BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21894_g1_i2 len=1556 path=[363:0-524 888:525-593 956:594-666
@362@!:667-955 25:956-1087 157:1088-1555]

Length=1556
                                                                      Score     E

ref|XP_002283118.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    389   3e-128   Vitis vinifera
emb|CBI21383.3|  unnamed protein product                                389   3e-128   
ref|XP_011099108.1|  PREDICTED: uncharacterized protein LOC105177598    385   8e-127   
ref|XP_010652787.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    385   2e-126   
ref|XP_009786713.1|  PREDICTED: uncharacterized protein LOC104234...    382   9e-126   
ref|XP_009786712.1|  PREDICTED: uncharacterized protein LOC104234...    378   4e-124   
ref|XP_006339867.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    377   8e-124   
ref|XP_009599930.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    375   5e-123   
ref|XP_004231861.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    375   5e-123   
ref|XP_002534389.1|  RNA binding protein, putative                      374   1e-122   Ricinus communis
ref|XP_006339866.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    373   4e-122   
ref|XP_007206844.1|  hypothetical protein PRUPE_ppa027064mg             373   4e-122   
ref|XP_008244007.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    373   7e-122   
ref|XP_009599929.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    371   2e-121   
ref|XP_010315980.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    370   2e-121   
emb|CDP02518.1|  unnamed protein product                                370   3e-121   
ref|XP_009367393.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    370   6e-121   
ref|XP_008340323.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    370   6e-121   
ref|XP_010070564.1|  PREDICTED: uncharacterized protein LOC104457...    369   1e-120   
ref|XP_010070563.1|  PREDICTED: uncharacterized protein LOC104457...    368   4e-120   
ref|XP_008340318.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    366   4e-119   
ref|XP_009367383.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    365   4e-119   
ref|XP_009367401.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    364   1e-118   
ref|XP_008340330.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    364   1e-118   
ref|XP_004169849.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    360   4e-117   
ref|XP_007047347.1|  RNA-binding family protein isoform 1               356   1e-115   
ref|XP_008440306.1|  PREDICTED: protein WHI4                            355   4e-115   
ref|XP_004288011.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    355   6e-115   
ref|XP_006425957.1|  hypothetical protein CICLE_v10026071mg             354   1e-114   
ref|XP_006494470.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    354   1e-114   
gb|KGN48541.1|  hypothetical protein Csa_6G491040                       352   4e-114   
ref|XP_002310126.1|  hypothetical protein POPTR_0007s10740g             350   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_011000064.1|  PREDICTED: leukocyte receptor cluster member...    349   8e-113   
ref|XP_010679519.1|  PREDICTED: RNA-binding protein with multiple...    347   2e-112   
ref|XP_011000063.1|  PREDICTED: E3 ubiquitin-protein ligase RBBP6...    347   7e-112   
dbj|BAJ53198.1|  JHL03K20.7                                             346   9e-112   
gb|EYU34564.1|  hypothetical protein MIMGU_mgv1a010396mg                345   3e-111   
ref|XP_010679518.1|  PREDICTED: RNA-binding protein with multiple...    344   3e-111   
ref|XP_009372429.1|  PREDICTED: ENHANCER OF AG-4 protein 2-like i...    345   6e-111   
gb|KDP31973.1|  hypothetical protein JCGZ_12434                         344   8e-111   
emb|CAN64038.1|  hypothetical protein VITISV_021557                     344   1e-110   Vitis vinifera
gb|EYU34563.1|  hypothetical protein MIMGU_mgv1a010396mg                341   7e-110   
ref|XP_009372430.1|  PREDICTED: ENHANCER OF AG-4 protein 2-like i...    341   1e-109   
ref|XP_009372428.1|  PREDICTED: ENHANCER OF AG-4 protein 2-like i...    340   3e-109   
ref|XP_007156776.1|  hypothetical protein PHAVU_002G016600g             339   1e-108   
ref|XP_004511897.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    337   8e-108   
ref|XP_003539345.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    334   1e-106   
ref|XP_003611682.1|  RNA-binding protein with multiple splicing         332   4e-106   
ref|XP_010270670.1|  PREDICTED: pollen-specific leucine-rich repe...    329   7e-105   
ref|XP_006590649.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    329   9e-105   
gb|KEH27520.1|  RNA recognition motif                                   328   2e-104   
gb|EPS61714.1|  hypothetical protein M569_13079                         327   3e-104   
ref|XP_010547796.1|  PREDICTED: uncharacterized protein LOC104819403    326   3e-104   
gb|KHN36249.1|  RNA-binding protein with multiple splicing 2            325   5e-104   
ref|XP_010270662.1|  PREDICTED: polyadenylate-binding protein RBP...    327   8e-104   
ref|XP_006590650.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    326   1e-103   
ref|XP_010508600.1|  PREDICTED: uncharacterized protein LOC104785...    323   5e-103   
ref|XP_010517741.1|  PREDICTED: uncharacterized protein LOC104793145    322   7e-103   
ref|XP_010315981.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    322   8e-103   
ref|XP_010506036.1|  PREDICTED: uncharacterized protein LOC104782...    322   2e-102   
ref|XP_006425958.1|  hypothetical protein CICLE_v10026071mg             322   2e-102   
ref|XP_002879975.1|  hypothetical protein ARALYDRAFT_903572             321   2e-102   
ref|XP_003516604.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    322   3e-102   
ref|XP_006293501.1|  hypothetical protein CARUB_v10023763mg             320   4e-102   
ref|XP_010270653.1|  PREDICTED: polyadenylate-binding protein RBP...    322   5e-102   
ref|XP_010508599.1|  PREDICTED: uncharacterized protein LOC104785...    318   3e-101   
gb|AAO37217.1|  hypothetical protein                                    317   8e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506035.1|  PREDICTED: uncharacterized protein LOC104782...    317   8e-101   
ref|NP_001078040.1|  RNA recognition motif-containing protein           317   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006573645.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    318   2e-100   
gb|AAO37215.1|  hypothetical protein                                    315   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411485.1|  hypothetical protein EUTSA_v10017030mg             315   8e-100   
ref|NP_850366.2|  RNA recognition motif-containing protein              315   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932032.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    316   1e-99    
ref|XP_008778277.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    316   1e-99    
ref|NP_001118504.1|  RNA recognition motif-containing protein           313   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420640.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    312   3e-98    
ref|XP_009420639.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    311   7e-98    
ref|XP_008778276.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    309   6e-97    
ref|XP_010093507.1|  RNA-binding protein with multiple splicing 2       307   1e-96    
ref|XP_009417190.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    297   2e-92    
ref|XP_009417189.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    296   4e-92    
emb|CDY22555.1|  BnaC03g23650D                                          291   3e-90    
ref|XP_006657270.1|  PREDICTED: protein couch potato-like               287   4e-89    
ref|XP_002437482.1|  hypothetical protein SORBIDRAFT_10g027920          280   2e-86    Sorghum bicolor [broomcorn]
gb|ACF83035.1|  unknown                                                 280   5e-86    Zea mays [maize]
ref|XP_006573644.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    278   6e-85    
ref|XP_004966276.1|  PREDICTED: cell wall integrity protein scw1-...    275   2e-84    
ref|XP_006855227.1|  hypothetical protein AMTR_s00051p00211030          273   5e-83    
gb|ABK25922.1|  unknown                                                 271   4e-82    Picea sitchensis
gb|KHG27237.1|  Cell wall integrity scw1                                266   8e-82    
ref|XP_010227379.1|  PREDICTED: LOW QUALITY PROTEIN: U2 small nuc...    268   2e-81    
dbj|BAJ89334.1|  predicted protein                                      254   4e-76    
gb|EEE66246.1|  hypothetical protein OsJ_22424                          246   3e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EEC81209.1|  hypothetical protein OsI_24241                          246   3e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_007047348.1|  RNA-binding family protein isoform 2               239   2e-71    
ref|XP_009417191.1|  PREDICTED: uncharacterized protein LOC103997...    239   5e-71    
gb|KDO79113.1|  hypothetical protein CISIN_1g0206321mg                  223   8e-66    
gb|KEH27521.1|  RNA recognition motif                                   219   1e-63    
ref|XP_008778278.1|  PREDICTED: RNA binding protein fox-1 homolog...    205   7e-58    
gb|AAO37216.1|  hypothetical protein                                    192   5e-54    Arabidopsis thaliana [mouse-ear cress]
gb|KDO79114.1|  hypothetical protein CISIN_1g0206321mg                  191   8e-54    
gb|ABR17821.1|  unknown                                                 190   4e-52    Picea sitchensis
ref|XP_007047349.1|  RNA-binding family protein isoform 3               184   8e-51    
ref|XP_006853785.1|  hypothetical protein AMTR_s00056p00211180          184   2e-49    
ref|XP_003531623.1|  PREDICTED: uncharacterized protein LOC100783764    175   6e-47    
gb|KHN11295.1|  RNA-binding protein with multiple splicing              175   7e-47    
gb|KDP40792.1|  hypothetical protein JCGZ_24791                         174   3e-46    
ref|XP_009388581.1|  PREDICTED: uncharacterized protein LOC103975...    174   4e-46    
ref|XP_004297607.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    172   9e-46    
ref|XP_009388580.1|  PREDICTED: protein WHI4 isoform X1                 173   1e-45    
ref|NP_001242824.1|  uncharacterized protein LOC100810989               171   2e-45    
ref|XP_007024462.1|  RNA-binding family protein isoform 2               171   3e-45    
gb|AAB88654.1|  putative RNA-binding protein                            167   4e-45    Arabidopsis thaliana [mouse-ear cress]
gb|KHN39295.1|  RNA-binding protein with multiple splicing              169   7e-45    
ref|XP_002279868.1|  PREDICTED: protein WHI4                            169   9e-45    Vitis vinifera
ref|XP_010062604.1|  PREDICTED: protein WHI4                            169   1e-44    
ref|XP_011072492.1|  PREDICTED: protein WHI4                            169   2e-44    
ref|XP_010542440.1|  PREDICTED: protein WHI3                            169   2e-44    
ref|XP_011007087.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    169   2e-44    
ref|XP_010262179.1|  PREDICTED: protein WHI4                            170   3e-44    
ref|XP_007024461.1|  RNA-binding family protein isoform 1               168   3e-44    
ref|XP_011007086.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    167   6e-44    
ref|XP_006385350.1|  RNA-binding family protein                         167   6e-44    
ref|XP_008794079.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    168   9e-44    
ref|XP_004510361.1|  PREDICTED: uncharacterized protein LOC101503574    166   1e-43    
ref|XP_010925497.1|  PREDICTED: uncharacterized protein LOC105048014    167   2e-43    
ref|XP_004155937.1|  PREDICTED: LOW QUALITY PROTEIN: U2 small nuc...    165   3e-43    
ref|XP_008462363.1|  PREDICTED: LOW QUALITY PROTEIN: U2 small nuc...    165   4e-43    
ref|XP_006342997.1|  PREDICTED: uncharacterized protein LOC102592531    165   5e-43    
ref|XP_004141677.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    164   6e-43    
ref|XP_006407179.1|  hypothetical protein EUTSA_v10021259mg             165   7e-43    
ref|XP_006426509.1|  hypothetical protein CICLE_v10026213mg             164   8e-43    
emb|CDO97927.1|  unnamed protein product                                164   9e-43    
ref|XP_006426508.1|  hypothetical protein CICLE_v10026213mg             164   9e-43    
ref|XP_009146463.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    164   1e-42    
ref|XP_006466053.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    164   1e-42    
gb|KDO65304.1|  hypothetical protein CISIN_1g023143mg                   164   1e-42    
ref|XP_004235610.1|  PREDICTED: protein WHI4                            163   2e-42    
ref|NP_001118622.1|  RNA recognition motif-containing protein           163   2e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146460.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    162   4e-42    
gb|EMS51264.1|  Cell wall integrity protein scw1                        160   4e-42    
ref|XP_007135563.1|  hypothetical protein PHAVU_010G140000g             161   6e-42    
ref|XP_008228314.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    163   7e-42    
gb|AFK36557.1|  unknown                                                 161   8e-42    
ref|XP_008391315.1|  PREDICTED: nucleolin isoform X2                    161   1e-41    
emb|CDY23631.1|  BnaC05g39630D                                          161   1e-41    
emb|CDX97508.1|  BnaA05g25710D                                          161   1e-41    
ref|XP_009765117.1|  PREDICTED: uncharacterized protein LOC104216...    162   1e-41    
ref|XP_002884983.1|  hypothetical protein ARALYDRAFT_478769             161   1e-41    
ref|XP_008228313.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    163   1e-41    
ref|XP_010465227.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    161   1e-41    
gb|KFK38719.1|  hypothetical protein AALP_AA3G151100                    161   1e-41    
ref|XP_010501068.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    161   1e-41    
ref|XP_007215635.1|  hypothetical protein PRUPE_ppa008170mg             162   2e-41    
ref|XP_010106675.1|  RNA-binding protein with multiple splicing         160   2e-41    
ref|XP_011007088.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    160   3e-41    
ref|XP_009599765.1|  PREDICTED: U1 small nuclear ribonucleoprotein A    161   4e-41    
ref|XP_010487138.1|  PREDICTED: uncharacterized protein LOC104765...    159   7e-41    
gb|EPS65567.1|  hypothetical protein M569_09212                         159   8e-41    
ref|XP_009765118.1|  PREDICTED: uncharacterized protein LOC104216...    160   8e-41    
ref|XP_006655792.1|  PREDICTED: uncharacterized protein LOC102704894    159   8e-41    
ref|XP_008391314.1|  PREDICTED: uncharacterized protein LOC103453...    159   9e-41    
ref|XP_006298208.1|  hypothetical protein CARUB_v10014258mg             159   1e-40    
ref|XP_010465231.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    158   1e-40    
dbj|BAJ95564.1|  predicted protein                                      157   2e-40    
ref|XP_006298207.1|  hypothetical protein CARUB_v10014258mg             158   3e-40    
ref|XP_010465230.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    157   4e-40    
ref|XP_010228037.1|  PREDICTED: protein WHI3                            157   4e-40    
ref|XP_010501059.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    156   7e-40    
ref|XP_010686077.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    156   2e-39    
ref|XP_010686078.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    155   3e-39    
ref|XP_010487139.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    155   3e-39    
ref|NP_001056827.1|  Os06g0151200                                       155   3e-39    Oryza sativa Japonica Group [Japonica rice]
gb|AGT16844.1|  hypothetical protein SHCRBa_055_F12_F_220               154   9e-39    
ref|XP_009367543.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    153   1e-38    
ref|XP_002307278.2|  hypothetical protein POPTR_0005s18450g             145   5e-38    Populus trichocarpa [western balsam poplar]
gb|KHG11089.1|  RNA-binding with multiple splicing                      151   6e-38    
ref|NP_001136951.1|  uncharacterized protein LOC100217110               151   7e-38    Zea mays [maize]
ref|XP_004964834.1|  PREDICTED: single-stranded TG1-3 DNA-binding...    150   1e-37    
ref|XP_009367542.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    149   3e-37    
ref|NP_187983.1|  RNA recognition motif-containing protein              149   6e-37    Arabidopsis thaliana [mouse-ear cress]
gb|AFW69180.1|  hypothetical protein ZEAMMB73_553458                    144   2e-36    
gb|ELU06415.1|  hypothetical protein CAPTEDRAFT_112394                  148   3e-36    
ref|NP_001132012.1|  hypothetical protein                               143   5e-36    Zea mays [maize]
ref|XP_001770950.1|  predicted protein                                  142   1e-35    
gb|EEE65097.1|  hypothetical protein OsJ_20145                          145   2e-35    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058407.1|  Os06g0687500                                       141   4e-35    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80024.1|  hypothetical protein OsI_21699                          143   6e-35    Oryza sativa Indica Group [Indian rice]
ref|XP_002437844.1|  hypothetical protein SORBIDRAFT_10g003600          148   1e-34    Sorghum bicolor [broomcorn]
ref|XP_005708732.1|  RNA-binding protein, putative                      142   3e-34    
gb|KHG24004.1|  RNA-binding with multiple splicing 2                    136   3e-32    
gb|EYU21388.1|  hypothetical protein MIMGU_mgv1a012396mg                133   4e-32    
ref|XP_007023092.1|  RNA-binding family protein                         133   2e-31    
gb|KHG04234.1|  RNA-binding with multiple splicing 2                    131   1e-30    
ref|XP_006568351.1|  PREDICTED: protein couch potato-like isoform X3    130   2e-30    
gb|KDO46300.1|  hypothetical protein CISIN_1g020297mg                   129   3e-30    
ref|XP_006568349.1|  PREDICTED: protein couch potato-like isoform X1    129   4e-30    
ref|XP_008202232.1|  PREDICTED: protein couch potato isoform X2         129   6e-30    
ref|XP_008546747.1|  PREDICTED: protein couch potato-like               129   8e-30    
emb|CDO97764.1|  unnamed protein product                                129   8e-30    
emb|CDY27533.1|  BnaC01g32160D                                          128   1e-29    
ref|XP_008202231.1|  PREDICTED: protein couch potato isoform X1         127   2e-29    
ref|XP_008202233.1|  PREDICTED: protein couch potato isoform X3         127   2e-29    
ref|XP_002316452.2|  hypothetical protein POPTR_0010s25610g             127   3e-29    Populus trichocarpa [western balsam poplar]
gb|KDO79111.1|  hypothetical protein CISIN_1g0206322mg                  121   4e-29    
gb|KDO35809.1|  hypothetical protein CISIN_1g032280mg                   121   5e-29    
ref|XP_011046510.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    126   7e-29    
ref|XP_006568350.1|  PREDICTED: protein couch potato-like isoform X2    125   8e-29    
ref|XP_002525006.1|  RNA-binding protein with multiple splicing, ...    125   1e-28    Ricinus communis
ref|XP_010928627.1|  PREDICTED: cell wall integrity protein scw1-...    125   1e-28    
ref|XP_003693144.1|  PREDICTED: protein couch potato-like               125   1e-28    
ref|XP_006568352.1|  PREDICTED: protein couch potato-like isoform X4    125   1e-28    
dbj|BAB01919.1|  unnamed protein product                                124   1e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_392443.4|  PREDICTED: protein couch potato-like isoform X7       125   2e-28    Apis mellifera [bee]
ref|XP_006427728.1|  hypothetical protein CICLE_v10026062mg             125   2e-28    
ref|XP_006492013.1|  PREDICTED: cell wall integrity protein scw1-...    125   2e-28    
gb|KDO46299.1|  hypothetical protein CISIN_1g020297mg                   124   2e-28    
ref|XP_006342871.1|  PREDICTED: cell wall integrity protein scw1-...    124   2e-28    
ref|XP_004235512.1|  PREDICTED: RNA-binding protein with multiple...    124   2e-28    
ref|XP_006378851.1|  hypothetical protein POPTR_0010s25610g             125   2e-28    
ref|XP_010928626.1|  PREDICTED: RNA-binding protein with multiple...    124   2e-28    
ref|XP_006845565.1|  hypothetical protein AMTR_s00019p00188800          124   2e-28    
ref|XP_003372884.1|  protein couch potato                               124   3e-28    
ref|XP_008380263.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    124   3e-28    
ref|XP_002311913.2|  hypothetical protein POPTR_0008s00980g             124   3e-28    Populus trichocarpa [western balsam poplar]
ref|XP_011033021.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    124   4e-28    
gb|ETN70792.1|  hypothetical protein NECAME_04805                       123   5e-28    
ref|XP_009333987.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    123   6e-28    
ref|XP_009339532.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    123   6e-28    
ref|XP_008342403.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    123   7e-28    
ref|XP_009767203.1|  PREDICTED: cell wall integrity protein scw1-...    122   8e-28    
ref|XP_009596214.1|  PREDICTED: cell wall integrity protein scw1 ...    122   9e-28    
ref|XP_008200639.1|  PREDICTED: protein couch potato isoform X1         122   9e-28    
gb|KHJ87727.1|  hypothetical protein OESDEN_12492                       121   1e-27    
ref|XP_009109736.1|  PREDICTED: cell wall integrity protein scw1        122   2e-27    
ref|XP_010063634.1|  PREDICTED: cell wall integrity protein scw1        122   2e-27    
ref|XP_010913619.1|  PREDICTED: RNA-binding protein with multiple...    122   2e-27    
gb|EYU45930.1|  hypothetical protein MIMGU_mgv1a009541mg                122   2e-27    
ref|XP_008782084.1|  PREDICTED: cell wall integrity protein scw1        121   3e-27    
ref|XP_011072723.1|  PREDICTED: RNA-binding protein with multiple...    121   3e-27    
ref|XP_006611191.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    120   4e-27    
gb|KFK39426.1|  hypothetical protein AALP_AA3G243500                    121   4e-27    
ref|XP_009418180.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    120   4e-27    
ref|XP_010550813.1|  PREDICTED: cell wall integrity protein scw1-...    121   4e-27    
ref|XP_002740760.2|  PREDICTED: protein couch potato-like isoform X1    119   6e-27    Saccoglossus kowalevskii
ref|XP_002108108.1|  hypothetical protein TRIADDRAFT_52243              119   7e-27    Trichoplax adhaerens
ref|XP_003704621.1|  PREDICTED: protein couch potato-like               120   9e-27    
emb|CDJ91157.1|  RNA recognition motif domain containing protein        119   1e-26    
ref|XP_010259754.1|  PREDICTED: cell wall integrity protein scw1        119   1e-26    
gb|AES86340.2|  RNA recognition motif                                   119   1e-26    
gb|EYC39753.1|  hypothetical protein Y032_0642g1041                     119   2e-26    
ref|XP_004358286.1|  RNA recognition motif domain containing protein    118   2e-26    
gb|ACG40041.1|  cell wall integrity protein scw1                        119   2e-26    Zea mays [maize]
ref|NP_001149394.1|  LOC100283020                                       119   2e-26    Zea mays [maize]
ref|XP_009384899.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    118   2e-26    
gb|AES86339.2|  RNA recognition motif                                   118   3e-26    
dbj|BAD05688.1|  putative mec-8                                         118   3e-26    Oryza sativa Japonica Group [Japonica rice]
gb|AFW60945.1|  hypothetical protein ZEAMMB73_771004                    118   3e-26    
gb|AFW60943.1|  hypothetical protein ZEAMMB73_771004                    116   2e-25    
ref|XP_003573610.1|  PREDICTED: RNA-binding protein mde7                116   2e-25    
gb|KDP34461.1|  hypothetical protein JCGZ_11932                         116   2e-25    
ref|XP_003396564.1|  PREDICTED: protein couch potato-like               115   3e-25    
ref|XP_008789700.1|  PREDICTED: cell wall integrity protein scw1-...    115   3e-25    
ref|XP_009384887.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    115   5e-25    
ref|XP_007142144.1|  hypothetical protein PHAVU_008G256200g             114   7e-25    
ref|XP_006824049.1|  PREDICTED: protein couch potato-like isoform X2    114   1e-24    
gb|AFK46375.1|  unknown                                                 113   1e-24    
emb|CAA64866.1|  mec-8                                                  113   2e-24    Caenorhabditis elegans [roundworm]
ref|NP_492508.1|  Protein MEC-8                                         113   2e-24    Caenorhabditis elegans [roundworm]
ref|XP_001779544.1|  predicted protein                                  111   5e-24    
gb|KHJ44336.1|  hypothetical protein D918_05347                         112   6e-24    
gb|EPS67740.1|  hypothetical protein M569_07031                         112   7e-24    
gb|EHJ67566.1|  putative Protein couch potato                           111   8e-24    
gb|KHN39362.1|  RNA-binding protein with multiple splicing 2            112   9e-24    
ref|XP_002639203.1|  C. briggsae CBR-MEC-8 protein                      110   1e-23    Caenorhabditis briggsae
ref|XP_003109290.1|  CRE-MEC-8 protein                                  110   1e-23    
ref|XP_002445300.1|  hypothetical protein SORBIDRAFT_07g008520          110   2e-23    Sorghum bicolor [broomcorn]
ref|XP_010687275.1|  PREDICTED: RNA-binding protein with multiple...    110   4e-23    
gb|EMT05373.1|  RNA-binding protein with multiple splicing 2            109   4e-23    
gb|EMS56901.1|  RNA-binding protein with multiple splicing 2            108   5e-23    
ref|XP_003529515.1|  PREDICTED: RNA-binding protein mde7-like           108   8e-23    
ref|XP_004973090.1|  PREDICTED: cell wall integrity protein scw1-...    108   2e-22    
ref|XP_003604143.1|  RNA-binding protein with multiple splicing         106   4e-22    
gb|ACU19162.1|  unknown                                                 103   7e-22    
ref|XP_006659971.1|  PREDICTED: cell wall integrity protein scw1-...    105   7e-22    
ref|XP_003604142.1|  RNA-binding protein with multiple splicing         105   9e-22    
ref|XP_006406300.1|  hypothetical protein EUTSA_v10021034mg             104   3e-21    
gb|ADN34103.1|  hypothetical protein                                  99.8    3e-21    
emb|CDW55905.1|  protein couch potato                                   104   4e-21    
ref|XP_968800.3|  PREDICTED: protein couch potato isoform X2            103   7e-21    
ref|XP_002527419.1|  RNA binding protein, putative                      100   1e-20    
gb|KFD57113.1|  hypothetical protein M513_01998                         103   2e-20    
ref|XP_011049718.1|  PREDICTED: LOW QUALITY PROTEIN: protein couc...    101   2e-20    
ref|XP_002428041.1|  conserved hypothetical protein                     102   3e-20    
ref|XP_002129832.1|  PREDICTED: uncharacterized protein LOC100177894  99.8    1e-19    
emb|CDH59187.1|  rna binding protein                                  99.0    1e-19    
gb|EFN71193.1|  Protein couch potato                                  99.4    2e-19    
gb|EPZ35794.1|  hypothetical protein O9G_003277                       98.6    2e-19    
ref|XP_003531769.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  98.2    3e-19    
ref|XP_002948675.1|  hypothetical protein VOLCADRAFT_104008           97.8    5e-19    
gb|AFW75528.1|  hypothetical protein ZEAMMB73_795624                  95.1    1e-18    
ref|XP_001696037.1|  hypothetical protein CHLREDRAFT_104778           95.9    1e-18    
ref|XP_010545616.1|  PREDICTED: protein couch potato                  96.7    2e-18    
ref|XP_005651478.1|  hypothetical protein COCSUDRAFT_12206            95.1    2e-18    
gb|EMS52701.1|  Cell wall integrity protein scw1                      94.7    4e-18    
ref|XP_009596215.1|  PREDICTED: uncharacterized protein LOC104092...  92.0    3e-17    
ref|XP_002592407.1|  hypothetical protein BRAFLDRAFT_118420           94.4    8e-17    
ref|XP_008648816.1|  PREDICTED: RNA-binding protein with multiple...  87.4    2e-16    
ref|XP_005861196.1|  PREDICTED: RNA-binding protein with multiple...  87.8    4e-16    
ref|XP_004855706.1|  PREDICTED: RNA-binding protein with multiple...  87.0    5e-16    
ref|XP_008118765.1|  PREDICTED: RNA-binding protein with multiple...  85.9    1e-15    
ref|XP_006568354.1|  PREDICTED: protein couch potato-like isoform X6  87.0    1e-15    
pdb|2M9K|A  Chain A, Rbpms2-nter                                      82.8    2e-15    
dbj|BAB26834.1|  unnamed protein product                              84.7    2e-15    
ref|XP_004711978.1|  PREDICTED: RNA-binding protein with multiple...  85.5    2e-15    
ref|XP_005603388.1|  PREDICTED: RNA-binding protein with multiple...  85.1    2e-15    
ref|XP_008834522.1|  PREDICTED: RNA-binding protein with multiple...  85.5    2e-15    
ref|XP_001641893.1|  predicted protein                                82.4    2e-15    
ref|NP_082306.2|  RNA-binding protein with multiple splicing 2        85.1    2e-15    
ref|XP_006629005.1|  PREDICTED: RNA-binding protein with multiple...  85.1    2e-15    
ref|XP_010886384.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_005659550.1|  PREDICTED: RNA-binding protein with multiple...  85.1    3e-15    
ref|XP_006568353.1|  PREDICTED: protein couch potato-like isoform X5  85.9    3e-15    
ref|XP_008114840.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_853385.2|  PREDICTED: RNA-binding protein with multiple sp...  85.1    3e-15    
gb|ACN11069.1|  RNA-binding protein with multiple splicing            84.7    3e-15    
emb|CDQ58494.1|  unnamed protein product                              84.7    3e-15    
ref|XP_010882622.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_006093460.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_005316746.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|NP_001166897.1|  RNA-binding protein with multiple splicing 2     85.1    3e-15    
ref|XP_007956013.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_004409470.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_010569842.1|  PREDICTED: RNA-binding protein with multiple...  84.3    3e-15    
ref|XP_010991845.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_007450770.1|  PREDICTED: RNA-binding protein with multiple...  84.7    3e-15    
ref|XP_010886383.1|  PREDICTED: RNA-binding protein with multiple...  85.1    4e-15    
ref|XP_004466740.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_004421746.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_004274791.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_008164990.1|  PREDICTED: RNA-binding protein with multiple...  84.0    4e-15    
ref|XP_006831601.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_005685900.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_006141788.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_009058496.1|  hypothetical protein LOTGIDRAFT_122701           85.9    4e-15    
ref|XP_008706908.1|  PREDICTED: RNA-binding protein with multiple...  85.5    4e-15    
ref|XP_004629003.1|  PREDICTED: RNA-binding protein with multiple...  85.9    4e-15    
ref|NP_001002409.1|  RNA-binding protein with multiple splicing 2     84.3    4e-15    
ref|XP_005815997.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_004558081.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_002718127.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_005490353.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_007235133.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_008071315.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_008532044.1|  PREDICTED: RNA-binding protein with multiple...  83.6    4e-15    
ref|NP_990200.1|  RNA-binding protein with multiple splicing          84.3    4e-15    
ref|XP_005142564.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_008534182.1|  PREDICTED: RNA-binding protein with multiple...  84.7    4e-15    
ref|XP_005521390.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_008402966.1|  PREDICTED: RNA-binding protein with multiple...  84.0    4e-15    
ref|XP_005163024.1|  PREDICTED: RNA-binding protein with multiple...  84.3    4e-15    
ref|XP_007235132.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|NP_956553.1|  RNA binding protein with multiple splicing 2b       84.3    5e-15    
ref|XP_007549088.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_005280999.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_005017287.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_006020322.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_007549090.1|  PREDICTED: RNA-binding protein with multiple...  84.0    5e-15    
ref|NP_001133590.1|  RNA-binding protein with multiple splicing       84.3    5e-15    
gb|EEZ98900.1|  hypothetical protein TcasGA2_TC004515                 85.5    5e-15    
ref|XP_008014481.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_009427601.1|  PREDICTED: RNA-binding protein with multiple...  84.0    5e-15    
ref|XP_006747147.1|  PREDICTED: RNA-binding protein with multiple...  82.8    5e-15    
ref|XP_008402964.1|  PREDICTED: RNA-binding protein with multiple...  84.0    5e-15    
gb|AAD39515.1|AF148511_1  hermes                                      84.0    5e-15    
ref|XP_009296033.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_010639596.1|  PREDICTED: RNA-binding protein with multiple...  84.3    5e-15    
ref|XP_007658268.1|  PREDICTED: RNA-binding protein with multiple...  82.8    6e-15    
ref|XP_008402960.1|  PREDICTED: RNA-binding protein with multiple...  84.3    6e-15    
dbj|BAC37585.1|  unnamed protein product                              83.2    6e-15    
ref|XP_008402959.1|  PREDICTED: RNA-binding protein with multiple...  84.3    6e-15    
ref|XP_007549087.1|  PREDICTED: RNA-binding protein with multiple...  84.3    6e-15    
ref|NP_001165323.1|  RNA binding protein with multiple splicing       83.6    6e-15    
ref|XP_009003307.1|  PREDICTED: RNA-binding protein with multiple...  84.0    6e-15    
gb|EAW63452.1|  hCG14793, isoform CRA_b                               82.4    6e-15    
ref|XP_005273447.1|  PREDICTED: RNA-binding protein with multiple...  82.4    6e-15    
ref|XP_006630121.1|  PREDICTED: RNA-binding protein with multiple...  83.6    7e-15    
ref|NP_001083477.1|  RNA binding protein with multiple splicing       84.0    7e-15    
emb|CEF67899.1|  RNA recognition motif domain and Nucleotide-bind...  86.7    7e-15    
ref|XP_010986310.1|  PREDICTED: RNA-binding protein with multiple...  84.3    7e-15    
ref|XP_004310681.1|  PREDICTED: RNA-binding protein with multiple...  82.4    7e-15    
ref|XP_007479620.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
gb|EFX80516.1|  hypothetical protein DAPPUDRAFT_23478                 84.7    7e-15    
gb|EFB22904.1|  hypothetical protein PANDA_002166                     82.8    7e-15    
ref|XP_004877659.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_003784468.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_003267039.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_007479621.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_002193531.1|  PREDICTED: RNA-binding protein with multiple...  83.2    7e-15    
ref|XP_010837119.1|  PREDICTED: RNA-binding protein with multiple...  82.4    7e-15    
ref|XP_008014480.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_009096733.1|  PREDICTED: RNA-binding protein with multiple...  83.2    7e-15    
ref|XP_006920619.1|  PREDICTED: RNA-binding protein with multiple...  85.1    7e-15    
ref|XP_005559842.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|XP_001174270.1|  PREDICTED: RNA-binding protein with multiple...  84.0    7e-15    
ref|NP_919248.1|  RNA-binding protein with multiple splicing 2        84.0    7e-15    
ref|XP_009453416.1|  PREDICTED: RNA-binding protein with multiple...  83.2    8e-15    
ref|XP_007495650.1|  PREDICTED: RNA-binding protein with multiple...  83.6    8e-15    
ref|XP_010590780.1|  PREDICTED: RNA-binding protein with multiple...  83.2    8e-15    
gb|ELR57225.1|  RNA-binding protein with multiple splicing 2          83.2    9e-15    
ref|XP_008922389.1|  PREDICTED: RNA-binding protein with multiple...  83.6    9e-15    
ref|XP_010590778.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_005273443.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_003772849.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_010837118.1|  PREDICTED: RNA-binding protein with multiple...  82.8    9e-15    
ref|XP_002196184.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_003969676.1|  PREDICTED: RNA-binding protein with multiple...  84.3    9e-15    
ref|XP_008977509.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_005532221.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_008977511.1|  PREDICTED: RNA-binding protein with multiple...  82.8    9e-15    
ref|XP_010783744.1|  PREDICTED: RNA-binding protein with multiple...  84.3    9e-15    
ref|XP_004592750.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_004475214.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_004662502.1|  PREDICTED: RNA-binding protein with multiple...  83.6    9e-15    
ref|XP_007532199.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|NP_006858.1|  RNA-binding protein with multiple splicing isof...  83.2    9e-15    
ref|XP_003462658.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_003412600.1|  PREDICTED: RNA-binding protein with multiple...  83.2    9e-15    
ref|XP_009296034.1|  PREDICTED: RNA-binding protein with multiple...  83.6    9e-15    
ref|XP_006834556.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_010346977.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_006793894.1|  PREDICTED: RNA-binding protein with multiple...  84.3    1e-14    
ref|XP_005455761.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_008171807.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_002920867.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_008144429.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_010818604.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_004383440.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_005963350.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_003450833.2|  PREDICTED: RNA-binding protein with multiple...  84.3    1e-14    
ref|XP_005226099.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_007495649.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_004428876.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_004578401.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_001915758.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_006076259.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_010369189.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_006793893.1|  PREDICTED: RNA-binding protein with multiple...  84.3    1e-14    
ref|XP_004277194.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_008295627.1|  PREDICTED: RNA-binding protein with multiple...  84.3    1e-14    
ref|XP_009891447.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_008295626.1|  PREDICTED: RNA-binding protein with multiple...  84.3    1e-14    
ref|XP_006253303.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_010590779.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_005393945.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_007447689.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_010818603.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_004558079.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_006086244.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_005606404.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_005743998.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_007425765.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_004558080.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_006932526.1|  PREDICTED: RNA-binding protein with multiple...  81.3    1e-14    
ref|XP_009453418.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_005348237.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|NP_001008711.1|  RNA-binding protein with multiple splicing i...  83.2    1e-14    
ref|XP_005563043.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_007960281.1|  PREDICTED: RNA-binding protein with multiple...  83.2    1e-14    
ref|XP_005671875.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_006278880.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_009453412.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_009322146.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|XP_008769525.1|  PREDICTED: RNA-binding protein with multiple...  83.6    1e-14    
ref|NP_062707.1|  RNA-binding protein with multiple splicing isof...  82.8    1e-14    
ref|NP_001273097.1|  RNA-binding protein with multiple splicing i...  82.8    1e-14    
ref|XP_004066912.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_006974014.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_005066671.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_003418460.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_006793892.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_010734022.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_007495644.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_008295625.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_005743996.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
gb|ELW71298.1|  RNA-binding protein with multiple splicing 2          83.6    1e-14    
gb|EHA98493.1|  RNA-binding protein with multiple splicing 2          82.4    1e-14    
ref|XP_004606936.1|  PREDICTED: RNA-binding protein with multiple...  82.8    1e-14    
ref|XP_008200641.1|  PREDICTED: protein couch potato isoform X3       84.0    1e-14    
gb|AAH92476.1|  RNA binding protein with multiple splicing            83.2    1e-14    
ref|XP_010297735.1|  PREDICTED: RNA-binding protein with multiple...  82.4    1e-14    
ref|XP_007112809.1|  PREDICTED: RNA-binding protein with multiple...  84.0    1e-14    
ref|XP_009979290.1|  PREDICTED: RNA-binding protein with multiple...  82.4    1e-14    
tpg|DAA25383.1|  TPA: RNA binding protein with multiple splicing ...  82.4    1e-14    
ref|XP_009998064.1|  PREDICTED: RNA-binding protein with multiple...  82.8    2e-14    
ref|XP_010734021.1|  PREDICTED: RNA-binding protein with multiple...  84.0    2e-14    
ref|XP_006932525.1|  PREDICTED: RNA-binding protein with multiple...  82.0    2e-14    
ref|XP_005284031.1|  PREDICTED: RNA-binding protein with multiple...  83.2    2e-14    
ref|XP_002756964.2|  PREDICTED: RNA-binding protein with multiple...  83.2    2e-14    



>ref|XP_002283118.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X2 [Vitis 
vinifera]
Length=336

 Score =   389 bits (1000),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/260 (75%), Positives = 220/260 (85%), Gaps = 11/260 (4%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PLY P  S DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  66   SYAPPLY-PQTSVDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSQNSQPFAF  124

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+AAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G +K++KG A
Sbjct  125  AVFLDQQSAIAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRADDERPGLDKKVKGSA  184

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA--NKSAAP-----  729
              SR  +SGVG++H+PGMG+SAY+ +GYP TQS+ NFDGRA+NE  A  N S+AP     
Sbjct  185  GFSRPPDSGVGSVHMPGMGNSAYSMIGYPSTQSHGNFDGRALNETPAKLNNSSAPYFPQN  244

Query  730  --PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
              PCPTLFVANLGP CSEQEL  +FSRC GFLKLKMQSTYG PVAFVDF+DT CS  AL+
Sbjct  245  ATPCPTLFVANLGPTCSEQELIDIFSRCPGFLKLKMQSTYGTPVAFVDFQDTPCSTGALN  304

Query  904  HLQGTMLYSSP-GEGMRLEY  960
            HLQGT+LYSSP GEGMR+EY
Sbjct  305  HLQGTVLYSSPAGEGMRIEY  324



>emb|CBI21383.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/260 (75%), Positives = 220/260 (85%), Gaps = 11/260 (4%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PLY P  S DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  63   SYAPPLY-PQTSVDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSQNSQPFAF  121

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+AAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G +K++KG A
Sbjct  122  AVFLDQQSAIAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRADDERPGLDKKVKGSA  181

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA--NKSAAP-----  729
              SR  +SGVG++H+PGMG+SAY+ +GYP TQS+ NFDGRA+NE  A  N S+AP     
Sbjct  182  GFSRPPDSGVGSVHMPGMGNSAYSMIGYPSTQSHGNFDGRALNETPAKLNNSSAPYFPQN  241

Query  730  --PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
              PCPTLFVANLGP CSEQEL  +FSRC GFLKLKMQSTYG PVAFVDF+DT CS  AL+
Sbjct  242  ATPCPTLFVANLGPTCSEQELIDIFSRCPGFLKLKMQSTYGTPVAFVDFQDTPCSTGALN  301

Query  904  HLQGTMLYSSP-GEGMRLEY  960
            HLQGT+LYSSP GEGMR+EY
Sbjct  302  HLQGTVLYSSPAGEGMRIEY  321



>ref|XP_011099108.1| PREDICTED: uncharacterized protein LOC105177598 [Sesamum indicum]
Length=309

 Score =   385 bits (988),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 228/309 (74%), Gaps = 48/309 (16%)
 Frame = +1

Query  211   SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFA  387
             +YA P+Y P  SHD+VRTLF+AGLPEDVKPREIYNLFREFPGY+SS+LR P SSN QPFA
Sbjct  47    AYAPPIY-PQSSHDQVRTLFVAGLPEDVKPREIYNLFREFPGYQSSNLRPPTSSNNQPFA  105

Query  388   FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP  567
             FA F DQQ+A+ A++ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R GSEKR+KG 
Sbjct  106   FATFADQQTAIMALHALNGMVFDLEKGSTLYIDLAKSNSRSKRLRADDERQGSEKRLKGS  165

Query  568   AVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLF  747
                SR  + GVG++H+PGMG+SAYNT+GYP TQS  N +G + +E  ANKS+  PCPTLF
Sbjct  166   TAFSRSHDPGVGSVHMPGMGNSAYNTIGYPSTQSLGNVEGGSGSEA-ANKSSNTPCPTLF  224

Query  748   VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
             VANLGP CSE+EL QVFSRCRGFLKLKMQSTYGAPVAFVDF+DTACS EAL HLQGT+LY
Sbjct  225   VANLGPTCSEEELMQVFSRCRGFLKLKMQSTYGAPVAFVDFQDTACSTEALGHLQGTVLY  284

Query  928   SS-PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSR  1104
             SS  GEGMRLE                                            +AKSR
Sbjct  285   SSTSGEGMRLE--------------------------------------------FAKSR  300

Query  1105  MGMRSKKSR  1131
             MG+RSKKSR
Sbjct  301   MGLRSKKSR  309



>ref|XP_010652787.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X1 [Vitis 
vinifera]
Length=337

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 220/261 (84%), Gaps = 12/261 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PLY P  S DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  66   SYAPPLY-PQTSVDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSQNSQPFAF  124

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+AAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G +K++KG A
Sbjct  125  AVFLDQQSAIAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRADDERPGLDKKVKGSA  184

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA--NKSAAP----  729
              SR  +S GVG++H+PGMG+SAY+ +GYP TQS+ NFDGRA+NE  A  N S+AP    
Sbjct  185  GFSRPPDSAGVGSVHMPGMGNSAYSMIGYPSTQSHGNFDGRALNETPAKLNNSSAPYFPQ  244

Query  730  ---PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
               PCPTLFVANLGP CSEQEL  +FSRC GFLKLKMQSTYG PVAFVDF+DT CS  AL
Sbjct  245  NATPCPTLFVANLGPTCSEQELIDIFSRCPGFLKLKMQSTYGTPVAFVDFQDTPCSTGAL  304

Query  901  SHLQGTMLYSSP-GEGMRLEY  960
            +HLQGT+LYSSP GEGMR+EY
Sbjct  305  NHLQGTVLYSSPAGEGMRIEY  325



>ref|XP_009786713.1| PREDICTED: uncharacterized protein LOC104234778 isoform X2 [Nicotiana 
sylvestris]
Length=319

 Score =   382 bits (982),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 226/306 (74%), Gaps = 48/306 (16%)
 Frame = +1

Query  220   APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFAFAV  396
             +P+Y P HS+D+VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS  SSN+QPFAFAV
Sbjct  60    SPIY-PQHSYDDVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSQISSNSQPFAFAV  118

Query  397   FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
             F DQ SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR RTDD R  SEKR+KG A I
Sbjct  119   FTDQNSALTAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRTDDGRPVSEKRIKGSAAI  178

Query  577   SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVAN  756
             SR   SGVG++H+PGMG+SAYNT+GYPPTQS   F GR +N+  A+K+ A PCPT+FVAN
Sbjct  179   SRDGGSGVGSVHMPGMGNSAYNTIGYPPTQSQGKFGGRGVNQA-ASKTVADPCPTIFVAN  237

Query  757   LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS-  933
             LG +C+EQEL QVFSRCRGFLKLKMQ TYGAPVAFVDF+DTACS EAL  LQGT+LYSS 
Sbjct  238   LGQSCNEQELIQVFSRCRGFLKLKMQGTYGAPVAFVDFQDTACSTEALGRLQGTVLYSST  297

Query  934   PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGM  1113
              GEGMRLE                                            YAKSRMGM
Sbjct  298   SGEGMRLE--------------------------------------------YAKSRMGM  313

Query  1114  RSKKSR  1131
             RSKKSR
Sbjct  314   RSKKSR  319



>ref|XP_009786712.1| PREDICTED: uncharacterized protein LOC104234778 isoform X1 [Nicotiana 
sylvestris]
Length=320

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 226/307 (74%), Gaps = 49/307 (16%)
 Frame = +1

Query  220   APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFAFAV  396
             +P+Y P HS+D+VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS  SSN+QPFAFAV
Sbjct  60    SPIY-PQHSYDDVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSQISSNSQPFAFAV  118

Query  397   FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
             F DQ SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR RTDD R  SEKR+KG A I
Sbjct  119   FTDQNSALTAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRTDDGRPVSEKRIKGSAAI  178

Query  577   SRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVA  753
             SR   S GVG++H+PGMG+SAYNT+GYPPTQS   F GR +N+  A+K+ A PCPT+FVA
Sbjct  179   SRDGGSAGVGSVHMPGMGNSAYNTIGYPPTQSQGKFGGRGVNQA-ASKTVADPCPTIFVA  237

Query  754   NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
             NLG +C+EQEL QVFSRCRGFLKLKMQ TYGAPVAFVDF+DTACS EAL  LQGT+LYSS
Sbjct  238   NLGQSCNEQELIQVFSRCRGFLKLKMQGTYGAPVAFVDFQDTACSTEALGRLQGTVLYSS  297

Query  934   -PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMG  1110
               GEGMRLE                                            YAKSRMG
Sbjct  298   TSGEGMRLE--------------------------------------------YAKSRMG  313

Query  1111  MRSKKSR  1131
             MRSKKSR
Sbjct  314   MRSKKSR  320



>ref|XP_006339867.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Solanum tuberosum]
Length=315

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 223/306 (73%), Gaps = 46/306 (15%)
 Frame = +1

Query  217   AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS-PSSNTQPFAFA  393
             +APL  P  SH +VRTLFIAGLPEDVKPREIYNLFREF GYESSHLRS  SSN+QPFAFA
Sbjct  55    SAPLLYPQDSHGDVRTLFIAGLPEDVKPREIYNLFREFAGYESSHLRSQTSSNSQPFAFA  114

Query  394   VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAV  573
             VF DQ SA+ AMYELNG+VFD EK S L+I+LAKSNS+SKR R DD R  SEKR+KG A 
Sbjct  115   VFADQHSALMAMYELNGMVFDFEKDSKLYIELAKSNSKSKRLRPDDGRPVSEKRIKGSAA  174

Query  574   ISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVA  753
             ISR   +G G+IH+PGMG+SAYNT+GYPPTQS   FDGR  N+  A+K+AA PCPTLF+A
Sbjct  175   ISRDSGTGFGSIHMPGMGNSAYNTIGYPPTQSQGKFDGRVGNQA-ASKTAADPCPTLFIA  233

Query  754   NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
             NLG +C+EQEL QVFSR RGFLKLKMQSTYGAPVAFVDF+DTA S EALSHLQGT+L+SS
Sbjct  234   NLGQSCTEQELIQVFSRFRGFLKLKMQSTYGAPVAFVDFQDTASSTEALSHLQGTILHSS  293

Query  934   PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGM  1113
              GEGMRLE                                            YAKSRMG+
Sbjct  294   SGEGMRLE--------------------------------------------YAKSRMGL  309

Query  1114  RSKKSR  1131
             RSKKSR
Sbjct  310   RSKKSR  315



>ref|XP_009599930.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Nicotiana tomentosiformis]
Length=319

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 225/306 (74%), Gaps = 48/306 (16%)
 Frame = +1

Query  220   APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFAFAV  396
             +P+Y P HS+D+VRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS  SSN+QPFAFAV
Sbjct  60    SPIY-PQHSYDDVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSQISSNSQPFAFAV  118

Query  397   FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
             F DQ SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR RTDD +  SEKR+KG A I
Sbjct  119   FTDQNSALMAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRTDDGKPVSEKRIKGSAAI  178

Query  577   SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVAN  756
             SR    GVG++H+PGMG+SAYNT+GYPPTQS   F  R +N+  A+K+AA PCPT+FVAN
Sbjct  179   SRDSGCGVGSVHMPGMGNSAYNTIGYPPTQSKGKFGDRVVNQA-ASKTAADPCPTIFVAN  237

Query  757   LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS-  933
             LG +C+EQEL QVFSRC+GFLKLKMQ TYGAPVAFVDF+DTACS EAL  LQGT+LYSS 
Sbjct  238   LGQSCNEQELIQVFSRCQGFLKLKMQGTYGAPVAFVDFQDTACSTEALGRLQGTVLYSST  297

Query  934   PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGM  1113
              GEGMRLE                                            YAKSRMGM
Sbjct  298   SGEGMRLE--------------------------------------------YAKSRMGM  313

Query  1114  RSKKSR  1131
             RSKKSR
Sbjct  314   RSKKSR  319



>ref|XP_004231861.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Solanum lycopersicum]
Length=308

 Score =   375 bits (962),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 218/300 (73%), Gaps = 46/300 (15%)
 Frame = +1

Query  235   PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS-PSSNTQPFAFAVFVDQQ  411
             P  SHD+VRTLFIAGLPEDVKPREIYNLFREF GYESSHLRS  SSN+QPFAFAVF DQ 
Sbjct  54    PQDSHDDVRTLFIAGLPEDVKPREIYNLFREFAGYESSHLRSQTSSNSQPFAFAVFADQH  113

Query  412   SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
             SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR R DD R  SEKR+KG A ISR   
Sbjct  114   SALVAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRPDDGRSVSEKRIKGSAAISRDSG  173

Query  592   SGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNC  771
             SG G+IH+PGMG+SAYNT+GYPPTQS   FDGR  N+  A+K AA PCPTLF+ANLG +C
Sbjct  174   SGFGSIHMPGMGNSAYNTIGYPPTQSLGKFDGRVGNQA-ASKKAADPCPTLFIANLGQSC  232

Query  772   SEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMR  951
             +EQEL QVFSR RGFLKLKMQSTYGAPVAFVDF+DTA S EALSHLQGT+L+SS G GM+
Sbjct  233   TEQELIQVFSRFRGFLKLKMQSTYGAPVAFVDFQDTASSTEALSHLQGTILHSSSGVGMQ  292

Query  952   LEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGMRSKKSR  1131
             LE                                            YAKSRMG+RSKKSR
Sbjct  293   LE--------------------------------------------YAKSRMGLRSKKSR  308



>ref|XP_002534389.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF27997.1| RNA binding protein, putative [Ricinus communis]
Length=318

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 209/255 (82%), Gaps = 5/255 (2%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP Y P   HD VRTLF+AGLPEDV PREIYNLFREFPGYESSHLR+P+  +QPFAFA F
Sbjct  62   APPYVPYAGHDLVRTLFVAGLPEDVMPREIYNLFREFPGYESSHLRTPTQTSQPFAFATF  121

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVI  576
             DQ SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RT D+  G +K+ K  PA+ 
Sbjct  122  ADQPSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTADEWPGLDKKAKASPAIP  181

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAAPPCPTLF  747
                +SG G++H+PGMG+SAYN +GYPP QS+  FD RA  E    N+N S+APPCPTLF
Sbjct  182  QSNFDSGFGSVHLPGMGNSAYNMIGYPPAQSHGTFDSRAKTETKSINSNNSSAPPCPTLF  241

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANLGPNC+EQELTQ+FSR  GFLKLKMQSTYGAPVAFVDF+DTACS  AL+HLQGT+LY
Sbjct  242  VANLGPNCTEQELTQLFSRFAGFLKLKMQSTYGAPVAFVDFQDTACSTGALNHLQGTVLY  301

Query  928  SS-PGEGMRLEYPML  969
            SS  GEGMRLEYP L
Sbjct  302  SSTSGEGMRLEYPFL  316



>ref|XP_006339866.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Solanum tuberosum]
Length=316

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 223/307 (73%), Gaps = 47/307 (15%)
 Frame = +1

Query  217   AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS-PSSNTQPFAFA  393
             +APL  P  SH +VRTLFIAGLPEDVKPREIYNLFREF GYESSHLRS  SSN+QPFAFA
Sbjct  55    SAPLLYPQDSHGDVRTLFIAGLPEDVKPREIYNLFREFAGYESSHLRSQTSSNSQPFAFA  114

Query  394   VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAV  573
             VF DQ SA+ AMYELNG+VFD EK S L+I+LAKSNS+SKR R DD R  SEKR+KG A 
Sbjct  115   VFADQHSALMAMYELNGMVFDFEKDSKLYIELAKSNSKSKRLRPDDGRPVSEKRIKGSAA  174

Query  574   ISRVI-ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
             ISR    +G G+IH+PGMG+SAYNT+GYPPTQS   FDGR  N+  A+K+AA PCPTLF+
Sbjct  175   ISRDSGTAGFGSIHMPGMGNSAYNTIGYPPTQSQGKFDGRVGNQA-ASKTAADPCPTLFI  233

Query  751   ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
             ANLG +C+EQEL QVFSR RGFLKLKMQSTYGAPVAFVDF+DTA S EALSHLQGT+L+S
Sbjct  234   ANLGQSCTEQELIQVFSRFRGFLKLKMQSTYGAPVAFVDFQDTASSTEALSHLQGTILHS  293

Query  931   SPGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMG  1110
             S GEGMRLE                                            YAKSRMG
Sbjct  294   SSGEGMRLE--------------------------------------------YAKSRMG  309

Query  1111  MRSKKSR  1131
             +RSKKSR
Sbjct  310   LRSKKSR  316



>ref|XP_007206844.1| hypothetical protein PRUPE_ppa027064mg [Prunus persica]
 gb|EMJ08043.1| hypothetical protein PRUPE_ppa027064mg [Prunus persica]
Length=328

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 212/258 (82%), Gaps = 11/258 (4%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP   P  SHDEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLR+P+  +QPFAFAVF
Sbjct  59   APALVPQPSHDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRTPTEKSQPFAFAVF  118

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVIS  579
            +DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+K+ +G +   
Sbjct  119  LDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKKARGSSYSR  178

Query  580  RVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAA-------P  729
               +SGVG+IH+PGMG+SAYN +GYP   S+ NF+G  ++E   GN N SAA        
Sbjct  179  GAPDSGVGSIHMPGMGNSAYNIIGYPSAPSHGNFNGIPVHETIAGNVNNSAAQHFPQNNT  238

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PCPT+FVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  ALSHL
Sbjct  239  PCPTIFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGALSHL  298

Query  910  QGTMLYSS-PGEGMRLEY  960
            QGT+LYSS  GEGMRLEY
Sbjct  299  QGTILYSSTTGEGMRLEY  316



>ref|XP_008244007.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' [Prunus mume]
Length=328

 Score =   373 bits (957),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 212/258 (82%), Gaps = 11/258 (4%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP   P  SHDEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLR+P+  +QPFAFAVF
Sbjct  59   APALVPQPSHDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRTPTEKSQPFAFAVF  118

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVIS  579
            +DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+K+ +G +   
Sbjct  119  LDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKKARGSSYSR  178

Query  580  RVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAA-------P  729
               +SGVG+IH+PGMG+SAYN +GYP   S+ NF+G  ++E   GN N SAA        
Sbjct  179  GAPDSGVGSIHMPGMGNSAYNIIGYPSAPSHGNFNGIPVHETIAGNVNNSAAQHFPQNNT  238

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PCPT+FVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  ALSHL
Sbjct  239  PCPTIFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSSGALSHL  298

Query  910  QGTMLYSS-PGEGMRLEY  960
            QGT+LYSS  GEGMRLEY
Sbjct  299  QGTILYSSTTGEGMRLEY  316



>ref|XP_009599929.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Nicotiana tomentosiformis]
Length=320

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 226/307 (74%), Gaps = 49/307 (16%)
 Frame = +1

Query  220   APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFAFAV  396
             +P+Y P HS+D+VRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS  SSN+QPFAFAV
Sbjct  60    SPIY-PQHSYDDVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSQISSNSQPFAFAV  118

Query  397   FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
             F DQ SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR RTDD +  SEKR+KG A I
Sbjct  119   FTDQNSALMAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRTDDGKPVSEKRIKGSAAI  178

Query  577   SRVIE-SGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVA  753
             SR    +GVG++H+PGMG+SAYNT+GYPPTQS   F  R +N+  A+K+AA PCPT+FVA
Sbjct  179   SRDSGCAGVGSVHMPGMGNSAYNTIGYPPTQSKGKFGDRVVNQA-ASKTAADPCPTIFVA  237

Query  754   NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
             NLG +C+EQEL QVFSRC+GFLKLKMQ TYGAPVAFVDF+DTACS EAL  LQGT+LYSS
Sbjct  238   NLGQSCNEQELIQVFSRCQGFLKLKMQGTYGAPVAFVDFQDTACSTEALGRLQGTVLYSS  297

Query  934   -PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMG  1110
               GEGMRLE                                            YAKSRMG
Sbjct  298   TSGEGMRLE--------------------------------------------YAKSRMG  313

Query  1111  MRSKKSR  1131
             MRSKKSR
Sbjct  314   MRSKKSR  320



>ref|XP_010315980.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Solanum lycopersicum]
Length=309

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 218/301 (72%), Gaps = 47/301 (16%)
 Frame = +1

Query  235   PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS-PSSNTQPFAFAVFVDQQ  411
             P  SHD+VRTLFIAGLPEDVKPREIYNLFREF GYESSHLRS  SSN+QPFAFAVF DQ 
Sbjct  54    PQDSHDDVRTLFIAGLPEDVKPREIYNLFREFAGYESSHLRSQTSSNSQPFAFAVFADQH  113

Query  412   SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
             SA+ AMYELNG+VFD EK S L+I+LAKSNSRSKR R DD R  SEKR+KG A ISR   
Sbjct  114   SALVAMYELNGMVFDFEKDSKLYIELAKSNSRSKRLRPDDGRSVSEKRIKGSAAISRDSG  173

Query  592   S-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPN  768
             S G G+IH+PGMG+SAYNT+GYPPTQS   FDGR  N+  A+K AA PCPTLF+ANLG +
Sbjct  174   SAGFGSIHMPGMGNSAYNTIGYPPTQSLGKFDGRVGNQA-ASKKAADPCPTLFIANLGQS  232

Query  769   CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
             C+EQEL QVFSR RGFLKLKMQSTYGAPVAFVDF+DTA S EALSHLQGT+L+SS G GM
Sbjct  233   CTEQELIQVFSRFRGFLKLKMQSTYGAPVAFVDFQDTASSTEALSHLQGTILHSSSGVGM  292

Query  949   RLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGMRSKKS  1128
             +LE                                            YAKSRMG+RSKKS
Sbjct  293   QLE--------------------------------------------YAKSRMGLRSKKS  308

Query  1129  R  1131
             R
Sbjct  309   R  309



>emb|CDP02518.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 226/308 (73%), Gaps = 49/308 (16%)
 Frame = +1

Query  211   SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
             +YA PLY P  SHDEVRTLFIAGLPEDVK REIYNLFREFPGYESSHLR+ +S TQPFAF
Sbjct  52    NYAPPLY-PQSSHDEVRTLFIAGLPEDVKAREIYNLFREFPGYESSHLRTTAS-TQPFAF  109

Query  391   AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
             AVFVDQQSAV A++ LNG+VFDLEKGSTL+IDLAKSN RSKR RTDD+   SEKRMK  A
Sbjct  110   AVFVDQQSAVMALHTLNGMVFDLEKGSTLYIDLAKSNPRSKRLRTDDESAASEKRMKSSA  169

Query  571   VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
               SR  +SGVG+IH+PG G+SA+NT+GY  TQS  +FD RA N+ ++ K  + PCPTLFV
Sbjct  170   S-SRGTDSGVGSIHMPGTGNSAHNTIGYSSTQSEGSFDERAAND-SSKKLNSTPCPTLFV  227

Query  751   ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
             ANLGP CSEQEL QVFSRC GFLKLKMQSTYGAPVAFVDF+D+A S EAL+HLQGT+LYS
Sbjct  228   ANLGPTCSEQELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDSATSSEALNHLQGTVLYS  287

Query  931   SP-GEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRM  1107
             SP G+GMRLE                                            YAKSRM
Sbjct  288   SPSGQGMRLE--------------------------------------------YAKSRM  303

Query  1108  GMRSKKSR  1131
             G+RSKKSR
Sbjct  304   GLRSKKSR  311



>ref|XP_009367393.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Pyrus x bretschneideri]
Length=328

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 213/261 (82%), Gaps = 12/261 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYAA L   P S+DE+RTLF+AGLPEDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYAATLIPQP-SYDELRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA-----  726
                  +SGVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E    NAN S+      
Sbjct  176  YSRGTPDSGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNANNSSVQHFPQ  235

Query  727  --PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
               PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  AL
Sbjct  236  NNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGAL  295

Query  901  SHLQGTMLYSS-PGEGMRLEY  960
            SHLQGT LYSS  GEGMRLEY
Sbjct  296  SHLQGTFLYSSTAGEGMRLEY  316



>ref|XP_008340323.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Malus domestica]
Length=328

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 185/261 (71%), Positives = 214/261 (82%), Gaps = 12/261 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY+APL   P S+DE+RTLF+AGLPEDV+PREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYSAPLIPQP-SYDELRTLFVAGLPEDVEPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA-----  726
                  +SGVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E    NAN S+      
Sbjct  176  YSRGTPDSGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNANNSSVQHFPQ  235

Query  727  --PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
               PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  AL
Sbjct  236  NNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGAL  295

Query  901  SHLQGTMLYSS-PGEGMRLEY  960
            SHLQGT LYSS  GEGMRLEY
Sbjct  296  SHLQGTFLYSSTAGEGMRLEY  316



>ref|XP_010070564.1| PREDICTED: uncharacterized protein LOC104457306 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59389.1| hypothetical protein EUGRSUZ_H02095 [Eucalyptus grandis]
Length=320

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 215/255 (84%), Gaps = 7/255 (3%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY AP+  P  ++DEVRTLF+AGLPEDVK REIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  56   SYGAPV-VPHGAYDEVRTLFVAGLPEDVKAREIYNLFREFPGYESSHLRSPSKNSQPFAF  114

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF DQQSAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DDDRHGS+KR K  +
Sbjct  115  AVFSDQQSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRLR-DDDRHGSDKRAKLSS  173

Query  571  VIS-RVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANK---SAAPPCP  738
              S   ++SGVG+ H+PGMG+SAY+T+GYP TQS+ + D R M    A K   S APPCP
Sbjct  174  PFSFGALDSGVGSPHMPGMGNSAYSTIGYPSTQSHGSSDSRGMKGMTAAKTGNSTAPPCP  233

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLFVANLGP C+EQEL QVFSRC GFLKLKMQSTYGAPVAFVDF+DTACS EAL+ LQGT
Sbjct  234  TLFVANLGPRCTEQELIQVFSRCSGFLKLKMQSTYGAPVAFVDFQDTACSTEALNQLQGT  293

Query  919  MLYSSP-GEGMRLEY  960
            +L+SSP G+G+RLE+
Sbjct  294  LLHSSPAGDGIRLEF  308



>ref|XP_010070563.1| PREDICTED: uncharacterized protein LOC104457306 isoform X1 [Eucalyptus 
grandis]
 gb|KCW59390.1| hypothetical protein EUGRSUZ_H02095 [Eucalyptus grandis]
Length=321

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/256 (73%), Positives = 213/256 (83%), Gaps = 8/256 (3%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY AP+  P  ++DEVRTLF+AGLPEDVK REIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  56   SYGAPV-VPHGAYDEVRTLFVAGLPEDVKAREIYNLFREFPGYESSHLRSPSKNSQPFAF  114

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMK--G  564
            AVF DQQSAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DDDRHGS+KR K   
Sbjct  115  AVFSDQQSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRLR-DDDRHGSDKRAKLSS  173

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANK---SAAPPC  735
            P     +  +GVG+ H+PGMG+SAY+T+GYP TQS+ + D R M    A K   S APPC
Sbjct  174  PFSFGALDSAGVGSPHMPGMGNSAYSTIGYPSTQSHGSSDSRGMKGMTAAKTGNSTAPPC  233

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLFVANLGP C+EQEL QVFSRC GFLKLKMQSTYGAPVAFVDF+DTACS EAL+ LQG
Sbjct  234  PTLFVANLGPRCTEQELIQVFSRCSGFLKLKMQSTYGAPVAFVDFQDTACSTEALNQLQG  293

Query  916  TMLYSSP-GEGMRLEY  960
            T+L+SSP G+G+RLE+
Sbjct  294  TLLHSSPAGDGIRLEF  309



>ref|XP_008340318.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Malus domestica]
Length=329

 Score =   366 bits (939),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/262 (71%), Positives = 214/262 (82%), Gaps = 13/262 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY+APL   P S+DE+RTLF+AGLPEDV+PREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYSAPLIPQP-SYDELRTLFVAGLPEDVEPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA----  726
                  +S GVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E    NAN S+     
Sbjct  176  YSRGTPDSAGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNANNSSVQHFP  235

Query  727  ---PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
                PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  A
Sbjct  236  QNNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGA  295

Query  898  LSHLQGTMLYSS-PGEGMRLEY  960
            LSHLQGT LYSS  GEGMRLEY
Sbjct  296  LSHLQGTFLYSSTAGEGMRLEY  317



>ref|XP_009367383.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Pyrus x bretschneideri]
Length=329

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/262 (71%), Positives = 213/262 (81%), Gaps = 13/262 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYAA L   P S+DE+RTLF+AGLPEDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYAATLIPQP-SYDELRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA----  726
                  +S GVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E    NAN S+     
Sbjct  176  YSRGTPDSAGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNANNSSVQHFP  235

Query  727  ---PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
                PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  A
Sbjct  236  QNNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGA  295

Query  898  LSHLQGTMLYSS-PGEGMRLEY  960
            LSHLQGT LYSS  GEGMRLEY
Sbjct  296  LSHLQGTFLYSSTAGEGMRLEY  317



>ref|XP_009367401.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Pyrus x bretschneideri]
Length=323

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 211/256 (82%), Gaps = 7/256 (3%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYAA L   P S+DE+RTLF+AGLPEDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYAATLIPQP-SYDELRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAP----PC  735
                  +S GVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E  +  +  P    PC
Sbjct  176  YSRGTPDSAGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNAHFPQNNTPC  235

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  ALSHLQG
Sbjct  236  PTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGALSHLQG  295

Query  916  TMLYSS-PGEGMRLEY  960
            T LYSS  GEGMRLEY
Sbjct  296  TFLYSSTAGEGMRLEY  311



>ref|XP_008340330.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Malus domestica]
Length=323

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/256 (71%), Positives = 212/256 (83%), Gaps = 7/256 (3%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY+APL   P S+DE+RTLF+AGLPEDV+PREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYSAPLIPQP-SYDELRTLFVAGLPEDVEPREIYNLFREFPGYESSHLRTPNGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAP----PC  735
                  +S GVG+IH+PGMG+SAYN  GYP   S+ NF+GRA++E  +  +  P    PC
Sbjct  176  YSRGTPDSAGVGSIHMPGMGNSAYNMTGYPSAPSHGNFNGRAVHETISPNAHFPQNNTPC  235

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLFVANLGP C+EQEL QVFSRC GF+KLKMQSTYGAPVAFVDF+DTACS  ALSHLQG
Sbjct  236  PTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTYGAPVAFVDFQDTACSTGALSHLQG  295

Query  916  TMLYSS-PGEGMRLEY  960
            T LYSS  GEGMRLEY
Sbjct  296  TFLYSSTAGEGMRLEY  311



>ref|XP_004169849.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like, partial 
[Cucumis sativus]
Length=306

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 207/253 (82%), Gaps = 2/253 (1%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PL     S +EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLR+P+  TQPFAF
Sbjct  52   SYALPLLPHTTSINEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRTPTQTTQPFAF  111

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF DQQSAV AM+ +NG+VFDLEK S L++DLAKSNSRSKR RT+++R+GS+K+ K   
Sbjct  112  AVFSDQQSAVGAMHAVNGMVFDLEKQSVLYVDLAKSNSRSKRTRTEEERYGSDKKAKVSI  171

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG-NANKSAAPPCPTLF  747
            +     + G+G+ H+ GMG+SAYNT+GYP  QS+ +FD + +N+   AN    PPCPTLF
Sbjct  172  IPRSTPDPGLGSTHMSGMGNSAYNTIGYPSAQSHGSFDNKTVNDTVAANIPQNPPCPTLF  231

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANLGP C+EQEL Q+F RC GFLKLKMQSTYGAPVAFVDF+DTACS  AL+HLQG++LY
Sbjct  232  VANLGPGCTEQELIQIFLRCPGFLKLKMQSTYGAPVAFVDFQDTACSTGALNHLQGSILY  291

Query  928  SS-PGEGMRLEYP  963
            SS PGEGMRLEYP
Sbjct  292  SSPPGEGMRLEYP  304



>ref|XP_007047347.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX91504.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=327

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 209/253 (83%), Gaps = 8/253 (3%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSS--NTQPFA  387
            Y+ P  +   SHD VRTLFIAGLPED+KPREIYNLFREFPGYESSHLR+P+S  N+QPFA
Sbjct  67   YSVPYVSACSSHDSVRTLFIAGLPEDIKPREIYNLFREFPGYESSHLRNPNSAQNSQPFA  126

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP  567
            FAVF DQQSA+AAM  LNG+VFDLEKGSTLFID AKSNSRSKR RTDD+  GS+K+ +G 
Sbjct  127  FAVFSDQQSAIAAMQALNGMVFDLEKGSTLFIDFAKSNSRSKRPRTDDEWTGSDKKSRG-  185

Query  568  AVISR-VIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTL  744
               SR   +SG G++H+PGMG+SA+N +GYPP QS  N D  A +E  A KS+A PCPTL
Sbjct  186  -SFSRPTTDSGFGSVHMPGMGNSAHNMIGYPPAQSSGNAD--ANSESTAMKSSASPCPTL  242

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLG +C+E+EL QVFSRC GFLKLKMQSTYGAPVAFVDF+DTACS  A++ LQGT+L
Sbjct  243  FVANLGASCTEEELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDTACSTGAMNSLQGTIL  302

Query  925  YSSP-GEGMRLEY  960
            YSSP G+GMRLEY
Sbjct  303  YSSPAGDGMRLEY  315



>ref|XP_008440306.1| PREDICTED: protein WHI4 [Cucumis melo]
Length=316

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/253 (68%), Positives = 204/253 (81%), Gaps = 3/253 (1%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY  PL     S +EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLR+P+  TQPFAF
Sbjct  52   SYGLPLLPHTTSINEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRTPTQTTQPFAF  111

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF DQQSAV AM+ +NG+VFDLEK S L++DLAKSNSRSKR RT+D+R+GS+K+ K   
Sbjct  112  AVFSDQQSAVGAMHAVNGMVFDLEKQSVLYVDLAKSNSRSKRTRTEDERYGSDKKAKVSI  171

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCPTL  744
            +     + G+G+ H+ GMG+SAYNT+GYP  QS+ +FD + +N+  A       PPCPTL
Sbjct  172  ISRSTPDPGLGSTHMSGMGNSAYNTIGYPSAQSHGSFDNKTVNDTVAANVIPQNPPCPTL  231

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLGP C+EQEL Q+F RC GFLKLKMQSTYGAPVAFVDF+DTACS  AL+HLQG++L
Sbjct  232  FVANLGPGCTEQELIQIFLRCPGFLKLKMQSTYGAPVAFVDFQDTACSTGALNHLQGSIL  291

Query  925  YSS-PGEGMRLEY  960
            YSS PGEGMRLEY
Sbjct  292  YSSPPGEGMRLEY  304



>ref|XP_004288011.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Fragaria 
vesca subsp. vesca]
Length=327

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 202/250 (81%), Gaps = 11/250 (4%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            ++DEVRTLF+AGLPEDVK REIYNLFREFPGYESSHLR+P+  TQPFAFAVF+DQQSA+ 
Sbjct  66   AYDEVRTLFVAGLPEDVKAREIYNLFREFPGYESSHLRTPTEKTQPFAFAVFLDQQSAIG  125

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG  603
            AM  LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+R GS+K+ +G +      + GVG
Sbjct  126  AMQALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDERSGSDKKARGSSYSRATSDPGVG  185

Query  604  NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAA-------PPCPTLFVA  753
            +IH+PGMG+SAYN +GYP   S+ +F G  +NE    N N S+A        PCPTLFVA
Sbjct  186  SIHMPGMGNSAYNMIGYPSAPSHGSFSGSGVNETIASNMNISSAQHFPQNNTPCPTLFVA  245

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGP C+EQEL QVFSRC GF+KLKMQSTYG PVAFVDF+DTA S  ALSHLQGT+LYSS
Sbjct  246  NLGPTCTEQELIQVFSRCPGFIKLKMQSTYGTPVAFVDFQDTASSTGALSHLQGTILYSS  305

Query  934  -PGEGMRLEY  960
              GEGMRLE+
Sbjct  306  TSGEGMRLEF  315



>ref|XP_006425957.1| hypothetical protein CICLE_v10026071mg [Citrus clementina]
 gb|ESR39197.1| hypothetical protein CICLE_v10026071mg [Citrus clementina]
Length=322

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 206/251 (82%), Gaps = 12/251 (5%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S+DEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS + N+QPFAFAVF DQQSA+ 
Sbjct  60   SYDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSSTQNSQPFAFAVFSDQQSALG  119

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR-VIESGV  600
            AMY LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+  GS+K+ +GP+  SR   + G+
Sbjct  120  AMYALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDEWTGSDKKARGPSAFSRGTADLGI  179

Query  601  GNIHIPGMGSSAYNTVGYPPTQSYANFDGRA---MNEGNANKSAAP-------PCPTLFV  750
            G++H+PGMG+SA+NT+GYP TQS+ NFD R    +     N S+AP       PC TLFV
Sbjct  180  GSVHMPGMGNSAFNTIGYPHTQSHENFDARGGSLITTAKFNNSSAPSGPKNVTPCATLFV  239

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGP C+EQELTQVFS+C GFLKLK+QSTYG PVAFVDF+DT  S  AL++LQGT+LYS
Sbjct  240  ANLGPTCTEQELTQVFSKCPGFLKLKIQSTYGPPVAFVDFQDTVSSTAALNNLQGTILYS  299

Query  931  SP-GEGMRLEY  960
            SP  +G+RLE+
Sbjct  300  SPTSDGIRLEF  310



>ref|XP_006494470.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Citrus 
sinensis]
Length=326

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 206/251 (82%), Gaps = 12/251 (5%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S+DEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS + N+QPFAFAVF DQQSA+ 
Sbjct  64   SYDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSSTQNSQPFAFAVFSDQQSALG  123

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR-VIESGV  600
            AMY LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+  GS+K+ +GP+  SR   + G+
Sbjct  124  AMYALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDEWTGSDKKARGPSAFSRGTADLGI  183

Query  601  GNIHIPGMGSSAYNTVGYPPTQSYANFDGRA---MNEGNANKSAAP-------PCPTLFV  750
            G++H+PGMG+SA+NT+GYP TQS+ NFD R    +     N S+AP       PC TLFV
Sbjct  184  GSVHMPGMGNSAFNTIGYPHTQSHENFDARGGSLITTAKFNNSSAPSGPKNVTPCATLFV  243

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGP C+EQELTQVFS+C GFLKLK+QSTYG PVAFVDF+DT  S  AL++LQGT+LYS
Sbjct  244  ANLGPTCTEQELTQVFSKCPGFLKLKIQSTYGPPVAFVDFQDTVSSTAALNNLQGTILYS  303

Query  931  SP-GEGMRLEY  960
            SP  +G+RLE+
Sbjct  304  SPTSDGIRLEF  314



>gb|KGN48541.1| hypothetical protein Csa_6G491040 [Cucumis sativus]
Length=317

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/255 (69%), Positives = 208/255 (82%), Gaps = 6/255 (2%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PL     S +EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLR+P+  TQPFAF
Sbjct  52   SYALPLLPHTTSINEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRTPTQTTQPFAF  111

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF DQQSAV AM+ +NG+VFDLEK S L++DLAKSNSRSKR RT+++R+GS+K+ K  +
Sbjct  112  AVFSDQQSAVGAMHAVNGMVFDLEKQSVLYVDLAKSNSRSKRTRTEEERYGSDKKAKV-S  170

Query  571  VISRVI--ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCP  738
            +I R     +G+G+ H+ GMG+SAYNT+GYP  QS+ +FD + +N+  A       PPCP
Sbjct  171  IIPRSTPDPAGLGSTHMSGMGNSAYNTIGYPSAQSHGSFDNKTVNDTVAANVIPQNPPCP  230

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLFVANLGP C+EQEL Q+F RC GFLKLKMQSTYGAPVAFVDF+DTACS  AL+HLQG+
Sbjct  231  TLFVANLGPGCTEQELIQIFLRCPGFLKLKMQSTYGAPVAFVDFQDTACSTGALNHLQGS  290

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS PGEGMRLEY
Sbjct  291  ILYSSPPGEGMRLEY  305



>ref|XP_002310126.1| hypothetical protein POPTR_0007s10740g [Populus trichocarpa]
 gb|EEE90576.1| hypothetical protein POPTR_0007s10740g [Populus trichocarpa]
Length=323

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 205/253 (81%), Gaps = 8/253 (3%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            + P Y P   HD+VRTLF+AGLP+D+KPRE+YNLFREFPGYESSHLR+PS N+QPFAFA 
Sbjct  62   SVPAYVP---HDQVRTLFVAGLPDDIKPREMYNLFREFPGYESSHLRTPSQNSQPFAFAT  118

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
            F DQ SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+    +K+ +  +  
Sbjct  119  FTDQPSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDEWSSLDKKARVSSGF  178

Query  577  SR-VIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAAPPCPTL  744
            S    +SG G++H+PGM +SA+NT+G+P  QS  + D R+ NE   G  N S+APPCPTL
Sbjct  179  SMGTPDSGFGSVHLPGMANSAFNTIGFPSAQSPGSIDDRSRNESKAGRMNNSSAPPCPTL  238

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLG NC+E+EL QVFSRC GFLKLKMQSTYGAPVAFVDF+DTA S  AL+HLQGT+L
Sbjct  239  FVANLGQNCTEEELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDTASSTGALNHLQGTVL  298

Query  925  YSS-PGEGMRLEY  960
            YSS  GEG+RLEY
Sbjct  299  YSSVAGEGLRLEY  311



>ref|XP_011000064.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform 
X2 [Populus euphratica]
Length=321

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 204/253 (81%), Gaps = 8/253 (3%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            + P Y P   HD+VRTLF+AGLP+D+KPRE+YNLFREFPGYESSHLR+PS N+QPFAFA 
Sbjct  60   SVPAYVP---HDQVRTLFVAGLPDDIKPREMYNLFREFPGYESSHLRTPSQNSQPFAFAT  116

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
            F DQ SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+    +K+ +  +  
Sbjct  117  FTDQPSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRARTDDEWSSLDKKARVSSGF  176

Query  577  SR-VIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAAPPCPTL  744
            S    +SG G++H+PGM +SAYNT+G+P  QS  + D R+ NE   G  N S+APPCPTL
Sbjct  177  SMGTPDSGFGSVHLPGMANSAYNTIGFPSAQSPGSIDDRSRNESKAGRMNNSSAPPCPTL  236

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLG NC+E+EL QVFSRC GFLKLKMQSTYGAPVAFVDF+D A S  AL+HLQGT+L
Sbjct  237  FVANLGQNCTEEELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDAASSTGALNHLQGTVL  296

Query  925  YSS-PGEGMRLEY  960
            YSS  GEG+RLEY
Sbjct  297  YSSVAGEGLRLEY  309



>ref|XP_010679519.1| PREDICTED: RNA-binding protein with multiple splicing 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=303

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 201/252 (80%), Gaps = 12/252 (5%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAV  420
             S DEVRTLF+AGLPEDVKPRE+YNLFR+FPGY SS+LRSPS ++QPFAFA F+DQ SA+
Sbjct  40   QSPDEVRTLFVAGLPEDVKPREVYNLFRDFPGYLSSNLRSPSKSSQPFAFAEFLDQHSAI  99

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRVIESG  597
             AM+ LNG++FDLEKGSTL+IDLAKSNSRSKRQR DD    S+K+ KG PA     +E G
Sbjct  100  TAMHALNGMIFDLEKGSTLYIDLAKSNSRSKRQRADDSGPVSDKKHKGSPAFARGSVELG  159

Query  598  VGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSA----------APPCPTLF  747
            +G+ HIPGMG+SAYNT+GYP  QS+ ++  R  +E NA KS+           PPCPT+F
Sbjct  160  IGSFHIPGMGNSAYNTIGYPSAQSHWSYTSRGTSEANAPKSSHSSASHVPQDNPPCPTIF  219

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANL P CSEQEL QVFSR RGFLKLK+QSTYGAPVAFVDF+DTACS EAL  LQGT+L+
Sbjct  220  VANLSPKCSEQELIQVFSRYRGFLKLKIQSTYGAPVAFVDFQDTACSTEALGQLQGTVLF  279

Query  928  SSP-GEGMRLEY  960
            S P G+GMRLEY
Sbjct  280  SDPAGDGMRLEY  291



>ref|XP_011000063.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6 isoform X1 [Populus 
euphratica]
Length=322

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/254 (67%), Positives = 203/254 (80%), Gaps = 9/254 (4%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            + P Y P   HD+VRTLF+AGLP+D+KPRE+YNLFREFPGYESSHLR+PS N+QPFAFA 
Sbjct  60   SVPAYVP---HDQVRTLFVAGLPDDIKPREMYNLFREFPGYESSHLRTPSQNSQPFAFAT  116

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
            F DQ SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+    +K+ +  +  
Sbjct  117  FTDQPSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRARTDDEWSSLDKKARVSSGF  176

Query  577  SRVI--ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAAPPCPT  741
            S      +G G++H+PGM +SAYNT+G+P  QS  + D R+ NE   G  N S+APPCPT
Sbjct  177  SMGTPDSAGFGSVHLPGMANSAYNTIGFPSAQSPGSIDDRSRNESKAGRMNNSSAPPCPT  236

Query  742  LFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTM  921
            LFVANLG NC+E+EL QVFSRC GFLKLKMQSTYGAPVAFVDF+D A S  AL+HLQGT+
Sbjct  237  LFVANLGQNCTEEELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDAASSTGALNHLQGTV  296

Query  922  LYSS-PGEGMRLEY  960
            LYSS  GEG+RLEY
Sbjct  297  LYSSVAGEGLRLEY  310



>dbj|BAJ53198.1| JHL03K20.7 [Jatropha curcas]
Length=316

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 208/251 (83%), Gaps = 5/251 (2%)
 Frame = +1

Query  229  YTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQ  408
            Y P   HD VRTLF+AGLP+DVKPREIYNLFREFPGYESSHLRSP+  +QPFAFA F+DQ
Sbjct  66   YAPHAPHDPVRTLFVAGLPDDVKPREIYNLFREFPGYESSHLRSPTQTSQPFAFATFIDQ  125

Query  409  QSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRV  585
             SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R+DD+  G +KR+K  PA     
Sbjct  126  PSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRSDDEWSGLDKRVKASPATPGGS  185

Query  586  IESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAAPPCPTLFVAN  756
            ++SG G++H+PGM +SAYN +GY   QS+  FD RA +E    N++ S+APPCPTLFVAN
Sbjct  186  LDSGFGSVHLPGMSNSAYNMIGYTSPQSHGIFDSRAASEPTGANSSNSSAPPCPTLFVAN  245

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGPNC EQEL QVFSRC GFLKLKMQSTYGAPVAFVDF+DT+CS  AL+HLQGT+LYSSP
Sbjct  246  LGPNCMEQELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDTSCSTGALNHLQGTILYSSP  305

Query  937  -GEGMRLEYPM  966
             G+GMRLEYP 
Sbjct  306  AGDGMRLEYPF  316



>gb|EYU34564.1| hypothetical protein MIMGU_mgv1a010396mg [Erythranthe guttata]
Length=312

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 214/311 (69%), Gaps = 49/311 (16%)
 Frame = +1

Query  211   SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFA  387
             +YA PLY P  S D+VRTLF+AGLPEDVKPREIY+LFRE PGYE+S+LR P SSN QPFA
Sbjct  47    AYAPPLY-PQSSLDQVRTLFVAGLPEDVKPREIYHLFRECPGYETSNLRPPTSSNNQPFA  105

Query  388   FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP  567
             FA FVDQQSAV A++ +NG+VFDLEKGSTL IDLAKSNSRSKR R DDD  GSEKR KG 
Sbjct  106   FATFVDQQSAVMALHAINGMVFDLEKGSTLHIDLAKSNSRSKRSRADDDSQGSEKRQKGS  165

Query  568   AVISRVIESGVGNIHI--PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPT  741
             A  SR  + GVG +H   PG+ +S+Y+TVGY PTQS  + DG       ++KS + PCPT
Sbjct  166   AGFSRNDDPGVGRVHTHTPGIVNSSYSTVGYSPTQSQRSVDGGGSMSRVSSKSNSGPCPT  225

Query  742   LFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTM  921
             LFVANLGP C+E+EL  VFSRCRGFLKLKMQ TYGAPVAFVDF+DTA S EAL  LQGT 
Sbjct  226   LFVANLGPTCNEEELMHVFSRCRGFLKLKMQGTYGAPVAFVDFQDTASSTEALRDLQGTF  285

Query  922   LYSS-PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAK  1098
             LYSS  GEGMRLE                                            +AK
Sbjct  286   LYSSTSGEGMRLE--------------------------------------------FAK  301

Query  1099  SRMGMRSKKSR  1131
             SRMGMRSKKSR
Sbjct  302   SRMGMRSKKSR  312



>ref|XP_010679518.1| PREDICTED: RNA-binding protein with multiple splicing 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 201/253 (79%), Gaps = 13/253 (5%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAV  420
             S DEVRTLF+AGLPEDVKPRE+YNLFR+FPGY SS+LRSPS ++QPFAFA F+DQ SA+
Sbjct  40   QSPDEVRTLFVAGLPEDVKPREVYNLFRDFPGYLSSNLRSPSKSSQPFAFAEFLDQHSAI  99

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR--VIES  594
             AM+ LNG++FDLEKGSTL+IDLAKSNSRSKRQR DD    S+K+ KG    +R  V  +
Sbjct  100  TAMHALNGMIFDLEKGSTLYIDLAKSNSRSKRQRADDSGPVSDKKHKGSPAFARGSVELA  159

Query  595  GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSA----------APPCPTL  744
            G+G+ HIPGMG+SAYNT+GYP  QS+ ++  R  +E NA KS+           PPCPT+
Sbjct  160  GIGSFHIPGMGNSAYNTIGYPSAQSHWSYTSRGTSEANAPKSSHSSASHVPQDNPPCPTI  219

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANL P CSEQEL QVFSR RGFLKLK+QSTYGAPVAFVDF+DTACS EAL  LQGT+L
Sbjct  220  FVANLSPKCSEQELIQVFSRYRGFLKLKIQSTYGAPVAFVDFQDTACSTEALGQLQGTVL  279

Query  925  YSSP-GEGMRLEY  960
            +S P G+GMRLEY
Sbjct  280  FSDPAGDGMRLEY  292



>ref|XP_009372429.1| PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=333

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 179/262 (68%), Positives = 206/262 (79%), Gaps = 15/262 (6%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY AP    P S+DE+RTLFIAGL EDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYVAPRIPQP-SYDELRTLFIAGLSEDVKPREIYNLFREFPGYESSHLRTPTGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGS L+IDLAKSNSRSKR RTDD+R  S+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSKLYIDLAKSNSRSKRSRTDDERPSSDKRARSSS  175

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA-----  726
                  +SGVG+IH+PGMG+SAYN +GYP   S  +F+ RA++E    N N S+A     
Sbjct  176  YSRGTPDSGVGSIHVPGMGNSAYNMIGYP---SAPSFNDRAVHETIAPNMNNSSAQHFPQ  232

Query  727  --PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
               PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQST GAPVAFVDF+DTACS  AL
Sbjct  233  NNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTCGAPVAFVDFQDTACSTGAL  292

Query  901  SHLQGTMLYSS-PGEGMRLEYP  963
            S LQGT LYSS  GEGMRLE P
Sbjct  293  SRLQGTFLYSSTTGEGMRLEIP  314



>gb|KDP31973.1| hypothetical protein JCGZ_12434 [Jatropha curcas]
Length=322

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 207/249 (83%), Gaps = 5/249 (2%)
 Frame = +1

Query  229  YTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQ  408
            Y P   HD VRTLF+AGLP+DVKPREIYNLFREFPGYESSHLRSP+  +QPFAFA F+DQ
Sbjct  62   YAPHAPHDPVRTLFVAGLPDDVKPREIYNLFREFPGYESSHLRSPTQTSQPFAFATFIDQ  121

Query  409  QSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRV  585
             SAVAAM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R+DD+  G +KR+K  PA     
Sbjct  122  PSAVAAMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRSDDEWSGLDKRVKASPATPGGS  181

Query  586  IESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---GNANKSAAPPCPTLFVAN  756
            ++SG G++H+PGM +SAYN +GY   QS+  FD RA +E    N++ S+APPCPTLFVAN
Sbjct  182  LDSGFGSVHLPGMSNSAYNMIGYTSPQSHGIFDSRAASEPTGANSSNSSAPPCPTLFVAN  241

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGPNC EQEL QVFSRC GFLKLKMQSTYGAPVAFVDF+DT+CS  AL+HLQGT+LYSSP
Sbjct  242  LGPNCMEQELIQVFSRCPGFLKLKMQSTYGAPVAFVDFQDTSCSTGALNHLQGTILYSSP  301

Query  937  -GEGMRLEY  960
             G+GMRLEY
Sbjct  302  AGDGMRLEY  310



>emb|CAN64038.1| hypothetical protein VITISV_021557 [Vitis vinifera]
Length=335

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 193/230 (84%), Gaps = 10/230 (4%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SYA PLY P  S DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS N+QPFAF
Sbjct  63   SYAPPLY-PQTSVDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSQNSQPFAF  121

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+A M+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G +K++KG A
Sbjct  122  AVFLDQQSAIATMHALNGMVFDLEKGSTLYIDLAKSNSRSKRSRADDERPGLDKKVKGSA  181

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA--NKSAAP-----  729
              SR  +SGVG++H+PGMG+SAY+ +GYP TQS+ NFDGRA+NE  A  N S+AP     
Sbjct  182  GFSRPPDSGVGSVHMPGMGNSAYSMIGYPSTQSHGNFDGRALNETPAKLNNSSAPYFPQN  241

Query  730  --PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFK  873
              PCPTLFVANLGP CSEQEL  +FSRC GFLKLKMQSTYG PVAFVDF+
Sbjct  242  VTPCPTLFVANLGPTCSEQELIDIFSRCPGFLKLKMQSTYGTPVAFVDFQ  291



>gb|EYU34563.1| hypothetical protein MIMGU_mgv1a010396mg [Erythranthe guttata]
Length=313

 Score =   341 bits (875),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 215/312 (69%), Gaps = 50/312 (16%)
 Frame = +1

Query  211   SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFA  387
             +YA PLY P  S D+VRTLF+AGLPEDVKPREIY+LFRE PGYE+S+LR P SSN QPFA
Sbjct  47    AYAPPLY-PQSSLDQVRTLFVAGLPEDVKPREIYHLFRECPGYETSNLRPPTSSNNQPFA  105

Query  388   FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP  567
             FA FVDQQSAV A++ +NG+VFDLEKGSTL IDLAKSNSRSKR R DDD  GSEKR KG 
Sbjct  106   FATFVDQQSAVMALHAINGMVFDLEKGSTLHIDLAKSNSRSKRSRADDDSQGSEKRQKGS  165

Query  568   AVISRVIE-SGVGNIHI--PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCP  738
             A  SR  + +GVG +H   PG+ +S+Y+TVGY PTQS  + DG       ++KS + PCP
Sbjct  166   AGFSRNDDPAGVGRVHTHTPGIVNSSYSTVGYSPTQSQRSVDGGGSMSRVSSKSNSGPCP  225

Query  739   TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
             TLFVANLGP C+E+EL  VFSRCRGFLKLKMQ TYGAPVAFVDF+DTA S EAL  LQGT
Sbjct  226   TLFVANLGPTCNEEELMHVFSRCRGFLKLKMQGTYGAPVAFVDFQDTASSTEALRDLQGT  285

Query  919   MLYSS-PGEGMRLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYA  1095
              LYSS  GEGMRLE                                            +A
Sbjct  286   FLYSSTSGEGMRLE--------------------------------------------FA  301

Query  1096  KSRMGMRSKKSR  1131
             KSRMGMRSKKSR
Sbjct  302   KSRMGMRSKKSR  313



>ref|XP_009372430.1| PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=326

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/262 (68%), Positives = 206/262 (79%), Gaps = 16/262 (6%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY AP    P S+DE+RTLFIAGL EDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYVAPRIPQP-SYDELRTLFIAGLSEDVKPREIYNLFREFPGYESSHLRTPTGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGS L+IDLAKSNSRSKR RTDD+R  S+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSKLYIDLAKSNSRSKRSRTDDERPSSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA----  726
                  +S GVG+IH+PGMG+SAYN +GYP   S  +F+ RA++E    N N S+A    
Sbjct  176  YSRGTPDSAGVGSIHVPGMGNSAYNMIGYP---SAPSFNDRAVHETIAPNMNNSSAQHFP  232

Query  727  ---PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
                PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQST GAPVAFVDF+DTACS  A
Sbjct  233  QNNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTCGAPVAFVDFQDTACSTGA  292

Query  898  LSHLQGTMLYSS-PGEGMRLEY  960
            LS LQGT LYSS  GEGMRLEY
Sbjct  293  LSRLQGTFLYSSTTGEGMRLEY  314



>ref|XP_009372428.1| PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=334

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 206/263 (78%), Gaps = 16/263 (6%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY AP    P S+DE+RTLFIAGL EDVKPREIYNLFREFPGYESSHLR+P+  +QPFAF
Sbjct  57   SYVAPRIPQP-SYDELRTLFIAGLSEDVKPREIYNLFREFPGYESSHLRTPTGKSQPFAF  115

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
            AVF+DQQSA+ AM+ LNG+VFDLEKGS L+IDLAKSNSRSKR RTDD+R  S+KR +  +
Sbjct  116  AVFLDQQSAIGAMHALNGMVFDLEKGSKLYIDLAKSNSRSKRSRTDDERPSSDKRARSSS  175

Query  571  VISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG---NANKSAA----  726
                  +S GVG+IH+PGMG+SAYN +GYP   S  +F+ RA++E    N N S+A    
Sbjct  176  YSRGTPDSAGVGSIHVPGMGNSAYNMIGYP---SAPSFNDRAVHETIAPNMNNSSAQHFP  232

Query  727  ---PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
                PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQST GAPVAFVDF+DTACS  A
Sbjct  233  QNNTPCPTLFVANLGPTCTEQELIQVFSRCPGFIKLKMQSTCGAPVAFVDFQDTACSTGA  292

Query  898  LSHLQGTMLYSS-PGEGMRLEYP  963
            LS LQGT LYSS  GEGMRLE P
Sbjct  293  LSRLQGTFLYSSTTGEGMRLEIP  315



>ref|XP_007156776.1| hypothetical protein PHAVU_002G016600g [Phaseolus vulgaris]
 gb|ESW28770.1| hypothetical protein PHAVU_002G016600g [Phaseolus vulgaris]
Length=337

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/256 (67%), Positives = 202/256 (79%), Gaps = 13/256 (5%)
 Frame = +1

Query  232  TPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQ  411
            +P  S +EVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRSP++++QPFAFAVF  QQ
Sbjct  70   SPQPSTNEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSPTNSSQPFAFAVFASQQ  129

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
            SA+ AM+ +NG+VFDLEKGSTLFIDLAKSNSRSKR R DDDR G++K+ +         +
Sbjct  130  SAIMAMHAVNGMVFDLEKGSTLFIDLAKSNSRSKRSRIDDDRAGADKKARSVTSSWATPD  189

Query  592  SGVGNIHIPGMGSSAY--NTVGYPPTQSYANFDGRAMNEG---NANKSAAP-------PC  735
            SGV +IH+PGMG+ AY  NT GYP  QS  N DG AM++G   N  KS+ P       PC
Sbjct  190  SGVSSIHMPGMGNPAYNTNTFGYPSAQSLGNADGSAMSDGLYMNMKKSSTPYIPQNSTPC  249

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D + S EAL+ LQG
Sbjct  250  ATLFVANLGPSCNEQELMQVFSRYHGFLKLKMQSTYGAPVAFVDFQDASSSTEALNSLQG  309

Query  916  TMLYSS-PGEGMRLEY  960
            ++L+SS  GEGMRLEY
Sbjct  310  SILHSSQTGEGMRLEY  325



>ref|XP_004511897.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Cicer 
arietinum]
Length=326

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 203/255 (80%), Gaps = 13/255 (5%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P  S +EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP++++Q FAFAVFV+QQS
Sbjct  60   PLSSSNEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPNNSSQAFAFAVFVNQQS  119

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            A+ AM+ LNG+VFDLEKGSTL+IDLAKSNSR+KR R DD+R  S+K+ +G A      ES
Sbjct  120  AIMAMHALNGMVFDLEKGSTLYIDLAKSNSRAKRARIDDERASSDKKARGSAPSWATPES  179

Query  595  GVGNIHIPGMGSSAY--NTVGYPPTQSYANFDGRAMNEG---NANKSAAP-------PCP  738
            GV ++H+PGMG+ A+  NT+GYPP QS+ N DG A+N+    N  K + P       PC 
Sbjct  180  GVSSVHMPGMGNPAFNTNTIGYPPAQSHGNADGNAVNDNLFPNLKKCSTPYIPQNTTPCA  239

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D A S  AL+ LQGT
Sbjct  240  TLFVANLGPSCNEQELIQVFSRFPGFLKLKMQSTYGAPVAFVDFQDVASSTGALNSLQGT  299

Query  919  MLYSSP-GEGMRLEY  960
            +L+SSP  EGMRLEY
Sbjct  300  LLHSSPVDEGMRLEY  314



>ref|XP_003539345.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Glycine max]
Length=338

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 200/255 (78%), Gaps = 13/255 (5%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P  S  EVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRSPS+++QPFAFAVF  Q+S
Sbjct  71   PQSSTHEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSPSNSSQPFAFAVFASQKS  130

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            A+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G++K+ +G        +S
Sbjct  131  AILAMHALNGLVFDLEKGSTLYIDLAKSNSRSKRTRIDDERVGADKKARGLTPSWSTPDS  190

Query  595  GVGNIHIPGMGSSAY--NTVGYPPTQSYANFDGRAMNE---GNANKSAAP-------PCP  738
            GVG+IH+PGMG+ A+  NT GYP  QS  N DG AM++    N  KS+ P       PC 
Sbjct  191  GVGSIHMPGMGNPAFNTNTFGYPSAQSLGNADGSAMSDSLFANLKKSSTPYIPQNSTPCA  250

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQGT
Sbjct  251  TLFVANLGPSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQGT  310

Query  919  MLYSS-PGEGMRLEY  960
            +L+SS  GEGMRLEY
Sbjct  311  ILHSSQSGEGMRLEY  325



>ref|XP_003611682.1| RNA-binding protein with multiple splicing [Medicago truncatula]
 gb|AES94640.1| RNA recognition motif [Medicago truncatula]
Length=340

 Score =   332 bits (852),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 203/256 (79%), Gaps = 13/256 (5%)
 Frame = +1

Query  232  TPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQ  411
            +P  S ++VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP++++Q FAFAVF +QQ
Sbjct  73   SPLASTNDVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPNNSSQAFAFAVFSNQQ  132

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
            SA+ A++ LNG++FDLEKGSTL+IDLAKSNSR+KR R DDDR  S+K+ +G A      +
Sbjct  133  SAIMALHALNGMIFDLEKGSTLYIDLAKSNSRAKRARIDDDRASSDKKARGSASSWPTPD  192

Query  592  SGVGNIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG---NANKSAAP-------PC  735
            SGV +IH+PGMG+ A+NT  +GYPP QS+   DG AM++G   N  K + P       PC
Sbjct  193  SGVSSIHMPGMGNPAFNTNMIGYPPAQSHGIADGNAMHDGLFLNLKKCSNPYIPTNTTPC  252

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPV+FVDFKD   +  AL+ LQG
Sbjct  253  ATLFVANLGPSCNEQELIQVFSRFPGFLKLKMQSTYGAPVSFVDFKDIPSATVALNSLQG  312

Query  916  TMLYSSP-GEGMRLEY  960
            T+LYSSP GEGMRLEY
Sbjct  313  TILYSSPAGEGMRLEY  328



>ref|XP_010270670.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X3 [Nelumbo nucifera]
Length=335

 Score =   329 bits (844),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 202/264 (77%), Gaps = 14/264 (5%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY   L   PHS DEVRTLFIAGLP DVKPREIYNLFREFPGY+SS LRS + ++Q FAF
Sbjct  60   SYPPGLPPQPHSQDEVRTLFIAGLPGDVKPREIYNLFREFPGYQSSQLRSSTQSSQAFAF  119

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-EKRMKGP  567
            AVF DQQSA+AAM+ LNG+VFDLEK ST++IDLAKSNSRSKR RTDD + GS +K+++G 
Sbjct  120  AVFSDQQSALAAMHALNGLVFDLEKNSTVYIDLAKSNSRSKRSRTDDGQPGSFDKKVRGS  179

Query  568  AVISR-VIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGN---ANKSAAP-  729
               SR   + GVG NIH+PGM SS+YN +GYP TQS    D  A+N+ +    N ++ P 
Sbjct  180  TASSRGTSDFGVGSNIHMPGMSSSSYNMIGYPSTQSQGTSDSGAVNDMDPMKLNNASVPH  239

Query  730  ------PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSM  891
                  PCPTLFVANLG  CSEQEL QVFSRC GFLKLKMQ+ YGAPVAFVDF+D A S 
Sbjct  240  IPQNTAPCPTLFVANLGAACSEQELNQVFSRCPGFLKLKMQNKYGAPVAFVDFQDVASST  299

Query  892  EALSHLQGTMLYSS-PGEGMRLEY  960
             AL+HLQGT+LYSS  GEGMRLEY
Sbjct  300  AALNHLQGTVLYSSLDGEGMRLEY  323



>ref|XP_006590649.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Glycine max]
Length=339

 Score =   329 bits (844),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 171/256 (67%), Positives = 200/256 (78%), Gaps = 14/256 (5%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P  S  EVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRSPS+++QPFAFAVF  Q+S
Sbjct  71   PQSSTHEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSPSNSSQPFAFAVFASQKS  130

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRVIE  591
            A+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G++K+ +G     S    
Sbjct  131  AILAMHALNGLVFDLEKGSTLYIDLAKSNSRSKRTRIDDERVGADKKARGLTPSWSTPDS  190

Query  592  SGVGNIHIPGMGSSAY--NTVGYPPTQSYANFDGRAMNE---GNANKSAAP-------PC  735
            +GVG+IH+PGMG+ A+  NT GYP  QS  N DG AM++    N  KS+ P       PC
Sbjct  191  AGVGSIHMPGMGNPAFNTNTFGYPSAQSLGNADGSAMSDSLFANLKKSSTPYIPQNSTPC  250

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQG
Sbjct  251  ATLFVANLGPSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQG  310

Query  916  TMLYSS-PGEGMRLEY  960
            T+L+SS  GEGMRLEY
Sbjct  311  TILHSSQSGEGMRLEY  326



>gb|KEH27520.1| RNA recognition motif [Medicago truncatula]
Length=341

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 203/257 (79%), Gaps = 14/257 (5%)
 Frame = +1

Query  232  TPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQ  411
            +P  S ++VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP++++Q FAFAVF +QQ
Sbjct  73   SPLASTNDVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPNNSSQAFAFAVFSNQQ  132

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
            SA+ A++ LNG++FDLEKGSTL+IDLAKSNSR+KR R DDDR  S+K+ +G A      +
Sbjct  133  SAIMALHALNGMIFDLEKGSTLYIDLAKSNSRAKRARIDDDRASSDKKARGSASSWPTPD  192

Query  592  S-GVGNIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG---NANKSAAP-------P  732
            S GV +IH+PGMG+ A+NT  +GYPP QS+   DG AM++G   N  K + P       P
Sbjct  193  SAGVSSIHMPGMGNPAFNTNMIGYPPAQSHGIADGNAMHDGLFLNLKKCSNPYIPTNTTP  252

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPV+FVDFKD   +  AL+ LQ
Sbjct  253  CATLFVANLGPSCNEQELIQVFSRFPGFLKLKMQSTYGAPVSFVDFKDIPSATVALNSLQ  312

Query  913  GTMLYSSP-GEGMRLEY  960
            GT+LYSSP GEGMRLEY
Sbjct  313  GTILYSSPAGEGMRLEY  329



>gb|EPS61714.1| hypothetical protein M569_13079, partial [Genlisea aurea]
Length=304

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 203/300 (68%), Gaps = 49/300 (16%)
 Frame = +1

Query  244   SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP-SSNTQPFAFAVFVDQQSAV  420
             S D VRTLF+AGLPEDVKPREIYNLFREFPGY SS+LR P SSN+QPFAFA F DQ SA+
Sbjct  50    SQDHVRTLFVAGLPEDVKPREIYNLFREFPGYMSSNLRPPGSSNSQPFAFATFSDQPSAI  109

Query  421   AAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRVIESG  597
              AM+ LNG+VFDLE GSTL+I+LAKSNSRSKR RTDDD   SEKR KG  A  SR   SG
Sbjct  110   LAMHSLNGLVFDLETGSTLYINLAKSNSRSKRSRTDDDNQDSEKRFKGESASFSRGFGSG  169

Query  598   VGNI-HIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCS  774
                  HI G+GSS +NT+GYP  Q Y  FDG     G+ +KS  P CPTLFVANLGP CS
Sbjct  170   KSYFTHITGLGSSVHNTIGYPSPQRYETFDGSVHVSGSNSKSGGP-CPTLFVANLGPMCS  228

Query  775   EQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS-SPGEGMR  951
             E+EL QVFSRCRGFLKLK+QSTYGAPVAFVDFKD+ CS EAL +LQG ++YS +  +G+R
Sbjct  229   EEELMQVFSRCRGFLKLKLQSTYGAPVAFVDFKDSGCSSEALRNLQGVVVYSATTHQGLR  288

Query  952   LEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGMRSKKSR  1131
             LE                                            YAKSRMG+RSK+SR
Sbjct  289   LE--------------------------------------------YAKSRMGLRSKRSR  304



>ref|XP_010547796.1| PREDICTED: uncharacterized protein LOC104819403 [Tarenaya hassleriana]
Length=297

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 196/252 (78%), Gaps = 11/252 (4%)
 Frame = +1

Query  223  PLYTPPH-SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            P Y+ PH S DEVRTLF+AGLPEDVKPREIYNLFR+FPGYESSHLRS   +++PFAFAVF
Sbjct  39   PTYSHPHASGDEVRTLFVAGLPEDVKPREIYNLFRDFPGYESSHLRSSDKDSKPFAFAVF  98

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVIS  579
             D QSAVAAM+ LNG+VFDLEK S L IDLAKSN RSKR RTDD      + +K    +S
Sbjct  99   SDLQSAVAAMHALNGMVFDLEKHSILHIDLAKSNPRSKRTRTDD----GWENLKKTKSLS  154

Query  580  RVIESGVG--NIHIPGMGSSAYNTVGYPPTQSYANFD--GRAMNEGNANKSAAPPCPTLF  747
               + G+G  +IH PGM SSAY+T+GYPP  S+   D  G AM  G +N SAA PCPTLF
Sbjct  155  AATDFGLGSTSIHSPGMSSSAYDTIGYPPAPSHGIVDTPGGAMATGKSNNSAA-PCPTLF  213

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANLGP+C+E EL QVFSRCRGFLKLKMQ TYG PVAFVDF+D + S EAL +LQGT+LY
Sbjct  214  VANLGPSCTESELVQVFSRCRGFLKLKMQDTYGTPVAFVDFQDVSYSAEALHNLQGTVLY  273

Query  928  SSP-GEGMRLEY  960
            SSP GEG+RL+Y
Sbjct  274  SSPTGEGLRLQY  285



>gb|KHN36249.1| RNA-binding protein with multiple splicing 2 [Glycine soja]
Length=281

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 195/252 (77%), Gaps = 13/252 (5%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S  EVRTLF+AGLPEDVKPREIYNLFREFP YESSHLRSPS+++QPFAFAVF  QQSA+ 
Sbjct  17   STHEVRTLFVAGLPEDVKPREIYNLFREFPDYESSHLRSPSNSSQPFAFAVFASQQSAIM  76

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG  603
            A + LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G++K+ +G        +SGVG
Sbjct  77   AKHALNGLVFDLEKGSTLYIDLAKSNSRSKRTRIDDERAGADKKARGLTPSWATPDSGVG  136

Query  604  NIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG---NANKSAAP-------PCPTLF  747
            +IH+PGMG+ A+NT   GYP  QS  N DG  M+ G   N  KS+ P       PC TLF
Sbjct  137  SIHMPGMGNPAFNTNMFGYPSAQSLGNADGSTMSGGLFANLKKSSTPYVPQNSTPCATLF  196

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANLG +C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQGT+L+
Sbjct  197  VANLGSSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQGTILH  256

Query  928  SS-PGEGMRLEY  960
            SS  GEGMR+EY
Sbjct  257  SSQSGEGMRVEY  268



>ref|XP_010270662.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Nelumbo 
nucifera]
Length=342

 Score =   327 bits (838),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 175/271 (65%), Positives = 202/271 (75%), Gaps = 21/271 (8%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY   L   PHS DEVRTLFIAGLP DVKPREIYNLFREFPGY+SS LRS + ++Q FAF
Sbjct  60   SYPPGLPPQPHSQDEVRTLFIAGLPGDVKPREIYNLFREFPGYQSSQLRSSTQSSQAFAF  119

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-EKRMKGP  567
            AVF DQQSA+AAM+ LNG+VFDLEK ST++IDLAKSNSRSKR RTDD + GS +K+++G 
Sbjct  120  AVFSDQQSALAAMHALNGLVFDLEKNSTVYIDLAKSNSRSKRSRTDDGQPGSFDKKVRGS  179

Query  568  AVISR-VIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGN----------A  711
               SR   + GVG NIH+PGM SS+YN +GYP TQS    D  A+N+ +           
Sbjct  180  TASSRGTSDFGVGSNIHMPGMSSSSYNMIGYPSTQSQGTSDSGAVNDMDPMKLELSYIWQ  239

Query  712  NKSAAP-------PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDF  870
            N ++ P       PCPTLFVANLG  CSEQEL QVFSRC GFLKLKMQ+ YGAPVAFVDF
Sbjct  240  NNASVPHIPQNTAPCPTLFVANLGAACSEQELNQVFSRCPGFLKLKMQNKYGAPVAFVDF  299

Query  871  KDTACSMEALSHLQGTMLYSS-PGEGMRLEY  960
            +D A S  AL+HLQGT+LYSS  GEGMRLEY
Sbjct  300  QDVASSTAALNHLQGTVLYSSLDGEGMRLEY  330



>ref|XP_006590650.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X3 [Glycine max]
Length=338

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 201/255 (79%), Gaps = 13/255 (5%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P  S  EVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRSPS+++QPFAFAVF  Q+S
Sbjct  71   PQSSTHEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSPSNSSQPFAFAVFASQKS  130

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISRVIE  591
            A+ AM+ LNG+VFDLEKGSTL+IDLAKSNSRSKR R DD+R G++K+ +G     S    
Sbjct  131  AILAMHALNGLVFDLEKGSTLYIDLAKSNSRSKRTRIDDERVGADKKARGLTPSWSTPDS  190

Query  592  SGVGNIHIPGMGSSAY--NTVGYPPTQSYANFDGRAMNEGN-AN-KSAAP-------PCP  738
            +GVG+IH+PGMG+ A+  NT GYP  QS  N DG AM++   AN KS+ P       PC 
Sbjct  191  AGVGSIHMPGMGNPAFNTNTFGYPSAQSLGNADGSAMSDSLFANLKSSTPYIPQNSTPCA  250

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLFVANLGP+C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQGT
Sbjct  251  TLFVANLGPSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQGT  310

Query  919  MLYSS-PGEGMRLEY  960
            +L+SS  GEGMRLEY
Sbjct  311  ILHSSQSGEGMRLEY  325



>ref|XP_010508600.1| PREDICTED: uncharacterized protein LOC104785148 isoform X2 [Camelina 
sativa]
Length=292

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/255 (67%), Positives = 193/255 (76%), Gaps = 13/255 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H      DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPAHVSIGGRDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL+IDLAKSN +SKR RTDD   G E  +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLYIDLAKSNPKSKRSRTDD---GWES-LKK  146

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
            P  +S   ESG G+ H PGM SSAYNT+GY   QS   AN  GRA   G +N + A PCP
Sbjct  147  PKSLSTTTESGFGSFHTPGMSSSAYNTIGYSHAQSQGIANVAGRAPTTGKSN-NVADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GEG+RL+Y
Sbjct  266  VLYSSLTGEGLRLQY  280



>ref|XP_010517741.1| PREDICTED: uncharacterized protein LOC104793145 [Camelina sativa]
Length=292

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 194/255 (76%), Gaps = 13/255 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPAHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL+IDLAKSN +SKR RTDD   G E  +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLYIDLAKSNPKSKRSRTDD---GWES-LKK  146

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
            P  +S   ESG G+ H PGM SSAYNT+GY   QS   AN  GRA   G +N + A PCP
Sbjct  147  PKSLSTTTESGFGSFHTPGMSSSAYNTIGYSHAQSQGIANVAGRAPTTGKSN-NVADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GEG+R++Y
Sbjct  266  VLYSSLTGEGLRVQY  280



>ref|XP_010315981.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X3 
[Solanum lycopersicum]
Length=288

 Score =   322 bits (826),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 200/301 (66%), Gaps = 68/301 (23%)
 Frame = +1

Query  235   PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRS-PSSNTQPFAFAVFVDQQ  411
             P  SHD+VRTLFIAGLPEDVKPREIYNLFREF GYESSHLRS  SSN+Q           
Sbjct  54    PQDSHDDVRTLFIAGLPEDVKPREIYNLFREFAGYESSHLRSQTSSNSQ-----------  102

Query  412   SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
                       G+VFD EK S L+I+LAKSNSRSKR R DD R  SEKR+KG A ISR   
Sbjct  103   ----------GMVFDFEKDSKLYIELAKSNSRSKRLRPDDGRSVSEKRIKGSAAISRDSG  152

Query  592   S-GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPN  768
             S G G+IH+PGMG+SAYNT+GYPPTQS   FDGR  N+  A+K AA PCPTLF+ANLG +
Sbjct  153   SAGFGSIHMPGMGNSAYNTIGYPPTQSLGKFDGRVGNQA-ASKKAADPCPTLFIANLGQS  211

Query  769   CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
             C+EQEL QVFSR RGFLKLKMQSTYGAPVAFVDF+DTA S EALSHLQGT+L+SS G GM
Sbjct  212   CTEQELIQVFSRFRGFLKLKMQSTYGAPVAFVDFQDTASSTEALSHLQGTILHSSSGVGM  271

Query  949   RLEYPMLAF*ADN*LTFPRPLGPSLKPPISSFMFYVSFLVFP*HKLRYAKSRMGMRSKKS  1128
             +LE                                            YAKSRMG+RSKKS
Sbjct  272   QLE--------------------------------------------YAKSRMGLRSKKS  287

Query  1129  R  1131
             R
Sbjct  288   R  288



>ref|XP_010506036.1| PREDICTED: uncharacterized protein LOC104782722 isoform X2 [Camelina 
sativa]
Length=292

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 192/255 (75%), Gaps = 13/255 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H      DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPAHVSIGGRDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFD EK STL+IDLAKSN +SKR RTDD   G E  +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDREKHSTLYIDLAKSNPKSKRSRTDD---GWES-LKK  146

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
            P  +S   ESG G+ H PGM SSAYNT+GY   QS   AN  GRA   G +N + A PCP
Sbjct  147  PKSLSTTTESGFGSFHTPGMSSSAYNTIGYSHAQSQGIANVAGRAPTTGKSN-NVADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GEG+RL+Y
Sbjct  266  VLYSSLTGEGLRLQY  280



>ref|XP_006425958.1| hypothetical protein CICLE_v10026071mg [Citrus clementina]
 gb|ESR39198.1| hypothetical protein CICLE_v10026071mg [Citrus clementina]
Length=326

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 190/239 (79%), Gaps = 14/239 (6%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S+DEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS + N+QPFAFAVF DQQSA+ 
Sbjct  60   SYDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSSTQNSQPFAFAVFSDQQSALG  119

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR-VIESGV  600
            AMY LNG+VFDLEKGSTL+IDLAKSNSRSKR RTDD+  GS+K+ +GP+  SR   + G+
Sbjct  120  AMYALNGMVFDLEKGSTLYIDLAKSNSRSKRSRTDDEWTGSDKKARGPSAFSRGTADLGI  179

Query  601  GNIHIPGMGSSAYNTVGYPPTQSYANFDGRA---MNEGNANKSAAP-------PCPTLFV  750
            G++H+PGMG+SA+NT+GYP TQS+ NFD R    +     N S+AP       PC TLFV
Sbjct  180  GSVHMPGMGNSAFNTIGYPHTQSHENFDARGGSLITTAKFNNSSAPSGPKNVTPCATLFV  239

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            ANLGP C+EQELTQVFS+C GFLKLK+QSTYG PVAFVDF+ T      + H+  ++L+
Sbjct  240  ANLGPTCTEQELTQVFSKCPGFLKLKIQSTYGPPVAFVDFQVTCV---CVCHILFSLLF  295



>ref|XP_002879975.1| hypothetical protein ARALYDRAFT_903572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56234.1| hypothetical protein ARALYDRAFT_903572 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 193/257 (75%), Gaps = 13/257 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  ++ P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  30   AHSVFLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  88

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAV  M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD   G E  +K 
Sbjct  89   AFAVFSDLQSAVTVMHALNGMVFDLEKYSTLHIDLAKSNPKSKRSRTDD---GWES-LKK  144

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
            P   S   ESG G+ H PGM SS YNT+GY P QS   AN  GRA   GN++K AA PCP
Sbjct  145  PKPWSTTTESGFGSFHTPGMSSSTYNTIGYSPAQSQGIANVAGRAPTTGNSSK-AADPCP  203

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  204  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  263

Query  919  MLYSS-PGEGMRLEYPM  966
            +LYSS  GEG+RL+  M
Sbjct  264  VLYSSLTGEGLRLQSRM  280



>ref|XP_003516604.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Glycine max]
Length=332

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 194/252 (77%), Gaps = 13/252 (5%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S  EVRTLF+AGLPEDVKPREIYNLFREFP YESSHLRSPS+++QPFAFAVF  QQSA+ 
Sbjct  68   STHEVRTLFVAGLPEDVKPREIYNLFREFPDYESSHLRSPSNSSQPFAFAVFASQQSAIM  127

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG  603
            A + LNG+VFDLEKGS L+IDLAKSNSRSKR R DD+R G++K+ +G        +SGVG
Sbjct  128  AKHALNGLVFDLEKGSILYIDLAKSNSRSKRTRIDDERAGADKKARGLTPSWATPDSGVG  187

Query  604  NIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG---NANKSAAP-------PCPTLF  747
            +IH+PGMG+ A+NT   GYP  QS  N DG  M+ G   N  KS+ P       PC TLF
Sbjct  188  SIHMPGMGNPAFNTNMFGYPSAQSLGNADGSTMSGGLFANLKKSSTPYVPQNSTPCATLF  247

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            VANLG +C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQGT+L+
Sbjct  248  VANLGSSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQGTILH  307

Query  928  SS-PGEGMRLEY  960
            SS  GEGMR+EY
Sbjct  308  SSQSGEGMRVEY  319



>ref|XP_006293501.1| hypothetical protein CARUB_v10023763mg [Capsella rubella]
 gb|EOA26399.1| hypothetical protein CARUB_v10023763mg [Capsella rubella]
Length=293

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 189/255 (74%), Gaps = 12/255 (5%)
 Frame = +1

Query  217  AAPLYTPPHS----HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H+     DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPTHASIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLE  STL IDLAKSN +SKR RTDD      + +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLENHSTLHIDLAKSNPKSKRTRTDD----GWQSLKK  146

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
            P       ESG G+ H PGM SSAYNT+GY  TQS   AN   RA   G +N + A PCP
Sbjct  147  PKSWRTTTESGFGSFHTPGMSSSAYNTIGYSHTQSQGIANVVRRAPTTGKSNTNVADPCP  206

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  207  TLFLANMGPNCTEAELVQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQGT  266

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GEG+RL+Y
Sbjct  267  VLYSSLTGEGLRLQY  281



>ref|XP_010270653.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Nelumbo 
nucifera]
Length=352

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 202/281 (72%), Gaps = 31/281 (11%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            SY   L   PHS DEVRTLFIAGLP DVKPREIYNLFREFPGY+SS LRS + ++Q FAF
Sbjct  60   SYPPGLPPQPHSQDEVRTLFIAGLPGDVKPREIYNLFREFPGYQSSQLRSSTQSSQAFAF  119

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-EKRMKGP  567
            AVF DQQSA+AAM+ LNG+VFDLEK ST++IDLAKSNSRSKR RTDD + GS +K+++G 
Sbjct  120  AVFSDQQSALAAMHALNGLVFDLEKNSTVYIDLAKSNSRSKRSRTDDGQPGSFDKKVRGS  179

Query  568  AVISR-VIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGN-----------  708
               SR   + GVG NIH+PGM SS+YN +GYP TQS    D  A+N+ +           
Sbjct  180  TASSRGTSDFGVGSNIHMPGMSSSSYNMIGYPSTQSQGTSDSGAVNDMDPMKLIYFAYSC  239

Query  709  ---------ANKSAAP-------PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQST  840
                      N ++ P       PCPTLFVANLG  CSEQEL QVFSRC GFLKLKMQ+ 
Sbjct  240  IFKELSYIWQNNASVPHIPQNTAPCPTLFVANLGAACSEQELNQVFSRCPGFLKLKMQNK  299

Query  841  YGAPVAFVDFKDTACSMEALSHLQGTMLYSS-PGEGMRLEY  960
            YGAPVAFVDF+D A S  AL+HLQGT+LYSS  GEGMRLEY
Sbjct  300  YGAPVAFVDFQDVASSTAALNHLQGTVLYSSLDGEGMRLEY  340



>ref|XP_010508599.1| PREDICTED: uncharacterized protein LOC104785148 isoform X1 [Camelina 
sativa]
Length=293

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 193/256 (75%), Gaps = 14/256 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H      DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPAHVSIGGRDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL+IDLAKSN +SKR RTDD   G E  +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLYIDLAKSNPKSKRSRTDD---GWES-LKK  146

Query  565  PAVISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPC  735
            P  +S   ES G G+ H PGM SSAYNT+GY   QS   AN  GRA   G +N + A PC
Sbjct  147  PKSLSTTTESAGFGSFHTPGMSSSAYNTIGYSHAQSQGIANVAGRAPTTGKSN-NVADPC  205

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQG
Sbjct  206  PTLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQG  265

Query  916  TMLYSS-PGEGMRLEY  960
            T+LYSS  GEG+RL+Y
Sbjct  266  TVLYSSLTGEGLRLQY  281



>gb|AAO37217.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAX55157.1| hypothetical protein At2g42245 [Arabidopsis thaliana]
Length=287

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 192/258 (74%), Gaps = 13/258 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  17   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  75

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD    S K++K 
Sbjct  76   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWE-SLKKLKS  134

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
                +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA      +K AA PCP
Sbjct  135  ---WNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRAPTSRKPSK-AADPCP  190

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  191  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  250

Query  919  MLYSS-PGEGMRLEYPML  969
            +LYSS  GE +RL+YP L
Sbjct  251  VLYSSLTGEVLRLQYPSL  268



>ref|XP_010506035.1| PREDICTED: uncharacterized protein LOC104782722 isoform X1 [Camelina 
sativa]
Length=293

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 192/256 (75%), Gaps = 14/256 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H      DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPAHVSIGGRDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFD EK STL+IDLAKSN +SKR RTDD   G E  +K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDREKHSTLYIDLAKSNPKSKRSRTDD---GWES-LKK  146

Query  565  PAVISRVIES-GVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPC  735
            P  +S   ES G G+ H PGM SSAYNT+GY   QS   AN  GRA   G +N + A PC
Sbjct  147  PKSLSTTTESAGFGSFHTPGMSSSAYNTIGYSHAQSQGIANVAGRAPTTGKSN-NVADPC  205

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQG
Sbjct  206  PTLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQG  265

Query  916  TMLYSS-PGEGMRLEY  960
            T+LYSS  GEG+RL+Y
Sbjct  266  TVLYSSLTGEGLRLQY  281



>ref|NP_001078040.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAF00572.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEC10094.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=302

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 192/258 (74%), Gaps = 13/258 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD    S K++K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWE-SLKKLKS  149

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
                +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA      +K AA PCP
Sbjct  150  ---WNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRAPTSRKPSK-AADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEYPML  969
            +LYSS  GE +RL+YP L
Sbjct  266  VLYSSLTGEVLRLQYPSL  283



>ref|XP_006573645.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X3 [Glycine max]
Length=333

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 194/253 (77%), Gaps = 14/253 (6%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S  EVRTLF+AGLPEDVKPREIYNLFREFP YESSHLRSPS+++QPFAFAVF  QQSA+ 
Sbjct  68   STHEVRTLFVAGLPEDVKPREIYNLFREFPDYESSHLRSPSNSSQPFAFAVFASQQSAIM  127

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES-GV  600
            A + LNG+VFDLEKGS L+IDLAKSNSRSKR R DD+R G++K+ +G        +S GV
Sbjct  128  AKHALNGLVFDLEKGSILYIDLAKSNSRSKRTRIDDERAGADKKARGLTPSWATPDSAGV  187

Query  601  GNIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG---NANKSAAP-------PCPTL  744
            G+IH+PGMG+ A+NT   GYP  QS  N DG  M+ G   N  KS+ P       PC TL
Sbjct  188  GSIHMPGMGNPAFNTNMFGYPSAQSLGNADGSTMSGGLFANLKKSSTPYVPQNSTPCATL  247

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLG +C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ LQGT+L
Sbjct  248  FVANLGSSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNSLQGTIL  307

Query  925  YSS-PGEGMRLEY  960
            +SS  GEGMR+EY
Sbjct  308  HSSQSGEGMRVEY  320



>gb|AAO37215.1| hypothetical protein [Arabidopsis thaliana]
Length=277

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 190/255 (75%), Gaps = 13/255 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  17   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  75

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD    S K++K 
Sbjct  76   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWE-SLKKLKS  134

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
                +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA      +K AA PCP
Sbjct  135  ---WNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRAPTSRKPSK-AADPCP  190

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  191  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  250

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GE +RL+Y
Sbjct  251  VLYSSLTGEVLRLQY  265



>ref|XP_006411485.1| hypothetical protein EUTSA_v10017030mg [Eutrema salsugineum]
 gb|ESQ52938.1| hypothetical protein EUTSA_v10017030mg [Eutrema salsugineum]
Length=290

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 189/250 (76%), Gaps = 11/250 (4%)
 Frame = +1

Query  226  LYTPPHSH--DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            +Y P H+   DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLR+ S   +PFAFAVF
Sbjct  35   VYLPTHASIGDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRT-SDGAKPFAFAVF  93

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVIS  579
             D QSAVA M+ LNG+VFDLEK STL+IDLAKSN +SKR RTDD   G E  +K     S
Sbjct  94   SDLQSAVAVMHALNGMVFDLEKHSTLYIDLAKSNPKSKRLRTDD---GWES-LKKTKSWS  149

Query  580  RVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCPTLFVA  753
               ESG G+ H PG  SSAYNT G  P QS   AN   R+   G +N +AA PCPTLF+A
Sbjct  150  ATPESGFGSFHTPGTSSSAYNTFGCSPAQSQGIANVAKRSTTTGKSN-NAAEPCPTLFIA  208

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            N+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT+LYSS
Sbjct  209  NMGPNCTESELVQVFSRCRGFLKLKIQGTYGTPVAFVDFQDISCSSEALHTLQGTVLYSS  268

Query  934  -PGEGMRLEY  960
              GEG+RL+Y
Sbjct  269  LTGEGLRLQY  278



>ref|NP_850366.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAD94469.1| putative RNA-binding protein [Arabidopsis thaliana]
 dbj|BAF01884.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEC10093.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=292

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 190/255 (75%), Gaps = 13/255 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD    S K++K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWE-SLKKLKS  149

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
                +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA      +K AA PCP
Sbjct  150  ---WNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRAPTSRKPSK-AADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEY  960
            +LYSS  GE +RL+Y
Sbjct  266  VLYSSLTGEVLRLQY  280



>ref|XP_010932032.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' [Elaeis guineensis]
Length=339

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 193/263 (73%), Gaps = 14/263 (5%)
 Frame = +1

Query  214  YAAPLYTPPH--SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFA  387
            Y  P   PP   S DEVRTLFIAGLP+DVKPREIYNLFREF GY+S  LR    ++Q +A
Sbjct  63   YGVPCSLPPQQPSRDEVRTLFIAGLPDDVKPREIYNLFREFSGYQSCQLRCTGQSSQAYA  122

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKG  564
            FAVF DQQSA+AAM+ LNG++FDLEK   L+IDLAKSNSR+KR R DD     S+KR++G
Sbjct  123  FAVFSDQQSALAAMHALNGMMFDLEKECALYIDLAKSNSRTKRSRQDDSVPCSSDKRVRG  182

Query  565  PAVISRVI-ESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANK-------  717
                SR   +SGVG NIH+PGMG+SAY+  GYP TQS+  +D   +N+ +  K       
Sbjct  183  SVGYSRGFPDSGVGSNIHMPGMGNSAYSLNGYPSTQSHTTYDYDPVNDTDPKKMNNSSTY  242

Query  718  --SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSM  891
                 PPCPTLFVANLGP CSEQELTQVFSRC GFLKLKMQ+  G PVAFVDF+D  CS 
Sbjct  243  VPQNNPPCPTLFVANLGPTCSEQELTQVFSRCPGFLKLKMQNKNGVPVAFVDFQDVNCST  302

Query  892  EALSHLQGTMLYSSPGEGMRLEY  960
             AL+HLQGT+LYSS GEGMRLEY
Sbjct  303  GALNHLQGTLLYSSVGEGMRLEY  325



>ref|XP_008778277.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Phoenix dactylifera]
Length=341

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 191/262 (73%), Gaps = 14/262 (5%)
 Frame = +1

Query  217  AAPLYTPPHS--HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
             AP   PP     DEVRTLFIAGLP+DVKPREIYNLFREF GY+S  LR    ++Q +AF
Sbjct  66   GAPCSLPPQQPPRDEVRTLFIAGLPDDVKPREIYNLFREFSGYQSCQLRCTGQSSQAYAF  125

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGP  567
             VF DQQSA+AAM+ LNG++FDLEK   L+IDLAKSNSR KR R DD   + S+KR KG 
Sbjct  126  VVFSDQQSALAAMHTLNGMMFDLEKECALYIDLAKSNSRMKRSRQDDSVPYSSDKRAKGS  185

Query  568  AVISRVI-ESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANK--------  717
               SR   +SGVG NIH+PGMG+SAY+  GYP TQS+ N+D   +N+ +  K        
Sbjct  186  VGYSRGFPDSGVGSNIHMPGMGNSAYSLNGYPSTQSHTNYDYDPVNDTDPKKMNNSSTYV  245

Query  718  -SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSME  894
                PPCPTLFVANLGP CSEQELTQVFSRC GFLKLKMQ+  G PVAFVDF+D  CS  
Sbjct  246  PQNNPPCPTLFVANLGPACSEQELTQVFSRCPGFLKLKMQNKNGVPVAFVDFQDANCSTG  305

Query  895  ALSHLQGTMLYSSPGEGMRLEY  960
            ALSHLQGT+LYSS GEGMRLEY
Sbjct  306  ALSHLQGTVLYSSVGEGMRLEY  327



>ref|NP_001118504.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEC10095.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=289

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 190/257 (74%), Gaps = 13/257 (5%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  32   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  90

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD    S K++K 
Sbjct  91   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWE-SLKKLKS  149

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCP  738
                +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA      +K AA PCP
Sbjct  150  ---WNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRAPTSRKPSK-AADPCP  205

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+AN+GPNC+E EL QVFSRCRGFLKLK+Q TYG PVAFVDF+D +CS EAL  LQGT
Sbjct  206  TLFIANMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGT  265

Query  919  MLYSS-PGEGMRLEYPM  966
            +LYSS  GE +RL+  M
Sbjct  266  VLYSSLTGEVLRLQSRM  282



>ref|XP_009420640.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=334

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 191/249 (77%), Gaps = 10/249 (4%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAV  420
            +S DEVRTLFIAG P+DVKPREIYNLFREFPGY+S+ LRS   ++Q +AFAVF DQQSA+
Sbjct  73   YSRDEVRTLFIAGFPDDVKPREIYNLFREFPGYQSAQLRSSGQSSQAYAFAVFTDQQSAL  132

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVI-ES  594
            AAM+ LNG++FDLE+ STL+IDLAKSNSRSKR RTDD   + S+KR++GP    R   +S
Sbjct  133  AAMHALNGLMFDLERESTLYIDLAKSNSRSKRSRTDDGVPYSSDKRVRGPGAYLRGFPDS  192

Query  595  GVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA------PPCPTLFVA  753
            G G NIH+ GM +SAY+  GYP TQS  NF G   +    N S+       PPCPTLFVA
Sbjct  193  GSGSNIHMSGMVNSAYSLSGYPSTQSQTNF-GYEADHNKLNNSSTYAPLSNPPCPTLFVA  251

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNCSEQEL QVFSRC GF+KLKMQ+  G PVAFVDF+D   S  AL+HLQGT+LYSS
Sbjct  252  NLGPNCSEQELAQVFSRCPGFIKLKMQNKNGLPVAFVDFQDVNSSTGALNHLQGTILYSS  311

Query  934  PGEGMRLEY  960
             GEGMRLEY
Sbjct  312  VGEGMRLEY  320



>ref|XP_009420639.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=335

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 188/250 (75%), Gaps = 11/250 (4%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAV  420
            +S DEVRTLFIAG P+DVKPREIYNLFREFPGY+S+ LRS   ++Q +AFAVF DQQSA+
Sbjct  73   YSRDEVRTLFIAGFPDDVKPREIYNLFREFPGYQSAQLRSSGQSSQAYAFAVFTDQQSAL  132

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESG  597
            AAM+ LNG++FDLE+ STL+IDLAKSNSRSKR RTDD   + S+KR++GP    R     
Sbjct  133  AAMHALNGLMFDLERESTLYIDLAKSNSRSKRSRTDDGVPYSSDKRVRGPGAYLRGFPDS  192

Query  598  VG---NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA------PPCPTLFV  750
             G   NIH+ GM +SAY+  GYP TQS  NF G   +    N S+       PPCPTLFV
Sbjct  193  AGSGSNIHMSGMVNSAYSLSGYPSTQSQTNF-GYEADHNKLNNSSTYAPLSNPPCPTLFV  251

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNCSEQEL QVFSRC GF+KLKMQ+  G PVAFVDF+D   S  AL+HLQGT+LYS
Sbjct  252  ANLGPNCSEQELAQVFSRCPGFIKLKMQNKNGLPVAFVDFQDVNSSTGALNHLQGTILYS  311

Query  931  SPGEGMRLEY  960
            S GEGMRLEY
Sbjct  312  SVGEGMRLEY  321



>ref|XP_008778276.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Phoenix dactylifera]
Length=348

 Score =   309 bits (792),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 166/269 (62%), Positives = 190/269 (71%), Gaps = 21/269 (8%)
 Frame = +1

Query  217  AAPLYTPPHS--HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
             AP   PP     DEVRTLFIAGLP+DVKPREIYNLFREF GY+S  LR    ++Q +AF
Sbjct  66   GAPCSLPPQQPPRDEVRTLFIAGLPDDVKPREIYNLFREFSGYQSCQLRCTGQSSQAYAF  125

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT--------DDDRHGS  546
             VF DQQSA+AAM+ LNG++FDLEK   L+IDLAKSNSR KR R         D   + S
Sbjct  126  VVFSDQQSALAAMHTLNGMMFDLEKECALYIDLAKSNSRMKRSRQGHNLVFSYDSVPYSS  185

Query  547  EKRMKGPAVISRVI-ESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANK-  717
            +KR KG    SR   +SGVG NIH+PGMG+SAY+  GYP TQS+ N+D   +N+ +  K 
Sbjct  186  DKRAKGSVGYSRGFPDSGVGSNIHMPGMGNSAYSLNGYPSTQSHTNYDYDPVNDTDPKKM  245

Query  718  --------SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFK  873
                       PPCPTLFVANLGP CSEQELTQVFSRC GFLKLKMQ+  G PVAFVDF+
Sbjct  246  NNSSTYVPQNNPPCPTLFVANLGPACSEQELTQVFSRCPGFLKLKMQNKNGVPVAFVDFQ  305

Query  874  DTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            D  CS  ALSHLQGT+LYSS GEGMRLEY
Sbjct  306  DANCSTGALSHLQGTVLYSSVGEGMRLEY  334



>ref|XP_010093507.1| RNA-binding protein with multiple splicing 2 [Morus notabilis]
 gb|EXB54173.1| RNA-binding protein with multiple splicing 2 [Morus notabilis]
Length=322

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 182/230 (79%), Gaps = 15/230 (7%)
 Frame = +1

Query  229  YTP----PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            YTP    P SHDEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRSP+  +QPFAFAV
Sbjct  57   YTPSLVAPCSHDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSPTQASQPFAFAV  116

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI  576
            F+DQQ A+AAM+ LNG+VFDLEKGSTL+IDLAK+NSRSKRQR+DD R G +KR K     
Sbjct  117  FLDQQYAIAAMHALNGMVFDLEKGSTLYIDLAKANSRSKRQRSDDGRFGLDKRSKRSPFS  176

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA---NKSAAP------  729
                +SGVG+ H+PGMG+SAYN +GYP   S  N + RA+NE  A   + S+AP      
Sbjct  177  RGPNDSGVGSTHMPGMGNSAYN-IGYPSAPSQGNLESRAVNETTALHLHNSSAPHLPQNN  235

Query  730  -PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKD  876
             PCPTLFVANLGP C+EQEL QVFSRC GF+KLKMQ TYG+PVAFVDF++
Sbjct  236  TPCPTLFVANLGPACTEQELIQVFSRCPGFIKLKMQGTYGSPVAFVDFQN  285



>ref|XP_009417190.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=322

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 185/256 (72%), Gaps = 9/256 (4%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            Y  P   P  S DEVRTLFIAGLP+DVKPREIYNLFREFPGY+S+ LR    ++Q +AF 
Sbjct  55   YGTPADHP--SRDEVRTLFIAGLPDDVKPREIYNLFREFPGYQSAQLRRSGQSSQAYAFT  112

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDD-RHGSEKRMKGPA  570
            VF DQQSA++AM  LNG++FDLE+ STL+IDLAKSNSR KR RTDD   +  +KR++G  
Sbjct  113  VFTDQQSALSAMRALNGLMFDLERESTLYIDLAKSNSRFKRSRTDDGVSYSYDKRVRGSV  172

Query  571  VISRVI-ESGVG-NIHIPGMGSSAYNTVGYPPTQSYANF----DGRAMNEGNANKSAAPP  732
              SR   +SG G +IH+PGM +SAY+   +P  QS  NF      + +N       + PP
Sbjct  173  AYSRGFSDSGAGSHIHMPGMVNSAYSLNDFPSAQSQTNFGYEAKHKMLNNSTYTPQSNPP  232

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            CPTLFVANLGP  SEQEL QVFSRC GFLKLKMQ+  G PVAFVDF+DT  S  A +HLQ
Sbjct  233  CPTLFVANLGPKSSEQELAQVFSRCPGFLKLKMQNKNGVPVAFVDFQDTGSSTGARNHLQ  292

Query  913  GTMLYSSPGEGMRLEY  960
            GT+LYSS GEGMRLEY
Sbjct  293  GTILYSSVGEGMRLEY  308



>ref|XP_009417189.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=323

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 182/257 (71%), Gaps = 10/257 (4%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            Y  P   P  S DEVRTLFIAGLP+DVKPREIYNLFREFPGY+S+ LR    ++Q +AF 
Sbjct  55   YGTPADHP--SRDEVRTLFIAGLPDDVKPREIYNLFREFPGYQSAQLRRSGQSSQAYAFT  112

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDD-RHGSEKRMKGPA  570
            VF DQQSA++AM  LNG++FDLE+ STL+IDLAKSNSR KR RTDD   +  +KR++G  
Sbjct  113  VFTDQQSALSAMRALNGLMFDLERESTLYIDLAKSNSRFKRSRTDDGVSYSYDKRVRGSV  172

Query  571  VISRVIESGVG---NIHIPGMGSSAYNTVGYPPTQSYANF----DGRAMNEGNANKSAAP  729
              SR      G   +IH+PGM +SAY+   +P  QS  NF      + +N       + P
Sbjct  173  AYSRGFSDSAGAGSHIHMPGMVNSAYSLNDFPSAQSQTNFGYEAKHKMLNNSTYTPQSNP  232

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PCPTLFVANLGP  SEQEL QVFSRC GFLKLKMQ+  G PVAFVDF+DT  S  A +HL
Sbjct  233  PCPTLFVANLGPKSSEQELAQVFSRCPGFLKLKMQNKNGVPVAFVDFQDTGSSTGARNHL  292

Query  910  QGTMLYSSPGEGMRLEY  960
            QGT+LYSS GEGMRLEY
Sbjct  293  QGTILYSSVGEGMRLEY  309



>emb|CDY22555.1| BnaC03g23650D [Brassica napus]
Length=331

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 202/335 (60%), Gaps = 71/335 (21%)
 Frame = +1

Query  223   PLYTPPHSHD-EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
             P+Y P  S   +VRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLR  S  ++PFAFAVF
Sbjct  35    PVYLPTQSSTGDVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLR-ISGGSKPFAFAVF  93

Query  400   VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSE-KRMKGPAVI  576
              D QSA+A M+ LNG+VFDLEK STL+IDLAKSN +SKR RT      S  + +K     
Sbjct  94    SDLQSALAVMHALNGMVFDLEKYSTLYIDLAKSNPKSKRSRTGKFWILSALESLKKTKPW  153

Query  577   SRVIES-GVGNIHIPGMGSSAYNTVGYPP-----------------------------TQ  666
             S   ES G G+ H PGM SSA+NT+G+ P                              Q
Sbjct  154   SNTAESAGFGSFHTPGMSSSAHNTIGFSPAQRAHFLVTWQCLDYVSLLHTLFHVICLEVQ  213

Query  667   SYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYG  846
               AN  GRAM+   +N +AA PCPTLF+ANLGPNC+E EL QVFSRCRGFLKLK+Q TYG
Sbjct  214   GVANVAGRAMSTPKSN-NAAEPCPTLFIANLGPNCTESELVQVFSRCRGFLKLKIQGTYG  272

Query  847   APVAFVDFKDTACSMEALSHLQGTMLYSS-PGEGMRLEYPMLAF*ADN*LTFPRPLGPSL  1023
               VAFVDF+D +CS EAL  LQGT+LYSS  G G+RL++ + +                 
Sbjct  273   THVAFVDFQDVSCSSEALHALQGTVLYSSLTGVGLRLQFNLTS-----------------  315

Query  1024  KPPISSFMFYVSFLVFP*HKLRYAKSRMGMRSKKS  1128
                                  RYA+SRMGMR K S
Sbjct  316   -------------------STRYARSRMGMRKKIS  331



>ref|XP_006657270.1| PREDICTED: protein couch potato-like [Oryza brachyantha]
Length=297

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 181/246 (74%), Gaps = 9/246 (4%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            PP   DE+RTLFIAGLP D K RE+YNLFR+FPGY SSHLRS   ++Q +AFA+F DQ S
Sbjct  43   PPR--DELRTLFIAGLPGDAKAREVYNLFRDFPGYVSSHLRSSGKSSQAYAFAIFADQPS  100

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDD-DRHGSEKRMKGPAVISRVIE  591
            A+AAM   NG++FDLE  STL +DLAKSNSRSKR RTDD   + SEK+ + P       E
Sbjct  101  ALAAMSATNGMIFDLENNSTLHVDLAKSNSRSKRSRTDDVPPYSSEKKARNPRGYP---E  157

Query  592  SGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCPTLFVANLG  762
            SG G NIH+ GMG+S+++  GYP  QSY NF+  A ++  +  +    PPCPTLFVANLG
Sbjct  158  SGAGSNIHMSGMGNSSHSLNGYPSAQSYTNFEPSAFSKDPSAFAPQNNPPCPTLFVANLG  217

Query  763  PNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGE  942
            P CSEQEL  VFS C GF+KLKMQ+ +GAPVAFVDFKD   S EA++ LQG +LYSS GE
Sbjct  218  PTCSEQELIDVFSSCAGFIKLKMQNKFGAPVAFVDFKDANSSTEAINRLQGVILYSSTGE  277

Query  943  GMRLEY  960
            G+RLEY
Sbjct  278  GVRLEY  283



>ref|XP_002437482.1| hypothetical protein SORBIDRAFT_10g027920 [Sorghum bicolor]
 gb|EER88849.1| hypothetical protein SORBIDRAFT_10g027920 [Sorghum bicolor]
Length=310

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 178/244 (73%), Gaps = 9/244 (4%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            + DE+RTLFIAGLP D KPRE+YNLFR+FPGY SSHLR+  S +Q +AFAVF DQQSA+ 
Sbjct  57   ARDELRTLFIAGLPADAKPREVYNLFRDFPGYVSSHLRTGKS-SQAYAFAVFADQQSALT  115

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESGV  600
            A+   NG+VFDLEK  +L +DLAKSNSRSKR R+DD   +  EKR + P       +SG 
Sbjct  116  ALSGTNGMVFDLEKNCSLHVDLAKSNSRSKRLRSDDTSPYSPEKRTRKPRGFP---DSGA  172

Query  601  G-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PPCPTLFVANLGPN  768
            G NI+I GMGSS+++  GYP  QSY + +  A    + +  A    PPCPTLFVANLGP 
Sbjct  173  GSNIYISGMGSSSHSLSGYPSAQSYTSLESSASLSKDPSTFAPQINPPCPTLFVANLGPA  232

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            CSEQEL  VFS C GF+KLKMQ+  GAPVAFVDFKD+  S EA++ LQG +LYSS GEGM
Sbjct  233  CSEQELIDVFSSCAGFVKLKMQNKLGAPVAFVDFKDSISSTEAINRLQGVILYSSLGEGM  292

Query  949  RLEY  960
            RLEY
Sbjct  293  RLEY  296



>gb|ACF83035.1| unknown [Zea mays]
 gb|AFW69181.1| hypothetical protein ZEAMMB73_553458 [Zea mays]
Length=306

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 177/244 (73%), Gaps = 9/244 (4%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            + DEVRTLFIAGLP D KPRE+YNLFR+FPGY SSHLR+  S +Q +AFAVF DQQSA+A
Sbjct  53   ARDEVRTLFIAGLPADAKPREVYNLFRDFPGYVSSHLRTGKS-SQAYAFAVFADQQSALA  111

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESGV  600
            A+   NG+VFDLEK  +L +DLAKSNSRSKR R+DD   +  EKR + P       +SG 
Sbjct  112  ALSATNGMVFDLEKNCSLHVDLAKSNSRSKRLRSDDTSPYSPEKRNRKPRGFP---DSGA  168

Query  601  G-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PPCPTLFVANLGPN  768
            G NI+I GMGS++++  GYP  QSY + +  A    + +  A    PPCPTLFVANL P 
Sbjct  169  GSNIYISGMGSTSHSLSGYPSAQSYTSLESSASLSKDPSTFAPQNNPPCPTLFVANLAPA  228

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            CSEQ+L  VFS C GF+KLKMQ+  GAPVAFVDFKD   S EA++ LQG +LYSS GEGM
Sbjct  229  CSEQQLIDVFSSCAGFVKLKMQNKLGAPVAFVDFKDAISSTEAINRLQGVILYSSSGEGM  288

Query  949  RLEY  960
            RLEY
Sbjct  289  RLEY  292



>ref|XP_006573644.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Glycine max]
Length=335

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 181/259 (70%), Gaps = 24/259 (9%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S  EVRTLF+AGLPEDVKPREIYNLFREFP YESSHLRSPS+++QPFAFAVF  QQSA+ 
Sbjct  68   STHEVRTLFVAGLPEDVKPREIYNLFREFPDYESSHLRSPSNSSQPFAFAVFASQQSAIM  127

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG  603
            A + LNG+VFDLEKGS L+IDLAKSNSRSKR R DD+R G++K+ +G        +SG  
Sbjct  128  AKHALNGLVFDLEKGSILYIDLAKSNSRSKRTRIDDERAGADKKARGLTPSWATPDSGT-  186

Query  604  NIHIPGMGSSAYNTVGYPPTQSY---------ANFDGRAMNEG---NANKSAAP------  729
               +  M S       +  ++ +          N DG  M+ G   N  KS+ P      
Sbjct  187  ---LLPMSSHCTCFALFGTSRCWQHSHARNGLGNADGSTMSGGLFANLKKSSTPYVPQNS  243

Query  730  -PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSH  906
             PC TLFVANLG +C+EQEL QVFSR  GFLKLKMQSTYGAPVAFVDF+D   S +AL+ 
Sbjct  244  TPCATLFVANLGSSCNEQELIQVFSRYPGFLKLKMQSTYGAPVAFVDFQDVGSSTDALNS  303

Query  907  LQGTMLYSS-PGEGMRLEY  960
            LQGT+L+SS  GEGMR+EY
Sbjct  304  LQGTILHSSQSGEGMRVEY  322



>ref|XP_004966276.1| PREDICTED: cell wall integrity protein scw1-like [Setaria italica]
Length=308

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 174/242 (72%), Gaps = 9/242 (4%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DE+RTLFIAGLP D KPRE+YNLFR+FPGY SSHLR+  S +Q +AFAVF DQ SA+AA+
Sbjct  56   DELRTLFIAGLPADAKPREVYNLFRDFPGYVSSHLRTGKS-SQAYAFAVFADQPSALAAL  114

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESGVG-  603
               NG+VFDLEK  +L +DLAKSNSRSKR R+DD   +  EKR + P       +SG G 
Sbjct  115  NATNGMVFDLEKNCSLHVDLAKSNSRSKRLRSDDASPYSPEKRTRKPMGFP---DSGAGS  171

Query  604  NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PPCPTLFVANLGPNCS  774
            NI+I GMG+S+++  GYP  QSY N +       + +  A    PPCPTLFVANLGP CS
Sbjct  172  NIYISGMGNSSHSLSGYPSAQSYTNLESSTSVRKDPSTFAPQNNPPCPTLFVANLGPACS  231

Query  775  EQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRL  954
            EQEL  VFS C GF+KLKMQ+  G PVAFVDF D   S EAL+ LQG +LYSSPGEG+RL
Sbjct  232  EQELIDVFSSCAGFVKLKMQNKLGNPVAFVDFMDANSSTEALNRLQGVILYSSPGEGIRL  291

Query  955  EY  960
            EY
Sbjct  292  EY  293



>ref|XP_006855227.1| hypothetical protein AMTR_s00051p00211030 [Amborella trichopoda]
 gb|ERN16694.1| hypothetical protein AMTR_s00051p00211030 [Amborella trichopoda]
Length=327

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 188/259 (73%), Gaps = 20/259 (8%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P +    S DEVRTLFIAGLP DVK REI+NLFR+FPG++S  L+S  ++ Q FAFAVF 
Sbjct  63   PFHLQSSSVDEVRTLFIAGLPGDVKLREIHNLFRDFPGFQSCQLKSSGNSNQAFAFAVFS  122

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-EKRMKGPAVIS  579
            DQQSAV+AM+ LNG+ FDLE  STL IDLAKSNSR+KR RTD+D  GS +K+++G A   
Sbjct  123  DQQSAVSAMHTLNGLEFDLEFESTLHIDLAKSNSRTKRSRTDNDGSGSFDKKVRGFATGL  182

Query  580  RV-IESGVGNIHIPGMGSSAYNTV-GYPPTQSYANFDGRAMNEGNANKS----AAPP---  732
            R  ++SG+G+       ++ YN + GY  TQS+ N DG  +++ N+  S    A PP   
Sbjct  183  RGPLDSGLGS-------NTLYNGMNGYSSTQSHGNLDGLGIHDLNSGISLGQPAIPPSAN  235

Query  733  ---CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
               CPTLFVANLGPNC+E EL QVFSR  GFLKLKMQ  +GAPVAFVDF+D+ CS +AL+
Sbjct  236  NNACPTLFVANLGPNCTEDELLQVFSRFPGFLKLKMQMKHGAPVAFVDFQDSTCSTQALN  295

Query  904  HLQGTMLYSSPGEGMRLEY  960
             LQG++LYSS  +GMRLEY
Sbjct  296  LLQGSILYSSGHKGMRLEY  314



>gb|ABK25922.1| unknown [Picea sitchensis]
Length=345

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 176/252 (70%), Gaps = 15/252 (6%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRTLFIAGLP+DVK REIYNLFREFPGY S  LR+    TQ +AF VF DQQSA+AAM
Sbjct  80   DEVRTLFIAGLPDDVKHREIYNLFREFPGYRSCQLRNSEGGTQVYAFTVFTDQQSALAAM  139

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDD-DRHGSEKRMKGPAVISRVI-ESGV-  600
            + LNG+ FD E  + L+IDLAKSNSRSKR RTDD   + S+KR++GP  +  V  ++GV 
Sbjct  140  HALNGMDFDPETRAVLYIDLAKSNSRSKRSRTDDGGSNSSDKRIRGPNSVPGVYPDAGVG  199

Query  601  GNIHIPGMGSSAY-NTVGYPPTQSYANFDGRAMNEG----NANKSAA-------PPCPTL  744
            G +H+PGM +S Y +T G+P TQS    +     +G       +S A       PPCPTL
Sbjct  200  GTVHMPGMANSGYSDTSGFPSTQSGGMMEASIFQDGVPGLTTGQSTAPTQPASNPPCPTL  259

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            FVANLGP CSE+ELTQVFSRC GFLKLKMQ     PVAFVDF++   S +AL+HLQ  ML
Sbjct  260  FVANLGPTCSEEELTQVFSRCPGFLKLKMQIIGELPVAFVDFQEITSSTQALNHLQNAML  319

Query  925  YSSPGEGMRLEY  960
             SS   GMRL+Y
Sbjct  320  LSSDRGGMRLQY  331



>gb|KHG27237.1| Cell wall integrity scw1 [Gossypium arboreum]
Length=233

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +1

Query  364  SSNTQPFAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHG  543
            S+N  PFAFAVF DQQSA+AAM  LNG+VFDLEKGSTLFID AKSNSRSK  RTD++  G
Sbjct  25   SANFPPFAFAVFSDQQSALAAMQALNGMVFDLEKGSTLFIDFAKSNSRSKHPRTDEEWTG  84

Query  544  SEKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSA  723
            S K+ +G +      +S  G++H+ GMG+SAY+ +GYPP QS  N D  A  E  A KS+
Sbjct  85   SNKKSRG-SFSRSTSDSCFGSVHVSGMGNSAYSMIGYPPAQSLGNVDANA--ESTAMKSS  141

Query  724  APPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
            A PCPTLFVANLG +C+E+EL QVFSRC GFLKLKMQSTYGAPVAFVDF+DTACS  A++
Sbjct  142  ASPCPTLFVANLGASCTEEELIQVFSRCSGFLKLKMQSTYGAPVAFVDFQDTACSTGAIN  201

Query  904  HLQGTMLYSSP-GEGMRLEY  960
             LQGT+LYSSP G+GMRLEY
Sbjct  202  SLQGTILYSSPAGDGMRLEY  221



>ref|XP_010227379.1| PREDICTED: LOW QUALITY PROTEIN: U2 small nuclear ribonucleoprotein 
B'' [Brachypodium distachyon]
Length=311

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 172/245 (70%), Gaps = 8/245 (3%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P   DE+RTLFIAGLP DVK RE+YNLFR+FPGY SSHLR+  S  Q +AFAVF DQQSA
Sbjct  59   PPPRDELRTLFIAGLPADVKAREVYNLFRDFPGYVSSHLRAGKS-AQAYAFAVFEDQQSA  117

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESG  597
            +AAM   NG+ FDLEK  ++ +DLAKSNSRSKR RTDD    SEK+ +    IS   +SG
Sbjct  118  LAAMSATNGMAFDLEKNCSIHVDLAKSNSRSKRPRTDDFSRSSEKKARNARGIS---DSG  174

Query  598  VG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PPCPTLFVANLGP  765
             G NIH+ GMG+S+++  GYP  QS  NF        + +  A    PPCPTLFVANL  
Sbjct  175  AGSNIHMSGMGNSSHSLNGYPSAQSCTNFGASTAFSKDPSIFAPQNNPPCPTLFVANLAE  234

Query  766  NCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEG  945
             CSE+ELT VFS   GF+KLKMQ+  GAPVAFVDF+D   S EAL+ LQG +L+SS  EG
Sbjct  235  TCSERELTDVFSSFAGFMKLKMQNKSGAPVAFVDFEDDYSSTEALNRLQGAILHSSTAEG  294

Query  946  MRLEY  960
            MRLEY
Sbjct  295  MRLEY  299



>dbj|BAJ89334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 178/257 (69%), Gaps = 17/257 (7%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            A PL  P    DE+RTLFIAGLP DVKPRE+YNLFR+FPGY SSH+RS  S  Q +AFAV
Sbjct  57   AEPLAPP---RDELRTLFIAGLPADVKPREVYNLFRDFPGYVSSHVRSGKS-AQSYAFAV  112

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRS---KRQRTD--DDRHGSEKRMK  561
            F DQ SA+AA+   NG+VFDLEK  ++ +DLAKSNSRS   KR R+D  D    + K+ +
Sbjct  113  FGDQPSALAAVSATNGLVFDLEKNCSIHVDLAKSNSRSTSSKRPRSDYEDFPKSTGKKAR  172

Query  562  GPAVISRVIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---P  729
             P       +SG G N H+ GMG+S+++  GYP  QSY +F   A    + +  A    P
Sbjct  173  SPRGRP---DSGAGSNNHMSGMGNSSHSLNGYP-AQSYTDFGSSAAFSKDPSMFAPQNNP  228

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PCPTLFVANLG   SE+ELT VFS C GF+KLKMQ+ +GAPVAFVDFKD   S EAL+ L
Sbjct  229  PCPTLFVANLGQTVSERELTDVFSGCEGFIKLKMQNKFGAPVAFVDFKDDHSSTEALNRL  288

Query  910  QGTMLYSSPGEGMRLEY  960
            QG +L+SS GEGMRLEY
Sbjct  289  QGAILHSSSGEGMRLEY  305



>gb|EEE66246.1| hypothetical protein OsJ_22424 [Oryza sativa Japonica Group]
Length=283

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            A PL  PP   DE+RTLFIAGLP D K RE+YNLFR+FPGY SSHLR+   ++Q +AFAV
Sbjct  59   AEPL--PPR--DELRTLFIAGLPGDAKAREVYNLFRDFPGYVSSHLRTSGKSSQAYAFAV  114

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDD-DRHGSEKRMKGPAV  573
            F DQ SA+AAM   NG +FDLE   TL +DLAKSNSRSKR RTDD   + SEK+ + P  
Sbjct  115  FADQPSALAAMSATNGRIFDLENNCTLHVDLAKSNSRSKRSRTDDVPSYSSEKKARNPRG  174

Query  574  ISRVIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCPTL  744
                 +SG G NIH+ GMG+S+++  GYP  QSY NF+  A ++  +  +    PPCPTL
Sbjct  175  FP---DSGAGSNIHMSGMGNSSHSLNGYPSAQSYTNFEPAAFSKDPSAFAPQNNPPCPTL  231

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFK  873
            FVANLGP CSEQEL  VFS C GF+K+KMQ+ +GAPVAFVDFK
Sbjct  232  FVANLGPTCSEQELIDVFSSCAGFIKVKMQNKFGAPVAFVDFK  274



>gb|EEC81209.1| hypothetical protein OsI_24241 [Oryza sativa Indica Group]
Length=283

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            A PL  PP   DE+RTLFIAGLP D K RE+YNLFR+FPGY SSHLR+   ++Q +AFAV
Sbjct  59   AEPL--PPR--DELRTLFIAGLPGDAKAREVYNLFRDFPGYVSSHLRTSGKSSQAYAFAV  114

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDD-DRHGSEKRMKGPAV  573
            F DQ SA+AAM   NG +FDLE   TL +DLAKSNSRSKR RTDD   + SEK+ + P  
Sbjct  115  FADQPSALAAMSATNGRIFDLENNCTLHVDLAKSNSRSKRSRTDDVPSYSSEKKARNPRG  174

Query  574  ISRVIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCPTL  744
                 +SG G NIH+ GMG+S+++  GYP  QSY NF+  A ++  +  +    PPCPTL
Sbjct  175  FP---DSGAGSNIHMSGMGNSSHSLNGYPSAQSYTNFEPAAFSKDPSAFAPQNNPPCPTL  231

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFK  873
            FVANLGP CSEQEL  VFS C GF+K+KMQ+ +GAPVAFVDFK
Sbjct  232  FVANLGPTCSEQELIDVFSSCAGFIKVKMQNKFGAPVAFVDFK  274



>ref|XP_007047348.1| RNA-binding family protein isoform 2, partial [Theobroma cacao]
 gb|EOX91505.1| RNA-binding family protein isoform 2, partial [Theobroma cacao]
Length=243

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 144/181 (80%), Gaps = 7/181 (4%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSS--NTQPFA  387
            Y+ P  +   SHD VRTLFIAGLPED+KPREIYNLFREFPGYESSHLR+P+S  N+QPFA
Sbjct  67   YSVPYVSACSSHDSVRTLFIAGLPEDIKPREIYNLFREFPGYESSHLRNPNSAQNSQPFA  126

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP  567
            FAVF DQQSA+AAM  LNG+VFDLEKGSTLFID AKSNSRSKR RTDD+  GS+K+ +G 
Sbjct  127  FAVFSDQQSAIAAMQALNGMVFDLEKGSTLFIDFAKSNSRSKRPRTDDEWTGSDKKSRG-  185

Query  568  AVISR-VIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTL  744
               SR   +SG G++H+PGMG+SA+N +GYPP QS  N D  A +E  A KS+A PCPTL
Sbjct  186  -SFSRPTTDSGFGSVHMPGMGNSAHNMIGYPPAQSSGNAD--ANSESTAMKSSASPCPTL  242

Query  745  F  747
            F
Sbjct  243  F  243



>ref|XP_009417191.1| PREDICTED: uncharacterized protein LOC103997629 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=277

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 155/250 (62%), Gaps = 42/250 (17%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            Y  P   P  S DEVRTLFIAGLP+DVKPREIYNLFREFPGY+S+ LR    ++Q +AF 
Sbjct  55   YGTPADHP--SRDEVRTLFIAGLPDDVKPREIYNLFREFPGYQSAQLRRSGQSSQAYAFT  112

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDD-RHGSEKRMKGPA  570
            VF DQQSA++AM  LNG++FDLE+ STL+IDLAKSNSR KR RTDD   +  +KR++G  
Sbjct  113  VFTDQQSALSAMRALNGLMFDLERESTLYIDLAKSNSRFKRSRTDDGVSYSYDKRVRGSV  172

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
              SR        I +  M  S                                       
Sbjct  173  AYSRGFSDSAKQILV--MKQS-------------------------------------IK  193

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            +NLGP  SEQEL QVFSRC GFLKLKMQ+  G PVAFVDF+DT  S  A +HLQGT+LYS
Sbjct  194  SNLGPKSSEQELAQVFSRCPGFLKLKMQNKNGVPVAFVDFQDTGSSTGARNHLQGTILYS  253

Query  931  SPGEGMRLEY  960
            S GEGMRLEY
Sbjct  254  SVGEGMRLEY  263



>gb|KDO79113.1| hypothetical protein CISIN_1g0206321mg, partial [Citrus sinensis]
Length=190

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 12/178 (7%)
 Frame = +1

Query  463  KGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR-VIESGVGNIHIPGMGSSAY  639
            KGSTL+IDLAKSNSRSKR RTDD+  GS+K+ +GP+  SR   + G+G++H+PGMG+SA+
Sbjct  1    KGSTLYIDLAKSNSRSKRSRTDDEWTGSDKKARGPSAFSRGTADLGIGSVHMPGMGNSAF  60

Query  640  NTVGYPPTQSYANFDGRA---MNEGNANKSAAP-------PCPTLFVANLGPNCSEQELT  789
            NT+GYP TQS+ NFD R    +     N S+AP       PC TLFVANLGP C+EQELT
Sbjct  61   NTIGYPHTQSHENFDARGGSLITTAKFNNSSAPSGPKNVTPCATLFVANLGPTCTEQELT  120

Query  790  QVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP-GEGMRLEY  960
            QVFS+C GFLKLK+QSTYG PVAFVDF+DT  S  AL++LQGT+LYSSP  +G+RLE+
Sbjct  121  QVFSKCPGFLKLKIQSTYGPPVAFVDFQDTVSSTAALNNLQGTILYSSPTSDGIRLEF  178



>gb|KEH27521.1| RNA recognition motif [Medicago truncatula]
Length=252

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  232  TPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQ  411
            +P  S ++VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSP++++Q FAFAVF +QQ
Sbjct  73   SPLASTNDVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPNNSSQAFAFAVFSNQQ  132

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIE  591
            SA+ A++ LNG++FDLEKGSTL+IDLAKSNSR+KR R DDDR  S+K+ +G A      +
Sbjct  133  SAIMALHALNGMIFDLEKGSTLYIDLAKSNSRAKRARIDDDRASSDKKARGSASSWPTPD  192

Query  592  SGVGNIHIPGMGSSAYNT--VGYPPTQSYANFDGRAMNEG  705
            SGV +IH+PGMG+ A+NT  +GYPP QS+   DG AM++G
Sbjct  193  SGVSSIHMPGMGNPAFNTNMIGYPPAQSHGIADGNAMHDG  232



>ref|XP_008778278.1| PREDICTED: RNA binding protein fox-1 homolog 3 isoform X3 [Phoenix 
dactylifera]
Length=288

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 146/260 (56%), Gaps = 63/260 (24%)
 Frame = +1

Query  217  AAPLYTPPHS--HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
             AP   PP     DEVRTLFIAGLP+DVKPREIYNLFREF GY+S  LR    ++Q +AF
Sbjct  66   GAPCSLPPQQPPRDEVRTLFIAGLPDDVKPREIYNLFREFSGYQSCQLRCTGQSSQAYAF  125

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT--------DDDRHGS  546
             VF DQQSA+AAM+ LNG++FDLEK   L+IDLAKSNSR KR R         D   + S
Sbjct  126  VVFSDQQSALAAMHTLNGMMFDLEKECALYIDLAKSNSRMKRSRQGHNLVFSYDSVPYSS  185

Query  547  EKRMKGPAVISRVI-ESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKS  720
            +KR KG    SR   +SGVG NIH+PGMG+SAY+  GYP TQS+ N+D   +N+ +  K 
Sbjct  186  DKRAKGSVGYSRGFPDSGVGSNIHMPGMGNSAYSLNGYPSTQSHTNYDYDPVNDTDPKK-  244

Query  721  AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
                                                               D  CS  AL
Sbjct  245  --------------------------------------------------MDANCSTGAL  254

Query  901  SHLQGTMLYSSPGEGMRLEY  960
            SHLQGT+LYSS GEGMRLEY
Sbjct  255  SHLQGTVLYSSVGEGMRLEY  274



>gb|AAO37216.1| hypothetical protein [Arabidopsis thaliana]
Length=204

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 118/165 (72%), Gaps = 11/165 (7%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREI NLFREFPGYE+SHLRS S   +PF
Sbjct  17   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIXNLFREFPGYETSHLRS-SDGAKPF  75

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RTDD   G E  +K 
Sbjct  76   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDD---GWES-LKK  131

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQS--YANFDGRA  693
            P   +   ESG G+   PGM SSAYNT+GY P QS   AN  GRA
Sbjct  132  PKSWNTTTESGFGSFQTPGMSSSAYNTIGYSPAQSQGIANVAGRA  176



>gb|KDO79114.1| hypothetical protein CISIN_1g0206321mg, partial [Citrus sinensis]
Length=194

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 14/166 (8%)
 Frame = +1

Query  463  KGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR-VIESGVGNIHIPGMGSSAY  639
            KGSTL+IDLAKSNSRSKR RTDD+  GS+K+ +GP+  SR   + G+G++H+PGMG+SA+
Sbjct  1    KGSTLYIDLAKSNSRSKRSRTDDEWTGSDKKARGPSAFSRGTADLGIGSVHMPGMGNSAF  60

Query  640  NTVGYPPTQSYANFDGRA---MNEGNANKSAAP-------PCPTLFVANLGPNCSEQELT  789
            NT+GYP TQS+ NFD R    +     N S+AP       PC TLFVANLGP C+EQELT
Sbjct  61   NTIGYPHTQSHENFDARGGSLITTAKFNNSSAPSGPKNVTPCATLFVANLGPTCTEQELT  120

Query  790  QVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            QVFS+C GFLKLK+QSTYG PVAFVDF+ T      + H+  ++L+
Sbjct  121  QVFSKCPGFLKLKIQSTYGPPVAFVDFQVTCV---CVCHILFSLLF  163



>gb|ABR17821.1| unknown [Picea sitchensis]
Length=302

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 153/246 (62%), Gaps = 8/246 (3%)
 Frame = +1

Query  241  HSHDE-VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            ++H E VRTLFI+GLPED+K REIYNLFR  PG+E+  L+      Q  AFAVF   Q A
Sbjct  29   NNHKERVRTLFISGLPEDIKHREIYNLFRRRPGFEACQLKYTGRGYQIVAFAVFSHHQLA  88

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-EKRMKGPAVISRVI-E  591
            +AA   LNG+ FD E G+TL I+LA++NSR KR  TDD  +G  +KR++GP  +  V  +
Sbjct  89   LAAKDVLNGLTFDPETGATLNIELARTNSRIKRSGTDDGGNGPYDKRIRGPFGVPGVFDD  148

Query  592  SGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRA--MNEGNANKSAAPPCPTLFVANLG  762
             GVG  + +P  GSS     G     S A  DG +    E        PPCPTLFVANLG
Sbjct  149  DGVGETVKMP--GSSNIVQSGGVVGGSLAGEDGNSGPTKEQAPGPGGNPPCPTLFVANLG  206

Query  763  PNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGE  942
            P C+E EL +V SR +GF  LK+Q+  G PVAFVDF+D   S EAL  LQ T+L SS   
Sbjct  207  PTCTEGELREVLSRFQGFKMLKLQTKGGMPVAFVDFEDVTSSAEALKQLQDTLLPSSDRG  266

Query  943  GMRLEY  960
            G+ LEY
Sbjct  267  GLHLEY  272



>ref|XP_007047349.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOX91506.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=233

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +1

Query  214  YAAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSS--NTQPFA  387
            Y+ P  +   SHD VRTLFIAGLPED+KPREIYNLFREFPGYESSHLR+P+S  N+QPFA
Sbjct  67   YSVPYVSACSSHDSVRTLFIAGLPEDIKPREIYNLFREFPGYESSHLRNPNSAQNSQPFA  126

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            FAVF DQQSA+AAM  LNG+VFDLEKGSTLFID AKSNSRSKR RTDD+  GS+K+ +G
Sbjct  127  FAVFSDQQSAIAAMQALNGMVFDLEKGSTLFIDFAKSNSRSKRPRTDDEWTGSDKKSRG  185



>ref|XP_006853785.1| hypothetical protein AMTR_s00056p00211180 [Amborella trichopoda]
 gb|ERN15252.1| hypothetical protein AMTR_s00056p00211180 [Amborella trichopoda]
Length=344

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 145/256 (57%), Gaps = 26/256 (10%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            ++++TLFI+GLP+DVK REI+NLFR   G+ES  L+      Q  AFA F D  +A+ AM
Sbjct  84   EQIKTLFISGLPDDVKAREIHNLFRRRYGFESCQLKYTGRGNQVVAFATFFDHHAAMMAM  143

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNI  609
              LNG VFD + G+TL I+LA+SNSR+KRQR  +     + R K    +S+  + G  + 
Sbjct  144  DALNGTVFDPQTGATLHIELARSNSRNKRQRGSEAYTIIDNREK----VSKGDQEGWSS-  198

Query  610  HIPGMGSSAYNTVGYPPTQSYANF----DGRAMNEGNANKSAA---------------PP  732
               G+G S   +   P T   +       G   ++ NA  S +               P 
Sbjct  199  --DGVGGSDEPSDSNPSTSKKSGLSSAQSGETADQINAQDSTSGAHNEQLGKPVAGETPL  256

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ANLGP C+ +EL  V S+ RGF  LKMQ+  G PVAF DF+D +CS EAL  LQ
Sbjct  257  CSTLFIANLGPTCNHEELNTVLSKYRGFEMLKMQTKGGMPVAFADFQDISCSTEALKDLQ  316

Query  913  GTMLYSSPGEGMRLEY  960
            G +L SS   GM +EY
Sbjct  317  GVLLLSSDRGGMHVEY  332



>ref|XP_003531623.1| PREDICTED: uncharacterized protein LOC100783764 [Glycine max]
Length=264

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 143/251 (57%), Gaps = 7/251 (3%)
 Frame = +1

Query  223  PLYTPPHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            P Y   + HDE   + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA
Sbjct  8    PFYL--YQHDEQSNINTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFA  65

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PA  570
             F + QSA+AA++ LNG+ FD + GS L I+LA+SNSR KR+         +KR KG P 
Sbjct  66   TFFNHQSAMAALHALNGVKFDPQTGSVLHIELARSNSRRKRKPGSGAYVVIDKRSKGEPD  125

Query  571  VISRVIESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLF  747
            +     E G  +   P   G +  +       ++    D     E +   S    C TLF
Sbjct  126  LQGSSSEDGDSDPDEPSDSGDNQGDLAIMTSDETAVGSDNAVSVEQHGKGSTGGLCSTLF  185

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E EL Q FS   GF  +KM+S  G PVAFVDF++T  + + +  LQG++L 
Sbjct  186  IANLGPNCTEDELKQAFSAYTGFNMVKMRSRGGMPVAFVDFEETHQAAKVMEELQGSLLP  245

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  246  SSDRGGMHIEY  256



>gb|KHN11295.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=259

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 143/251 (57%), Gaps = 7/251 (3%)
 Frame = +1

Query  223  PLYTPPHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            P Y   + HDE   + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA
Sbjct  8    PFYL--YQHDEQSNINTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFA  65

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PA  570
             F + QSA+AA++ LNG+ FD + GS L I+LA+SNSR KR+         +KR KG P 
Sbjct  66   TFFNHQSAMAALHALNGVKFDPQTGSVLHIELARSNSRRKRKPGSGAYVVIDKRSKGEPD  125

Query  571  VISRVIESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLF  747
            +     E G  +   P   G +  +       ++    D     E +   S    C TLF
Sbjct  126  LQGSSSEDGDSDPDEPSDSGDNQGDLAIMTSDETAVGSDNAVSVEQHGKGSTGGLCSTLF  185

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E EL Q FS   GF  +KM+S  G PVAFVDF++T  + + +  LQG++L 
Sbjct  186  IANLGPNCTEDELKQAFSAYTGFNMVKMRSRGGMPVAFVDFEETHQAAKVMEELQGSLLP  245

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  246  SSDRGGMHIEY  256



>gb|KDP40792.1| hypothetical protein JCGZ_24791 [Jatropha curcas]
Length=280

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/255 (41%), Positives = 141/255 (55%), Gaps = 31/255 (12%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVKPREI+NLFR  PG++S  L+      Q  AFA F + QSA+AAM+ 
Sbjct  29   INTLFVSGLPDDVKPREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAAMHS  88

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKR-----------QRTDDDRHGSE--------KRM  558
            LNG+ FD + GSTL I+LA+SNSR KR           +RT    +  E           
Sbjct  89   LNGVKFDPQTGSTLHIELARSNSRRKRKPGSGAYVVIDKRTQQTSNAQETSSDDGASDSD  148

Query  559  KGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMN-EGNANKSAAPPC  735
            + PA         VG+ +   + S      G P +   A ++    + EG  N     PC
Sbjct  149  EAPAA------GNVGSANQGDLVSLKSEAAGDPDSAVVAAYEQLEKSAEGGVN-----PC  197

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ANLGPNC+E EL Q  S+  GF  LKM++  G PVAF DF++   + + +  LQG
Sbjct  198  STLFIANLGPNCTEDELRQTLSQYPGFNVLKMRAKGGMPVAFADFEEIDQAKKTMEELQG  257

Query  916  TMLYSSPGEGMRLEY  960
            T+L SS   GM +EY
Sbjct  258  TLLPSSDRGGMHIEY  272



>ref|XP_009388581.1| PREDICTED: uncharacterized protein LOC103975361 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=319

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 139/248 (56%), Gaps = 5/248 (2%)
 Frame = +1

Query  226  LYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVD  405
            +Y+ P     ++TLF++GLP+DVKPREI+NLFR  PG++S  L       Q  AFA F +
Sbjct  66   VYSKPEQQ-RIKTLFVSGLPDDVKPREIHNLFRRRPGFDSCQLEYTGRGDQVVAFATFFN  124

Query  406  QQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRV  585
             QSA+AAM  L+G+VFD E G+TL I+LA+SNSR KR R        +KR+K       +
Sbjct  125  HQSAIAAMSSLDGVVFDPEIGATLHIELARSNSR-KRSRGVGAYTVIDKRVKVTNDDQEL  183

Query  586  IESGVGNIHIPGM--GSSAYNTVGYPPTQSYANFDGRAMNEGNANK-SAAPPCPTLFVAN  756
                 G    P      +  N       +S          +G  N  +  PPC TLF+AN
Sbjct  184  FSDDDGGSDEPSGTDNDNPSNKDALAAVKSEGTIVIPDGADGTFNDHTDIPPCSTLFIAN  243

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGP C+E+EL QV S+  GF  LKM+   G PVAF DF DT  S  A++ LQG +L SS 
Sbjct  244  LGPTCTEEELKQVLSKYSGFHMLKMRGRGGMPVAFADFTDTESSTAAMNGLQGILLESSD  303

Query  937  GEGMRLEY  960
              G+ +EY
Sbjct  304  RGGVHVEY  311



>ref|XP_004297607.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/248 (42%), Positives = 141/248 (57%), Gaps = 18/248 (7%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  25   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHA  84

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQ------RTDDDRHGSEKRMKGPAV---ISRVI  588
            LNG+ FD + GS L I+LA+SNSR KR+         D R   E   +G +     S   
Sbjct  85   LNGVKFDPQTGSLLHIELARSNSRRKRKPGGGAYVVIDKRSKKEDDNQGTSSDDGDSESE  144

Query  589  ESGVGNIHIPGMGSSAYNTVG----YPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVAN  756
            E+   + H  G  S   NT        P  S A     A+NE +   +    C TLF+AN
Sbjct  145  EASETDNHDSGEKSELANTKSTEAVLDPDNSIA-----AVNEQSEKHTDQGQCSTLFIAN  199

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGPNC+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+GTML SS 
Sbjct  200  LGPNCTEDELKQVLSQYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGTMLPSSD  259

Query  937  GEGMRLEY  960
              GM +EY
Sbjct  260  RGGMHIEY  267



>ref|XP_009388580.1| PREDICTED: protein WHI4 isoform X1 [Musa acuminata subsp. malaccensis]
Length=320

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 141/249 (57%), Gaps = 6/249 (2%)
 Frame = +1

Query  226  LYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVD  405
            +Y+ P     ++TLF++GLP+DVKPREI+NLFR  PG++S  L       Q  AFA F +
Sbjct  66   VYSKPEQQ-RIKTLFVSGLPDDVKPREIHNLFRRRPGFDSCQLEYTGRGDQVVAFATFFN  124

Query  406  QQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRV  585
             QSA+AAM  L+G+VFD E G+TL I+LA+SNSR KR R        +KR+K       +
Sbjct  125  HQSAIAAMSSLDGVVFDPEIGATLHIELARSNSR-KRSRGVGAYTVIDKRVKVTNDDQEL  183

Query  586  I-ESGVGNIHIPGM--GSSAYNTVGYPPTQSYANFDGRAMNEGNANK-SAAPPCPTLFVA  753
              + G G    P      +  N       +S          +G  N  +  PPC TLF+A
Sbjct  184  FSDDGDGGSDEPSGTDNDNPSNKDALAAVKSEGTIVIPDGADGTFNDHTDIPPCSTLFIA  243

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGP C+E+EL QV S+  GF  LKM+   G PVAF DF DT  S  A++ LQG +L SS
Sbjct  244  NLGPTCTEEELKQVLSKYSGFHMLKMRGRGGMPVAFADFTDTESSTAAMNGLQGILLESS  303

Query  934  PGEGMRLEY  960
               G+ +EY
Sbjct  304  DRGGVHVEY  312



>ref|NP_001242824.1| uncharacterized protein LOC100810989 [Glycine max]
 gb|ACU18677.1| unknown [Glycine max]
Length=265

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 140/247 (57%), Gaps = 2/247 (1%)
 Frame = +1

Query  226  LYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVD  405
            LY        + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F +
Sbjct  11   LYQQQDERSNINTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFATFFN  70

Query  406  QQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISR  582
             QSA+AA++ LNG+ FD + GS L I+LA+SNSR KR+   +     +KR  G P +   
Sbjct  71   HQSAMAALHALNGVKFDPQTGSVLHIELARSNSRRKRKPGGEACVVIDKRSTGEPDLQGS  130

Query  583  VIESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANL  759
              + G  +   P   G +  N       ++    D     E +   SA   C TLF+ANL
Sbjct  131  SSDDGDSDPDEPSDSGDNQGNIAIMTSDETAVGSDNAVSVEQHGKGSAGGLCSTLFIANL  190

Query  760  GPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPG  939
            GPNC+E EL Q FS   GF  +KM+S  G PVAFVDF++T  + + +  LQG++L SS  
Sbjct  191  GPNCTEDELKQAFSVYTGFNMVKMRSRGGMPVAFVDFEETDQAAKVVEELQGSLLPSSDR  250

Query  940  EGMRLEY  960
             GM +EY
Sbjct  251  GGMHIEY  257



>ref|XP_007024462.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY27084.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=271

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 138/255 (54%), Gaps = 19/255 (7%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P    + + TLF++GLP+DVK REI+NLFR   G++S  L+      Q  AFA F++ QS
Sbjct  15   PDQDRNLINTLFVSGLPDDVKAREIHNLFRRRAGFDSCQLKYTGRGNQVVAFATFLNHQS  74

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            A+AAM+ LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A        
Sbjct  75   AIAAMHALNGVKFDPQAGSVLHIELARSNSRRKRKPDSGPYVVIDKRTKASANTQETSSD  134

Query  595  GVGNIHIPGMGSSAYN-------------TVGYPPTQSYANFDGRAMNEGNANKSAAPPC  735
              G+      G+   N             T+  P     A    R ++EG      A PC
Sbjct  135  DGGSDTEEPSGTDDANSSNKGDLRTVKSETIVDPENAVAAANLERNVDEG------AQPC  188

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ANLGPNC+E EL QV SR  GF  LK+++  G PVAF DF+ T  +   ++ LQ 
Sbjct  189  STLFIANLGPNCTEDELKQVLSRYPGFNMLKIRAKGGMPVAFADFEQTEQATTVMTDLQS  248

Query  916  TMLYSSPGEGMRLEY  960
            ++L SS   GM +EY
Sbjct  249  SLLPSSDRGGMNIEY  263



>gb|AAB88654.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=158

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 100/154 (65%), Gaps = 29/154 (19%)
 Frame = +1

Query  217  AAPLYTPPH----SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPF  384
            A  +Y P H    + DEVRTLF+AGLPEDVKPREIYNLFREFPGYE+SHLRS S   +PF
Sbjct  17   AHSVYLPTHVSIGARDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLRS-SDGAKPF  75

Query  385  AFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG  564
            AFAVF D QSAVA M+ LNG+VFDLEK STL IDLAKSN +SKR RT             
Sbjct  76   AFAVFSDLQSAVAVMHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTGK-----------  124

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQ  666
                             PGM SSAYNT+GY P Q
Sbjct  125  -------------YFQTPGMSSSAYNTIGYSPAQ  145



>gb|KHN39295.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=261

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 140/247 (57%), Gaps = 2/247 (1%)
 Frame = +1

Query  226  LYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVD  405
            LY        + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F +
Sbjct  11   LYQQQDERSNINTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFATFFN  70

Query  406  QQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKG-PAVISR  582
             QSA+AA++ LNG+ FD + GS L I+LA+SNSR KR+   +     +KR  G P +   
Sbjct  71   HQSAMAALHALNGVKFDPQTGSVLHIELARSNSRRKRKPGGEAYVVIDKRSTGEPDLQGS  130

Query  583  VIESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANL  759
              + G  +   P   G +  +       ++    D     E +   SA   C TLF+ANL
Sbjct  131  SSDDGDSDPDEPSDSGDNQGDIAIMTSDETAVGSDNAVSVEQHGKGSAGGLCSTLFIANL  190

Query  760  GPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPG  939
            GPNC+E EL Q FS   GF  +KM+S  G PVAFVDF++T  + + +  LQG++L SS  
Sbjct  191  GPNCTEDELKQAFSVYTGFNMVKMRSRGGMPVAFVDFEETDQAAKVVEELQGSLLPSSDR  250

Query  940  EGMRLEY  960
             GM +EY
Sbjct  251  GGMHIEY  257



>ref|XP_002279868.1| PREDICTED: protein WHI4 [Vitis vinifera]
 emb|CBI35969.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 138/250 (55%), Gaps = 20/250 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVKPREI+NLFR  PG++S  L+      Q  AFA F + Q+AVAA++ 
Sbjct  20   INTLFVSGLPDDVKPREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQTAVAALHA  79

Query  436  LNGIVFDLEKGSTLFIDLAKSNSR-------------SKRQRTDDDRHGSEKRMKGPAVI  576
            LNG+ FD + GS L I+LA+SNSR              KR +T  + H +          
Sbjct  80   LNGVKFDPQTGSILHIELARSNSRRKRVPGSGAYVVIDKRSKTSTNAHETSSDDGDSESD  139

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA--PPCPTLFV  750
                 S   + +   + ++    +   P  +       A+NE     + A  PPC TLF+
Sbjct  140  EPAKTSNPDSGNNDDLVTAKSGEMAVDPDSTLT-----AVNEQPEKTTDAGLPPCSTLFI  194

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGP C+E EL QV S+  GF  LKM++  G PVAF DF++   + +A+  LQG+ML S
Sbjct  195  ANLGPTCTEDELKQVLSQYPGFNVLKMRAKGGMPVAFADFEEIEQANKAMDALQGSMLAS  254

Query  931  SPGEGMRLEY  960
            S   GM LEY
Sbjct  255  SDRGGMHLEY  264



>ref|XP_010062604.1| PREDICTED: protein WHI4 [Eucalyptus grandis]
 gb|KCW69741.1| hypothetical protein EUGRSUZ_F03123 [Eucalyptus grandis]
Length=286

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 142/250 (57%), Gaps = 21/250 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  35   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHA  94

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHGSEKRMKGPAV----ISRV  585
            LNG+ FD + GS+L I+LA+SNSR KR+         D+R       + P+      S  
Sbjct  95   LNGVKFDPQSGSSLHIELARSNSRRKRKPGSGPYVVIDNRSNEASDAREPSSNDDGDSES  154

Query  586  IESGVGNIHIPG-----MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
             +    + H  G       + +  T G   T +  N   + + +GN N     PC TLF+
Sbjct  155  EDPSKDDNHESGNEDDSETAKSGETTGADGTAAVENLSEKPV-DGNVN-----PCSTLFI  208

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E+ELTQ  S+  GF  +K++   G PVAF DF++   + +A+  LQG+ L S
Sbjct  209  ANLGPNCTEEELTQALSQYAGFKMVKIRGRSGMPVAFADFEEIEQASKAMEELQGSQLAS  268

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  269  SDRGGMNIEY  278



>ref|XP_011072492.1| PREDICTED: protein WHI4 [Sesamum indicum]
Length=276

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 131/248 (53%), Gaps = 21/248 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG+ES  L+      Q  AFA FV+ QSA+AA++ 
Sbjct  29   INTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGNQVVAFATFVNHQSAMAALHS  88

Query  436  LNGIVFDLEKGSTLFIDLAKSNSR-------------SKRQRTDDDRHGSEKRMKGPAVI  576
            LNG+ FD + GSTL I+LA+SNSR              KR + D+D   S          
Sbjct  89   LNGVKFDPQTGSTLHIELARSNSRRKHKPGSGPYVVIDKRTKADNDAKESSSDDGDSDYD  148

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVAN  756
                    GN        S   T            DG       A K     C TLF+AN
Sbjct  149  EPAGHHDAGNQDDSAADRSTDQTTNC--------NDGFTQENEQAEKRTDGACSTLFIAN  200

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGPNC+E+EL QV S+ +GF  LK+++  G PVAF DF+    + E ++ LQG+ L SS 
Sbjct  201  LGPNCTEEELKQVLSQYQGFNSLKVRARGGMPVAFADFERVEQATETMNALQGSTLPSSD  260

Query  937  GEGMRLEY  960
              GM +EY
Sbjct  261  RGGMHIEY  268



>ref|XP_010542440.1| PREDICTED: protein WHI3 [Tarenaya hassleriana]
Length=284

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 148/264 (56%), Gaps = 20/264 (8%)
 Frame = +1

Query  211  SYAAPLYTPPHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQP  381
            S+  P  + P   DE   + T+FI+GLP DVK REI+NLFR  PG++S  L+      Q 
Sbjct  19   SHHLPPPSLPQVSDEAGAISTVFISGLPHDVKAREIHNLFRRRPGFDSCQLKYTGRGNQV  78

Query  382  FAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-----  546
             AFA F + + A+AA+ ELNG+ FD + GSTL I+LAKSNSR K      DR GS     
Sbjct  79   VAFATFTNNRFAIAALNELNGVKFDPQTGSTLHIELAKSNSRRK------DRPGSGPYVV  132

Query  547  -EKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAM----NEGNA  711
             + R K  A           + +  G    + N      +++ ++ D +A      +   
Sbjct  133  IDNRNKKSARSQETPSDHGDSDNDEGGNDYSINETDIAKSEAGSDTDSKAQFVHEQQQYV  192

Query  712  NKS-AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACS  888
            N +  A PC TLF+ANLGPNC+E EL QV SR  GF  +KM+S  G PVAF DF++T  +
Sbjct  193  NSAGGAQPCSTLFIANLGPNCTEDELKQVLSRYPGFNAMKMRSRGGIPVAFADFEETEQA  252

Query  889  MEALSHLQGTMLYSSPGEGMRLEY  960
            +  ++ LQG++L SS   G+ +EY
Sbjct  253  VYVMNVLQGSLLTSSDRGGLHIEY  276



>ref|XP_011007087.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Populus euphratica]
Length=281

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 138/248 (56%), Gaps = 18/248 (7%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+N+FR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  31   INTLFVSGLPDDVKAREIHNIFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHS  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA----VISRVIES---  594
            LNG+ FD + GSTL I+LA+SNSR KR+         +KR K P+      S  +ES   
Sbjct  91   LNGVKFDPQSGSTLHIELARSNSRRKRKPGSGAYVVIDKRTKKPSDAHETSSDDVESDPE  150

Query  595  ------GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVAN  756
                   V   +  G  ++       P   + A   G    EG        PC TLF+AN
Sbjct  151  EDPEMNNVNTAYQGGSENAKSEATSDPDNAAVAVNIGERTAEGGVR-----PCSTLFIAN  205

Query  757  LGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSP  936
            LGPNC+E EL QV S+  GF  LK+++  G PVAF DF++   + + + +LQ T L SS 
Sbjct  206  LGPNCTEDELKQVLSQYPGFHVLKIRAKGGMPVAFADFEEIEQATKVMENLQETTLPSSD  265

Query  937  GEGMRLEY  960
              GM +EY
Sbjct  266  RGGMHIEY  273



>ref|XP_010262179.1| PREDICTED: protein WHI4 [Nelumbo nucifera]
Length=338

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 142/259 (55%), Gaps = 37/259 (14%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVKPREI+NLFR   G++   L+      Q  AFA FV+ QSA+ A++ 
Sbjct  85   INTLFVSGLPDDVKPREIHNLFRRRHGFDFCQLKYTGRGNQVVAFATFVNHQSAMTALHA  144

Query  436  LNGIVFDLEKGSTLFIDLAKSNSR-------------SKRQRTDDDRH---------GSE  549
            LNG+ FD + G+TL I+LA+SNSR              KR +T+ D           GS+
Sbjct  145  LNGVTFDPQSGATLHIELARSNSRRKHPPGSGAYVIIDKRLKTESDAQETWSNDGDGGSD  204

Query  550  KRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAP  729
            +    P+   +   S  G++     G S  +           N  G A+NE      A  
Sbjct  205  E----PSGTDKPNSSNKGDLATAESGESKVDP---------DNNAGAAVNELTEKLPAGE  251

Query  730  --PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
              PC TLF+ANLGPNC+E+EL Q  S+  GF  LKM++  G PVAF DF+D   + EA+ 
Sbjct  252  VQPCSTLFIANLGPNCTEEELKQALSQFTGFYVLKMRAKGGMPVAFADFEDVERATEAMQ  311

Query  904  HLQGTMLYSSPGEGMRLEY  960
             LQG+ML SS   G+ LEY
Sbjct  312  SLQGSMLPSSDRGGLHLEY  330



>ref|XP_007024461.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY27083.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=273

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 139/257 (54%), Gaps = 21/257 (8%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P    + + TLF++GLP+DVK REI+NLFR   G++S  L+      Q  AFA F++ QS
Sbjct  15   PDQDRNLINTLFVSGLPDDVKAREIHNLFRRRAGFDSCQLKYTGRGNQVVAFATFLNHQS  74

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            A+AAM+ LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A        
Sbjct  75   AIAAMHALNGVKFDPQAGSVLHIELARSNSRRKRKPDSGPYVVIDKRTKASANTQETSSD  134

Query  595  GVGNIHIPGMGSSAYN-------------TVGYPPTQSYANFDG--RAMNEGNANKSAAP  729
              G+      G+   N             T+  P     A  +   R ++EG      A 
Sbjct  135  DGGSDTEEPSGTDDANSSNKGDLRTVKSETIVDPENAVAAANEQLERNVDEG------AQ  188

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ANLGPNC+E EL QV SR  GF  LK+++  G PVAF DF+ T  +   ++ L
Sbjct  189  PCSTLFIANLGPNCTEDELKQVLSRYPGFNMLKIRAKGGMPVAFADFEQTEQATTVMTDL  248

Query  910  QGTMLYSSPGEGMRLEY  960
            Q ++L SS   GM +EY
Sbjct  249  QSSLLPSSDRGGMNIEY  265



>ref|XP_011007086.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Populus euphratica]
Length=282

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 139/249 (56%), Gaps = 19/249 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+N+FR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  31   INTLFVSGLPDDVKAREIHNIFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHS  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA----VISRVIES---  594
            LNG+ FD + GSTL I+LA+SNSR KR+         +KR K P+      S  +ES   
Sbjct  91   LNGVKFDPQSGSTLHIELARSNSRRKRKPGSGAYVVIDKRTKKPSDAHETSSDDVESDPE  150

Query  595  ------GVGNIHIPGMGSSAYNTVGYPPTQSYA-NFDGRAMNEGNANKSAAPPCPTLFVA  753
                   V   +  G  ++       P   + A N  G    EG        PC TLF+A
Sbjct  151  EDPEMNNVNTAYQGGSENAKSEATSDPDNAAVAVNEIGERTAEGGVR-----PCSTLFIA  205

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  LK+++  G PVAF DF++   + + + +LQ T L SS
Sbjct  206  NLGPNCTEDELKQVLSQYPGFHVLKIRAKGGMPVAFADFEEIEQATKVMENLQETTLPSS  265

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  266  DRGGMHIEY  274



>ref|XP_006385350.1| RNA-binding family protein [Populus trichocarpa]
 gb|ERP63147.1| RNA-binding family protein [Populus trichocarpa]
Length=281

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 140/249 (56%), Gaps = 19/249 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+N+FR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  30   INTLFVSGLPDDVKAREIHNIFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHS  89

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA----VISRVIESG--  597
            LNG+ FD + GSTL I+LA+SNSR KR+         +KR K P+      S  +ES   
Sbjct  90   LNGVKFDPQSGSTLHIELARSNSRRKRKPGSGAYVVIDKRTKKPSDAHETSSDDVESDPE  149

Query  598  ----VGNIHIPGMGSS--AYNTVGYPPTQS--YANFDGRAMNEGNANKSAAPPCPTLFVA  753
                + N+     G S  A +     P  +    N  G    EG        PC TLF+A
Sbjct  150  EDPEMNNVDTAYQGDSENAKSEAASDPDNAAVAVNEIGERTAEGGVR-----PCSTLFIA  204

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  LK+++  G PVAF DF++   + + + +LQ T L SS
Sbjct  205  NLGPNCTEDELKQVLSQYPGFHVLKIRAKGGMPVAFADFEEIEQATKVMENLQETTLPSS  264

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  265  DRGGMHIEY  273



>ref|XP_008794079.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' [Phoenix dactylifera]
Length=332

 Score =   168 bits (426),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 137/260 (53%), Gaps = 28/260 (11%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P     ++ TLF++GLP+DVKPREI+NLFR   G++S  L+      Q  AFA F + QS
Sbjct  75   PNPEQQKINTLFVSGLPDDVKPREIHNLFRRRHGFDSCQLKYTGRGDQVVAFATFFNHQS  134

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQR--------------TDDDRHGSEK  552
            A++AM  LNG+VFD E G+TL I+LA+SNSR KR R              TDDD+     
Sbjct  135  AMSAMGALNGVVFDPETGATLHIELARSNSR-KRPRGGGAYAVIDKRVKVTDDDQDLWSN  193

Query  553  RMKG----PAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKS  720
               G    P        S  G +     G  A    G P     A+ +      G+    
Sbjct  194  DGDGGSDEPLGTENDNSSNKGALTAAQSGGIA----GKPDNDQAASNEPEKQTPGD----  245

Query  721  AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
              PPC TLF+ANLGP C+E+EL QV S   GFL LKM+   G PVAF DF D   S  A+
Sbjct  246  -IPPCSTLFIANLGPTCTEEELKQVLSEYPGFLTLKMRGRGGMPVAFADFADVESSTAAM  304

Query  901  SHLQGTMLYSSPGEGMRLEY  960
            + LQ ++L SS   G  +EY
Sbjct  305  NSLQDSLLASSDRGGTHVEY  324



>ref|XP_004510361.1| PREDICTED: uncharacterized protein LOC101503574 [Cicer arietinum]
Length=269

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 135/241 (56%), Gaps = 6/241 (2%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + Q+A+AA++ 
Sbjct  20   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFATFFNHQAAMAALHA  79

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA-VISRVIESGVGNIH  612
            LNG+ FD + GS L I+LA+SNSR KR+         +KR KG A V     + G     
Sbjct  80   LNGVKFDPQYGSVLHIELARSNSRRKRKPGGGVYVVIDKRSKGEANVQGSSSDDGESEPD  139

Query  613  IPGMGSSAYNTVGYPPTQSYANFDGR-----AMNEGNANKSAAPPCPTLFVANLGPNCSE  777
             P    S++  V    +   A          A  +         PC TLF+ANLGPNC+E
Sbjct  140  EPSENGSSHGDVANTQSGDTAAVGSDSVAPVASEQHKKGGGDGGPCSTLFIANLGPNCTE  199

Query  778  QELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLE  957
             EL Q FS   GF  +KM+S  G PVAF DF++   +++ +  LQG++L SS   GM +E
Sbjct  200  DELKQAFSVYAGFNLVKMRSRGGMPVAFADFEEIDQAVKVMEELQGSLLPSSDRGGMHIE  259

Query  958  Y  960
            Y
Sbjct  260  Y  260



>ref|XP_010925497.1| PREDICTED: uncharacterized protein LOC105048014 [Elaeis guineensis]
Length=329

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 142/252 (56%), Gaps = 12/252 (5%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            P     ++ TLF++GLP+DVKPREI+NLFR   G++S  L+      Q  AFA F + QS
Sbjct  72   PNAEQQKINTLFVSGLPDDVKPREIHNLFRRRHGFDSCQLKYTGRGDQVVAFATFFNHQS  131

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            A+AAM  LNG+VFD E G+TL I+LA+SNSR KR R        +KR+K       +  +
Sbjct  132  AMAAMNALNGVVFDPETGATLHIELARSNSR-KRPRGGGAYAVIDKRVKITDDDQDLWSN  190

Query  595  -GVGNIHIPGMGS---SAYNTVGYPPTQSYANFDGRAMNEGNANKSAA------PPCPTL  744
             G G    P +G+   ++ N       QS    D    ++  +N+         PPC TL
Sbjct  191  DGDGGSDEP-LGTENDNSSNKGALAAAQSGGVADKLENDQAASNEPEKPTSGDIPPCSTL  249

Query  745  FVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTML  924
            F+ANLGP C+E+EL QV S   GF  +KM+   G PVAF DF D   S  A++ LQ ++L
Sbjct  250  FIANLGPTCTEEELKQVLSEYPGFHTIKMRGRGGMPVAFADFADVESSTAAMNTLQDSLL  309

Query  925  YSSPGEGMRLEY  960
             SS   GM +EY
Sbjct  310  ASSDRGGMHVEY  321



>ref|XP_004155937.1| PREDICTED: LOW QUALITY PROTEIN: U2 small nuclear ribonucleoprotein 
B''-like [Cucumis sativus]
Length=262

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 134/238 (56%), Gaps = 11/238 (5%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLFI+GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSAV A++ 
Sbjct  25   INTLFISGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFYNHQSAVTALHA  84

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIH-  612
            LNG+ FD + GS L I+LA+SNSR K +         +KR K P   S+   S  G    
Sbjct  85   LNGVKFDPQSGSVLHIELARSNSRRKHKPGGGAYVVIDKRKK-PXANSQETSSDDGGSEP  143

Query  613  -IPGMGSSAYNTVGYPPTQSY-ANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQEL  786
              P   +   N     P  +  A ++    N+G        PC TLF+ANLGPNC+E EL
Sbjct  144  DEPSKKAQQSNEAVVTPANAISAPYEHHEKNDGG-------PCSTLFIANLGPNCNEDEL  196

Query  787  TQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             +V  +  GF  LK+++  G PVAF DF+D   + + +  LQG++L SS   GM +EY
Sbjct  197  KEVLCKYPGFNVLKLRAKSGMPVAFADFEDIEQASKVMEELQGSVLPSSDRGGMHIEY  254



>ref|XP_008462363.1| PREDICTED: LOW QUALITY PROTEIN: U2 small nuclear ribonucleoprotein 
B'' 2 [Cucumis melo]
Length=262

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 133/237 (56%), Gaps = 9/237 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLFI+GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSAV A++ 
Sbjct  25   INTLFISGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFYNHQSAVTALHA  84

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRV-IESGVGNIH  612
            LNG+ FD + GS L I+LA+SNSR K +         +KR K  A       + G     
Sbjct  85   LNGVKFDPQSGSVLHIELARSNSRRKHKPGGGAYVVIDKRXKTDANSQETSSDDGGSEPD  144

Query  613  IPGMGSSAYN-TVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELT  789
             P   +   N  V  P +   A ++    N+G        PC TLF+ANLGPNC+E EL 
Sbjct  145  EPSKKAQQSNEAVVTPASAISAPYEHHEKNDGG-------PCSTLFIANLGPNCNEDELK  197

Query  790  QVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +V  +  GF  LK+++  G PVAF DF+D   + + +  LQG++L SS   GM +EY
Sbjct  198  EVLCKYPGFNVLKLRAKSGMPVAFADFEDIEQASKVMEELQGSVLPSSDRGGMHIEY  254



>ref|XP_006342997.1| PREDICTED: uncharacterized protein LOC102592531 [Solanum tuberosum]
Length=278

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 139/263 (53%), Gaps = 24/263 (9%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P+Y   +  ++++TLF++GLP+DVK REI+NLFR  PG+ES  L+      Q  AFA F+
Sbjct  15   PVYAYNNEQNDIKTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGNQVVAFATFI  74

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSR-------------SKRQRTDDDRHG  543
            D  SA+AAM+ LNG+ FD + GSTL I+ A+SNSR               R + ++D  G
Sbjct  75   DHPSAMAAMHALNGVKFDPQTGSTLHIEPARSNSRRIQIPGRGPYVVIDNRNKFNEDAEG  134

Query  544  SEKRMKGPAVISRVIESGVGNIHIPGMG----SSAYNTVGYPPTQSYANFDGRAMNEGNA  711
                 +G      +          P  G    SS            +A       NE   
Sbjct  135  GTSSNEG-----DIDSDDASEPENPDSGTKDDSSEEKREEKVVEPDHALAPKSEQNEKTT  189

Query  712  NKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSM  891
            +   A PC TLF+ANLGPNC+E EL QV S   GF  LK+++  G PVAF DF+    + 
Sbjct  190  D--GAQPCSTLFIANLGPNCTEDELKQVISLYPGFNTLKVRARGGMPVAFADFEGVEQAT  247

Query  892  EALSHLQGTMLYSSPGEGMRLEY  960
            +AL+ LQG+ L SS   GM +EY
Sbjct  248  KALNELQGSTLPSSDRGGMHIEY  270



>ref|XP_004141677.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Cucumis 
sativus]
 gb|KGN45535.1| hypothetical protein Csa_7G451410 [Cucumis sativus]
Length=262

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/237 (41%), Positives = 132/237 (56%), Gaps = 9/237 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLFI+GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSAV A++ 
Sbjct  25   INTLFISGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFYNHQSAVTALHA  84

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRV-IESGVGNIH  612
            LNG+ FD + GS L I+LA+SNSR K +         +KR K  A       + G     
Sbjct  85   LNGVKFDPQSGSVLHIELARSNSRRKHKPGGGAYVVIDKRKKTDANSQETSSDDGGSEPD  144

Query  613  IPGMGSSAYNTVGYPPTQSY-ANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELT  789
             P   +   N     P  +  A ++    N+G        PC TLF+ANLGPNC+E EL 
Sbjct  145  EPSKKAQQSNEAVVTPANAISAPYEHHEKNDGG-------PCSTLFIANLGPNCNEDELK  197

Query  790  QVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +V  +  GF  LK+++  G PVAF DF+D   + + +  LQG++L SS   GM +EY
Sbjct  198  EVLCKYPGFNVLKLRAKSGMPVAFADFEDIEQASKVMEELQGSVLPSSDRGGMHIEY  254



>ref|XP_006407179.1| hypothetical protein EUTSA_v10021259mg [Eutrema salsugineum]
 gb|ESQ48632.1| hypothetical protein EUTSA_v10021259mg [Eutrema salsugineum]
Length=287

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 140/251 (56%), Gaps = 23/251 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG+ES  L+      Q  AFA F     A+AAM E
Sbjct  36   INTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFSSHGFAMAAMNE  95

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHGSEKRMKGPAVISRVIESG  597
            LNG+ FD + GSTL I+LA+SNSR K +         D+R+    + +        I+  
Sbjct  96   LNGVKFDPQTGSTLHIELARSNSRRKERPGSGPYVVIDNRNQKSSKSQDDQSDEEEIDPD  155

Query  598  V----GNIHIPGMGSSAYNTVGYPPTQSYANFDGRA-MNEGNANK-----SAAPPCPTLF  747
                 GNI  P           Y  +++ ++ D +A    G+  K     S A PC TLF
Sbjct  156  EAQEPGNIDSPKEND-------YAKSEADSDADSKAPPGSGHLEKVPEGGSGARPCSTLF  208

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L 
Sbjct  209  IANLGPNCTEDELKQLLSRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNDLQGNLLS  268

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  269  SSDRGGMHIEY  279



>ref|XP_006426509.1| hypothetical protein CICLE_v10026213mg [Citrus clementina]
 gb|ESR39749.1| hypothetical protein CICLE_v10026213mg [Citrus clementina]
Length=280

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 139/250 (56%), Gaps = 21/250 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DV+ REI+NLFR  PG++   L+      Q  AFA FV+ Q+AVAA++E
Sbjct  35   INTLFVSGLPDDVRAREIHNLFRRKPGFDFCQLKYTGRGNQVVAFATFVNHQTAVAALHE  94

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A +     S  G+   
Sbjct  95   LNGVKFDPQSGSVLHIELARSNSRKKRKPGSGAYVVIDKRTKTEANVQES-SSADGDSDT  153

Query  616  ----PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA-----NKSAAP------PCPTLFV  750
                P     + +   +  TQS      RA + GNA      +S  P      PC TLF+
Sbjct  154  DEASPVRNIDSADKGDFVTTQSE-----RATDSGNAVAPINEQSEKPYEGGVQPCSTLFI  208

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E EL Q  S   GF  LKM++  G PVAF DF++   +  A+  LQ + L S
Sbjct  209  ANLGPNCTEDELKQTLSAYPGFNMLKMRARGGMPVAFADFEEVEQASIAMEGLQDSTLPS  268

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  269  SDRGGMHIEY  278



>emb|CDO97927.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/253 (39%), Positives = 137/253 (54%), Gaps = 29/253 (11%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG+E   L+      Q  AFA FV+ QSA+AA++ 
Sbjct  44   INTLFVSGLPDDVKAREIHNLFRRRPGFEFCQLKYTGRGNQVVAFATFVNHQSAMAALHS  103

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS+L I+LA+SNSR K      ++ GS     GP ++         + H 
Sbjct  104  LNGVKFDPQTGSSLHIELARSNSRRK------NKPGS-----GPYIVIDKRTKSSNDAHE  152

Query  616  PGMGSSAYNTVGYPPTQSYANFDGRAMNE-----GNANKSAAP-------------PCPT  741
                    +    P     AN D   + +       A+ + AP              C T
Sbjct  153  TSSDDGDSDDPSRPNNPDSANKDDSVVEKSSEVAAEADNTLAPETEQVEKAVDGTQACST  212

Query  742  LFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTM  921
            LF+ANLGP C+E EL Q  S+C GF  LK+++  G PVAF DF+    + EA++ LQG++
Sbjct  213  LFIANLGPLCTEDELKQALSQCPGFNSLKLRARGGMPVAFADFEGVEQASEAMNALQGSL  272

Query  922  LYSSPGEGMRLEY  960
            L SS   GM +EY
Sbjct  273  LSSSDRGGMHIEY  285



>ref|XP_006426508.1| hypothetical protein CICLE_v10026213mg [Citrus clementina]
 gb|ESR39748.1| hypothetical protein CICLE_v10026213mg [Citrus clementina]
Length=286

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 139/250 (56%), Gaps = 21/250 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DV+ REI+NLFR  PG++   L+      Q  AFA FV+ Q+AVAA++E
Sbjct  35   INTLFVSGLPDDVRAREIHNLFRRKPGFDFCQLKYTGRGNQVVAFATFVNHQTAVAALHE  94

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A +     S  G+   
Sbjct  95   LNGVKFDPQSGSVLHIELARSNSRKKRKPGSGAYVVIDKRTKTEANVQES-SSADGDSDT  153

Query  616  ----PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA-----NKSAAP------PCPTLFV  750
                P     + +   +  TQS      RA + GNA      +S  P      PC TLF+
Sbjct  154  DEASPVRNIDSADKGDFVTTQSE-----RATDSGNAVAPINEQSEKPYEGGVQPCSTLFI  208

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E EL Q  S   GF  LKM++  G PVAF DF++   +  A+  LQ + L S
Sbjct  209  ANLGPNCTEDELKQTLSAYPGFNMLKMRARGGMPVAFADFEEVEQASIAMEGLQDSTLPS  268

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  269  SDRGGMHIEY  278



>ref|XP_009146463.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Brassica rapa]
Length=277

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 149/274 (54%), Gaps = 43/274 (16%)
 Frame = +1

Query  226  LYTP---PHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFA  387
            +Y P   P   DE   + TLF++GLP+DVK REI+NLFR  PG+ESS L+      Q  A
Sbjct  10   VYNPHPLPQLADEPGAINTLFVSGLPDDVKAREIHNLFRRRPGFESSQLKYTGRGDQVVA  69

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------E  549
            FA F     A+AAM ELNG+ FD + GSTL I++A+SNSR K      +R GS      +
Sbjct  70   FATFSSHGFAMAAMNELNGVKFDPQTGSTLHIEVARSNSRRK------ERPGSGPYVVID  123

Query  550  KRMKGPAVISRVIESGV-----------GNIHIPGMGSSAYNTVG------YPPTQSYAN  678
             R K P+  S+  +SG            GN + P    S  + V        PPT  +  
Sbjct  124  NRNKEPSK-SQDGQSGEGESDPDEAEEPGNSNSPKGNDSTKSEVDSDQDSKAPPTSGHLE  182

Query  679  FDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVA  858
               +A   G    S A PC TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVA
Sbjct  183  ---KAFEGG----SGARPCSTLFIANLGPNCTEDELKQLLSRYPGFNILKIRARGGMPVA  235

Query  859  FVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            F DF++   +   ++ LQG +L SS   GM +EY
Sbjct  236  FADFEEIEQATYVMNDLQGNLLSSSDRGGMHIEY  269



>ref|XP_006466053.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Citrus 
sinensis]
 gb|KDO65303.1| hypothetical protein CISIN_1g023143mg [Citrus sinensis]
Length=286

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 139/250 (56%), Gaps = 21/250 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DV+ REI+NLFR  PG++   L+      Q  AFA FV+ Q+AVAA++E
Sbjct  35   INTLFVSGLPDDVRAREIHNLFRRKPGFDFCQLKYTGRGNQVVAFATFVNHQTAVAALHE  94

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A +     S  G+   
Sbjct  95   LNGVKFDPQSGSVLHIELARSNSRKKRKPGSGAYVVIDKRTKTEANVQES-SSADGDSDT  153

Query  616  ----PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA-----NKSAAP------PCPTLFV  750
                P     + +   +  TQS      RA + GNA      +S  P      PC TLF+
Sbjct  154  DEASPVRNIDSADKGDFVTTQSE-----RATDSGNAVAPINEQSEKPYEGGVQPCSTLFI  208

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E EL Q  S   GF  LKM++  G PVAF DF++   +  A+  LQ + L S
Sbjct  209  ANLGPNCTEDELKQTLSVYPGFNMLKMRARGGMPVAFADFEEVEQASIAMEGLQDSTLPS  268

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  269  SDRGGMHIEY  278



>gb|KDO65304.1| hypothetical protein CISIN_1g023143mg [Citrus sinensis]
Length=284

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 137/243 (56%), Gaps = 9/243 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DV+ REI+NLFR  PG++   L+      Q  AFA FV+ Q+AVAA++E
Sbjct  35   INTLFVSGLPDDVRAREIHNLFRRKPGFDFCQLKYTGRGNQVVAFATFVNHQTAVAALHE  94

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A +     S  G+   
Sbjct  95   LNGVKFDPQSGSVLHIELARSNSRKKRKPGSGAYVVIDKRTKTEANVQES-SSADGDSDT  153

Query  616  ----PGMGSSAYNTVGYPPTQSYANFD-GRAMNEGNANK---SAAPPCPTLFVANLGPNC  771
                P     + +   +  TQS    D G A+   N+ K       PC TLF+ANLGPNC
Sbjct  154  DEASPVRNIDSADKGDFVTTQSERATDSGNAVAPINSEKPYEGGVQPCSTLFIANLGPNC  213

Query  772  SEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMR  951
            +E EL Q  S   GF  LKM++  G PVAF DF++   +  A+  LQ + L SS   GM 
Sbjct  214  TEDELKQTLSVYPGFNMLKMRARGGMPVAFADFEEVEQASIAMEGLQDSTLPSSDRGGMH  273

Query  952  LEY  960
            +EY
Sbjct  274  IEY  276



>ref|XP_004235610.1| PREDICTED: protein WHI4 [Solanum lycopersicum]
 ref|XP_004235611.1| PREDICTED: protein WHI4 [Solanum lycopersicum]
Length=278

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 140/264 (53%), Gaps = 26/264 (10%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P+Y   +  ++++TLF++GLP+DVK REI+NLFR   G+ES  L+      Q  AFA F+
Sbjct  15   PVYAYKNEQNDIKTLFVSGLPDDVKAREIHNLFRRRHGFESCQLKYTGRGNQVVAFATFI  74

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSR-------------SKRQRTDDDRHG  543
            D  SA+AAM+ LNG+ FD + GSTL I+ A+SNSR               R + ++D  G
Sbjct  75   DHPSAMAAMHALNGVKFDPQTGSTLHIEPARSNSRRIQIPGRGPYVVIDNRNKFNEDAEG  134

Query  544  SEKRMKGPAVISRVIE-----SGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGN  708
                 +G        E     SG  +       SS            +A       NE  
Sbjct  135  GTSSNEGDNDSDDASEPENPDSGTKD------DSSEEKREEKVVEPDHALAPKSEQNEKT  188

Query  709  ANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACS  888
             +   A PC TLF+ANLGPNC+E EL QV S+  GF  LK+++  G PVAF DF+    +
Sbjct  189  TD--GAQPCSTLFIANLGPNCTEDELKQVVSQYSGFNTLKVRARGGMPVAFADFEGVEQA  246

Query  889  MEALSHLQGTMLYSSPGEGMRLEY  960
             +AL+ LQG+ L SS   GM +EY
Sbjct  247  TKALNELQGSTLPSSDRGGMHIEY  270



>ref|NP_001118622.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAC42069.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75401.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=287

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 138/247 (56%), Gaps = 15/247 (6%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F   + A+AAM E
Sbjct  36   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHRFALAAMNE  95

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHG------SEKRMKGPAVIS  579
            LNG+ FD + GS L I+LA+SNSR K +         D+R+        ++  +G +   
Sbjct  96   LNGVKFDPQTGSNLHIELARSNSRRKERPGSGPYVVIDNRNKEISKSQDDQSDEGDSDPD  155

Query  580  RVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANL  759
             V E   GN   P    +  +     P     + +G  + + +   S A  C TLF+ANL
Sbjct  156  EVQEP--GNSDSPKENDTTKSEADSEPDSKAPSANGH-LEKASEGGSGARACSTLFIANL  212

Query  760  GPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPG  939
            GPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++   + +A++HLQG +L SS  
Sbjct  213  GPNCTEDELKQLLSRYPGFHILKIRARGGMPVAFADFEEIEQATDAMNHLQGNLLSSSDR  272

Query  940  EGMRLEY  960
             GM +EY
Sbjct  273  GGMHIEY  279



>ref|XP_009146460.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Brassica rapa]
 ref|XP_009146461.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Brassica rapa]
Length=280

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 150/273 (55%), Gaps = 38/273 (14%)
 Frame = +1

Query  226  LYTP---PHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFA  387
            +Y P   P   DE   + TLF++GLP+DVK REI+NLFR  PG+ESS L+      Q  A
Sbjct  10   VYNPHPLPQLADEPGAINTLFVSGLPDDVKAREIHNLFRRRPGFESSQLKYTGRGDQVVA  69

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------E  549
            FA F     A+AAM ELNG+ FD + GSTL I++A+SNSR K      +R GS      +
Sbjct  70   FATFSSHGFAMAAMNELNGVKFDPQTGSTLHIEVARSNSRRK------ERPGSGPYVVID  123

Query  550  KRMKGPAVISRVIESGVG-----NIHIPGMGSSAYNTVGYPPTQSYAN-----FDGRA--  693
             R K P+  S+  +SG G         PG  +S     G   T+ + N      D +A  
Sbjct  124  NRNKEPSK-SQDGQSGEGESDPDEAEEPGNSNSPK---GNDSTKRFENEVDSDQDSKAPP  179

Query  694  ----MNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAF  861
                + +     S A PC TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF
Sbjct  180  TSGHLEKAFEGGSGARPCSTLFIANLGPNCTEDELKQLLSRYPGFNILKIRARGGMPVAF  239

Query  862  VDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             DF++   +   ++ LQG +L SS   GM +EY
Sbjct  240  ADFEEIEQATYVMNDLQGNLLSSSDRGGMHIEY  272



>gb|EMS51264.1| Cell wall integrity protein scw1 [Triticum urartu]
Length=226

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 126/196 (64%), Gaps = 13/196 (7%)
 Frame = +1

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSK-----RQRTDDDRHGSEKRMKGP  567
            DQ SA+AAM   NG++FDLEK  ++ +DLAKSNSRS      R   +D    + K+ + P
Sbjct  16   DQPSALAAMSATNGLIFDLEKNCSIHVDLAKSNSRSNSSKRPRSDYEDFPKSTGKKARSP  75

Query  568  AVISRVIESGVG-NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PPC  735
                   +SG G NIH+ GMG+S+++  GYP  QSY +F   A    +    A    PPC
Sbjct  76   ---RGRPDSGAGSNIHMSGMGNSSHSLNGYP-AQSYMDFGSSAAFSKDPAIFAPQNNPPC  131

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
            PTLFVANLG   S+ ELT VFS   GF+KLKMQ+ +GAPVAFVDFKD   S EAL+ LQG
Sbjct  132  PTLFVANLGQTVSDHELTDVFSSYEGFIKLKMQNKFGAPVAFVDFKDDRSSTEALNRLQG  191

Query  916  TMLYSSPGEGMRLEYP  963
             +L SS GEGMRLEYP
Sbjct  192  AILQSSSGEGMRLEYP  207



>ref|XP_007135563.1| hypothetical protein PHAVU_010G140000g [Phaseolus vulgaris]
 gb|ESW07557.1| hypothetical protein PHAVU_010G140000g [Phaseolus vulgaris]
Length=264

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 134/249 (54%), Gaps = 26/249 (10%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  20   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFATFFNHQSAMAALHA  79

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVI---------  588
            LNG+ FD + GS L I+LA+SNSR KR+         +KR KG   +             
Sbjct  80   LNGVKFDPQTGSVLHIELARSNSRRKRKPGSGAYVVIDKRTKGELDVHGSSSDDGDSDPD  139

Query  589  -----ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVA  753
                 +   G++ I     +A  +    P + +               S+   C TLF+A
Sbjct  140  EPSDSDGNHGDLSIIASDETAVGSDNPIPVEQH------------EKGSSGGLCSTLFIA  187

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL Q F+   GF  +KM+S  G PVAF DF++   + + +  LQG++L SS
Sbjct  188  NLGPNCTEDELKQAFAAYAGFNMVKMRSRGGMPVAFADFEEIDQAAKVVEELQGSLLSSS  247

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  248  DRGGMHIEY  256



>ref|XP_008228314.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Prunus mume]
Length=338

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 132/242 (55%), Gaps = 7/242 (3%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  89   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  148

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A               
Sbjct  149  LNGVKFDPQTGSLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEADTQETSSDDDSETDE  208

Query  616  PGM-------GSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCS  774
            P           +   T     T   ++     +NE +       PC TLF+ANLGPNC+
Sbjct  209  PSETENNDSGDKTELETTKSAETAVDSDNAVATVNEQSEKHVDGGPCSTLFIANLGPNCT  268

Query  775  EQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRL  954
            E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS   GM +
Sbjct  269  EDELKQVLSKYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSSDRGGMHI  328

Query  955  EY  960
            EY
Sbjct  329  EY  330



>gb|AFK36557.1| unknown [Medicago truncatula]
 gb|KEH18333.1| small nuclear ribonucleoprotein [Medicago truncatula]
Length=268

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 132/240 (55%), Gaps = 5/240 (2%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + Q+A+ A++ 
Sbjct  20   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRANQVVAFATFFNHQAAMQALHS  79

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA-VISRVIESGVGNIH  612
            LNG+ FD + GS L I+LA+SNSR KR+         +KR KG A V     + G  +  
Sbjct  80   LNGVKFDPQSGSVLHIELARSNSRRKRKPGGGAYVVIDKRSKGEANVQGSSSDDGESDPD  139

Query  613  IPGMGSSAYNTVGYPPTQSYA----NFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQ  780
             P    S +  +    +        N    A  +         PC TLF+ANLGPNC+E 
Sbjct  140  EPSENGSNHGDIATAQSGDAVVGSDNHVPVARAQHGKGGGDGGPCSTLFIANLGPNCTED  199

Query  781  ELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            EL Q  S   GF  +KM+S  G PVAF DF++   +++ +  LQG+ L SS   GM +EY
Sbjct  200  ELKQALSVYAGFNLVKMRSRGGMPVAFADFEEIDQAVKVMEELQGSSLPSSDRGGMHIEY  259



>ref|XP_008391315.1| PREDICTED: nucleolin isoform X2 [Malus domestica]
Length=278

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 134/244 (55%), Gaps = 10/244 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  28   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  87

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI---------SRVI  588
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A           S   
Sbjct  88   LNGVKFDPQTGSLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEADTQETSSDDGESESD  147

Query  589  ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPN  768
            E    + H  G  S    T          N    A+N+       A  C TLF+ANLGPN
Sbjct  148  EPSETDKHDSGDKSDLATTKSGETAVDSENAVA-AVNDQPEKHVDAGQCSTLFIANLGPN  206

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            C+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS   GM
Sbjct  207  CTEDELKQVLSQYTGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSSDRGGM  266

Query  949  RLEY  960
             +EY
Sbjct  267  HIEY  270



>emb|CDY23631.1| BnaC05g39630D [Brassica napus]
Length=270

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 140/252 (56%), Gaps = 30/252 (12%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG+ES  L+      Q  AFA F     A+AAM E
Sbjct  31   INTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFSSHGFAMAAMNE  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI------------S  579
            LNG+ FD + GSTL I++A+SNSR K      DR GS     GP V+            S
Sbjct  91   LNGVKFDPQTGSTLHIEVARSNSRRK------DRPGS-----GPYVVIDNRNKETSDDQS  139

Query  580  RVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPT  741
               ES       PG  S++   +    ++  ++ D +A      + + +   S A PC T
Sbjct  140  DEGESDPYEAQEPG-NSNSPKEIDNTKSEVDSDQDSKAPPTSGYLEKASEGGSGARPCST  198

Query  742  LFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTM  921
            LF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++   +   ++ LQG +
Sbjct  199  LFIANLGPNCTEDELKQLLSRYSGFNILKIRARGGMPVAFADFEEIEQATYVMNDLQGNL  258

Query  922  LYSSPGEGMRLE  957
            L SS   GM +E
Sbjct  259  LSSSDRGGMHIE  270



>emb|CDX97508.1| BnaA05g25710D [Brassica napus]
Length=268

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 148/273 (54%), Gaps = 43/273 (16%)
 Frame = +1

Query  226  LYTP---PHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFA  387
            +Y P   P   DE   + TLF++GLP+DVK REI+NLFR  PG+ESS L+      Q  A
Sbjct  10   VYNPHPLPQLADEPGAINTLFVSGLPDDVKAREIHNLFRRRPGFESSQLKYTGRGDQVVA  69

Query  388  FAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------E  549
            FA F     A+AAM ELNG+ FD + GSTL I++A+SNSR K      +R GS      +
Sbjct  70   FATFSSHGFAMAAMNELNGVKFDPQTGSTLHIEVARSNSRRK------ERPGSGPYVVID  123

Query  550  KRMKGPAVISRVIESGV-----------GNIHIPGMGSSAYNTVG------YPPTQSYAN  678
             R K P+  S+  +SG            GN + P    S  + V        PPT  +  
Sbjct  124  NRNKEPSK-SQDGQSGEGESDPDEAEEPGNSNSPKGNDSTKSEVDSDQDSKAPPTSGHLE  182

Query  679  FDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVA  858
               +A   G    S A PC TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVA
Sbjct  183  ---KAFEGG----SGARPCSTLFIANLGPNCTEDELKQLLSRYPGFNILKIRARGGMPVA  235

Query  859  FVDFKDTACSMEALSHLQGTMLYSSPGEGMRLE  957
            F DF++   +   ++ LQG +L SS   GM +E
Sbjct  236  FADFEEIEQATYVMNDLQGNLLSSSDRGGMHIE  268



>ref|XP_009765117.1| PREDICTED: uncharacterized protein LOC104216699 isoform X1 [Nicotiana 
sylvestris]
Length=321

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 140/266 (53%), Gaps = 30/266 (11%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP+Y      ++++TLF++GLP+DVK REI+NLFR   G+ES  L+      Q  AFA F
Sbjct  59   APVYAYSKEQNDIKTLFVSGLPDDVKAREIHNLFRRRLGFESCQLKYTGRGDQVVAFATF  118

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP-AVI  576
            +D  SA+AAM+ LNG+ FD + GSTL I+LA+SNSR             +   +GP  VI
Sbjct  119  IDHPSAMAAMHSLNGVEFDPQTGSTLHIELARSNSRR-----------VQVPGRGPYVVI  167

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYP----------PTQSYANFDGRAMNEGNANKS--  720
                +S          G +  +    P          P++  +       +   A KS  
Sbjct  168  DNRTKSKNAKDTSSNEGDTESDDASEPDNPDSGTNDDPSEEKSEEKVVESDHALAPKSEQ  227

Query  721  ------AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTA  882
                   A PC TLF+ANLGPNC+E EL QV S+  GF  LK+++  G PVAF DF+   
Sbjct  228  SEKTTDGAQPCSTLFIANLGPNCTEDELKQVISKYPGFNTLKVRARGGMPVAFADFQGID  287

Query  883  CSMEALSHLQGTMLYSSPGEGMRLEY  960
             + E L+ LQG  L SS   GM +EY
Sbjct  288  QATEVLNALQGCTLPSSDRGGMHIEY  313



>ref|XP_002884983.1| hypothetical protein ARALYDRAFT_478769 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61242.1| hypothetical protein ARALYDRAFT_478769 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 136/255 (53%), Gaps = 31/255 (12%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F   + A+AAM E
Sbjct  36   INTLFVSGLPNDVKAREIHNLFRRRYGFESCQLKYTGRGDQVVAFATFTSHRFAMAAMNE  95

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI--SRVIESGVGNI  609
            LNG+ FD + GSTL I+LA+SNSR K      +R GS     GP V+  +R  E      
Sbjct  96   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGS-----GPYVVIDNRNKELSKSQD  144

Query  610  HIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPP------------------C  735
                 G S  + V  P        +  A +E ++   +  P                  C
Sbjct  145  DQSDEGDSDPDEVQEPRNSESPKENDNAKSEADSEPDSKAPSANGHLEKAYEGGSGARAC  204

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++   + +A++ LQG
Sbjct  205  STLFIANLGPNCTEDELRQLLSRYSGFNILKIRARGGMPVAFADFEEIEQATDAMNELQG  264

Query  916  TMLYSSPGEGMRLEY  960
             +L SS   GM +EY
Sbjct  265  NLLSSSDRGGMHIEY  279



>ref|XP_008228313.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Prunus mume]
Length=339

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 138/244 (57%), Gaps = 10/244 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  89   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  148

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A  ++   S  G+   
Sbjct  149  LNGVKFDPQTGSLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEA-DTQETSSDDGDSET  207

Query  616  PGMGSSAYNTVG-------YPPTQSYANFDGRA--MNEGNANKSAAPPCPTLFVANLGPN  768
                 +  N  G           ++  + D     +NE +       PC TLF+ANLGPN
Sbjct  208  DEPSETENNDSGDKTELETTKSAETAVDSDNAVATVNEQSEKHVDGGPCSTLFIANLGPN  267

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            C+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS   GM
Sbjct  268  CTEDELKQVLSKYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSSDRGGM  327

Query  949  RLEY  960
             +EY
Sbjct  328  HIEY  331



>ref|XP_010465227.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Camelina sativa]
 ref|XP_010465228.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Camelina sativa]
Length=284

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 140/251 (56%), Gaps = 23/251 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVI----SRV  585
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+      S  
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  586  IESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPTLF  747
            ++S       PG   S         +++ ++ D +A      + +     S A PC TLF
Sbjct  147  VDSDPDEAQEPGNSDSPKENDN-SKSEADSDQDSKAPSANGHLEKACEGSSGARPCSTLF  205

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E+EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L 
Sbjct  206  IANLGPNCTEEELKQLISRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNELQGYLLS  265

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  266  SSDRGGMHIEY  276



>gb|KFK38719.1| hypothetical protein AALP_AA3G151100 [Arabis alpina]
Length=280

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 137/259 (53%), Gaps = 14/259 (5%)
 Frame = +1

Query  223  PLYTPPHSHDE---VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFA  393
            P   PP   DE   + TLF++GLP D+K REI+NLFR  PG+ES  L+      Q  AFA
Sbjct  15   PHPLPPQFSDEPGAINTLFVSGLPNDIKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFA  74

Query  394  VFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHGSEKR  555
             F     A+AAM ELNG+ FD + GS L I+LA+SNSR K +         D+R+    +
Sbjct  75   TFSSHGFAIAAMNELNGVKFDPQAGSCLHIELARSNSRRKERPGSGAYVVIDNRNKKPSK  134

Query  556  MKGPAVISRVIESGVGNIHI----PGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSA  723
             +         +      H+    P    SA +     P     + +G  + +     S 
Sbjct  135  SQEEESDEEDSDPDEAQEHVSSDSPKENDSAKSEADSDPDSKAPSANGH-LEKAFERGSG  193

Query  724  APPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
            A PC TLF+ANLGPNC+E EL Q+ S   GF  LK+++  G PVAF DF+++  + E + 
Sbjct  194  ARPCSTLFIANLGPNCTEDELKQLLSSYPGFNILKIRARGGMPVAFADFEESEQASEVMK  253

Query  904  HLQGTMLYSSPGEGMRLEY  960
             LQG +L SS   GM +EY
Sbjct  254  DLQGYLLSSSDRGGMHIEY  272



>ref|XP_010501068.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Camelina sativa]
Length=277

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 138/247 (56%), Gaps = 22/247 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVISRVIESG  597
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P   S+  +  
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKP---SKSQDDQ  143

Query  598  VGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPTLFVANL  759
                  PG   S         +++ ++ D +A      + +     S A PC TLF+ANL
Sbjct  144  SDEAQEPGSSDSPKENDN-SKSEADSDQDSKAPSANGHLEKACEGSSCARPCSTLFIANL  202

Query  760  GPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPG  939
            GPNC+E+EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L SS  
Sbjct  203  GPNCTEEELKQLISRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNELQGYLLSSSDR  262

Query  940  EGMRLEY  960
             GM +EY
Sbjct  263  GGMHIEY  269



>ref|XP_007215635.1| hypothetical protein PRUPE_ppa008170mg [Prunus persica]
 gb|EMJ16834.1| hypothetical protein PRUPE_ppa008170mg [Prunus persica]
Length=342

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 137/244 (56%), Gaps = 10/244 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  92   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  151

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A  ++   S  G+   
Sbjct  152  LNGVKFDPQTGSLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEA-DTQETSSDDGDSET  210

Query  616  PGMGSSAYNTVG-------YPPTQSYANFDGRA--MNEGNANKSAAPPCPTLFVANLGPN  768
                 +  N  G           ++  + D     +NE +       PC TLF+ANLGPN
Sbjct  211  DEPSETENNDSGDKTELETTKSAETAVDSDNAVATVNEQSEKHVDGGPCSTLFIANLGPN  270

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            C+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G  L SS   GM
Sbjct  271  CTEDELKQVLSKYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGNSLPSSDRGGM  330

Query  949  RLEY  960
             +EY
Sbjct  331  HIEY  334



>ref|XP_010106675.1| RNA-binding protein with multiple splicing [Morus notabilis]
 gb|EXC11124.1| RNA-binding protein with multiple splicing [Morus notabilis]
Length=284

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 134/249 (54%), Gaps = 14/249 (6%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  28   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  87

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHGSEKRMKGPAVIS------  579
            LNG+ FD + GS L I+LA+SNSR KR+         D R  +E+        S      
Sbjct  88   LNGVKFDPQTGSVLHIELARSNSRRKRKPGSGPYVVIDKRSNAEEGNDNAHEASTDDGDS  147

Query  580  RVIESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSA-APPCPTLFVA  753
               ES  G  H  G  G    +  G     S         N+    K     PC TLF A
Sbjct  148  ESDESSDGEKHDSGEKGDLVTSKSGETVVDSNNAAAAVNSNKQQPEKPVEGGPCSTLFFA  207

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  LK+++  G PVAF DF++   + +A+  L GTML SS
Sbjct  208  NLGPNCTEDELKQVLSQYPGFTMLKLRARGGMPVAFTDFEELEQANKAMEELSGTMLPSS  267

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  268  DRGGMHIEY  276



>ref|XP_011007088.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X3 
[Populus euphratica]
Length=273

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 134/240 (56%), Gaps = 19/240 (8%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+N+FR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  31   INTLFVSGLPDDVKAREIHNIFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAIAALHS  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA----VISRVIES---  594
            LNG+ FD + GSTL I+LA+SNSR KR+         +KR K P+      S  +ES   
Sbjct  91   LNGVKFDPQSGSTLHIELARSNSRRKRKPGSGAYVVIDKRTKKPSDAHETSSDDVESDPE  150

Query  595  ------GVGNIHIPGMGSSAYNTVGYPPTQSYA-NFDGRAMNEGNANKSAAPPCPTLFVA  753
                   V   +  G  ++       P   + A N  G    EG        PC TLF+A
Sbjct  151  EDPEMNNVNTAYQGGSENAKSEATSDPDNAAVAVNEIGERTAEGGVR-----PCSTLFIA  205

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  LK+++  G PVAF DF++   + + + +LQ T L SS
Sbjct  206  NLGPNCTEDELKQVLSQYPGFHVLKIRAKGGMPVAFADFEEIEQATKVMENLQETTLPSS  265



>ref|XP_009599765.1| PREDICTED: U1 small nuclear ribonucleoprotein A [Nicotiana tomentosiformis]
Length=327

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 139/266 (52%), Gaps = 30/266 (11%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP+Y      ++++TLF++GLP+DVK REI+NLFR   G+ES  L+      Q  AFA F
Sbjct  65   APVYGYNKEQNDIKTLFVSGLPDDVKAREIHNLFRRRLGFESCQLKYTGRGDQVVAFATF  124

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP-AVI  576
            +D  SA+AAM+ LNG+ FD + GSTL I+LA+SNSR             +   KGP  VI
Sbjct  125  IDHPSAMAAMHSLNGVEFDPQTGSTLHIELARSNSRR-----------VQVPGKGPYVVI  173

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFD----------------GRAMNEGN  708
                +S          G +  +    P        D                  A+    
Sbjct  174  DNRTKSKNAKDTSSNEGDTESDDASEPDNPDSGTNDDPSEEKSEEKVVESDHALAVKSEQ  233

Query  709  ANKS--AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTA  882
            + K+   A PC TLF+ANLGPNC+E EL QV S+  GF  LK+++  G PVAF DF+   
Sbjct  234  SEKTTDGAQPCSTLFIANLGPNCTEDELKQVISQYPGFNTLKVRARGGMPVAFADFQGID  293

Query  883  CSMEALSHLQGTMLYSSPGEGMRLEY  960
             + + L+ LQG+ L SS   GM +EY
Sbjct  294  QATKVLNALQGSTLPSSDRGGMHIEY  319



>ref|XP_010487138.1| PREDICTED: uncharacterized protein LOC104765160 isoform X1 [Camelina 
sativa]
Length=284

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 140/251 (56%), Gaps = 23/251 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVI----SRV  585
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+      S  
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  586  IESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKS-----AAPPCPTLF  747
            ++S       PG  GS   N       +S  +    + N G+  K+      A PC TLF
Sbjct  147  VDSDPDEAQEPGSSGSPKENDNSKSEAESDQDSKAPSAN-GHLEKACEGSFGARPCSTLF  205

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E+EL Q+ SR  GF  +K+++  G PVAF DF++   + + ++ LQG +L 
Sbjct  206  IANLGPNCTEEELKQLLSRYPGFNIMKIRARGGMPVAFADFEEIEQATDVMNELQGYLLS  265

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  266  SSDRGGMHIEY  276



>gb|EPS65567.1| hypothetical protein M569_09212 [Genlisea aurea]
Length=283

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 137/249 (55%), Gaps = 18/249 (7%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLFI+GLP+DVK REI+NLFR  PG+ S  L+      Q  AFA F D +SA+A+++ 
Sbjct  31   INTLFISGLPDDVKAREIHNLFRRRPGFASCQLKYTGRGNQVVAFATFSDHRSAMASLHA  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG+ FD + GSTL ++LA+SNSR   +R        +KR+K      RV     G    
Sbjct  91   LNGVKFDPQTGSTLHVELARSNSRRNPKRAGGPYVVIDKRVKSSDAKDRV----GGFSDE  146

Query  616  PGMGSSAYNTVGYPPTQSYAN--------------FDGRAMNEGNANKSAAPPCPTLFVA  753
             G   + ++  G   ++  A+              +D +        ++    C TLF+A
Sbjct  147  EGSDENRFSVSGDTDSEGGASNKRCMLYIHSRMPLWDCKLTMLLLMLQARDGACSTLFIA  206

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+++EL  + S+CRGF  LK++S+ G PVAF DF+    +  A+  LQG  + SS
Sbjct  207  NLGPNCTDEELRDLLSQCRGFNSLKLRSSGGMPVAFADFERVEHATMAMDALQGISISSS  266

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  267  DRGGMHIEY  275



>ref|XP_009765118.1| PREDICTED: uncharacterized protein LOC104216699 isoform X2 [Nicotiana 
sylvestris]
Length=312

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 139/265 (52%), Gaps = 30/265 (11%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP+Y      ++++TLF++GLP+DVK REI+NLFR   G+ES  L+      Q  AFA F
Sbjct  59   APVYAYSKEQNDIKTLFVSGLPDDVKAREIHNLFRRRLGFESCQLKYTGRGDQVVAFATF  118

Query  400  VDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGP-AVI  576
            +D  SA+AAM+ LNG+ FD + GSTL I+LA+SNSR             +   +GP  VI
Sbjct  119  IDHPSAMAAMHSLNGVEFDPQTGSTLHIELARSNSRR-----------VQVPGRGPYVVI  167

Query  577  SRVIESGVGNIHIPGMGSSAYNTVGYP----------PTQSYANFDGRAMNEGNANKS--  720
                +S          G +  +    P          P++  +       +   A KS  
Sbjct  168  DNRTKSKNAKDTSSNEGDTESDDASEPDNPDSGTNDDPSEEKSEEKVVESDHALAPKSEQ  227

Query  721  ------AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTA  882
                   A PC TLF+ANLGPNC+E EL QV S+  GF  LK+++  G PVAF DF+   
Sbjct  228  SEKTTDGAQPCSTLFIANLGPNCTEDELKQVISKYPGFNTLKVRARGGMPVAFADFQGID  287

Query  883  CSMEALSHLQGTMLYSSPGEGMRLE  957
             + E L+ LQG  L SS   GM +E
Sbjct  288  QATEVLNALQGCTLPSSDRGGMHIE  312



>ref|XP_006655792.1| PREDICTED: uncharacterized protein LOC102704894 [Oryza brachyantha]
Length=297

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 139/279 (50%), Gaps = 46/279 (16%)
 Frame = +1

Query  238  PHSHDE-----VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            PH+H +     V TLF+AGLP+DVKPREI+NLF   PG++   L       Q  AF  F 
Sbjct  19   PHTHPDPQRQGVLTLFVAGLPDDVKPREIHNLFSRRPGFDHCLLEYTGRGNQAVAFVSFF  78

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR  582
              Q+A++AM  LNG VFD + G  L I+LAKSNSR         RHG     +      R
Sbjct  79   THQAALSAMSALNGSVFDPDTGDCLHIELAKSNSRK--------RHGGVGVYRVIDKRLR  130

Query  583  VIESGVGNIHIPGMGSSAY--------------------------NTVGYPPTQS-----  669
               +G  N    G    A+                             G P  QS     
Sbjct  131  NKRTGHENTGDEGNDDDAWCEDDNGGSDGDGGSEEPLDTENDGFDEKNGLPAEQSSGQPG  190

Query  670  YANFDGRAMNEGNANK--SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTY  843
                 G++ ++  A+K  S  PPC TLFVANLG +C+E+EL +V S+  GF  LKM+   
Sbjct  191  LKQHKGQSPSDDQADKFSSDIPPCSTLFVANLGHSCTEEELKEVLSKHPGFHLLKMRRRG  250

Query  844  GAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            G PVAF DF D   S  A+S LQGT+L SS  +G+++EY
Sbjct  251  GMPVAFADFMDIESSTAAMSALQGTVLASSDADGLQIEY  289



>ref|XP_008391314.1| PREDICTED: uncharacterized protein LOC103453553 isoform X1 [Malus 
domestica]
Length=284

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 136/249 (55%), Gaps = 14/249 (6%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  28   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  87

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVI---------SRVI  588
            LNG+ FD + GS L I+LA+SNSR KR+         +KR K  A           S   
Sbjct  88   LNGVKFDPQTGSLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEADTQETSSDDGESESD  147

Query  589  ESGVGNIHIPGMGSSAYNTVGYPPTQS-YANFDGR----AMNEGNANKSAAPPCPTLFVA  753
            E    + H  G  S    T      ++     D      A+N+       A  C TLF+A
Sbjct  148  EPSETDKHDSGDKSDLATTKRLKELENGETAVDSENAVAAVNDQPEKHVDAGQCSTLFIA  207

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS
Sbjct  208  NLGPNCTEDELKQVLSQYTGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSS  267

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  268  DRGGMHIEY  276



>ref|XP_006298208.1| hypothetical protein CARUB_v10014258mg, partial [Capsella rubella]
 gb|EOA31106.1| hypothetical protein CARUB_v10014258mg, partial [Capsella rubella]
Length=303

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 136/251 (54%), Gaps = 23/251 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AF  F     AVAAM E
Sbjct  52   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFVTFTSHGFAVAAMSE  111

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVI----SRV  585
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+      S  
Sbjct  112  LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  165

Query  586  IESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPTLF  747
            ++S        G   S         +++ ++ D +A      + +     S A PC TLF
Sbjct  166  VDSDPDEAQESGNSDSPKEN-DNAKSEADSDQDSKAPSTNVHLEKACDGGSGARPCSTLF  224

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E EL Q+ SR  GF  LK ++  G PVAF DF+D   + + ++ LQG +L 
Sbjct  225  IANLGPNCTEDELKQLLSRYPGFNILKTRARGGMPVAFADFEDLEQATDVMNALQGNLLS  284

Query  928  SSPGEGMRLEY  960
            SS   GM +EY
Sbjct  285  SSDRGGMHIEY  295



>ref|XP_010465231.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X3 [Camelina sativa]
Length=275

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 139/250 (56%), Gaps = 23/250 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVI----SRV  585
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+      S  
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  586  IESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPTLF  747
            ++S       PG   S         +++ ++ D +A      + +     S A PC TLF
Sbjct  147  VDSDPDEAQEPGNSDSPKENDN-SKSEADSDQDSKAPSANGHLEKACEGSSGARPCSTLF  205

Query  748  VANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLY  927
            +ANLGPNC+E+EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L 
Sbjct  206  IANLGPNCTEEELKQLISRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNELQGYLLS  265

Query  928  SSPGEGMRLE  957
            SS   GM +E
Sbjct  266  SSDRGGMHIE  275



>dbj|BAJ95564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 131/250 (52%), Gaps = 27/250 (11%)
 Frame = +1

Query  226  LYTP-PHSHDEVR----TLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAF  390
            LY P P  H + R    TLF+AGLP+DVKPREI+NLF   PG++   L       Q  AF
Sbjct  24   LYAPQPLQHPDPRQGVVTLFVAGLPDDVKPREIHNLFSRRPGFDHCLLEYTGRGNQAVAF  83

Query  391  AVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPA  570
              F    +A++AM  LNG VFD + G  L I+LAKSNSR         RHG +    GP+
Sbjct  84   VSFFTHHAALSAMASLNGSVFDPDNGDCLHIELAKSNSRK--------RHGGQGGSDGPS  135

Query  571  VISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
                   S    +          +  G P T+      GR+ N+        PPC TLF+
Sbjct  136  DEENDNSSDKNEL--------LTDQSGEPGTKQQK---GRSSND---QPDKIPPCSTLFL  181

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            +NLG  C+E+EL ++ S+  GF  LKM+   G P AF DF D   S  A+ + +GTML S
Sbjct  182  SNLGQTCTEKELEELLSKQPGFHVLKMRRRGGLPAAFADFTDIESSTAAMENFKGTMLSS  241

Query  931  SPGEGMRLEY  960
            S  +G+++EY
Sbjct  242  SDSDGLQIEY  251



>ref|XP_006298207.1| hypothetical protein CARUB_v10014258mg, partial [Capsella rubella]
 gb|EOA31105.1| hypothetical protein CARUB_v10014258mg, partial [Capsella rubella]
Length=302

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 135/256 (53%), Gaps = 34/256 (13%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AF  F     AVAAM E
Sbjct  52   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFVTFTSHGFAVAAMSE  111

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVISRVIESG  597
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+         
Sbjct  112  LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  165

Query  598  V---------GNIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPP  732
                      GN   P    +A        +++ ++ D +A      + +     S A P
Sbjct  166  DSDPDEAQESGNSDSPKENDNA-------KSEADSDQDSKAPSTNVHLEKACDGGSGARP  218

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ANLGPNC+E EL Q+ SR  GF  LK ++  G PVAF DF+D   + + ++ LQ
Sbjct  219  CSTLFIANLGPNCTEDELKQLLSRYPGFNILKTRARGGMPVAFADFEDLEQATDVMNALQ  278

Query  913  GTMLYSSPGEGMRLEY  960
            G +L SS   GM +EY
Sbjct  279  GNLLSSSDRGGMHIEY  294



>ref|XP_010465230.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Camelina sativa]
Length=283

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 134/250 (54%), Gaps = 22/250 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVISRVIESG  597
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+         
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  598  V---------GNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFV  750
                      GN   P    ++ +           + +G  + +     S A PC TLF+
Sbjct  147  DSDPDEAQEPGNSDSPKENDNSKSEADSDQDSKAPSANGH-LEKACEGSSGARPCSTLFI  205

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E+EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L S
Sbjct  206  ANLGPNCTEEELKQLISRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNELQGYLLSS  265

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  266  SDRGGMHIEY  275



>ref|XP_010228037.1| PREDICTED: protein WHI3 [Brachypodium distachyon]
Length=301

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/281 (38%), Positives = 138/281 (49%), Gaps = 33/281 (12%)
 Frame = +1

Query  217  AAPLYTP-----PHSHDE-----VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS  366
            A PL  P     PH H +     V TLF+AGLP+DVKPREI+NLF   PG++   L    
Sbjct  13   APPLGDPYYVYAPHPHSDPQRQGVVTLFVAGLPDDVKPREIHNLFSRRPGFDQCLLEYTG  72

Query  367  SNTQPFAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS  546
               Q  AF  F   Q+A++ M  LNG VFD E G  L I+LAKSNSR +     D     
Sbjct  73   RGNQVCAFVSFFTHQAALSTMLALNGTVFDPENGDCLHIELAKSNSRRRHGGGGDVYRVI  132

Query  547  EKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA  726
            +KR+    V +     G  ++     G   Y   G        N +    NE  A++S  
Sbjct  133  DKRVNRREVNADNEHIGDDDVSGEDEGEGKYGEGGSDEPSDTENDNSSDKNELPADQSGE  192

Query  727  -----------------------PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQS  837
                                   PPC TLF+ NLG  C+E+EL +VFS+  GF  LKM+ 
Sbjct  193  PGIKQKKRQSPSNDQPDKSSVDIPPCSTLFIENLGQTCTEEELEEVFSKQPGFHVLKMRR  252

Query  838  TYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
              G P AF DF D   S  A+++LQGT+L SS  +G+R+EY
Sbjct  253  RGGMPAAFADFTDIESSTAAMNNLQGTILSSSDSDGLRIEY  293



>ref|XP_010501059.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X1 [Camelina sativa]
Length=283

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 136/250 (54%), Gaps = 22/250 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPAVISRVIESG  597
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+         
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  598  VG---NIHIPGMGSSAYNTVGYPPTQSYANFDGRA------MNEGNANKSAAPPCPTLFV  750
                     PG   S         +++ ++ D +A      + +     S A PC TLF+
Sbjct  147  DSDPYEAQEPGSSDSPKENDN-SKSEADSDQDSKAPSANGHLEKACEGSSCARPCSTLFI  205

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E+EL Q+ SR  GF  LK+++  G PVAF DF++   + + ++ LQG +L S
Sbjct  206  ANLGPNCTEEELKQLISRYPGFNILKIRARGGMPVAFADFEEIEQATDVMNELQGYLLSS  265

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  266  SDRGGMHIEY  275



>ref|XP_010686077.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=317

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 137/263 (52%), Gaps = 24/263 (9%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P+Y P      + TLF++GLP+DV PREI+NLFR  PG++SS L+      Q  AF  F 
Sbjct  54   PIYIPKEQR-HINTLFVSGLPDDVIPREIHNLFRRRPGFDSSQLKFTGRGNQVVAFVTFF  112

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSK-------------RQRTDDDRHG  543
            + QSAV A+ +L+G+ FD + GS L I+LA+SNSR K             R++  DD   
Sbjct  113  NHQSAVMALQDLDGVKFDPQAGSVLHIELARSNSRRKRMPGSGPYVVIDNRKKAADDCED  172

Query  544  SEKRMKGPAVISRVI----ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA  711
            +          +R      +S     H   + S     V     ++  N      +EG+ 
Sbjct  173  TSSDDGDNDSDNRSQSEDPDSSNNKTHSATVKSDE-KKVELCGAEARPNEQIEKTSEGDL  231

Query  712  NKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSM  891
                   C TLF+ANLGPNCSE EL Q  S+  GF  LK+++  G PVAF D+++   + 
Sbjct  232  RS-----CSTLFIANLGPNCSEDELRQALSQYPGFNGLKLRAKSGMPVAFADYEEVEQAT  286

Query  892  EALSHLQGTMLYSSPGEGMRLEY  960
             A+  LQG+ML SS   GM +EY
Sbjct  287  NAMQALQGSMLPSSDRGGMHIEY  309



>ref|XP_010686078.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=315

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 135/256 (53%), Gaps = 12/256 (5%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P+Y P      + TLF++GLP+DV PREI+NLFR  PG++SS L+      Q  AF  F 
Sbjct  54   PIYIPKEQR-HINTLFVSGLPDDVIPREIHNLFRRRPGFDSSQLKFTGRGNQVVAFVTFF  112

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQ-------RTDDDRHGSEKRMK  561
            + QSAV A+ +L+G+ FD + GS L I+LA+SNSR KR          D+ +  ++    
Sbjct  113  NHQSAVMALQDLDGVKFDPQAGSVLHIELARSNSRRKRMPGSGPYVVIDNRKKAADDCED  172

Query  562  GPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA---PP  732
              +               P   ++  ++      +      G A    N  K++      
Sbjct  173  TSSDDGDNDSDNRSQSEDPDSSNNKTHSATVKSDEKKVELCG-AEARPNIEKTSEGDLRS  231

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ANLGPNCSE EL Q  S+  GF  LK+++  G PVAF D+++   +  A+  LQ
Sbjct  232  CSTLFIANLGPNCSEDELRQALSQYPGFNGLKLRAKSGMPVAFADYEEVEQATNAMQALQ  291

Query  913  GTMLYSSPGEGMRLEY  960
            G+ML SS   GM +EY
Sbjct  292  GSMLPSSDRGGMHIEY  307



>ref|XP_010487139.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like isoform 
X2 [Camelina sativa]
Length=283

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 138/250 (55%), Gaps = 22/250 (9%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q  AFA F     A+AA+ E
Sbjct  33   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVVAFATFTSHGFAMAALSE  92

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS------EKRMKGPA---VISRVI  588
            LNG+ FD + GSTL I+LA+SNSR K      +R GS      + R K P+         
Sbjct  93   LNGVKFDPQTGSTLHIELARSNSRRK------ERPGSGPYVVIDNRNKKPSKSQDDQSDE  146

Query  589  ESGVGNIHIPG-MGSSAYNTVGYPPTQSYANFDGRAMNEGNANKS-----AAPPCPTLFV  750
            +S       PG  GS   N       +S  +    + N G+  K+      A PC TLF+
Sbjct  147  DSDPDEAQEPGSSGSPKENDNSKSEAESDQDSKAPSAN-GHLEKACEGSFGARPCSTLFI  205

Query  751  ANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYS  930
            ANLGPNC+E+EL Q+ SR  GF  +K+++  G PVAF DF++   + + ++ LQG +L S
Sbjct  206  ANLGPNCTEEELKQLLSRYPGFNIMKIRARGGMPVAFADFEEIEQATDVMNELQGYLLSS  265

Query  931  SPGEGMRLEY  960
            S   GM +EY
Sbjct  266  SDRGGMHIEY  275



>ref|NP_001056827.1| Os06g0151200 [Oryza sativa Japonica Group]
 dbj|BAD69323.1| RNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD69059.1| RNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF18741.1| Os06g0151200 [Oryza sativa Japonica Group]
 dbj|BAG91003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=300

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 140/273 (51%), Gaps = 49/273 (18%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            V TLF+AGLP+DVKPREI+NLF   PG++   L       Q  AF  FV+ Q+A++AM  
Sbjct  31   VLTLFVAGLPDDVKPREIHNLFSSRPGFDHCLLEYTGRGNQVVAFVSFVNHQAALSAMSA  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-------EKRMKGPAVISRVIES  594
            LNG VFD + G  L I+LAKS+SR         RHG        +KR+K     +    +
Sbjct  91   LNGTVFDPDTGDRLHIELAKSSSRK--------RHGDGGVYRVVDKRLKRKERAADHENA  142

Query  595  GVGN-----------------------IHIPGMGSSAYNTV------GYPPTQSYANFDG  687
            G G                        +      S   N +      G P  + +    G
Sbjct  143  GDGGNDDDAWGEDDNGGNDGDGGSDEPLDTENDDSDEKNELPAERSSGQPGLKQHR---G  199

Query  688  RAMNEGNANK--SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAF  861
            +++++   +K  S  PPC TLFVANLG +C+E+EL +V S+  GF  LKM+   G PVAF
Sbjct  200  QSLSDDQPDKLSSDIPPCSTLFVANLGHSCTEEELKEVLSKQPGFHLLKMRRRGGMPVAF  259

Query  862  VDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             DF D   S  A+  LQGT+L SS  +G+++EY
Sbjct  260  ADFTDIESSTAAMDALQGTVLASSDADGLQIEY  292



>gb|AGT16844.1| hypothetical protein SHCRBa_055_F12_F_220 [Saccharum hybrid cultivar 
R570]
Length=313

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 136/268 (51%), Gaps = 37/268 (14%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            V TLF+AGLP+DVKPREI+NLF   P ++   L       Q  AF  F   ++A++AM  
Sbjct  31   VLTLFVAGLPDDVKPREIHNLFSHRPAFDHCLLEYTGRGNQAVAFVTFFTHEAALSAMTS  90

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQ-----RTDDDRHGSEKRMKGPAVISRVIESGV  600
            LNG +FD E G  L I+LAKS SR  R      R  D R     + +G A    V + G 
Sbjct  91   LNGTIFDPETGDRLHIELAKSTSRRPRGGSEVYRVIDKR---ANKTEGNADNENVGDEGD  147

Query  601  GNIH---------------------IPGMGSSAYNTVGYPPTQS----YANFDGRAMNEG  705
              +                           SS  N +  P  QS    +   +G++++  
Sbjct  148  EEVWGEDEDGGNDDIGDGESDEPSGAENENSSDKNEL--PADQSDQPGHKKQNGQSLSND  205

Query  706  NANKSA--APPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDT  879
              +KS+   PPC TLFVANLG  C+E EL +V S+  GF  LKM+   G PVAF DF D 
Sbjct  206  GRDKSSNDIPPCSTLFVANLGHTCTEDELNEVLSKEPGFHVLKMRRHGGMPVAFADFTDI  265

Query  880  ACSMEALSHLQGTMLYSSPGEGMRLEYP  963
              S  A++ LQGT+L SS  +G+ +EYP
Sbjct  266  ESSTAAMNSLQGTVLASSDSDGLHIEYP  293



>ref|XP_009367543.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X2 
[Pyrus x bretschneideri]
Length=282

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 132/244 (54%), Gaps = 10/244 (4%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  32   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  91

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG----  603
            LNG+ FD +  + L I+LA+SNSR KR+         +KR K  A               
Sbjct  92   LNGVKFDPQTVTLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEADTQETSSDDGESDSD  151

Query  604  -----NIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPN  768
                 + H  G   S   T     T   +     A+N+       A  C TLF+ANLGPN
Sbjct  152  EPSETDNHDSG-DKSDLATAKSGETAVDSENAVAAVNDQPEKHVDAGQCSTLFIANLGPN  210

Query  769  CSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGM  948
            C+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS   GM
Sbjct  211  CTEDELKQVLSQYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSSDRGGM  270

Query  949  RLEY  960
             +EY
Sbjct  271  HIEY  274



>ref|XP_002307278.2| hypothetical protein POPTR_0005s18450g [Populus trichocarpa]
 gb|EEE94274.2| hypothetical protein POPTR_0005s18450g [Populus trichocarpa]
Length=117

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 11/105 (10%)
 Frame = +1

Query  229  YTPPHSHDEV-----------RTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNT  375
            Y PP  H +V           R LF+AGLP+D+KP EIY+LFREFPGYESSHLRSPS N+
Sbjct  5    YLPPSDHYQVPTIPSIPPPTVRILFVAGLPDDIKPSEIYSLFREFPGYESSHLRSPSQNS  64

Query  376  QPFAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRS  510
            QPFAFA F DQ SAVAAM+ LNG+VFDLE+GSTL+ DLAKSN+RS
Sbjct  65   QPFAFATFADQPSAVAAMHALNGMVFDLERGSTLYTDLAKSNARS  109



>gb|KHG11089.1| RNA-binding with multiple splicing [Gossypium arboreum]
Length=293

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 140/277 (51%), Gaps = 41/277 (15%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHL--------------------  354
            P    + + TLF++GLP+DVK REI+NLFR   G++   L                    
Sbjct  15   PDQDRNLINTLFVSGLPDDVKAREIHNLFRRRAGFDYCQLKYTGRGNQEAPTWGIGDIGE  74

Query  355  RSPSSNTQPFAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDD  534
            R P S  +  AFA F++ QSA+AAM+ LNG+ FD + GS L I+LA+SNSR KR+     
Sbjct  75   RLPMSGAEVVAFATFLNHQSAIAAMHALNGVKFDPQAGSVLHIELARSNSRRKRKPGSGP  134

Query  535  RHGSEKRMKGPAVISRV-IESGVGNIHIPGMGSSA------------YNTVGYPPTQSYA  675
                + R+K  A       + G  +   P     A             +TV  P     A
Sbjct  135  YVVIDNRIKASANTQETSSDDGDSDTEEPSGAEDADASNKDELKTVKSDTVQDPENSVPA  194

Query  676  NFDG--RAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGA  849
              +   R ++EG      A  C TLF+ANLGPNC+E EL QV S+  GF  LK+++  G 
Sbjct  195  ANEQLERTIDEG------AQACSTLFIANLGPNCTEYELKQVLSKYPGFNMLKIRAKGGM  248

Query  850  PVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            PVAF DF+    + + ++ LQ ++L SS   GM +EY
Sbjct  249  PVAFADFEQVEQATKVMTDLQSSLLPSSDRGGMHIEY  285



>ref|NP_001136951.1| uncharacterized protein LOC100217110 [Zea mays]
 gb|ACF82954.1| unknown [Zea mays]
Length=303

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 133/273 (49%), Gaps = 49/273 (18%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            V TLF+AGLP+DVKPREI+NLF   P ++   L       Q  AF  F   ++A++AM  
Sbjct  34   VLTLFVAGLPDDVKPREIHNLFSHRPAFDHCLLEYTGRGNQAVAFVTFFTHEAALSAMSS  93

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVGNIHI  615
            LNG +FD E G  L I+LAKS SR  R             ++G  VI +      GN   
Sbjct  94   LNGTIFDPESGDRLHIELAKSTSRRPR-----------GGVEGYRVIDKRANKTEGNADH  142

Query  616  PGMGSSAYNTVG--------------------------------YPPTQS----YANFDG  687
              +G    + V                                  P  QS    +   +G
Sbjct  143  ENVGDEDDDEVWGEDEDGGNDNNGDGGSDEPSGTENENPSDKNELPTDQSDQPGHKQQNG  202

Query  688  RAM-NEG-NANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAF  861
            +++ NEG + + S  PPC T+F+ANLG  C+E EL +V S+  GF  LKM+   G PVAF
Sbjct  203  QSLSNEGRDKSSSDIPPCSTIFIANLGHTCTEDELKEVLSKEPGFHVLKMRRRGGMPVAF  262

Query  862  VDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             DF D   S  A++ LQGT+L SS  +G+ +EY
Sbjct  263  ADFTDIESSTAAMNRLQGTVLASSDNDGLHIEY  295



>ref|XP_004964834.1| PREDICTED: single-stranded TG1-3 DNA-binding protein-like [Setaria 
italica]
Length=300

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 139/275 (51%), Gaps = 31/275 (11%)
 Frame = +1

Query  226  LYTP---PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            +Y P   P  H  V TLF+AGLP+DVKPREI+NLF   PG++   L       Q  AF  
Sbjct  19   VYAPRPDPQRHG-VLTLFVAGLPDDVKPREIHNLFSHRPGFDHCLLEYTGRGNQAVAFVT  77

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQ-----RTDDDR-HGSEKRM  558
            F   ++A++AM  LNG +FD E G  L I+LAKS SR  R      R  D R + +E   
Sbjct  78   FFTHEAALSAMTSLNGTIFDPETGDRLHIELAKSTSRRPRGGGEVYRVIDKRANKTEGNA  137

Query  559  KGPAVISRVIESGVGNIH-----------------IPGMGSSAYNTVGYPPTQ--SYANF  681
                V     E+  G                         SS  N +    +   ++   
Sbjct  138  DHENVGDEGDEAAWGEDEDGGSDDNGDGGSDEPSGTENENSSDKNELSADQSDQPAHKQQ  197

Query  682  DGRAMNEGNANKSAA--PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPV  855
            +G++ +    +KS++  PPC TLF+ANLG  C+E EL +V S+  GF  LKM+   G PV
Sbjct  198  NGQSPSNDGRDKSSSDIPPCSTLFIANLGHTCTEDELKEVLSKEPGFHVLKMRRRGGMPV  257

Query  856  AFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            AF DF D   S  A++ LQGT+L SS  +G+ +EY
Sbjct  258  AFADFTDIESSTAAMNSLQGTLLASSDNDGLHIEY  292



>ref|XP_009367542.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' isoform X1 
[Pyrus x bretschneideri]
Length=288

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 135/249 (54%), Gaps = 14/249 (6%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG++S  L+      Q  AFA F + QSA+AA++ 
Sbjct  32   INTLFVSGLPDDVKAREIHNLFRRRPGFDSCQLKYTGRGNQVVAFATFFNHQSAMAALHS  91

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG----  603
            LNG+ FD +  + L I+LA+SNSR KR+         +KR K  A               
Sbjct  92   LNGVKFDPQTVTLLHIELARSNSRRKRKPGSGAYVVIDKRTKKEADTQETSSDDGESDSD  151

Query  604  -----NIHIPGMGS---SAYNTVGYPPTQSYANFDG--RAMNEGNANKSAAPPCPTLFVA  753
                 + H  G  S   +A         ++  + +    A+N+       A  C TLF+A
Sbjct  152  EPSETDNHDSGDKSDLATAKRLKELENGETAVDSENAVAAVNDQPEKHVDAGQCSTLFIA  211

Query  754  NLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSS  933
            NLGPNC+E EL QV S+  GF  +K+++  G PVAF DF++   + +A+  L+G+ L SS
Sbjct  212  NLGPNCTEDELKQVLSQYPGFNVIKLRAKGGMPVAFADFEEIEQANKAMDELRGSSLPSS  271

Query  934  PGEGMRLEY  960
               GM +EY
Sbjct  272  DRGGMHIEY  280



>ref|NP_187983.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE75400.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=296

 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/264 (37%), Positives = 137/264 (52%), Gaps = 33/264 (13%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQP------------------  381
            + TLF++GLP DVK REI+NLFR   G+ES  L+      Q                   
Sbjct  36   INTLFVSGLPNDVKAREIHNLFRRRHGFESCQLKYTGRGDQVCKNLQFLFFFIPIFRKAV  95

Query  382  FAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD------DDRHG  543
             AFA F   + A+AAM ELNG+ FD + GS L I+LA+SNSR K +         D+R+ 
Sbjct  96   VAFATFTSHRFALAAMNELNGVKFDPQTGSNLHIELARSNSRRKERPGSGPYVVIDNRNK  155

Query  544  ------SEKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEG  705
                   ++  +G +    V E G  N   P    +  +     P     + +G  + + 
Sbjct  156  EISKSQDDQSDEGDSDPDEVQEPG--NSDSPKENDTTKSEADSEPDSKAPSANGH-LEKA  212

Query  706  NANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTAC  885
            +   S A  C TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++   
Sbjct  213  SEGGSGARACSTLFIANLGPNCTEDELKQLLSRYPGFHILKIRARGGMPVAFADFEEIEQ  272

Query  886  SMEALSHLQGTMLYSSPGEGMRLE  957
            + +A++HLQG +L SS   GM +E
Sbjct  273  ATDAMNHLQGNLLSSSDRGGMHIE  296



>gb|AFW69180.1| hypothetical protein ZEAMMB73_553458 [Zea mays]
Length=208

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 10/134 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            + DEVRTLFIAGLP D KPRE+YNLFR+FPGY SSHLR+  S +Q +AFAVF DQQSA+A
Sbjct  53   ARDEVRTLFIAGLPADAKPREVYNLFRDFPGYVSSHLRTGKS-SQAYAFAVFADQQSALA  111

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGP--------AVI  576
            A+   NG+VFDLEK  +L +DLAKSNSRSKR R+DD   +  EKR + P          +
Sbjct  112  ALSATNGMVFDLEKNCSLHVDLAKSNSRSKRLRSDDTSPYSPEKRNRKPRGFPDSVTQAL  171

Query  577  SRVIESGVGNIHIP  618
            S V+ S   + H+P
Sbjct  172  SLVLLSARTHPHLP  185



>gb|ELU06415.1| hypothetical protein CAPTEDRAFT_112394, partial [Capitella teleta]
Length=347

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 144/300 (48%), Gaps = 70/300 (23%)
 Frame = +1

Query  253  EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSN---TQPFAFAVFVDQQSAVA  423
            +VRTLF++GLP D KPRE+Y LFR + GYE S L+    N   T P  F  F  + +A A
Sbjct  1    QVRTLFVSGLPMDAKPRELYLLFRAYKGYEGSLLKVTGKNGKTTSPVGFVTFTSRVAAEA  60

Query  424  AMYELN-GIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGV  600
            A  +L  G+ FD +   TL ++ AKSN++  + +    +  +      P  I  +    +
Sbjct  61   AKQDLQQGVRFDPDLPQTLRLEFAKSNTKVTKPKQQSPQPAATH----PTFIHPLTGQEI  116

Query  601  GNIHIPGM-GSSAYNTVGYP-----------------------------PTQSYANFDGR  690
            G    PGM G+ A+   G+P                             P  + +     
Sbjct  117  GGAFFPGMPGAEAWP--GHPLVTGAYTELSPALHHPALLQHPALAAQVHPALAMSGHHAA  174

Query  691  AMNEG--NANKSAAP----------------------------PCPTLFVANLGPNCSEQ  780
            AMN    + + +A+P                            PC TLFVANLGP CSEQ
Sbjct  175  AMNSAVPHPHMAASPVLGSPVGGATSTSTLTSPSLATATSTHAPCSTLFVANLGPFCSEQ  234

Query  781  ELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            EL  +F    GFL+L+M +  G+PVAFV+++D  C+MEA+  LQG +L+SS   G+R+EY
Sbjct  235  ELKDLFQSISGFLRLRMHNKGGSPVAFVEYQDVRCAMEAMLKLQGCVLFSSERGGIRIEY  294



>ref|NP_001132012.1| hypothetical protein [Zea mays]
 gb|ACF80683.1| unknown [Zea mays]
 gb|AFW69178.1| hypothetical protein ZEAMMB73_553458 [Zea mays]
 gb|AFW69179.1| hypothetical protein ZEAMMB73_553458 [Zea mays]
Length=203

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRTLFIAGLP D KPRE+YNLFR+FPGY SSHLR+  S +Q +AFAVF DQQSA+AA+
Sbjct  55   DEVRTLFIAGLPADAKPREVYNLFRDFPGYVSSHLRTGKS-SQAYAFAVFADQQSALAAL  113

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGP  567
               NG+VFDLEK  +L +DLAKSNSRSKR R+DD   +  EKR + P
Sbjct  114  SATNGMVFDLEKNCSLHVDLAKSNSRSKRLRSDDTSPYSPEKRNRKP  160



>ref|XP_001770950.1| predicted protein [Physcomitrella patens]
 gb|EDQ64280.1| predicted protein [Physcomitrella patens]
Length=212

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 120/193 (62%), Gaps = 12/193 (6%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            + +EV+TLF++GLP+D+K REIYNLFR F GYES  L+      Q  AFAVF DQ +A+ 
Sbjct  11   AEEEVKTLFLSGLPDDIKEREIYNLFRNFEGYESCQLKFSGRGFQIVAFAVFTDQATALK  70

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIESGVG  603
            A  ELNG+ FD + G+ L I+LA++NSR+KR R+      S         +     +GVG
Sbjct  71   AKEELNGLKFDPQTGAVLHIELARANSRTKRSRSVKTLTESFC-----GTVFGFTLTGVG  125

Query  604  -NIHIPGMGSSAYNTV-GYPPTQS-YAN---FDGRAMNEGNANKSAAPPCPTLFVANLGP  765
              +H+PG+  S +N + G+PP  S + N   F G  +        + PPC TLF+ANLGP
Sbjct  126  ATLHMPGLHPSIFNDMPGFPPPPSDFTNLRRFQG-MVPLPPPAPGSNPPCSTLFIANLGP  184

Query  766  NCSEQELTQVFSR  804
            +C+E+EL+Q+ SR
Sbjct  185  SCTEEELSQLLSR  197



>gb|EEE65097.1| hypothetical protein OsJ_20145 [Oryza sativa Japonica Group]
Length=315

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 140/288 (49%), Gaps = 64/288 (22%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            V TLF+AGLP+DVKPREI+NLF   PG++   L       Q  AF  FV+ Q+A++AM  
Sbjct  31   VLTLFVAGLPDDVKPREIHNLFSSRPGFDHCLLEYTGRGNQVVAFVSFVNHQAALSAMSA  90

Query  436  LN---------------GIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS-------E  549
            LN               G VFD + G  L I+LAKS+SR         RHG        +
Sbjct  91   LNYVIPGVKYPDHREYSGTVFDPDTGDRLHIELAKSSSRK--------RHGDGGVYRVVD  142

Query  550  KRMKGPAVISRVIESGVGN-----------------------IHIPGMGSSAYNTV----  648
            KR+K     +    +G G                        +      S   N +    
Sbjct  143  KRLKRKERAADHENAGDGGNDDDAWGEDDNGGNDGDGGSDEPLDTENDDSDEKNELPAER  202

Query  649  --GYPPTQSYANFDGRAMNEGNANK--SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGF  816
              G P  + +    G+++++   +K  S  PPC TLFVANLG +C+E+EL +V S+  GF
Sbjct  203  SSGQPGLKQHR---GQSLSDDQPDKLSSDIPPCSTLFVANLGHSCTEEELKEVLSKQPGF  259

Query  817  LKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
              LKM+   G PVAF DF D   S  A+  LQGT+L SS  +G+++EY
Sbjct  260  HLLKMRRRGGMPVAFADFTDIESSTAAMDALQGTVLASSDADGLQIEY  307



>ref|NP_001058407.1| Os06g0687500 [Oryza sativa Japonica Group]
 dbj|BAD46058.1| RNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF20321.1| Os06g0687500 [Oryza sativa Japonica Group]
 dbj|BAG87959.1| unnamed protein product [Oryza sativa Japonica Group]
Length=219

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +1

Query  217  AAPLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAV  396
            A PL  PP   DE+RTLFIAGLP D K RE+YNLFR+FPGY SSHLR+   ++Q +AFAV
Sbjct  59   AEPL--PPR--DELRTLFIAGLPGDAKAREVYNLFRDFPGYVSSHLRTSGKSSQAYAFAV  114

Query  397  FVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDD-DRHGSEKRMKGP  567
            F DQ SA+AAM   NG +FDLE   TL +DLAKSNSRSKR RTDD   + SEK+ + P
Sbjct  115  FADQPSALAAMSATNGRIFDLENNCTLHVDLAKSNSRSKRSRTDDVPSYSSEKKARNP  172



>gb|EEC80024.1| hypothetical protein OsI_21699 [Oryza sativa Indica Group]
Length=315

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 104/300 (35%), Positives = 142/300 (47%), Gaps = 64/300 (21%)
 Frame = +1

Query  220  APLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVF  399
            AP   P      V TLF+AGLP+DVKPREI+ LF   PG++   L       Q  AF  F
Sbjct  19   APHPYPDTQRQGVLTLFVAGLPDDVKPREIHKLFSSRPGFDHCLLEYTGRGNQVVAFVSF  78

Query  400  VDQQSAVAAMYELN---------------GIVFDLEKGSTLFIDLAKSNSRSKRQRTDDD  534
            V+ Q+A++AM  LN               G VFD + G  L I+LAKS+SR         
Sbjct  79   VNHQAALSAMSALNYVIPGVKYPDHREYSGTVFDPDTGDRLHIELAKSSSRK--------  130

Query  535  RHGS-------EKRMKGPAVISRVIESGVGN-----------------------IHIPGM  624
            RHG        +KR+K     +    +G G                        +     
Sbjct  131  RHGDGGVYRVVDKRLKRKERAADHENAGDGGNDDDAWGEDDNGGNDGDGGSDEPLDTEND  190

Query  625  GSSAYNTV------GYPPTQSYANFDGRAMNEGNANK--SAAPPCPTLFVANLGPNCSEQ  780
             S   N +      G P  + +    G+++++   +K  S  PPC TLFVANLG +C+E+
Sbjct  191  DSDEKNELPAERSSGQPGLKQHR---GQSLSDDQPDKLSSDIPPCSTLFVANLGHSCTEE  247

Query  781  ELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            EL +V S+  GF  LKM+   G PVAF DF D   S  A+  LQGT+L SS  +G+++EY
Sbjct  248  ELKEVLSKQPGFHLLKMRRRGGMPVAFADFTDIESSTAAMDALQGTVLASSDADGLQIEY  307



>ref|XP_002437844.1| hypothetical protein SORBIDRAFT_10g003600 [Sorghum bicolor]
 gb|EER89211.1| hypothetical protein SORBIDRAFT_10g003600 [Sorghum bicolor]
Length=826

 Score =   148 bits (374),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 133/260 (51%), Gaps = 26/260 (10%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            V TLF+AGLP+DVKPREI+NLF   P ++   L       Q  AF  F   ++A++AM  
Sbjct  32   VLTLFVAGLPDDVKPREIHNLFSHRPAFDHCLLEYTGRANQVVAFVTFFTHEAALSAMTS  91

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQ-----RTDDDR----HGSEKRMKGPAVISRVI  588
            LNG +FD E G  L I+LAKS SR  R      R  D R     G+     G  V   V 
Sbjct  92   LNGTIFDPETGYRLHIELAKSTSRRPRGGGEVYRVIDKRTNKTEGNADENVGDEVDEEVW  151

Query  589  ---ESGVGNIHIPGMGSSAYNTVG--------YPPTQS----YANFDGRAMNEGNANKSA  723
               E G  + +  G       T           P  QS    +   +G++++    +KS+
Sbjct  152  GGDEDGANDDNGDGESDEPSGTENENSSDKNELPADQSDQPRHKKQNGKSLSNDGRDKSS  211

Query  724  --APPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
               PPC TLF+ANLG  C++ EL +V S+  GF  LKM+   G PVAF DF D   S  A
Sbjct  212  NDIPPCSTLFIANLGDTCTKDELNEVLSKEPGFDVLKMRRRGGMPVAFADFTDIESSTAA  271

Query  898  LSHLQGTMLYSSPGEGMRLE  957
            ++ LQGT+L SS  +G+ +E
Sbjct  272  MNSLQGTVLASSDSDGLHIE  291



>ref|XP_005708732.1| RNA-binding protein, putative [Galdieria sulphuraria]
 gb|EME32212.1| RNA-binding protein, putative [Galdieria sulphuraria]
Length=333

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 140/269 (52%), Gaps = 40/269 (15%)
 Frame = +1

Query  232  TPPHSHDEVRTLFIAGLPEDVKPREIYNLFR-EFPGYESSHLRSPSSNTQPFAFAVFVDQ  408
            T   S D VRTLFI G P DV  RE++NLFR  +P Y+   +++ S   +P  FAVF  +
Sbjct  18   TKQESEDTVRTLFITGFPADVLEREVHNLFRFRYPLYDGCIIKNSSRRKEPVVFAVFRTR  77

Query  409  QSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-----DDDRHGS----EKRMK  561
            + A  AM + +GIVFD   GS L I+ AKSN+R KR        +D+R       EKR +
Sbjct  78   EEAEEAMKDFDGIVFDPALGSKLKIEFAKSNTRVKRDWAHSSSFEDNRRNEGRRVEKRYR  137

Query  562  GP---------AVISRV---IESGVGNI---HIPGMGSSAYNTVGYPPTQSYANFDGRAM  696
            G           V++++    + G  N+   + PG+    ++ V  P T S  +F+  A 
Sbjct  138  GSDYSLGTGTGGVVAQLPLFTQPGSWNLASNNTPGLQYPMFSNVSLPLT-SNPSFNQNA-  195

Query  697  NEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQ-STYGAPVAFVDFK  873
                        C TLFV NL P+ ++ EL  +FSRC GF ++++      APVAFV+F 
Sbjct  196  ------------CSTLFVGNLSPSVTQAELENLFSRCTGFRRVRLNIKDERAPVAFVEFT  243

Query  874  DTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            D+  S +A+   Q   L SS   G+R+E+
Sbjct  244  DSVYSTQAMQQCQNVPLPSSEKGGIRIEF  272



>gb|KHG24004.1| RNA-binding with multiple splicing 2 [Gossypium arboreum]
Length=352

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 125/256 (49%), Gaps = 23/256 (9%)
 Frame = +1

Query  247  HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAA  426
            HDEVRT+FI GLPEDVK RE+ NL R  PGYE+S +       +P  FA+F   + AVAA
Sbjct  72   HDEVRTIFITGLPEDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSSARLAVAA  129

Query  427  MYELNGIVFDLEKGSTLFIDLAKSNSRSKRQ-RTDDDRHGSEKRMKGPAVISRVIESGVG  603
               L  +VFD E  S L +++AK N   KR   TD D +   KR++     S    +   
Sbjct  130  KDALQEMVFDAESKSLLHVEMAKKNLFVKRGIVTDSDAYDQTKRLRTGGNYSHSPYTSPS  189

Query  604  NIHIPGMGSSAYNTVGY----PPTQSYANFDGRAMNEGNA-------------NKSAAPP  732
              H P   +  +   GY    PP   Y  +    +                  N    PP
Sbjct  190  PFHPP---APVWGPHGYMAPTPPYDPYGCYPVPPVPMPTPAPVPAPSSYVPVQNTKDNPP  246

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D + +      LQ
Sbjct  247  CNTLFIGNLGENINEEELRGLFSAQPGFKQMKILRQERHTVCFIEFEDVSTATNVHHSLQ  306

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  307  GAVIPSSGSVGMRIQY  322



>gb|EYU21388.1| hypothetical protein MIMGU_mgv1a012396mg [Erythranthe guttata]
Length=251

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 121/246 (49%), Gaps = 42/246 (17%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAMYE  435
            + TLF++GLP+DVK REI+NLFR  PG+ES  L+      Q                   
Sbjct  29   INTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGNQ-------------------  69

Query  436  LNGIVFDLEKGSTLFIDLAKSNSRSKRQ-----------RTDDDRHGSEKRMKGPAVISR  582
              G+ FD E G TL I+LA+SNSR K +           RT   + G++ R         
Sbjct  70   --GVKFDPETGLTLHIELARSNSRRKHKPGSGPYVVIDLRT---KSGADARETSSDDDDG  124

Query  583  VIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLG  762
              E    N+       SA +       Q+  + D  A +   A K++   C TLF+ANLG
Sbjct  125  SDE----NVDAVNQDDSAADKSA---EQTTTSIDAFAPDNDQAEKTSDGACSTLFIANLG  177

Query  763  PNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGE  942
            PNC+E EL QV S   GF  LK+++  G PVAF DF+    +  A++ LQG+ L SS   
Sbjct  178  PNCTEDELKQVLSLYPGFNSLKIRARGGMPVAFADFEKVEQATHAINALQGSTLASSDRG  237

Query  943  GMRLEY  960
            GM +EY
Sbjct  238  GMHIEY  243



>ref|XP_007023092.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY25714.1| RNA-binding family protein [Theobroma cacao]
Length=328

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 123/256 (48%), Gaps = 19/256 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            SHDEVRT+FI GLPEDVK RE+ NL R  PGYE+S +       +P  FA+F   Q AVA
Sbjct  45   SHDEVRTIFITGLPEDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSSAQLAVA  102

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  ++FD E  S L I++AK N   KR    D + +   KR++     S    +  
Sbjct  103  AKDSLQDMLFDAESKSVLHIEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHSAYTAP  162

Query  601  GNIHIPG---MGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAPP  732
               H P     G   Y     PP   Y  +    +                  N    PP
Sbjct  163  SPFHPPPAPVWGPQGYMAPTPPPYDPYGGYPVPPVPMPTPAPVPAPSSYVPVQNTKDNPP  222

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +     +LQ
Sbjct  223  CNTLFIGNLGENINEEELRGLFSVQPGFKQMKILRQERHTVCFIEFEDVNTATNVHHNLQ  282

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  283  GAVIPSSGSVGMRIQY  298



>gb|KHG04234.1| RNA-binding with multiple splicing 2 [Gossypium arboreum]
Length=326

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 122/257 (47%), Gaps = 22/257 (9%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            SHDEVRT+FI GLPEDVK RE+ NL R  PGYE+S +       +P  FA+F   Q A+A
Sbjct  44   SHDEVRTIFITGLPEDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSSAQLAIA  101

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  +VFD E  S L I++AK N   KR    D + +   KR++     S    +  
Sbjct  102  AKDALQEMVFDAESKSVLHIEMAKKNLFVKRGIVADSNSYDQSKRLRTGGDYSH--SAYT  159

Query  601  GNIHIPGMGSSAYNTVGY----PPTQSYANFDGRAMNEGNA-------------NKSAAP  729
                     +  +   GY    PP   Y  +    +                  N    P
Sbjct  160  TPPPFHPPPAPVWGPHGYLSPTPPYDPYGGYPVPPVPMPTPTPVPAPSSYVPVQNTKDNP  219

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +      L
Sbjct  220  PCNTLFIGNLGENINEEELRGLFSAQPGFKQMKILRQERHTVCFIEFEDVNSASNVHHSL  279

Query  910  QGTMLYSSPGEGMRLEY  960
            QG ++ SS   GMR++Y
Sbjct  280  QGAVIPSSGSIGMRIQY  296



>ref|XP_006568351.1| PREDICTED: protein couch potato-like isoform X3 [Apis mellifera]
 ref|XP_006611189.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X4 [Apis dorsata]
Length=323

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 139/279 (50%), Gaps = 43/279 (15%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRVI  588
            AA  +L G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S   
Sbjct  80   AAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPFF  139

Query  589  ESGVGNIHIPGMGSSA--------YNTVGYP---------------------------PT  663
              G    H P   S+A        + T+ +P                           P+
Sbjct  140  PGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQAPMSLPHPTTLTSIHASLPHFLPS  199

Query  664  QSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTY  843
             + A+  G   ++ N   S A PC TLFVANLG   SE EL  +FS   GF +L+M +  
Sbjct  200  PALASPVGSPSSQPNIAVSNA-PCSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMHTKG  258

Query  844  GAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  GSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  297



>gb|KDO46300.1| hypothetical protein CISIN_1g020297mg [Citrus sinensis]
Length=306

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 125/261 (48%), Gaps = 19/261 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            +HDEVRT+FI GLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q AVA
Sbjct  45   AHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSTAQLAVA  102

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  ++FD E  S L  ++AK N   KR    D + +   KR++     +    S  
Sbjct  103  AKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAP  162

Query  601  GNIHIP--------------GMGSSAYNTVGYPPTQSYANFDGRAMNE--GNANKSAAPP  732
               H P                    Y   G PP Q  A     A +      N    PP
Sbjct  163  SPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPP  222

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +     +LQ
Sbjct  223  CNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQ  282

Query  913  GTMLYSSPGEGMRLEYPMLAF  975
            G ++ SS   GMR++YP   F
Sbjct  283  GAVIPSSGSVGMRIQYPFCCF  303



>ref|XP_006568349.1| PREDICTED: protein couch potato-like isoform X1 [Apis mellifera]
 ref|XP_006611187.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Apis dorsata]
Length=325

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 139/281 (49%), Gaps = 45/281 (16%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELNGIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRVI  588
            AA  +L G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S   
Sbjct  80   AAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPFF  139

Query  589  ESGVGNIHIPGMGSSA--------YNTVGYP-----------------------------  657
              G    H P   S+A        + T+ +P                             
Sbjct  140  PGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHFL  199

Query  658  PTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQS  837
            P+ + A+  G   ++ N   S A PC TLFVANLG   SE EL  +FS   GF +L+M +
Sbjct  200  PSPALASPVGSPSSQPNIAVSNA-PCSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMHT  258

Query  838  TYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
              G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  KGGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  299



>ref|XP_008202232.1| PREDICTED: protein couch potato isoform X2 [Nasonia vitripennis]
Length=337

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 143/288 (50%), Gaps = 55/288 (19%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQS  414
            S DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  + N +   P  F  F  +  
Sbjct  18   SEDEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTNKNGKTASPVGFVTFHTRSE  77

Query  415  AVAAMYEL-NGIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPAVISRVI  588
            A AA ++L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P      +
Sbjct  78   AEAAKHDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHP------L  131

Query  589  ESGVGNIHIPG-----MGSSAYNTVG-YPPTQSYANFDGRAMNEGNANKS----------  720
               +G+   PG         AY+T G  P T  +A     A++   A+ S          
Sbjct  132  TGPLGSPFFPGGPELWHHPLAYSTAGELPGTLQHAALVHPALHPQQASMSLPHPTTLTSL  191

Query  721  -------------AAP---------------PCPTLFVANLGPNCSEQELTQVFSRCRGF  816
                         A+P               PC TLFVANLG   SE EL ++F+   GF
Sbjct  192  HASLPHFLPSPALASPVGSSSSQPSIAVSNAPCSTLFVANLGQFVSEHELKEIFNSFPGF  251

Query  817  LKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             +L+M +  G+PVAFV+++D   + +A++ LQG++L SS    +R+EY
Sbjct  252  CRLRMHTKGGSPVAFVEYQDVRYAAQAMATLQGSLLVSSDRGAIRIEY  299



>ref|XP_008546747.1| PREDICTED: protein couch potato-like [Microplitis demolitor]
Length=328

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/288 (33%), Positives = 143/288 (50%), Gaps = 58/288 (20%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE+S L+  S N +   P  F  F  +  A 
Sbjct  22   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYENSLLKVTSKNGKTASPVGFVTFHTRAGAE  81

Query  421  AAMYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P      +  
Sbjct  82   AAKQDLQQGVKFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHP------LTG  135

Query  595  GVGNIHIPG-----------------MGSSAYNTVGYP----------------------  657
             +GN   P                   G+  + T+ +P                      
Sbjct  136  HIGNPFFPSAPELWHHPLAYSAAGELQGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIH  195

Query  658  -------PTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGF  816
                   P+ + A+  G + ++ +   S AP C TLFVANLG   SE ELT++F+   GF
Sbjct  196  ASLPHFLPSPALASPVGSSSSQPSLAVSNAP-CSTLFVANLGQFVSEHELTEIFNSFSGF  254

Query  817  LKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             +L+M +  G+PVAFV+F+D   + +A++ LQG++L SS    +R+EY
Sbjct  255  CRLRMHTKGGSPVAFVEFQDVRYAAQAMAALQGSLLLSSDRGPIRIEY  302



>emb|CDO97764.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 124/256 (48%), Gaps = 19/256 (7%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLPEDVK RE+ NL R  PGYE+S +        P  FA+F   Q A+AA 
Sbjct  51   DEVRTIFISGLPEDVKERELQNLLRWLPGYEASQVNF--KGEHPMGFALFATPQQAIAAK  108

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGVGN  606
              L  +VFD E  S L  ++AK N   KR    D + +   KR++     +    S    
Sbjct  109  DALRDLVFDAESNSILHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYTHTGYSSPSL  168

Query  607  IH---IPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAAP-------------PCP  738
             H    P  G   Y     PP   YA +    +        +AP             PC 
Sbjct  169  FHPPPAPVWGPHGYMAPAPPPYDPYAGYPVAPVPMPAPAPVSAPSSYVPVQNTKDNPPCN  228

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +     +LQG 
Sbjct  229  TLFIGNLGENINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHNLQGA  288

Query  919  MLYSSPGEGMRLEYPM  966
            ++ SS   GMR++YP+
Sbjct  289  VIPSSGSVGMRIQYPL  304



>emb|CDY27533.1| BnaC01g32160D [Brassica napus]
Length=343

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 125/261 (48%), Gaps = 21/261 (8%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            PP+  DE+RT+FIAGLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q 
Sbjct  50   PPY--DELRTIFIAGLPDDVKERELLNLLRWLPGYEASQVN--FKGEKPMGFALFSTAQF  105

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVI-  588
            A+AA   L  +VFD E  S L  ++AK N   KR    D + +   KR++     +  + 
Sbjct  106  ALAARDALQHLVFDAESKSVLHAEMAKKNLFVKRGIVGDSNAYDQSKRLRTGGDCTHSVY  165

Query  589  --ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA------------  726
                              Y +   PP   Y  +    +    +   AA            
Sbjct  166  SPSPFHPPPPQVWGPPHGYLSPAAPPYDPYGGYHAPPVPMPPSAPIAAPSSYVPVQNVKD  225

Query  727  -PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALS  903
             PPC TLF+ NLG N +E+EL  + S   GF ++K+       V F++F+D   +     
Sbjct  226  NPPCNTLFIGNLGENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHH  285

Query  904  HLQGTMLYSSPGEGMRLEYPM  966
            +LQG ++ SS   GMR++YP+
Sbjct  286  NLQGAVIPSSGSVGMRIQYPL  306



>ref|XP_008202231.1| PREDICTED: protein couch potato isoform X1 [Nasonia vitripennis]
Length=339

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 145/285 (51%), Gaps = 47/285 (16%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQS  414
            S DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  + N +   P  F  F  +  
Sbjct  18   SEDEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTNKNGKTASPVGFVTFHTRSE  77

Query  415  AVAAMYELN-GIVFDLEKGSTLFIDLAKSNSRSKRQR-----------------------  522
            A AA ++L  G+ FD +   T+ ++ AKSN++  + +                       
Sbjct  78   AEAAKHDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGPLGS  137

Query  523  -----------------TDDDRHGSEKR--MKGPAVISRVIESGVGNIHIPGMGSSAYNT  645
                             T  +  G+ +   +  PA+  +V ++ +   H   + S   + 
Sbjct  138  PFFPGGPELWHHPLAYSTAGELPGTLQHAALVHPALHPQVPQASMSLPHPTTLTSLHASL  197

Query  646  VGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKL  825
              + P+ + A+  G + ++ +   S AP C TLFVANLG   SE EL ++F+   GF +L
Sbjct  198  PHFLPSPALASPVGSSSSQPSIAVSNAP-CSTLFVANLGQFVSEHELKEIFNSFPGFCRL  256

Query  826  KMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +M +  G+PVAFV+++D   + +A++ LQG++L SS    +R+EY
Sbjct  257  RMHTKGGSPVAFVEYQDVRYAAQAMATLQGSLLVSSDRGAIRIEY  301



>ref|XP_008202233.1| PREDICTED: protein couch potato isoform X3 [Nasonia vitripennis]
Length=327

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 145/285 (51%), Gaps = 47/285 (16%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQS  414
            S DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  + N +   P  F  F  +  
Sbjct  18   SEDEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTNKNGKTASPVGFVTFHTRSE  77

Query  415  AVAAMYELN-GIVFDLEKGSTLFIDLAKSNSRSKRQR-----------------------  522
            A AA ++L  G+ FD +   T+ ++ AKSN++  + +                       
Sbjct  78   AEAAKHDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGPLGS  137

Query  523  -----------------TDDDRHGSEKR--MKGPAVISRVIESGVGNIHIPGMGSSAYNT  645
                             T  +  G+ +   +  PA+  +V ++ +   H   + S   + 
Sbjct  138  PFFPGGPELWHHPLAYSTAGELPGTLQHAALVHPALHPQVPQASMSLPHPTTLTSLHASL  197

Query  646  VGYPPTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKL  825
              + P+ + A+  G + ++ +   S AP C TLFVANLG   SE EL ++F+   GF +L
Sbjct  198  PHFLPSPALASPVGSSSSQPSIAVSNAP-CSTLFVANLGQFVSEHELKEIFNSFPGFCRL  256

Query  826  KMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +M +  G+PVAFV+++D   + +A++ LQG++L SS    +R+EY
Sbjct  257  RMHTKGGSPVAFVEYQDVRYAAQAMATLQGSLLVSSDRGAIRIEY  301



>ref|XP_002316452.2| hypothetical protein POPTR_0010s25610g [Populus trichocarpa]
 gb|EEF02623.2| hypothetical protein POPTR_0010s25610g [Populus trichocarpa]
Length=336

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 121/259 (47%), Gaps = 18/259 (7%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P +HDEVRT+FI G P+DVK RE+ NL R  PGYE+S +       +   FA+F   Q A
Sbjct  50   PPTHDEVRTIFITGFPDDVKERELQNLLRWLPGYEASQVNY--KGEKAMGFALFSCAQHA  107

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIES  594
            +AA   L  +VFD +  S L  ++AK N   KR    D + +   KR++     S    +
Sbjct  108  IAAKDALQDMVFDADTKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHTTYT  167

Query  595  GVGNIHIPG--MGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAP  729
                 H P    G   Y T   PP   Y  +    +                  N    P
Sbjct  168  SPSPFHPPPPVWGPHGYMTPAPPPYDPYGGYPVPQVPMPPPAPIPAPSSYVPVQNTKDNP  227

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      L
Sbjct  228  PCNTLFIGNLGENINEDELRGLFSVQPGFKQMKVLRQERHTVCFIEFEDLNSATNVHHTL  287

Query  910  QGTMLYSSPGEGMRLEYPM  966
            QG ++ SS   GMR++YP 
Sbjct  288  QGAVIPSSGSVGMRIQYPF  306



>gb|KDO79111.1| hypothetical protein CISIN_1g0206322mg, partial [Citrus sinensis]
 gb|KDO79112.1| hypothetical protein CISIN_1g0206322mg, partial [Citrus sinensis]
Length=129

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S+DEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS + N+QPFAFAVF DQQSA+ 
Sbjct  64   SYDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSSTQNSQPFAFAVFSDQQSALG  123

Query  424  AMYELN  441
            AMY LN
Sbjct  124  AMYALN  129



>gb|KDO35809.1| hypothetical protein CISIN_1g032280mg [Citrus sinensis]
Length=144

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            S+DEVRTLF+AGLPEDVKPREIYNLFREFPGYESSHLRS + N+QPFAFAVF DQQSA+ 
Sbjct  60   SYDEVRTLFVAGLPEDVKPREIYNLFREFPGYESSHLRSSTQNSQPFAFAVFSDQQSALG  119

Query  424  AMYELNGIVFDLEKGSTLF  480
            AMY LN         S LF
Sbjct  120  AMYALNNFAPSDSACSLLF  138



>ref|XP_011046510.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Populus 
euphratica]
Length=334

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 120/257 (47%), Gaps = 18/257 (7%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P +HDEVRT+FI G P+DVK RE+ NL R  PGYE+S +       +   FA+F   Q A
Sbjct  50   PPTHDEVRTIFITGFPDDVKERELQNLLRWLPGYEASQVNY--KGEKAMGFALFSCAQHA  107

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIES  594
            +AA   L  +VFD +  S L  ++AK N   KR    D + +   KR++     S    +
Sbjct  108  IAAKDALQDMVFDADTKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHTTYT  167

Query  595  GVGNIHIPG--MGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAP  729
                 H P    G   Y T   PP   Y  +    +                  N    P
Sbjct  168  SPSPFHPPPPVWGPHGYMTPAPPPYDPYGGYPVPQVPMPPPAPIPAPSSYVPVQNTKDNP  227

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      L
Sbjct  228  PCNTLFIGNLGENINEDELRGLFSVQSGFKQMKVLRQERHTVCFIEFEDVNSATNVHHTL  287

Query  910  QGTMLYSSPGEGMRLEY  960
            QG ++ SS   GMR++Y
Sbjct  288  QGAVIPSSGSVGMRIQY  304



>ref|XP_006568350.1| PREDICTED: protein couch potato-like isoform X2 [Apis mellifera]
 ref|XP_006611188.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Apis dorsata]
Length=324

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 139/280 (50%), Gaps = 44/280 (16%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRV  585
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S  
Sbjct  80   AAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPF  139

Query  586  IESGVGNIHIPGMGSSA--------YNTVGYP---------------------------P  660
               G    H P   S+A        + T+ +P                           P
Sbjct  140  FPGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQAPMSLPHPTTLTSIHASLPHFLP  199

Query  661  TQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQST  840
            + + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M + 
Sbjct  200  SPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMHTK  258

Query  841  YGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  GGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  298



>ref|XP_002525006.1| RNA-binding protein with multiple splicing, putative [Ricinus 
communis]
 gb|EEF37378.1| RNA-binding protein with multiple splicing, putative [Ricinus 
communis]
Length=337

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 119/256 (46%), Gaps = 19/256 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            +HDEVRT+FI GLPEDVK RE+ NL R  PGYE+S +       +P  FA+F   Q A+A
Sbjct  54   THDEVRTIFITGLPEDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSTSQFAIA  111

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRV-----  585
            A   L  ++FD E  S L  ++AK N   KR    D + +   KR++     S       
Sbjct  112  AKEALQDMLFDAESKSILHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHTAYTTP  171

Query  586  -----IESGVGNIH--IPGMGSSAYNTVGYPPTQSYANFDGRAMNEGN----ANKSAAPP  732
                   + V   H  +           GYP  Q             +     N    PP
Sbjct  172  SPFHPPPAPVWGPHGYMAPAPPPYDPYAGYPVPQVPMPAPAPMPAPSSYLPVQNTKDNPP  231

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      LQ
Sbjct  232  CNTLFIGNLGENINEDELRGLFSVQPGFKQMKVLRQERHTVCFIEFEDVNSASNVHRSLQ  291

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  292  GAVIPSSGSVGMRIQY  307



>ref|XP_010928627.1| PREDICTED: cell wall integrity protein scw1-like isoform X2 [Elaeis 
guineensis]
Length=320

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 119/253 (47%), Gaps = 20/253 (8%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP DVK RE++NL R  PG+E+S +       QP  FA+F   Q AVAA 
Sbjct  39   DEVRTIFISGLPGDVKERELHNLLRWLPGFEASQINF--KGEQPMGFALFSSPQHAVAAK  96

Query  430  YELNGIVFDLEKGSTLFIDLAKSN------------SRSKRQRTDDDRHGSEKRMKGPAV  573
              L  +VFD E  S L  ++AK N             +SKR RT  D + +         
Sbjct  97   NALQDLVFDAETNSVLHTEMAKKNLFVKRVANSSSVDQSKRLRTGGDYNYASYPTPPFHP  156

Query  574  ISRVIESGVGNIHIPGMGSSAYNTVGYP-PTQSYANFDGRAMNEGNA---NKSAAPPCPT  741
                   G      P      Y   GYP P  S           G +   N    PPC T
Sbjct  157  PPPPPVYGTPGYMAPSAPYDPYG--GYPVPQVSMPTPAPMPAPSGYSPIQNTKDNPPCNT  214

Query  742  LFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTM  921
            LF+ NLG N +E+EL  + S   G+ ++K+       V F++F D   ++    +LQG +
Sbjct  215  LFIGNLGENVNEEELGGLLSVQPGYKQMKILRQERNTVCFIEFDDVNSAITVHQNLQGAV  274

Query  922  LYSSPGEGMRLEY  960
            L SS   GMR+++
Sbjct  275  LPSSGRGGMRIQF  287



>ref|XP_003693144.1| PREDICTED: protein couch potato-like [Apis florea]
Length=331

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 139/282 (49%), Gaps = 46/282 (16%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRV  585
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S  
Sbjct  80   AAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPF  139

Query  586  IESGVGNIHIPGMGSSA--------YNTVGYP----------------------------  657
               G    H P   S+A        + T+ +P                            
Sbjct  140  FPGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHF  199

Query  658  -PTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQ  834
             P+ + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M 
Sbjct  200  LPSPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMH  258

Query  835  STYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +  G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  TKGGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  300



>ref|XP_006568352.1| PREDICTED: protein couch potato-like isoform X4 [Apis mellifera]
 ref|XP_006611190.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X5 [Apis dorsata]
Length=317

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 139/282 (49%), Gaps = 46/282 (16%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRV  585
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S  
Sbjct  80   AAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPF  139

Query  586  IESGVGNIHIPGMGSSA--------YNTVGYP----------------------------  657
               G    H P   S+A        + T+ +P                            
Sbjct  140  FPGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHF  199

Query  658  -PTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQ  834
             P+ + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M 
Sbjct  200  LPSPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMH  258

Query  835  STYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +  G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  TKGGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  300



>dbj|BAB01919.1| unnamed protein product [Arabidopsis thaliana]
Length=271

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +1

Query  376  QPFAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQ------RTDDDR  537
            Q  AFA F   + A+AAM ELNG+ FD + GS L I+LA+SNSR K +         D+R
Sbjct  51   QVVAFATFTSHRFALAAMNELNGVKFDPQTGSNLHIELARSNSRRKERPGSGPYVVIDNR  110

Query  538  HG------SEKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMN  699
            +        ++  +G +    V E G  N   P    +  +     P     + +G  + 
Sbjct  111  NKEISKSQDDQSDEGDSDPDEVQEPG--NSDSPKENDTTKSEADSEPDSKAPSANGH-LE  167

Query  700  EGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDT  879
            + +   S A  C TLF+ANLGPNC+E EL Q+ SR  GF  LK+++  G PVAF DF++ 
Sbjct  168  KASEGGSGARACSTLFIANLGPNCTEDELKQLLSRYPGFHILKIRARGGMPVAFADFEEI  227

Query  880  ACSMEALSHLQGTMLYSSPGEGMRLEYP  963
              + +A++HLQG +L SS   GM ++YP
Sbjct  228  EQATDAMNHLQGNLLSSSDRGGMHIDYP  255



>ref|XP_392443.4| PREDICTED: protein couch potato-like isoform X7 [Apis mellifera]
 ref|XP_003488500.1| PREDICTED: protein couch potato-like [Bombus impatiens]
 ref|XP_006611186.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Apis dorsata]
Length=326

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 139/282 (49%), Gaps = 46/282 (16%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            DEVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  20   DEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAE  79

Query  421  AAMYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRV  585
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S  
Sbjct  80   AAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPF  139

Query  586  IESGVGNIHIPGMGSSA--------YNTVGYP----------------------------  657
               G    H P   S+A        + T+ +P                            
Sbjct  140  FPGGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHF  199

Query  658  -PTQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQ  834
             P+ + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M 
Sbjct  200  LPSPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMH  258

Query  835  STYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +  G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  259  TKGGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  300



>ref|XP_006427728.1| hypothetical protein CICLE_v10026062mg [Citrus clementina]
 gb|ESR40968.1| hypothetical protein CICLE_v10026062mg [Citrus clementina]
 gb|KDO46298.1| hypothetical protein CISIN_1g020297mg [Citrus sinensis]
Length=328

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 123/256 (48%), Gaps = 19/256 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            +HDEVRT+FI GLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q AVA
Sbjct  45   AHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSTAQLAVA  102

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  ++FD E  S L  ++AK N   KR    D + +   KR++     +    S  
Sbjct  103  AKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAP  162

Query  601  GNIHIP--------------GMGSSAYNTVGYPPTQSYANFDGRAMNE--GNANKSAAPP  732
               H P                    Y   G PP Q  A     A +      N    PP
Sbjct  163  SPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPP  222

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +     +LQ
Sbjct  223  CNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQ  282

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  283  GAVIPSSGSVGMRIQY  298



>ref|XP_006492013.1| PREDICTED: cell wall integrity protein scw1-like [Citrus sinensis]
Length=328

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 123/256 (48%), Gaps = 19/256 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            +HDEVRT+FI GLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q AVA
Sbjct  45   AHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSTAQLAVA  102

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  ++FD E  S L  ++AK N   KR    D + +   KR++     +    S  
Sbjct  103  AKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAP  162

Query  601  GNIHIP--------------GMGSSAYNTVGYPPTQSYANFDGRAMNE--GNANKSAAPP  732
               H P                    Y   G PP Q  A     A +      N    PP
Sbjct  163  SPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPP  222

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +     +LQ
Sbjct  223  CNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQ  282

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  283  GAVIPSSGSVGMRIQY  298



>gb|KDO46299.1| hypothetical protein CISIN_1g020297mg [Citrus sinensis]
Length=320

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 123/256 (48%), Gaps = 19/256 (7%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            +HDEVRT+FI GLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q AVA
Sbjct  45   AHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNY--KGEKPMGFALFSTAQLAVA  102

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGV  600
            A   L  ++FD E  S L  ++AK N   KR    D + +   KR++     +    S  
Sbjct  103  AKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAP  162

Query  601  GNIHIP--------------GMGSSAYNTVGYPPTQSYANFDGRAMNE--GNANKSAAPP  732
               H P                    Y   G PP Q  A     A +      N    PP
Sbjct  163  SPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPP  222

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +     +LQ
Sbjct  223  CNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQ  282

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  283  GAVIPSSGSVGMRIQY  298



>ref|XP_006342871.1| PREDICTED: cell wall integrity protein scw1-like isoform X1 [Solanum 
tuberosum]
Length=317

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 119/254 (47%), Gaps = 19/254 (7%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP+DVK RE+ NL R  PGYE+S L        P  FA+F + Q A+ A 
Sbjct  37   DEVRTIFISGLPQDVKERELVNLLRWLPGYEASQLNF--KGELPMGFALFSNHQCAIGAK  94

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMK--GPAVISRVIESGV  600
              + G+VFD E    L  ++AK N   KR    D + H   KRM+  G    S       
Sbjct  95   DAIQGLVFDTEGKCVLHTEMAKKNLFVKRGIVADSNAHDQSKRMRTGGDYTHSGYSSPSP  154

Query  601  GNIHIPGMGS-SAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAPPCP  738
             +     + +   Y T   PP   Y  +    M                  N    PPC 
Sbjct  155  FHPPPAPVWAPHGYITQAPPPYNPYGGYPVAHMPMAAPAPVPAPSSYAPVQNTKDNPPCN  214

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+ NLG N +E+EL  + S   GF ++K+       V F++F+D   +      LQG 
Sbjct  215  TLFIGNLGENINEEELRGLISGQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHSLQGA  274

Query  919  MLYSSPGEGMRLEY  960
            ++ SS   GMR++Y
Sbjct  275  VIPSSGSVGMRIQY  288



>ref|XP_004235512.1| PREDICTED: RNA-binding protein with multiple splicing [Solanum 
lycopersicum]
Length=319

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 119/254 (47%), Gaps = 19/254 (7%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP+DVK RE+ NL R  PGYE+S L        P  FA+F + Q A+ A 
Sbjct  39   DEVRTIFISGLPQDVKERELVNLLRWLPGYEASQLNF--KGELPMGFALFSNHQCAIGAK  96

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQ-RTDDDRHGSEKRMK--GPAVISRVIESGV  600
              + G+VFD E    L  ++AK N   KR    D + H   KRM+  G    S       
Sbjct  97   DAIQGLVFDTEGKCVLHTEMAKKNLFVKRGIVVDSNAHDQSKRMRTGGDYTHSGYSSPSP  156

Query  601  GNIHIPGMGS-SAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAPPCP  738
             +     + +   Y T   PP   Y  +    M                  N    PPC 
Sbjct  157  FHPPPAPVWAPHGYITQAPPPYNPYGGYPVAHMPMAAPAPVPAPSSYAPVQNTKDNPPCN  216

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+ NLG N +E+EL  + S   GF ++K+       V F++F+D   +      LQG 
Sbjct  217  TLFIGNLGENINEEELRGLISGQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHTLQGA  276

Query  919  MLYSSPGEGMRLEY  960
            ++ SS   GMR++Y
Sbjct  277  VIPSSGSVGMRIQY  290



>ref|XP_006378851.1| hypothetical protein POPTR_0010s25610g [Populus trichocarpa]
 gb|ERP56648.1| hypothetical protein POPTR_0010s25610g [Populus trichocarpa]
Length=334

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 120/257 (47%), Gaps = 18/257 (7%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P +HDEVRT+FI G P+DVK RE+ NL R  PGYE+S +       +   FA+F   Q A
Sbjct  50   PPTHDEVRTIFITGFPDDVKERELQNLLRWLPGYEASQVNY--KGEKAMGFALFSCAQHA  107

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIES  594
            +AA   L  +VFD +  S L  ++AK N   KR    D + +   KR++     S    +
Sbjct  108  IAAKDALQDMVFDADTKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHTTYT  167

Query  595  GVGNIHIPG--MGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAP  729
                 H P    G   Y T   PP   Y  +    +                  N    P
Sbjct  168  SPSPFHPPPPVWGPHGYMTPAPPPYDPYGGYPVPQVPMPPPAPIPAPSSYVPVQNTKDNP  227

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      L
Sbjct  228  PCNTLFIGNLGENINEDELRGLFSVQPGFKQMKVLRQERHTVCFIEFEDLNSATNVHHTL  287

Query  910  QGTMLYSSPGEGMRLEY  960
            QG ++ SS   GMR++Y
Sbjct  288  QGAVIPSSGSVGMRIQY  304



>ref|XP_010928626.1| PREDICTED: RNA-binding protein with multiple splicing 2-like 
isoform X1 [Elaeis guineensis]
Length=322

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 119/255 (47%), Gaps = 22/255 (9%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP DVK RE++NL R  PG+E+S +       QP  FA+F   Q AVAA 
Sbjct  39   DEVRTIFISGLPGDVKERELHNLLRWLPGFEASQIN--FKGEQPMGFALFSSPQHAVAAK  96

Query  430  YELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDDRHGSEKRMKGP  567
              L  +VFD E  S L  ++AK N               +SKR RT  D + +       
Sbjct  97   NALQDLVFDAETNSVLHTEMAKKNLFVKRGVVANSSSVDQSKRLRTGGDYNYASYPTPPF  156

Query  568  AVISRVIESGVGNIHIPGMGSSAYNTVGYP-PTQSYANFDGRAMNEGNA---NKSAAPPC  735
                     G      P      Y   GYP P  S           G +   N    PPC
Sbjct  157  HPPPPPPVYGTPGYMAPSAPYDPYG--GYPVPQVSMPTPAPMPAPSGYSPIQNTKDNPPC  214

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ NLG N +E+EL  + S   G+ ++K+       V F++F D   ++    +LQG
Sbjct  215  NTLFIGNLGENVNEEELGGLLSVQPGYKQMKILRQERNTVCFIEFDDVNSAITVHQNLQG  274

Query  916  TMLYSSPGEGMRLEY  960
             +L SS   GMR+++
Sbjct  275  AVLPSSGRGGMRIQF  289



>ref|XP_006845565.1| hypothetical protein AMTR_s00019p00188800 [Amborella trichopoda]
 gb|ERN07240.1| hypothetical protein AMTR_s00019p00188800 [Amborella trichopoda]
Length=294

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 126/279 (45%), Gaps = 36/279 (13%)
 Frame = +1

Query  220  APLYTPPHSH------DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQP  381
            AP+  P   H      DEVRT+FI+GLP+DVK RE+ NL R  PGYE+S +       QP
Sbjct  18   APVMAPEAHHMSVNTQDEVRTIFISGLPDDVKERELQNLCRWLPGYEASQVNY--KGEQP  75

Query  382  FAFAVFVDQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRM  558
              F +F     A+AA   L  +VFD E  S L  ++AK N   KR    D +     KRM
Sbjct  76   MGFVLFSTAPMAMAARDALQELVFDAEAKSVLRTEMAKKNLFIKRGVVGDSNSFDQSKRM  135

Query  559  K-----GPAVISRVIESGVGNIHIPGMGSSAYNTVGY-PPTQSYANF-------------  681
            +      PA                     A+   GY PP+  Y  +             
Sbjct  136  RTGGDYNPAAYPHPPSYPPAT-------PPAWGPQGYMPPSAPYDPYVPPYVSASSAPAP  188

Query  682  -DGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVA  858
                A      N    PPC TLF+ NLG N  E+EL  +F+   G+ ++K+       V 
Sbjct  189  TPTPAAYAPVQNMKDNPPCNTLFIGNLGENIVEEELRGLFAGQPGYKQMKVLRQERNTVC  248

Query  859  FVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEYPMLAF  975
            F++F D   +M     LQG +L SS   GMR++YP++ F
Sbjct  249  FIEFYDVNSAMAVHRSLQGAVLPSSGRGGMRIQYPLICF  287



>ref|XP_003372884.1| protein couch potato [Trichinella spiralis]
 gb|EFV52966.1| protein couch potato [Trichinella spiralis]
Length=355

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 87/276 (32%), Positives = 134/276 (49%), Gaps = 40/276 (14%)
 Frame = +1

Query  253  EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSN---TQPFAFAVFVDQQSAVA  423
             VRTLF++GLP D KPRE+Y LFR + GYESS L+    N   T P  F  F  + +A  
Sbjct  64   RVRTLFVSGLPIDAKPRELYLLFRAYKGYESSLLKVTQKNGKATTPIGFVTFNSRAAAEE  123

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRHGS----EKRMKGPAVISRVIE  591
            A   L G+ FD E    + ++ A+SN++  + +       +       + G  +++ ++ 
Sbjct  124  AKQSLQGVKFDPELPQPIRLEFARSNTKVCKPKVQSPPASAYAPFLHPITGHELMAPILH  183

Query  592  SGVGNIHIPGMGSSA------------YNTVGYP-----PTQSYANFDGRAMNEGN----  708
                ++  P + S A             NT+ +P     P Q  +++    +   +    
Sbjct  184  GPGADLFHPALASYAAEFAQTFPHPLLQNTLQHPALPPIPHQLASHYPAAMLAAASGMPG  243

Query  709  ------------ANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAP  852
                        ++ SA  P  TLFVANLG    EQEL +VFS   GF++L++    G P
Sbjct  244  MLPPASLPPTSVSSMSAGQPSTTLFVANLGAKTQEQELLEVFSNIPGFIRLRILHKNGFP  303

Query  853  VAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            VAFV++ D   +  AL+ LQG +L SS   GMR+E+
Sbjct  304  VAFVEYSDVINANHALNALQGFVLMSSDRGGMRIEF  339



>ref|XP_008380263.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Malus domestica]
Length=329

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 122/256 (48%), Gaps = 23/256 (9%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI GLPEDVK REI NL R  PGYE+S + +     +P +FA+F     A+AA 
Sbjct  48   DEVRTIFITGLPEDVKEREIQNLLRWLPGYEASQVNN--KGEKPMSFALFSTAHQAIAAK  105

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESGVGN  606
              L G++FD E  + L  ++AK N   KR    D   +   KR++     S+   S    
Sbjct  106  DALQGMIFDSESKAVLHTEMAKKNLFVKRGIVGDTSPYDQSKRLRTGGDYSQAGYSSPSP  165

Query  607  IHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNEGNA----------------NKSAAPP  732
             H        +   GY  PP  +Y  + G  +                     N    PP
Sbjct  166  FHP--PPPPVWGPHGYMAPPPPTYDPYGGYPVPPVQMHPPPPVPAPSSYVPVLNTKDNPP  223

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG   +E+EL  +FS   GF ++K+       V F++F+D   +      LQ
Sbjct  224  CNTLFIGNLGETINEEELRGLFSSQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHALQ  283

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  284  GAVIPSSGSVGMRIQY  299



>ref|XP_002311913.2| hypothetical protein POPTR_0008s00980g [Populus trichocarpa]
 gb|EEE89280.2| hypothetical protein POPTR_0008s00980g [Populus trichocarpa]
Length=331

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 121/256 (47%), Gaps = 17/256 (7%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P +H+EVRT+FI G P+DVK RE+ NL R  PGYE+S +       +   FA+F   Q A
Sbjct  48   PPTHEEVRTIFITGFPDDVKERELQNLLRWLPGYEASQVNY--KGDKAMGFALFSSSQHA  105

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIES  594
            +AA   L  +VFD+E  S L  ++AK N   KR    D + +   KR++     S    +
Sbjct  106  IAAKDSLQDMVFDVETKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHAAYT  165

Query  595  GVGNIHIPG--MGSSAYNTVGYPPTQSYANFDGRAMNEGNA------------NKSAAPP  732
                 H P    G   Y     PP   Y  +    +    A            N    PP
Sbjct  166  TPSPFHPPPPVWGPHGYMAPVPPPYDPYGGYPAPQVPMPPAPIPAPSSYVPIQNTKDNPP  225

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      LQ
Sbjct  226  CNTLFIGNLGQNINEDELRGLFSVQPGFKQMKILRQERHTVCFIEFEDLNSATNVHHSLQ  285

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  286  GAVIPSSGSIGMRIQY  301



>ref|XP_011033021.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Populus euphratica]
 ref|XP_011033022.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Populus euphratica]
Length=331

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 121/256 (47%), Gaps = 17/256 (7%)
 Frame = +1

Query  238  PHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSA  417
            P +H+EVRT+FI G P+DVK RE+ NL R  PGYE+S +       +   FA+F   Q A
Sbjct  48   PPTHEEVRTIFITGFPDDVKERELQNLLRWLPGYEASQVNY--KGDKAMGFALFSSSQHA  105

Query  418  VAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIES  594
            +AA   L  +VFD+E  S L  ++AK N   KR    D + +   KR++     S    +
Sbjct  106  IAAKDSLQDMVFDVETKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHAAYT  165

Query  595  GVGNIHIPG--MGSSAYNTVGYPPTQSYANFDGRAMNEGNA------------NKSAAPP  732
                 H P    G   Y     PP   Y  +    +    A            N    PP
Sbjct  166  TPSPFHPPPPVWGPHGYMAPVPPPYDLYGGYPAPQVPMPPAPIPAPSSYVPIQNTKDNPP  225

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E EL  +FS   GF ++K+       V F++F+D   +      LQ
Sbjct  226  CNTLFIGNLGQNINEDELRGLFSVQPGFKQMKILRQERHTVCFIEFEDLNSATNVHHSLQ  285

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  286  GAVIPSSGSIGMRIQY  301



>gb|ETN70792.1| hypothetical protein NECAME_04805 [Necator americanus]
Length=296

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 129/266 (48%), Gaps = 26/266 (10%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSN---TQPFAFAVFVDQQ  411
             S  +VRTLF++GLP D KPRE+Y LFR + GYESS L+  + N   T P  F  F   +
Sbjct  21   ESCSQVRTLFVSGLPMDAKPRELYLLFRAYRGYESSLLKMTAKNGKPTSPVGFVTFQTSK  80

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSN---SRSKRQRTDDDRHGSEKRMKGPAVISR  582
             A  A   L G+ FD +    L ++LAKSN   SR K+         +      P  ++ 
Sbjct  81   DADDARKALQGVRFDPDCAQVLRLELAKSNTKVSRPKQSPPPVIPIAAPSLQTMPQFLAP  140

Query  583  V--IESGVGNIHIPGMGSSAYNTVG---YPPTQSYANFDGRAMNEGNANKSAA-------  726
            +   E+ V + H   +      ++    +P T     F G   ++G  +++AA       
Sbjct  141  LQPAEAIVLDQHPLLLDQHQLLSLSLPRFPATAQSLPFAGILQSDGAYHQNAAIFQAALG  200

Query  727  --------PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTA  882
                      C TLFVANL P  +E EL  VF    GF +L+M +  G+ VAF+++   A
Sbjct  201  LGAQNPAFQGCSTLFVANLSPGVTEDELRSVFKAFAGFTRLRMHTKNGSSVAFIEYSSLA  260

Query  883  CSMEALSHLQGTMLYSSPGEGMRLEY  960
             +  A+  LQG  L SS   G+R+EY
Sbjct  261  SATSAMMALQGFQLGSSERGGLRIEY  286



>ref|XP_009333987.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Pyrus x 
bretschneideri]
Length=329

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 121/256 (47%), Gaps = 23/256 (9%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI GLPEDVK REI NL R  PGYE+S + +     +P +FA+F     A+AA 
Sbjct  48   DEVRTIFITGLPEDVKEREIQNLLRWLPGYEASQVNN--KGEKPMSFALFSTAHQAIAAK  105

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDR-HGSEKRMKGPAVISRVIESGVGN  606
              L G++FD E  + L  ++AK N   KR    D   +   KR++     S+   S    
Sbjct  106  DALQGMIFDSESKAVLHTEMAKKNLFVKRGIVGDTSPYDQSKRLRTGGDYSQAGYSSPSP  165

Query  607  IHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNEGNA----------------NKSAAPP  732
             H        +   GY  PP  +Y  + G  +                     N    PP
Sbjct  166  FHP--PPPPVWGPHGYLAPPPPTYDPYGGYPVPPVQMHPPPPVPAPSSYVPVLNTKDNPP  223

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG   +E EL  +FS   GF ++K+       V F++F+D   +      LQ
Sbjct  224  CNTLFIGNLGETINEDELRGLFSSQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHALQ  283

Query  913  GTMLYSSPGEGMRLEY  960
            G ++ SS   GMR++Y
Sbjct  284  GAVIPSSGSVGMRIQY  299



>ref|XP_009339532.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Pyrus x 
bretschneideri]
Length=332

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 122/260 (47%), Gaps = 27/260 (10%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            +EVRT+FI GLPEDVK REI NL R  PGYE+S +   +   +P +FA+F   Q A+AA 
Sbjct  47   EEVRTIFITGLPEDVKEREIQNLLRWLPGYEASQVN--NKGEKPMSFALFSTAQEAIAAK  104

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGVGN  606
              L G++FD E  + L  +LAK N   KR    D   +   KR++     S+        
Sbjct  105  DALQGMIFDSESKAVLHTELAKKNLFVKRGIVADTGAYDQSKRLRTCGDYSQA--GYSSP  162

Query  607  IHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNEGNA--------------------NKS  720
                      +   GY  PP  +Y  + G  +                         N  
Sbjct  163  SPFHPPPPPVWGPHGYMAPPPPTYDPYGGYPVPPIPMHPPPPVPAPAPAPSSYVPVLNTK  222

Query  721  AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
              PPC TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +    
Sbjct  223  DNPPCNTLFIGNLGESINEEELRGLFSSQPGFKQMKVLRQERHTVCFIEFEDVNSATNVH  282

Query  901  SHLQGTMLYSSPGEGMRLEY  960
              LQG ++ SS   GMR++Y
Sbjct  283  QALQGAVIPSSGSVGMRIQY  302



>ref|XP_008342403.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Malus domestica]
 ref|XP_008342404.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Malus domestica]
 ref|XP_008342405.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Malus domestica]
 ref|XP_008342406.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Malus domestica]
Length=331

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 122/258 (47%), Gaps = 25/258 (10%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            +EVRT+FI GLPEDVK REI NL R  PGYE+S +   +   +P +FA+F   Q A+AA 
Sbjct  48   EEVRTIFITGLPEDVKEREIQNLLRWLPGYEASQVN--NKGEKPMSFALFSTAQQAIAAK  105

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIESGVGN  606
              L G++FD E  + L  ++AK N   KR    D   +   KR++     S+        
Sbjct  106  DALQGMIFDSESKAVLHTEMAKKNLFVKRGIVADTSAYDQSKRLRTGGDYSQ--GGYSSP  163

Query  607  IHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNEGNA------------------NKSAA  726
                      +   GY  PP  +Y  + G  +                       N    
Sbjct  164  SPFHPPPPPVWGPHGYMAPPPPTYDPYGGYPVPPVPMHPPPPVPAPAPSSYVPVLNTKDN  223

Query  727  PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSH  906
            PPC TLF+ NLG + +E+EL  +FS   GF ++K+       V F++F+D   +      
Sbjct  224  PPCNTLFIGNLGESINEEELRGLFSSQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHQA  283

Query  907  LQGTMLYSSPGEGMRLEY  960
            LQG ++ SS   GMR++Y
Sbjct  284  LQGAVIPSSGSVGMRIQY  301



>ref|XP_009767203.1| PREDICTED: cell wall integrity protein scw1-like [Nicotiana sylvestris]
Length=319

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 84/255 (33%), Positives = 116/255 (45%), Gaps = 20/255 (8%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP+DVK RE+ NL R  PGYE+S +        P  FA+F + Q A+ A 
Sbjct  38   DEVRTIFISGLPQDVKERELVNLMRWLPGYEASQVNF--KGEVPMGFALFSNHQFAIGAK  95

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQ-RTDDDRHGSEKRMKGPAVISR----VIES  594
              L G+ FD E    L  ++AK N   KR    D + H   KR++     +         
Sbjct  96   DALQGLCFDTEAKCILHTEMAKKNLFVKRGIVVDSNAHDQSKRLRTGGDYTHSGYSSPSP  155

Query  595  GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAPPC  735
                   P  G   Y     PP   Y  +    M                  N    PPC
Sbjct  156  FHPPPPAPVWGPHGYLAQAPPPYDPYGGYPVPHMPMPAPAPVPAPSSYVPIQNTKDNPPC  215

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +      LQG
Sbjct  216  NTLFIGNLGENINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHSLQG  275

Query  916  TMLYSSPGEGMRLEY  960
             ++ SS   GMR++Y
Sbjct  276  AVIPSSGSVGMRIQY  290



>ref|XP_009596214.1| PREDICTED: cell wall integrity protein scw1 isoform X1 [Nicotiana 
tomentosiformis]
Length=319

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 84/255 (33%), Positives = 116/255 (45%), Gaps = 20/255 (8%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP+DVK RE+ NL R  PGYE+S +        P  FA+F + Q A+ A 
Sbjct  38   DEVRTIFISGLPQDVKERELVNLLRWLPGYEASQVNF--KGEVPMGFALFSNHQFAIGAK  95

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISR----VIES  594
              L G+ FD E    L  ++AK N   KR    D + H   KR++     +         
Sbjct  96   DALQGLCFDTEAKCILHTEMAKKNLFVKRGIVGDSNAHDQSKRLRTGGDYTHSGYSSPSP  155

Query  595  GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA-------------NKSAAPPC  735
                   P  G   Y     PP   Y  +    M                  N    PPC
Sbjct  156  FHPPPPAPVWGPHGYLAQAPPPYDPYGGYPVPHMPMPAPAPVPAPSSYVPIQNTKDNPPC  215

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +      LQG
Sbjct  216  NTLFIGNLGENINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHSLQG  275

Query  916  TMLYSSPGEGMRLEY  960
             ++ SS   GMR++Y
Sbjct  276  AVIPSSGSVGMRIQY  290



>ref|XP_008200639.1| PREDICTED: protein couch potato isoform X1 [Tribolium castaneum]
Length=327

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 89/289 (31%), Positives = 139/289 (48%), Gaps = 54/289 (19%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAV  420
            +EVRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A 
Sbjct  23   EEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFNTRAGAE  82

Query  421  AAMYEL-NGIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPAVISRVIES  594
            AA  +L  G+ FD +   T+ ++ AKSN++ SK ++   +   +   +  P  ++ +  S
Sbjct  83   AAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQQAANAANTHPTLMHP--LTGLYFS  140

Query  595  GVGNIHIPGMGSSAYNTVGY-------------------------PPTQSYAN-------  678
             +G    PG     ++ + Y                         PP  S  +       
Sbjct  141  DLGTPFFPGGPELWHHPLAYSAAAELPGAALQHATLVHPALHPQVPPPMSLPHPTALTSV  200

Query  679  --------FDGRAMNEGNANKSAAP-------PCPTLFVANLGPNCSEQELTQVFSRCRG  813
                        A+     + S+ P       PC TLFVANLG   SE EL ++F+   G
Sbjct  201  HAASLPHFLPSPALASPVGSSSSQPGLGVSNPPCSTLFVANLGQFVSEHELKEIFASFPG  260

Query  814  FLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            F +L+M +  G+PVAF++++D  C+ + ++ LQG+ L SS    +R+EY
Sbjct  261  FCRLRMHNKGGSPVAFMEYQDVRCAAQVMAALQGSFLLSSDRGPIRIEY  309



>gb|KHJ87727.1| hypothetical protein OESDEN_12492 [Oesophagostomum dentatum]
Length=295

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/265 (34%), Positives = 129/265 (49%), Gaps = 25/265 (9%)
 Frame = +1

Query  241  HSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSN---TQPFAFAVFVDQQ  411
             S  +VRTLF++GLP D KPRE+Y LFR + GYESS L+  + N   T P  F  F   +
Sbjct  21   ESCSQVRTLFVSGLPMDAKPRELYLLFRAYRGYESSLLKMTAKNGKPTSPVGFVTFQTSK  80

Query  412  SAVAAMYELNGIVFDLEKGSTLFIDLAKSN---SRSKRQRTDDDRHGSEKRMKGPAVISR  582
             A  A   L G+ FD +    L ++LAKSN   SR K+         +      P  ++ 
Sbjct  81   DADDARKALQGVRFDPDCAQVLRLELAKSNTKVSRPKQSPPPVIPIAAPSLQTMPQFLAP  140

Query  583  V--IESGVGNIHIPGMGSSAYNTVG---YPPTQSYANFDGRAMNEGNANKSAA-------  726
            +   E+ V + H   +      ++    +P T     F G   ++G  +++AA       
Sbjct  141  LQPAEAIVLDQHPLLLDQHQLLSLSLPRFPATAQTLPFAGILPSDGAYHQNAAIFQALGL  200

Query  727  -------PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTAC  885
                     C TLFVANL P  +E EL  VF    GF +L+M +  G+ VAF+++   A 
Sbjct  201  GAQNPALQGCSTLFVANLSPGVTEDELRSVFKAFAGFQRLRMHTKNGSSVAFIEYSSLAS  260

Query  886  SMEALSHLQGTMLYSSPGEGMRLEY  960
            +  A+  LQG  L SS   G+R+EY
Sbjct  261  ATSAMMALQGFQLGSSERGGLRIEY  285



>ref|XP_009109736.1| PREDICTED: cell wall integrity protein scw1 [Brassica rapa]
Length=336

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 120/255 (47%), Gaps = 19/255 (7%)
 Frame = +1

Query  247  HDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAA  426
            +DE+RT+FIAGLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q A+AA
Sbjct  52   YDELRTIFIAGLPDDVKERELLNLLRWLPGYEASQVN--FKGEKPMGFALFSTAQFALAA  109

Query  427  MYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVI---ES  594
               L  +VFD E  S L  ++AK N   KR    D + +   KR++     +  +     
Sbjct  110  RDALQHLVFDAESKSVLHAEMAKKNLFVKRGIVGDSNAYDQSKRLRTGGDCTHSVYSPSP  169

Query  595  GVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNANKSAA-------------PPC  735
                          Y +   PP   Y  +    +    +   AA             PPC
Sbjct  170  FHPPPPQVWGPPHGYLSPAAPPYDPYGGYHAPPVPMPPSAPIAAPSSYVPVQNVKDNPPC  229

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ NLG N  E+EL  + S   GF ++K+       V F++F+D   +     +LQG
Sbjct  230  NTLFIGNLGENIHEEELRSLLSAQPGFKQMKVLRQERHTVCFIEFEDVNSATNVHHNLQG  289

Query  916  TMLYSSPGEGMRLEY  960
             ++ SS   GMR+++
Sbjct  290  AVIPSSGSVGMRIQF  304



>ref|XP_010063634.1| PREDICTED: cell wall integrity protein scw1 [Eucalyptus grandis]
 gb|KCW70872.1| hypothetical protein EUGRSUZ_F04002 [Eucalyptus grandis]
Length=330

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/257 (33%), Positives = 114/257 (44%), Gaps = 20/257 (8%)
 Frame = +1

Query  244  SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVA  423
            SHDEVRT+FI GLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q A+A
Sbjct  46   SHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNFKGE--KPMGFALFSTAQLALA  103

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDD-RHGSEKRM  558
            A   L  +VFD +  S L  ++AK N               +SKR RT  D  H      
Sbjct  104  AKDTLQDMVFDADTKSVLHTEMAKKNLFVKRGIVADSGVYDQSKRMRTGGDYTHAGYASP  163

Query  559  KGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRAMNEGNA---NKSAAP  729
                     +    G +  P             P                    N    P
Sbjct  164  SPFHPPPAPVWGPHGYMAPPPPPPYDPYAAYPVPAVPMPTPAPVPAPTNYVPVQNMKDNP  223

Query  730  PCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHL  909
            PC TLF+ NLG N +E+EL  +FS   GF ++K+       V F++F+D   +      L
Sbjct  224  PCNTLFIGNLGENVNEEELRGLFSVQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHSL  283

Query  910  QGTMLYSSPGEGMRLEY  960
            QG ++ SS   GMR++Y
Sbjct  284  QGAVISSSGSVGMRIQY  300



>ref|XP_010913619.1| PREDICTED: RNA-binding protein with multiple splicing-like [Elaeis 
guineensis]
Length=324

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 123/256 (48%), Gaps = 25/256 (10%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP DVK RE++NL R  PG+E+S +   +   QP  FA+F   Q A+AA 
Sbjct  38   DEVRTIFISGLPGDVKERELHNLLRWLPGFEASQINFKAE--QPMGFALFSTPQHAMAAK  95

Query  430  YELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDD-RHGSEKRMKG  564
              L  +VFD E  S L  ++AK N               +SKR RT  D  HG       
Sbjct  96   NALQDLVFDAETKSVLHTEMAKKNLFVKRGVVADSNSIDQSKRLRTGGDYTHGGYPPPFH  155

Query  565  PAVISRVIESGVGNIHIPGMGSSAYNTVGYP-PTQSYANFDGRAMNEGNA---NKSAAPP  732
            P     V   G      P      Y   GYP P  S           G A   N    PP
Sbjct  156  PPPPPPVW--GNPGYMAPPAPYDPYG--GYPVPQVSMPTPAPVPAPSGYAPVQNTKDNPP  211

Query  733  CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQ  912
            C TLF+ NLG N +E+EL  +FS   G+ ++K+       V F++F+D   +     +LQ
Sbjct  212  CNTLFIGNLGENVNEEELRGLFSVQPGYKQMKILHQERNTVCFIEFEDVNSATTVHQNLQ  271

Query  913  GTMLYSSPGEGMRLEY  960
            G +L SS   GMR+++
Sbjct  272  GAVLPSSGRGGMRIQF  287



>gb|EYU45930.1| hypothetical protein MIMGU_mgv1a009541mg [Erythranthe guttata]
Length=339

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 122/260 (47%), Gaps = 26/260 (10%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DE+RT+FI+GLPEDVK RE+ NL R  PGYE+S +        P  FA+F   Q A+AA 
Sbjct  52   DELRTIFISGLPEDVKERELQNLLRWLPGYEASQVN--FKGEHPMGFALFATPQHALAAR  109

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKR-QRTDDDRHGSEKRMKGPAVISRVIESGVGN  606
              L  +VFD +  S L  ++AK N   KR    D + +   KRM+     +    S    
Sbjct  110  DALQEMVFDADSKSVLHTEMAKKNLFVKRGMVVDSNTYDQSKRMRTGGDYTHTAYS-TSP  168

Query  607  IHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNEGNA--------------------NKS  720
             H P          GY  PP  SY  + G A+                         N  
Sbjct  169  FHPPPPPVWGPPHHGYMAPPPPSYDPYGGYAVPPVPMPMPMPAPTPVPAPSSYVPVQNTK  228

Query  721  AAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEAL  900
              PPC TLF+ NLG N +E+E+  +F    GF ++K+       V F++F+D   +    
Sbjct  229  DNPPCNTLFIGNLGENINEEEMRSLFVAQPGFKQMKVIRQDRHTVCFIEFEDVNSATNVH  288

Query  901  SHLQGTMLYSSPGEGMRLEY  960
             +LQG ++ SS   GMR++Y
Sbjct  289  HNLQGAVIASSGSIGMRIQY  308



>ref|XP_008782084.1| PREDICTED: cell wall integrity protein scw1 [Phoenix dactylifera]
Length=316

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 119/255 (47%), Gaps = 22/255 (9%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLP DVK RE++NL R  PG+++S +   +   QP  FA+F   Q A+AA 
Sbjct  38   DEVRTIFISGLPADVKERELHNLLRWLPGFDASQINFKAE--QPMGFALFSTPQHAIAAK  95

Query  430  YELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDDRHGSEKRMKGP  567
              L  +VFD E  S L  ++AK N               +SKR RT  D   +       
Sbjct  96   NALQDLVFDAETKSVLHTEMAKKNLFVKRGVVADSNSIDQSKRLRTGGDYTHAGYPAPPF  155

Query  568  AVISRVIESGVGNIHIPGMGSSAYNTVGYP-PTQSYANFDGRAMNEGNA---NKSAAPPC  735
                     G      P      Y   GYP P  S           G A   N    PPC
Sbjct  156  HTPPPPPVWGTPGYMAPPAPYDPYG--GYPVPQVSMPTPAPVPAPSGYAPVQNTKDNPPC  213

Query  736  PTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQG  915
             TLF+ NLG N +E+EL  +FS   G+ ++K+       V F++F D   +     +LQG
Sbjct  214  NTLFIGNLGENVNEEELRGIFSVQPGYKQMKILRQERNTVCFIEFDDVNGATTVHQNLQG  273

Query  916  TMLYSSPGEGMRLEY  960
             +L SS   GMR+++
Sbjct  274  AVLPSSGRGGMRIQF  288



>ref|XP_011072723.1| PREDICTED: RNA-binding protein with multiple splicing, partial 
[Sesamum indicum]
Length=329

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 119/277 (43%), Gaps = 50/277 (18%)
 Frame = +1

Query  223  PLYTPPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFV  402
            P   PP   DEVRT+FI+GLPEDVK RE+ NL R  PGYE+S +        P  FA+F 
Sbjct  42   PAVRPPS--DEVRTIFISGLPEDVKERELQNLLRWLPGYEASQVNF--KGEHPMGFALFA  97

Query  403  DQQSAVAAMYELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDDR-  537
              Q A+AA   L  +VFD E  S L  ++AK N               +SKR RT  D  
Sbjct  98   TAQHALAAKDALQDMVFDAESKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRMRTGGDYT  157

Query  538  ---------HGSEKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTV-------GYPPTQS  669
                     H     + GP                 G+ +              Y P Q 
Sbjct  158  HTAYSTSPFHPPPPAVWGPHGYMAPPPPPYDPYAGYGVPAVPMPAPAPVPAPSSYVPVQ-  216

Query  670  YANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGA  849
                          N    PPC TLF+ NLG N +E+EL  +FS   GF ++K+      
Sbjct  217  --------------NTKDNPPCNTLFIGNLGENINEEELRGLFSAQPGFKQMKILRQERH  262

Query  850  PVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             V F++F+D   +      LQG ++ SS   GMR++Y
Sbjct  263  TVCFIEFEDVNSATNVHHSLQGAVIPSSGSVGMRIQY  299



>ref|XP_006611191.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X6 [Apis dorsata]
Length=306

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 137/280 (49%), Gaps = 46/280 (16%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAVAA  426
            VRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A AA
Sbjct  2    VRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAA  61

Query  427  MYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRVIE  591
              +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S    
Sbjct  62   KQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPFFP  121

Query  592  SGVGNIHIPGMGSSA--------YNTVGYP-----------------------------P  660
             G    H P   S+A        + T+ +P                             P
Sbjct  122  GGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHFLP  181

Query  661  TQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQST  840
            + + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M + 
Sbjct  182  SPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMHTK  240

Query  841  YGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  241  GGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  280



>gb|KFK39426.1| hypothetical protein AALP_AA3G243500 [Arabis alpina]
Length=339

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 125/261 (48%), Gaps = 25/261 (10%)
 Frame = +1

Query  235  PPHSHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQS  414
            PP+  DE+RT+FIAGLP+DVK RE+ NL R  PGYE+S +       +P  FA+F   Q 
Sbjct  53   PPY--DELRTIFIAGLPDDVKERELLNLLRWLPGYEASQVN--FKGEKPMGFALFSTAQF  108

Query  415  AVAAMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRT-DDDRHGSEKRMKGPAVISRVIE  591
            A+AA   L  +VFD E  S +  ++AK N   KR    D + +   KR++     +  + 
Sbjct  109  AMAAKDTLQHMVFDAESKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTGGDCTHSVY  168

Query  592  SGVGNIHIPGMGSSAYNTVGY-----PPTQSYANFDGRAMNEGNA-------------NK  717
            S       P       +  GY     PP   YA +    +                  N 
Sbjct  169  SPSPFHPPPPPVWGPPH--GYMAPVPPPYDPYAGYHAPPVPMPAPAPIAAPSSYVPVQNI  226

Query  718  SAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
               PPC TLF+ NLG N +E+EL  + S   GF ++K+       V F++F+D   +   
Sbjct  227  KDNPPCNTLFIGNLGENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNV  286

Query  898  LSHLQGTMLYSSPGEGMRLEY  960
              +LQG ++ SS   GMR++Y
Sbjct  287  HHNLQGAVIPSSGSVGMRIQY  307



>ref|XP_009418180.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/254 (33%), Positives = 123/254 (48%), Gaps = 21/254 (8%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DE+RT+FI GLP DVK RE++NL R FPG+E+S +   +   QP  FA+F   Q AVAA 
Sbjct  36   DEIRTIFITGLPVDVKERELHNLLRWFPGFEASQINFKAE--QPMGFALFSTAQHAVAAK  93

Query  430  YELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTDDDRH-GSEKRMKGPAVISRVIESGVGN  606
              L  +VFD E  S+L  ++AK N   KR    +       KR++     +    +    
Sbjct  94   DALQDLVFDAETKSSLHTEMAKKNLFVKRGVVSESSSLDHSKRLRTGGDYTHAGYAAPAF  153

Query  607  IHIPGMGSSAYNTVGYPPTQSYANFDGRAMNE---------------GNANKSA-APPCP  738
               P  G+  Y  V   P   Y  + G  + +                   K+   PPC 
Sbjct  154  HQAPVWGTPGY--VAPHPPAPYDPYGGYPLPQVAMPTPSPMPAPSRYSPVQKTKDNPPCN  211

Query  739  TLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEALSHLQGT  918
            TLF+ NLG N  E+E+  +FS   GF ++K+       V F++F+D   +     +LQG 
Sbjct  212  TLFIGNLGENVIEEEVRGLFSVQPGFKQMKILRQERNTVCFIEFEDLNSATNVHQNLQGA  271

Query  919  MLYSSPGEGMRLEY  960
            +L SS   G+R+++
Sbjct  272  VLTSSSRGGIRIQF  285



>ref|XP_010550813.1| PREDICTED: cell wall integrity protein scw1-like [Tarenaya hassleriana]
Length=338

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 95/283 (34%), Positives = 131/283 (46%), Gaps = 23/283 (8%)
 Frame = +1

Query  235   PPH-SHDEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQ  411
             PP+ S+DE+RT+FIAGLP+DVK RE+ NL R  PGYE+S +       +P  FA+F    
Sbjct  49    PPYESYDELRTIFIAGLPDDVKERELLNLLRWLPGYEASQVN--FKGEKPMGFALFSTGP  106

Query  412   SAVAAMYELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDDRHGSE  549
              AVAA   L  +VFD +  S L  ++AK N               +SKR RT  D   S 
Sbjct  107   LAVAARDTLQDLVFDTDSNSVLHTEMAKKNLFVKRGIVVDSNAYDQSKRLRTGGDYTHSG  166

Query  550   KRMKGPAVISRVIESGV--GNIHIPGMGSSAYNTVGY--PPTQSYANFDGRAMNE--GNA  711
                            G+  G I             GY  PP   +A     A +      
Sbjct  167   YSSSPYHHHPPPPVWGLPHGYIAPAPPPPPYDPYAGYHVPPVPMHAPTPITAPSSYVPVQ  226

Query  712   NKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSM  891
             N    PPC TLF+ NLG N +E+EL  +FS   G+ ++K+       V F++F+D   + 
Sbjct  227   NIKDNPPCNTLFIGNLGENINEEELRSLFSAQPGYKQMKVLRQERHTVCFIEFEDVNSAT  286

Query  892   EALSHLQGTMLYSSPGEGMRLEYPMLAF*ADN*LTFPRPLGPS  1020
                 +LQG ++ SS   GMR++Y    F      + P P  PS
Sbjct  287   NVHHNLQGAVIPSSGSVGMRIQYSKNPFGKRKEGSHPVPPSPS  329



>ref|XP_002740760.2| PREDICTED: protein couch potato-like isoform X1 [Saccoglossus 
kowalevskii]
Length=287

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 126/261 (48%), Gaps = 37/261 (14%)
 Frame = +1

Query  289  DVKPREIYNLFREFPGYESSHLR---SPSSNTQPFAFAVFVDQQSAVAAMYELNGIVFDL  459
            D KPRE+Y LFR + GYE S L+       NT P  F  F  +  A AA   L G+ FD 
Sbjct  2    DAKPRELYLLFRAYKGYEGSLLKVTGKQGKNTSPVGFVTFETRVGAEAAKQALQGVRFDP  61

Query  460  EKGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISR------------VIESGVG  603
            +   TL ++ AKSN++  + +    +  +  +  GP +  R              E+ V 
Sbjct  62   DIPQTLRLEFAKSNTKVSKPKQSSPQPPNSHQALGPHLTPREPYDLGAAFFPGAPEAWVH  121

Query  604  N-----------IHIPGMGSSAYNTVGYP------PTQSYANFDGRAMNEGNANKSAA--  726
            +           +H P     A +   +P      P+  +A      +    AN  AA  
Sbjct  122  HPLAAYAELGPAMHHPAFSHPALHAQPHPAHPVIAPSHPHAPIPQPPLPASIANAMAAVT  181

Query  727  ---PPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTACSMEA  897
                PC TLFVANLG + +E+EL ++F R  GF +L++ +  GAP  FV+F++   + +A
Sbjct  182  GSNAPCSTLFVANLGTHTTEEELRELFGRIPGFSRLRLHNKGGAPCCFVEFQNVVFASQA  241

Query  898  LSHLQGTMLYSSPGEGMRLEY  960
            L+ +QG +++SS   G+R+E+
Sbjct  242  LNQMQGQVMFSSDRGGLRIEF  262



>ref|XP_002108108.1| hypothetical protein TRIADDRAFT_52243 [Trichoplax adhaerens]
 gb|EDV28906.1| hypothetical protein TRIADDRAFT_52243 [Trichoplax adhaerens]
Length=298

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 133/269 (49%), Gaps = 36/269 (13%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPS------SNTQPFAFAVFVDQQSA  417
            VRTLF++GLP DVK R+++ LFR  PGY  S L++ +      + + P AFA F  ++ A
Sbjct  15   VRTLFVSGLPVDVKQRDLHLLFRGLPGYLDSILKTSTKQPGHGNKSGPVAFATFETRELA  74

Query  418  VAAMYELNGIVFDLE-KGSTLFIDLAKSNSRSKRQRTDDDRHGSEKRMKGPAVISRVIES  594
              A   L G  FD +   S L +D AKSN++S R R +     + K       I   +E 
Sbjct  75   NEAKAILQGFQFDPDVTDSHLRVDFAKSNTKSYRSRHNSSNGQNVKNTIYNGNIPNKLE-  133

Query  595  GVGNIHIPGMGSSAYNTVGYPPT-------QSYANFDGRAMNEGNANKSA---APP----  732
             + N  IP     + +T+   PT       ++Y N            + A   APP    
Sbjct  134  -LANPAIPIYREHSISTIDLTPTYYQNIIPETYVNHIPIYPCPTEIPQPACHSAPPVLQP  192

Query  733  ------------CPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAP-VAFVDFK  873
                        C TLFVANLG N +++EL  +F RC GF +L+M    G P  AF++F 
Sbjct  193  HMQSFQQQLPQVCSTLFVANLGRNITDKELRDIFGRCVGFRRLRMHKKPGFPTTAFIEFA  252

Query  874  DTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            +   + +AL+ LQG ++ SS   G+R+EY
Sbjct  253  NIQFATQALNALQGAIIQSSECGGIRIEY  281



>ref|XP_003704621.1| PREDICTED: protein couch potato-like [Megachile rotundata]
Length=334

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 137/280 (49%), Gaps = 46/280 (16%)
 Frame = +1

Query  256  VRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQ---PFAFAVFVDQQSAVAA  426
            VRTLF++GLP D KPRE+Y LFR + GYE S L+  S N +   P  F  F  +  A AA
Sbjct  15   VRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAA  74

Query  427  MYELN-GIVFDLEKGSTLFIDLAKSNSR-SKRQRTDDDRHGSEKRMKGPA---VISRVIE  591
              +L  G+ FD +   T+ ++ AKSN++ SK ++       S   +  P    + S    
Sbjct  75   KQDLQQGVRFDPDMPQTIRLEFAKSNTKVSKPKQPAAAAATSHPALMHPLTGHLGSPFFP  134

Query  592  SGVGNIHIPGMGSSA--------YNTVGYP-----------------------------P  660
             G    H P   S+A        + T+ +P                             P
Sbjct  135  GGPELWHHPLAYSTAGELPGTLQHATLVHPALHPQVPAPMSLPHPTTLTSIHASLPHFLP  194

Query  661  TQSYANFDGRAMNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQST  840
            + + A+  G   ++ N   S AP C TLFVANLG   SE EL  +FS   GF +L+M + 
Sbjct  195  SPALASPVGSPSSQPNIAVSNAP-CSTLFVANLGQFVSEHELKDIFSSFPGFSRLRMHTK  253

Query  841  YGAPVAFVDFKDTACSMEALSHLQGTMLYSSPGEGMRLEY  960
             G+PVAFV+++D   + +A++ LQG+ L SS    +R+EY
Sbjct  254  GGSPVAFVEYQDVRYAAQAMATLQGSFLLSSDRGAIRIEY  293



>emb|CDJ91157.1| RNA recognition motif domain containing protein [Haemonchus contortus]
Length=297

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 127/266 (48%), Gaps = 33/266 (12%)
 Frame = +1

Query  253  EVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSN---TQPFAFAVFVDQQSAVA  423
            +VRTLF++GLP D KPRE+Y LFR + GYESS L+  + N   T P  F  F   + A  
Sbjct  25   QVRTLFVSGLPMDAKPRELYLLFRAYRGYESSLLKMTAKNGKPTSPVGFVTFQTSKDADE  84

Query  424  AMYELNGIVFDLEKGSTLFIDLAKSNSRSKRQRTD--------DDRHGSEKRMKGPAVIS  579
            A   L G+ FD +    L ++LAKSN++  R +               +  +   P   +
Sbjct  85   ARKALQGVRFDPDCAQVLRLELAKSNTKVSRPKQSPPPVIPMAAPSLQTMPQFLAPLQPA  144

Query  580  RVI----------ESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDG---------RAMNE  702
              I          +  + ++++P   ++A  T+   P     + DG          A+  
Sbjct  145  DAILLDQHPLLFDQHQLFSLNLPRFPTAATQTL---PLAGILSTDGGYHQNAFLQAALGL  201

Query  703  GNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFKDTA  882
               N  +   C TLFVANL P  +E EL  VF    GF +L+M +  G+ VAF+++   A
Sbjct  202  NAQNAPSLQGCSTLFVANLSPGVTEDELRSVFKAFAGFTRLRMHTKNGSSVAFIEYSSLA  261

Query  883  CSMEALSHLQGTMLYSSPGEGMRLEY  960
             +  A+  LQG  L SS   G+R+EY
Sbjct  262  SATSAMMALQGFHLGSSERGGIRIEY  287



>ref|XP_010259754.1| PREDICTED: cell wall integrity protein scw1 [Nelumbo nucifera]
Length=327

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 114/269 (42%), Gaps = 49/269 (18%)
 Frame = +1

Query  250  DEVRTLFIAGLPEDVKPREIYNLFREFPGYESSHLRSPSSNTQPFAFAVFVDQQSAVAAM  429
            DEVRT+FI+GLPEDVK RE+ NL R  PGYE+S +       QP  FA+F   Q A+AA 
Sbjct  39   DEVRTIFISGLPEDVKERELQNLLRWLPGYEASQVNYKGE--QPMGFALFSTAQLAMAAK  96

Query  430  YELNGIVFDLEKGSTLFIDLAKSN--------------SRSKRQRTDDDR----------  537
              L  +VFD E  S L  ++AK N               +SKR RT  D           
Sbjct  97   DALQDMVFDAESKSVLHTEMAKKNLFVKRGVVADSSSFDQSKRLRTGGDYTHTGYPSPSP  156

Query  538  --------HGSEKRMKGPAVISRVIESGVGNIHIPGMGSSAYNTVGYPPTQSYANFDGRA  693
                     G +  M                       +      GY P Q         
Sbjct  157  FHPPPPPVWGPQGYMAPAPPPYDPYGGYPVPPVPMPTPAPVPAPSGYAPVQ---------  207

Query  694  MNEGNANKSAAPPCPTLFVANLGPNCSEQELTQVFSRCRGFLKLKMQSTYGAPVAFVDFK  873
                  N    PPC TLF+ NLG N  E+EL  +FS   GF ++K+       V F++F 
Sbjct  208  ------NTKDNPPCNTLFIGNLGENVIEEELRNLFSVQPGFKQMKVLRQERNTVCFIEFD  261

Query  874  DTACSMEALSHLQGTMLYSSPGEGMRLEY  960
            D   +     +LQG ++ SS   GMR++Y
Sbjct  262  DVNSATNVHHNLQGAVIPSSGRGGMRIQY  290



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4306464265376