps = 4/267 (1%)
 Frame = -1

Query  1070  MASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD-PA  894
             +++TS  +RLEGKVAL+TGG + IGE   +LF+KHGAKV   D  D LG  LCQ+ D P 
Sbjct  5     LSATSITKRLEGKVALITGGASGIGECTARLFVKHGAKVLIADVQDDLGLSLCQEFDSPE  64

Query  893   AAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGV  714
                + HC++  +SDV++AVD  V+++GKLDIM N A   G   PSIL  +  +F++V  V
Sbjct  65    TISFVHCDVSSDSDVKNAVDLAVSRYGKLDIMYNNAGIGGNPDPSILSAENEDFKKVFDV  124

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G+FLG K+AA+ MIPN  G I+   SVAS     + ++Y ++KHAV+GL KN +VEL
Sbjct  125   NVFGSFLGAKYAAKVMIPNKKGCILFTSSVASVCCSGSLYAYIASKHAVVGLAKNLSVEL  184

Query  533   GRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLA  363
             G+ GIRVN +SPF V  P+   A+G    ++++++  +   LK  +L+ ED+A AALYLA
Sbjct  185   GQYGIRVNSISPFGVATPMLRNAVGNKEKKEVEQVIASAATLKEVILEPEDIANAALYLA  244

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCI  282
             SDESKYV+G NLV+DGG+S  N +  I
Sbjct  245   SDESKYVSGINLVVDGGYSLTNPSFAI  271



>ref|XP_002323034.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF04795.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 177/268 (66%), Gaps = 21/268 (8%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEG+VA+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L P+ + + HC++
Sbjct  32    RLEGRVAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGTLLANSLAPSVS-FVHCDV  90

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFL  693
               E D+E+ +++TV+ +GKLD++ N A  LG      SI   D  EF++VM VNV G  L
Sbjct  91    SLEEDIENLINSTVSHYGKLDVLFNNAGVLGNQSKNKSIANFDAEEFDRVMQVNVRGVAL  150

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRV
Sbjct  151   GIKHAARVMIPRGVGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  210

Query  512   NCVSPFIVCNPVGMKA------------LGLTTDEDLKKLYN------NLKGAVLKAEDV  387
             NC+SPF V   + + A             GL  +++++K+ +      NLKG  L+A D+
Sbjct  211   NCISPFGVATSMLVNAWRSGDEEEDCLNFGLPCEKEVEKMEDFVRGLANLKGPTLRARDI  270

Query  386   AEAALYLASDESKYVNGHNLVIDGGFST  303
             AEAALYLASDESKYV+GHNLV+DGG +T
Sbjct  271   AEAALYLASDESKYVSGHNLVVDGGITT  298



>gb|KEH24173.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=274

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 184/270 (68%), Gaps = 7/270 (3%)
 Frame = -1

Query  1070  MASTS---ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLD  900
             MAS+S    + RLEGKVAL+TGG + IG+   ++F++ GAKV   D  D+LG  + Q + 
Sbjct  1     MASSSPAAVNGRLEGKVALITGGASRIGKRTAEIFVQKGAKVVIADIQDELGHSVAQTIG  60

Query  899   PAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVM  720
              +   Y HC++ +ES +++ VD TV  +GKLDIM N A   G     I+ NDK++FE+V+
Sbjct  61    SSTCTYVHCDVTDESQIKNVVDTTVQTYGKLDIMFNNAGIGGPNNSRIIDNDKADFERVL  120

Query  719   GVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAV  540
              +NV G FLG KHAA+AMIP   GSI++  S++S   G   H+Y SAKHAV+GLTKN AV
Sbjct  121   SINVTGVFLGIKHAAQAMIPARTGSIISTTSISSYVGGAASHAYCSAKHAVVGLTKNAAV  180

Query  539   ELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALY  369
             ELG+ GIRVNCVSP+ +  P+  + +G   D +L+   N   NLKG +LK +DV  AALY
Sbjct  181   ELGKFGIRVNCVSPYALATPLATQFVGC-NDGELETTMNTLANLKGVILKTDDVVNAALY  239

Query  368   LASDESKYVNGHNLVIDGGFSTMNSTLCIF  279
              ASD+S+YV+GHNL+IDGGFS +N +  +F
Sbjct  240   FASDDSRYVSGHNLLIDGGFSIVNPSFHMF  269



>ref|XP_002323404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05165.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 176/259 (68%), Gaps = 3/259 (1%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-YFHC  873
             +RLEGKVAL+TGG + IGE   +LF++HG+KV   D  D LG  LCQ+      + Y HC
Sbjct  12    KRLEGKVALITGGASGIGECTARLFVQHGSKVLIADVQDDLGRALCQEYGSEEIISYVHC  71

Query  872   NIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFL  693
             N+  +SDV++AVD  V+++GKLDIM N A   G TK SIL +D  +F +V+ +NV G FL
Sbjct  72    NVTVDSDVQNAVDTAVSRYGKLDIMFNNAGISGNTKSSILNSDNEDFMRVLNINVCGGFL  131

Query  692   GTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRV  513
             G KHAAR MIP   G I+   SVAS   G   H+YT++K+A++GL KN +V+LG+ GIRV
Sbjct  132   GAKHAARVMIPAKKGCILFTASVASVLYGELAHAYTASKNAIVGLAKNLSVDLGQHGIRV  191

Query  512   NCVSPFIVCNPVGMKALGLTTD--EDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVN  339
             N +SP  V  P+   AL +T +  E       NLK AVL+ EDVA+AALYLASD+SKYV+
Sbjct  192   NSISPTAVATPMLTDALRMTKEAAEKFVASAANLKEAVLEPEDVAQAALYLASDDSKYVS  251

Query  338   GHNLVIDGGFSTMNSTLCI  282
             G NLVIDGG++  N +L +
Sbjct  252   GVNLVIDGGYNLTNPSLAM  270



>ref|XP_004170965.1| PREDICTED: zerumbone synthase-like, partial [Cucumis sativus]
Length=281

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 175/263 (67%), Gaps = 5/263 (2%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             ST + +RL GKVAL+TG  +  G+   +LF++HGA+V   D  D L + LC++L     V
Sbjct  4     STISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETV  63

Query  884   -YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++  +SDV+ AVD  V ++GKLDIM N A   G   P+IL  +   F++V  VNV
Sbjct  64    SYIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNV  123

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
              G FLG KHAAR MIPN +G I+   SVAS  +G +PH+Y  +KHAV+GL +N  VELG 
Sbjct  124   YGGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGE  183

Query  527   CGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNN---LKGAVLKAEDVAEAALYLASD  357
              GIRVN VSP  +  P+   ALG  T+++L+++  +   LKG V  AEDVAEAALYL SD
Sbjct  184   FGIRVNSVSPGAIATPLLRNALGF-TEKELEEVVRSSAILKGVVATAEDVAEAALYLCSD  242

Query  356   ESKYVNGHNLVIDGGFSTMNSTL  288
             ES+ ++GHNLV+DGG+ST N + 
Sbjct  243   ESRVISGHNLVVDGGYSTANRSF  265



>emb|CDP02837.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 186/268 (69%), Gaps = 5/268 (2%)
 Frame = -1

Query  1070  MASTSAD----RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             MA+ S++    +RLEGKVAL+TG    IG  + ++F+ HGAKV   D +++LG  +C DL
Sbjct  72    MANLSSEAQVGKRLEGKVALITGAAQGIGACMARVFVNHGAKVVCVDINEELGRSVCDDL  131

Query  902   DPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQV  723
                 A + +C++ +ESD+E+A++ TV + GKLDIM+N A      K SIL ND S+FE+V
Sbjct  132   GAENASFLYCDVTKESDIENAINRTVHEHGKLDIMINNAGIADEGKTSILDNDLSDFERV  191

Query  722   MGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTA  543
             M +N+ G FLG KHAAR MIP  +G I+NLGS++ +  G T HSY+S+KHAV+GLT+N A
Sbjct  192   MRLNLSGVFLGIKHAARVMIPARSGGIINLGSISGSIGGITSHSYSSSKHAVVGLTRNAA  251

Query  542   VELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAALYLA  363
              ELG+ GIRVNC+S  +V  P+         +E   ++Y NL+G VLK ED+A AA+YLA
Sbjct  252   AELGKHGIRVNCLSSHVVLTPLSQNFFNF-GEEGQSRVYTNLEGMVLKPEDLANAAVYLA  310

Query  362   SDESKYVNGHNLVIDGGFSTMNSTLCIF  279
             S+E+++++GHNL++DGGF+  N    +F
Sbjct  311   SEEARFMSGHNLMLDGGFTVTNPAFGLF  338



>ref|XP_004305640.1| PREDICTED: momilactone A synthase-like [Fragaria vesca subsp. 
vesca]
Length=278

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 172/256 (67%), Gaps = 4/256 (2%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVAL+TGG + IGE   + F+ HGAKV   D  D+L   + + +      + HC++
Sbjct  12    RLEGKVALITGGASGIGECTTRTFVNHGAKVVIADVQDELAHSVVESIGSENCTFVHCDV  71

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLGT  687
              +E+ +++AV+  VA +GKLDIM N A      K  I+ N K +FE+V+GVNV G FLG 
Sbjct  72    RDEAQIKNAVEQAVATYGKLDIMFNNAGIADENKARIIDNTKDDFERVLGVNVTGVFLGI  131

Query  686   KHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVNC  507
             KHA++ MI    G I++  S++S   G   H+Y  +KHA+ GLTKN AVELG+ GIRVNC
Sbjct  132   KHASQPMIRARTGCIISTASISSYIGGAASHAYACSKHAINGLTKNAAVELGQFGIRVNC  191

Query  506   VSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYVNG  336
             VSP+ +  P+  + +GL  DE L+ + N   NLKG  LKA+DVA AALYLASDE+KYV+G
Sbjct  192   VSPYALATPLATQFVGL-DDEGLENVMNSLANLKGVTLKAQDVANAALYLASDEAKYVSG  250

Query  335   HNLVIDGGFSTMNSTL  288
             HNL+IDGGFS +N + 
Sbjct  251   HNLLIDGGFSIVNPSF  266



>ref|XP_011041828.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=309

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/282 (48%), Positives = 182/282 (65%), Gaps = 25/282 (9%)
 Frame = -1

Query  1067  ASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             +S+ + +RLEGKVA++TGG   IGE  +KLF++HGAKV   D +D  G  L + L P+A 
Sbjct  25    SSSLSYKRLEGKVAIITGGARGIGEATVKLFVRHGAKVVIADIEDANGIALAESLSPSA-  83

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGV  714
             VY  C++  E ++ES ++ T++++G+LDI+ N A  LG      SI+  D  EF+ +M +
Sbjct  84    VYVRCDVCLEEEIESLINLTISQYGRLDILFNNAGVLGNQSKHKSIINFDADEFDNIMRI  143

Query  713   NVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVEL  534
             NV G  LG KHAAR M+P  +G +++  SVA    G  PH+YT++KHA++GLTKNTA EL
Sbjct  144   NVRGAALGMKHAARVMVPRRSGCVISTASVAGIIGGLGPHAYTASKHAIVGLTKNTACEL  203

Query  533   GRCGIRVNCVSPFIVCNPVGMKAL-GLTTDED---------------------LKKLYNN  420
             GR GIRVNC+SPF V   + + A  G   D D                     L +   N
Sbjct  204   GRYGIRVNCISPFGVATSMLVNAWRGCEEDGDDDEKCMDFGAPSEEEMEKIEELVRGLGN  263

Query  419   LKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNS  294
             LKG  LKA+D+AEAALYLASDESKYV+GHNLV+DGGF+T N+
Sbjct  264   LKGTTLKAKDIAEAALYLASDESKYVSGHNLVVDGGFTTFNN  305



>gb|KDP34951.1| hypothetical protein JCGZ_09239 [Jatropha curcas]
Length=246

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 167/251 (67%), Gaps = 5/251 (2%)
 Frame = -1

Query  1094  LSTNLNLSMASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKL  915
             ++TN  L + +    RRLEGKVAL+TGG   IG  I + F KHGAKV   D  D LG+ L
Sbjct  1     MATNFLLPINA----RRLEGKVALITGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSL  56

Query  914   CQDLDPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSE  735
              ++L    AV+ HC++  ESD+E+AVD  ++ FGKLDI+VN A      KPSI+ ND  +
Sbjct  57    SKELGTDKAVFVHCDVTIESDIENAVDTAISIFGKLDIIVNNAAIGDPRKPSIVDNDVVD  116

Query  734   FEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLT  555
             F++V+ VN++G FLG KHAAR MIP   GSI+ LGSV S+  G   H+YTS KH ++GL 
Sbjct  117   FKRVVKVNLIGVFLGPKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGIVGLA  176

Query  554   KNTAVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKLYNNLKGAVLKAEDVAEAA  375
             KN A ELG+ GIRVNC+S + +  P+ M    +  D     +Y+NLKG  LK EDVAEAA
Sbjct  177   KNAAAELGQFGIRVNCLSSYFIETPLTMNFFKMKEDGK-SGVYSNLKGVKLKEEDVAEAA  235

Query  374   LYLASDESKYV  342
             +YL SDESKYV
Sbjct  236   IYLGSDESKYV  246



>ref|XP_010246244.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=282

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 187/273 (68%), Gaps = 9/273 (3%)
 Frame = -1

Query  1076  LSMASTSAD--RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL  903
             +S AS+ A   +RLEGKVA++TGG + IG+   KLF++HGAKV   D  D+LG  LC++L
Sbjct  1     MSFASSVAPTTKRLEGKVAIITGGASGIGKSTAKLFVRHGAKVVVADVQDELGHSLCREL  60

Query  902   DPAAAVYF-HCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQ  726
             D     +F HC++ +E+DV+S VD+ V+K+GKLDIM N A   G   P +L+ D  +FE+
Sbjct  61    DSEDTAFFVHCDVSKEADVQSLVDSVVSKYGKLDIMYNNAAIPGNLNPELLETDPKDFER  120

Query  725   VMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNT  546
             V+ VN++G FLG KHAAR MIP   GSI+   SV S  +  +P+ Y  +K+A++GL K+ 
Sbjct  121   VLSVNLIGAFLGAKHAARVMIPQKKGSILFTSSVVSAISCGSPYPYGVSKYALVGLAKSL  180

Query  545   AVELGRCGIRVNCVSPFIVCNPVGMKALGLTTDEDLKKL-YN--NLKGAVLKAEDVAEAA  375
               ELG+ GIRVN +SP+ +  P+    LG      ++++ Y   NLKG +LK ED+AEAA
Sbjct  181   CGELGQYGIRVNVISPYGIATPMLGHVLGNMESSKVEEVTYGGANLKGVILKEEDIAEAA  240

Query  374   LYLASDESKYVNGHNLVIDGGFSTMNSTLCIFP  276
             ++LASDES+YV+G NL++DGG+ST+N+    FP
Sbjct  241   VFLASDESRYVSGLNLLVDGGYSTVNAA---FP  270



>ref|XP_010312311.1| PREDICTED: short-chain dehydrogenase reductase 2a isoform X1 
[Solanum lycopersicum]
Length=312

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/282 (48%), Positives = 182/282 (65%), Gaps = 32/282 (11%)
 Frame = -1

Query  1046  RLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNI  867
             RLEGKVA+VTGG   IGE  ++LF +HGAKV   D +D LG  L   L   +  Y HC++
Sbjct  34    RLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDILGNTLANML---SVTYIHCDV  90

Query  866   VEESDVESAVDATVAKFGKLDIMVNAATALGVT---KPSILQNDKSEFEQVMGVNVVGTF  696
               E ++++ +D+T++KFG +DI+ N A  LG     K SI+  D  EF++VM VNV G  
Sbjct  91    TSEDEIKNLIDSTLSKFGHIDILFNNAGVLGSQSSQKKSIINFDPDEFDRVMSVNVRGAA  150

Query  695   LGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIR  516
             LG KHAAR MIP G G I++  SVA    G  PH+YTS+KHA++GLTKN A ELGR GIR
Sbjct  151   LGMKHAARVMIPQGHGCIISTSSVAGVLGGLGPHTYTSSKHAIVGLTKNVACELGRYGIR  210

Query  515   VNCVSPFIVCNPVGMKA------------------LGLTTDEDLKKLYN------NLKGA  408
             VNC+SPF V   + + A                  +GL ++++++K+ +      NLKG 
Sbjct  211   VNCISPFGVATSMLVNAWSHDGDGDGDGDEGGEMNIGLPSEKEVEKIEDFVRGLGNLKGT  270

Query  407   VLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
              L+A+D+AEAALYLASDES+YV+GHNLV+DGG +T  S  CI
Sbjct  271   TLRAKDIAEAALYLASDESRYVSGHNLVVDGGVTT--SRNCI  310



>gb|KDP25017.1| hypothetical protein JCGZ_24000 [Jatropha curcas]
Length=277

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 173/263 (66%), Gaps = 3/263 (1%)
 Frame = -1

Query  1061  TSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV-  885
             TS  RRL+GKVAL+TGG + IGE   +LF+K GAKV   D  D+LG+ LC++L     + 
Sbjct  8     TSISRRLDGKVALITGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIIS  67

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVV  705
             Y HC++  +S V++AVD  V+K+GKLDIM + A   G   P IL  +K +F++V  VNV 
Sbjct  68    YIHCDVTNDSHVQNAVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVF  127

Query  704   GTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRC  525
             G FL  KHAA+ MIP   G+I+   SV S T     H Y  +KHA++GL KN +VELG  
Sbjct  128   GAFLAAKHAAKVMIPAKKGNIIFTASVVSVTCLGAAHPYVVSKHALVGLAKNLSVELGEY  187

Query  524   GIRVNCVSPFIVCNPVGMKALGL--TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDES  351
             GIRVNC+SPF+V  P   + + L   T E++     NLK A+LK ED+AEAA+YL S+ES
Sbjct  188   GIRVNCISPFLVITPQLKRTMELPEKTIEEVTYAAANLKEAILKQEDIAEAAVYLGSEES  247

Query  350   KYVNGHNLVIDGGFSTMNSTLCI  282
             KY++G NLV+DGGFS  N +  +
Sbjct  248   KYISGINLVVDGGFSLTNPSFAM  270



>ref|XP_007027903.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08405.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=277

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 176/258 (68%), Gaps = 5/258 (2%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCN  870
             RRL+GKVAL+TGG + IGE   +LF+  GAKV   D  D LG+ +C++L   +  Y HC+
Sbjct  12    RRLQGKVALITGGASGIGECTARLFVHQGAKVVIADIQDDLGQSICEELGHQSISYVHCD  71

Query  869   IVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNVVGTFLG  690
             +  +SDV +AVD  V+ +G LDIM N A   G  K SI+ +D  +F++V+ VNV G +LG
Sbjct  72    VTRDSDVRNAVDLAVSTYGSLDIMFNNAGIAGPDK-SIVSSDDEKFKKVLDVNVFGGYLG  130

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTP-HSYTSAKHAVLGLTKNTAVELGRCGIRV  513
              K+AA+ MIP   G I+   SV S   GT   H+Y ++KHA++GL KN  VELG+ GIRV
Sbjct  131   AKYAAKVMIPARKGCILFTSSVFSVIGGTDAGHAYVTSKHALVGLAKNLCVELGQYGIRV  190

Query  512   NCVSPFIVCNPVGMKALGLTTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDESKYV  342
             NC+SPF V  P+  K  G+   E +++L +   NLKG VLK +DVA+AALYLASDESKYV
Sbjct  191   NCISPFGVATPLLRKPFGMMEKEKVEELVSKGANLKGTVLKPDDVAQAALYLASDESKYV  250

Query  341   NGHNLVIDGGFSTMNSTL  288
             +G NLVIDGG+ST N ++
Sbjct  251   SGLNLVIDGGYSTTNPSM  268



>ref|XP_003623493.1| Sex determination protein tasselseed-2 [Medicago truncatula]
 gb|AES79711.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=302

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/282 (49%), Positives = 182/282 (65%), Gaps = 24/282 (9%)
 Frame = -1

Query  1064  STSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAV  885
             S  + +RLEGK+A+VTGG   IGE  +++F+KHGAKV   D +D+LG  L   L P+A +
Sbjct  22    SPPSPKRLEGKIAIVTGGARGIGEATVRIFVKHGAKVVIGDVEDELGIMLANSLSPSA-I  80

Query  884   YFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVN  711
             Y HC++  E DVE+ V +T++ +GKLDIM N A  LG      SI+  D  EF++VM VN
Sbjct  81    YVHCDVSVEKDVENLVTSTISHYGKLDIMFNNAGFLGNQSKNKSIVNFDTEEFDRVMNVN  140

Query  710   VVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELG  531
             V G  LG KHAA+ MIP G G IV+  SVA    G  PH+YT++KHA++GLTKN + ELG
Sbjct  141   VKGVALGMKHAAKVMIPRGNGCIVSTSSVAGVLGGLGPHAYTASKHAIVGLTKNASCELG  200

Query  530   RCGIRVNCVSPFIVCNPVGMKA-------------LGLTTDEDLKKL------YNNLKGA  408
             + GIRVNC+SPF V   + + A              GL   E+++K+        NL+G 
Sbjct  201   KYGIRVNCISPFGVATSMLVNAWRNGEDEVDEGINFGLPLIEEVEKMEEFVRGIGNLRGT  260

Query  407   VLKAEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
              LK +D+AEA LYLASDESKYV+GHNLV+DGG ++  S  CI
Sbjct  261   TLKTQDIAEAVLYLASDESKYVSGHNLVVDGGITS--SRNCI  300



>ref|XP_007134614.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
 gb|ESW06608.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
Length=308

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 183/279 (66%), Gaps = 28/279 (10%)
 Frame = -1

Query  1043  LEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAAVYFHCNIV  864
             LEGKVA+VTGG   IGE  +++F+K+GA+V   D +D LG  L + L P+A  Y HC++ 
Sbjct  31    LEGKVAIVTGGARGIGEATVRVFVKNGARVVIADVEDALGTMLAETLAPSA-TYVHCDVS  89

Query  863   EESDVESAVDATVAKFGKLDIMVNAATALG--VTKPSILQNDKSEFEQVMGVNVVGTFLG  690
              E +VE+ V +TV+++G++DIM N A  LG      SIL  D +EF++VM VNV G  LG
Sbjct  90    VEEEVENLVSSTVSRYGQVDIMFNNAGVLGNQSKNKSILNFDPNEFDRVMQVNVKGMALG  149

Query  689   TKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGIRVN  510
              KHAARAMIP G G I++  SVA    G  PH+YT++KHA++GLTKNTA ELGR GIRVN
Sbjct  150   IKHAARAMIPKGIGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  209

Query  509   CVSPFIVCNPVGMKA-----------------LGLTTDEDLKKLYN------NLKGAVLK  399
             C+SPF V   + + A                  GL   E+++K+        NLKG  L+
Sbjct  210   CISPFGVATNMLVNAWRSGGCDGEEGDDEGINFGLPFQEEVEKMEGFVRGLANLKGQTLR  269

Query  398   AEDVAEAALYLASDESKYVNGHNLVIDGGFSTMNSTLCI  282
             A+D+AEAALYLASDESKYV+GHNLV+DGG ++  S  CI
Sbjct  270   AKDIAEAALYLASDESKYVSGHNLVVDGGVTS--SRNCI  306



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (66%), Gaps = 3/263 (1%)
 Frame = -1

Query  1067  ASTSADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDLDPAAA  888
             A +S  +RLEGKVAL+TGG + +GE   +LF++HGAKV   D  D+LG  LCQ+L     
Sbjct  3     AESSVTKRLEGKVALITGGASGLGESTARLFVQHGAKVLIADIQDELGHSLCQELGTETI  62

Query  887   VYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTKPSILQNDKSEFEQVMGVNV  708
              Y HC++  ESDV++AV+  V+K+ KLDIM+N A  +G  +  +   D   F+ V  +NV
Sbjct  63    SYVHCDVTCESDVQNAVELAVSKYRKLDIMLNNAGIMGHHEVRVTDADTENFKTVFDINV  122

Query  707   VGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGR  528
             +G FLG KHAAR M+P   G I+   S+AS  +  TPH+Y ++KHAV+GLTK+ +VELG 
Sbjct  123   LGGFLGAKHAARVMVPAKKGCILFTASLASKISMGTPHAYKASKHAVVGLTKSLSVELGE  182

Query  527   CGIRVNCVSPFIVCNPVGMKALGL---TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASD  357
              GIRVNC+SP  V  P+  K LG+      E+       LKGAVL+ ED A AALYLASD
Sbjct  183   YGIRVNCISPHAVATPLFQKTLGVFDKKKGEEAVSASAVLKGAVLEPEDFANAALYLASD  242

Query  356   ESKYVNGHNLVIDGGFSTMNSTL  288
             E+KY++G NL IDGG+S  N T 
Sbjct  243   EAKYLSGVNLTIDGGYSLSNQTW  265



>ref|XP_010683578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Beta 
vulgaris subsp. vulgaris]
Length=299

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 183/291 (63%), Gaps = 19/291 (7%)
 Frame = -1

Query  1121  VQLHFDIILLSTNLNLSMASTS-ADRRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFT  945
             V+L  D  L    +++ + ST+ + +RL+GKVA+VTGG   IGE I++LF  HGAKV   
Sbjct  3     VELASDKPLQPEAIDMDIGSTNLSTKRLQGKVAIVTGGARGIGEAIVRLFASHGAKVVIA  62

Query  944   DTDDKLGEKLCQDLDPAAAVYFHCNIVEESDVESAVDATVAKFGKLDIMVNAATALGVTK  765
             D  D LG  +   L P  + Y HC++  E DVE  V  T+A  GKLDI  N A  LG  K
Sbjct  63    DILDNLGMSIANSLSPTVS-YIHCDVSHEEDVEKLVTNTIAIHGKLDIFFNNAAILGQQK  121

Query  764   -PSILQNDKSEFEQVMGVNVVGTFLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSY  588
               SI+  ++ EF+ +M VNV G  LGTK+AA+AM+P   G I++  SVA    G  PH+Y
Sbjct  122   RKSIMDFNEDEFDTIMRVNVKGMALGTKYAAKAMVPRKTGCIISTSSVAGVLGGCAPHAY  181

Query  587   TSAKHAVLGLTKNTAVELGRCGIRVNCVSPFIV---------CNPVG-------MKALGL  456
             T++KHA++GLTKN A ELG+ GIRVNC+SPF V         CN          ++   +
Sbjct  182   TASKHAIVGLTKNVASELGKYGIRVNCISPFGVATSMLINAWCNESEEEEYSNVLREHQV  241

Query  455   TTDEDLKKLYNNLKGAVLKAEDVAEAALYLASDESKYVNGHNLVIDGGFST  303
                E+L     NLKG  LKA+DVAEAALYLASDESKY++GHNLVIDGGF+T
Sbjct  242   EKVEELVNKLANLKGVTLKAQDVAEAALYLASDESKYISGHNLVIDGGFTT  292



>ref|XP_002530170.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32225.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=277

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 174/264 (66%), Gaps = 10/264 (4%)
 Frame = -1

Query  1049  RRLEGKVALVTGGTNIIGEPIIKLFLKHGAKVAFTDTDDKLGEKLCQDL--DPAAAVYFH  876
             +RLEGKVA++TGG + IGE   +LF+KHGAKV   D  D+LG  LC+ L  D     Y H
Sbjct  12    KRLEGKVAIITGGASGIGESSARLFVKHGAKVIIADIQDELGHSLCKVLGSDQEIISYIH  71

Query  875   CNIVEESDVESAVDATVAKFGKLDIMV-NAATALGVTKPSILQNDKSEFEQVMGVNVVGT  699
             C++  +SD++ AVD  V+K+GKLDIM  NA T+     PSIL  D  +F++V  VNV G 
Sbjct  72    CDVTSDSDMQKAVDFAVSKYGKLDIMFSNAGTS--CPSPSILATDNQDFKRVFDVNVFGA  129

Query  698   FLGTKHAARAMIPNGAGSIVNLGSVASTTAGTTPHSYTSAKHAVLGLTKNTAVELGRCGI  519
             FL  KHAAR MIP   G I+   S  S T   + H Y ++KHAV+GL KN  VELG+ GI
Sbjct  130   FLAAKHAARVMIPAKRGCIIFTASNLSVTCFQSMHPYIASKHAVVGLAKNLCVELGQYGI  189

Query  518   RVNCVSPFIVCNPVGMKALGL--TTDEDLKKLYN---NLKGAVLKAEDVAEAALYLASDE  354
             RVNCVSPF V  P+  K +GL     E +++L +   NLKGAVL+ EDVAEAA+YL SDE
Sbjct  190   RVNCVSPFAVVTPLLKKHMGLMEMEKEKIRELISKSANLKGAVLEPEDVAEAAVYLGSDE  249

Query  353   SKYVNGHNLVIDGGFSTMNSTLCI  282
             SKYV+G NL++DGG+   N +  I
Sbjct  250   SKYVSGLNLLVDGGYVVTNPSFEI  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2905088742028