BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21889_g1_i1 len=989 path=[1375:0-293 1669:294-802 502:803-843
2217:844-988]

Length=989
                                                                      Score     E

ref|XP_006365876.1|  PREDICTED: uncharacterized protein LOC102601024    332   3e-107   
ref|XP_004232757.1|  PREDICTED: uncharacterized protein LOC101266475    328   1e-105   
ref|XP_009588899.1|  PREDICTED: uncharacterized protein LOC104086354    324   3e-104   
ref|XP_009765356.1|  PREDICTED: uncharacterized protein LOC104216918    320   6e-103   
emb|CBI41096.3|  unnamed protein product                                313   2e-100   
ref|XP_010647488.1|  PREDICTED: uncharacterized protein LOC100244205    313   5e-100   
emb|CDP19908.1|  unnamed protein product                                311   2e-99    
gb|AFK40972.1|  unknown                                                 311   4e-99    
ref|XP_002317560.1|  zinc finger family protein                         310   8e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003607708.1|  C2H2 zinc finger protein                           310   8e-99    
ref|XP_010267823.1|  PREDICTED: uncharacterized protein LOC104604941    308   6e-98    
gb|KDP39034.1|  hypothetical protein JCGZ_00791                         307   1e-97    
ref|XP_007132990.1|  hypothetical protein PHAVU_011G142000g             307   1e-97    
ref|XP_010241023.1|  PREDICTED: uncharacterized protein LOC104585747    306   3e-97    
ref|NP_001240057.1|  uncharacterized protein LOC100787790               306   5e-97    
gb|KHN20446.1|  hypothetical protein glysoja_036162                     305   1e-96    
ref|XP_004505426.1|  PREDICTED: uncharacterized protein LOC101514605    304   2e-96    
ref|XP_010062955.1|  PREDICTED: uncharacterized protein LOC104450201    304   2e-96    
ref|XP_006452135.1|  hypothetical protein CICLE_v10008310mg             304   3e-96    
ref|XP_007021103.1|  Transcription factor                               303   4e-96    
emb|CBI20489.3|  unnamed protein product                                301   6e-96    
gb|KHG08884.1|  Zinc finger and BTB domain-containing 16                302   1e-95    
ref|XP_006370600.1|  hypothetical protein POPTR_0001s44130g             302   1e-95    
ref|XP_009355567.1|  PREDICTED: uncharacterized protein LOC103946569    302   2e-95    
ref|XP_010644321.1|  PREDICTED: uncharacterized protein LOC100260605    301   2e-95    
ref|XP_008386033.1|  PREDICTED: uncharacterized protein LOC103448548    301   3e-95    
gb|KDO41851.1|  hypothetical protein CISIN_1g013455mg                   301   3e-95    
emb|CAN83989.1|  hypothetical protein VITISV_039126                     299   1e-94    Vitis vinifera
ref|XP_006830064.1|  hypothetical protein AMTR_s00125p00062940          299   1e-94    
ref|XP_011095310.1|  PREDICTED: uncharacterized protein LOC105174809    299   2e-94    
emb|CDY28761.1|  BnaA02g09530D                                          299   2e-94    
ref|XP_010694273.1|  PREDICTED: uncharacterized protein LOC104907097    301   2e-94    
ref|XP_010092302.1|  hypothetical protein L484_021164                   299   3e-94    
emb|CDY06635.1|  BnaC02g13590D                                          298   4e-94    
ref|XP_008452316.1|  PREDICTED: uncharacterized protein LOC103493380    298   5e-94    
ref|XP_009392680.1|  PREDICTED: uncharacterized protein LOC103978...    298   6e-94    
ref|XP_011048266.1|  PREDICTED: uncharacterized protein LOC105142368    298   6e-94    
ref|XP_004149303.1|  PREDICTED: uncharacterized protein LOC101208986    298   7e-94    
emb|CDP05812.1|  unnamed protein product                                297   7e-94    
gb|KFK27073.1|  hypothetical protein AALP_AA8G330700                    298   7e-94    
ref|XP_009127078.1|  PREDICTED: uncharacterized protein LOC103851949    299   8e-94    
ref|XP_008776712.1|  PREDICTED: uncharacterized protein LOC103696776    297   8e-94    
ref|XP_004167219.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    297   8e-94    
ref|XP_009392663.1|  PREDICTED: uncharacterized protein LOC103978...    298   1e-93    
emb|CDY29286.1|  BnaC01g19380D                                          296   1e-93    
ref|XP_009776647.1|  PREDICTED: uncharacterized protein LOC104226368    296   2e-93    
ref|XP_009593520.1|  PREDICTED: uncharacterized protein LOC104090171    295   4e-93    
ref|XP_009346469.1|  PREDICTED: uncharacterized protein LOC103938197    296   5e-93    
ref|XP_008780304.1|  PREDICTED: uncharacterized protein LOC103700112    287   6e-93    
dbj|BAJ33911.1|  unnamed protein product                                296   9e-93    
ref|XP_006401551.1|  hypothetical protein EUTSA_v10013387mg             296   1e-92    
ref|XP_011096128.1|  PREDICTED: uncharacterized protein LOC105175392    293   1e-92    
gb|EYU27848.1|  hypothetical protein MIMGU_mgv1a007181mg                294   1e-92    
ref|XP_009143234.1|  PREDICTED: uncharacterized protein LOC103866964    294   1e-92    
emb|CDX89265.1|  BnaA01g16280D                                          294   1e-92    
ref|XP_008355355.1|  PREDICTED: uncharacterized protein LOC103419013    294   2e-92    
ref|XP_006280315.1|  hypothetical protein CARUB_v10026238mg             296   2e-92    
ref|XP_009358074.1|  PREDICTED: uncharacterized protein LOC103948743    294   3e-92    
ref|XP_002866053.1|  hypothetical protein ARALYDRAFT_918600             294   6e-92    
gb|EYU19199.1|  hypothetical protein MIMGU_mgv1a006892mg                292   8e-92    
ref|XP_010443040.1|  PREDICTED: uncharacterized protein LOC104725989    293   1e-91    
ref|XP_010923995.1|  PREDICTED: uncharacterized protein LOC105046939    291   1e-91    
ref|NP_200274.1|  zinc finger-related protein                           293   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520878.1|  PREDICTED: uncharacterized protein LOC104799891    292   2e-91    
ref|XP_009405930.1|  PREDICTED: uncharacterized protein LOC103988958    291   2e-91    
gb|EEE55508.1|  hypothetical protein OsJ_03710                          285   5e-91    Oryza sativa Japonica Group [Japonica rice]
gb|KGN57955.1|  hypothetical protein Csa_3G406040                       290   6e-91    
gb|ACB30362.1|  transcription factor                                    290   7e-91    Capsicum annuum
ref|XP_010482869.1|  PREDICTED: uncharacterized protein LOC104761480    290   1e-90    
ref|XP_008784662.1|  PREDICTED: uncharacterized protein LOC103703552    289   1e-90    
ref|XP_010931855.1|  PREDICTED: uncharacterized protein LOC105052658    290   2e-90    
ref|XP_009386466.1|  PREDICTED: uncharacterized protein LOC103973578    290   2e-90    
ref|XP_004244163.1|  PREDICTED: uncharacterized protein LOC101261138    288   3e-90    
gb|KFK29232.1|  hypothetical protein AALP_AA7G106800                    287   4e-90    
ref|XP_010448429.1|  PREDICTED: uncharacterized protein LOC104730884    289   4e-90    
ref|XP_006360102.1|  PREDICTED: uncharacterized protein LOC102605244    288   4e-90    
gb|EPS67430.1|  hypothetical protein M569_07344                         286   5e-90    
ref|XP_004152032.1|  PREDICTED: uncharacterized protein LOC101213316    289   5e-90    
ref|XP_008454573.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    287   8e-90    
ref|XP_004163521.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    290   8e-90    
ref|XP_011097935.1|  PREDICTED: uncharacterized protein LOC105176736    287   1e-89    
ref|XP_002869573.1|  predicted protein                                  285   3e-89    
ref|XP_010928416.1|  PREDICTED: uncharacterized protein LOC105050187    285   5e-89    
ref|XP_004295788.1|  PREDICTED: uncharacterized protein LOC101312619    286   5e-89    
ref|XP_006413099.1|  hypothetical protein EUTSA_v10025260mg             285   5e-89    
ref|NP_567769.1|  C2H2 type zinc finger protein                         285   7e-89    Arabidopsis thaliana [mouse-ear cress]
gb|EEC71610.1|  hypothetical protein OsI_04015                          286   8e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_007211726.1|  hypothetical protein PRUPE_ppa006039mg             284   1e-88    
ref|NP_001044471.1|  Os01g0785900                                       286   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438645.1|  PREDICTED: uncharacterized protein LOC104722207    284   1e-88    
ref|XP_008244332.1|  PREDICTED: uncharacterized protein LOC103342485    283   3e-88    
ref|XP_010433392.1|  PREDICTED: uncharacterized protein LOC104717513    283   4e-88    
emb|CDY18344.1|  BnaC09g30940D                                          283   4e-88    
ref|XP_006644817.1|  PREDICTED: uncharacterized protein LOC102701492    277   6e-88    
ref|XP_009419613.1|  PREDICTED: uncharacterized protein LOC103999...    281   1e-87    
ref|XP_009419608.1|  PREDICTED: uncharacterized protein LOC103999...    281   1e-87    
ref|XP_006283760.1|  hypothetical protein CARUB_v10004841mg             281   2e-87    
ref|XP_004970210.1|  PREDICTED: uncharacterized protein LOC101769772    281   8e-87    
ref|XP_003543285.1|  PREDICTED: uncharacterized protein LOC100800127    278   2e-86    
gb|KHN36742.1|  hypothetical protein glysoja_001473                     278   2e-86    
ref|XP_010448164.1|  PREDICTED: uncharacterized protein LOC104730664    278   4e-86    
ref|XP_002305640.1|  hypothetical protein POPTR_0004s03040g             275   9e-86    Populus trichocarpa [western balsam poplar]
ref|XP_002518577.1|  transcription factor, putative                     276   9e-86    Ricinus communis
ref|XP_010052462.1|  PREDICTED: uncharacterized protein LOC104441152    275   2e-85    
gb|EPS71826.1|  hypothetical protein M569_02932                         275   2e-85    
ref|XP_006592887.1|  PREDICTED: uncharacterized protein LOC100816798    275   3e-85    
ref|XP_009418763.1|  PREDICTED: uncharacterized protein LOC103998881    275   5e-85    
gb|EAZ38050.1|  hypothetical protein OsJ_22395                          271   6e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003391.1|  PREDICTED: uncharacterized protein LOC105110150    271   9e-84    
gb|EEC81194.1|  hypothetical protein OsI_24208                          271   2e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001058385.1|  Os06g0683000                                       271   2e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458613.1|  hypothetical protein SORBIDRAFT_03g036720          273   4e-83    Sorghum bicolor [broomcorn]
ref|XP_006657258.1|  PREDICTED: uncharacterized protein LOC102713921    268   5e-82    
gb|KDP20826.1|  hypothetical protein JCGZ_21297                         265   2e-81    
emb|CAN59868.1|  hypothetical protein VITISV_013440                     264   6e-81    Vitis vinifera
ref|XP_003564368.1|  PREDICTED: uncharacterized protein LOC100825897    262   2e-79    
ref|NP_001146839.1|  MRP interacting1                                   261   4e-79    Zea mays [maize]
gb|EPS69596.1|  hypothetical protein M569_05170                         259   5e-79    
dbj|BAK05649.1|  predicted protein                                      258   4e-78    
ref|XP_006370599.1|  hypothetical protein POPTR_0001s44130g             256   6e-78    
ref|XP_002522818.1|  transcription factor, putative                     249   1e-75    Ricinus communis
ref|XP_007025908.1|  Transcription factor, putative                     246   5e-74    
tpg|DAA57325.1|  TPA: hypothetical protein ZEAMMB73_591981              234   8e-72    
tpg|DAA57326.1|  TPA: hypothetical protein ZEAMMB73_591981              233   1e-71    
emb|CDM84498.1|  unnamed protein product                                239   1e-70    
ref|NP_001151870.1|  MRP interacting2                                   236   3e-69    Zea mays [maize]
gb|EYU33591.1|  hypothetical protein MIMGU_mgv1a020366mg                231   5e-69    
gb|EMT06139.1|  hypothetical protein F775_16699                         226   1e-68    
gb|KHN19066.1|  hypothetical protein glysoja_029928                     219   2e-65    
ref|XP_008646660.1|  PREDICTED: uncharacterized protein LOC103628187    224   2e-65    
ref|XP_006595420.1|  PREDICTED: uncharacterized protein LOC102659726    218   2e-65    
ref|XP_006417351.1|  hypothetical protein EUTSA_v10007989mg             219   2e-64    
ref|NP_172616.1|  C2H2 type zinc finger protein                         216   3e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547115.2|  PREDICTED: uncharacterized protein LOC100792577    213   4e-63    
ref|XP_004485667.1|  PREDICTED: uncharacterized protein LOC101513827    215   1e-62    
ref|XP_002892647.1|  zinc finger family protein                         214   1e-62    
ref|XP_010476073.1|  PREDICTED: uncharacterized protein LOC104755399    214   2e-62    
ref|XP_003593384.1|  hypothetical protein MTR_2g010860                  213   7e-62    
ref|XP_010492899.1|  PREDICTED: uncharacterized protein LOC104770204    212   9e-62    
gb|KHN33614.1|  hypothetical protein glysoja_005656                     213   1e-61    
ref|XP_002437461.1|  hypothetical protein SORBIDRAFT_10g027550          213   3e-61    Sorghum bicolor [broomcorn]
ref|XP_006306543.1|  hypothetical protein CARUB_v10012610mg             209   1e-60    
ref|XP_010668146.1|  PREDICTED: uncharacterized protein LOC104885139    210   2e-60    
gb|AES63636.2|  C2H2-like zinc finger protein                           208   3e-60    
ref|XP_010458547.1|  PREDICTED: uncharacterized protein LOC104739790    207   7e-60    
ref|XP_003593385.1|  hypothetical protein MTR_2g010870                  207   5e-59    
gb|KHN09177.1|  hypothetical protein glysoja_025638                     202   1e-58    
gb|KDO80746.1|  hypothetical protein CISIN_1g014111mg                   206   1e-58    
ref|XP_006434130.1|  hypothetical protein CICLE_v10001224mg             206   1e-58    
ref|XP_006472721.1|  PREDICTED: uncharacterized protein LOC102614418    204   7e-58    
ref|XP_003526611.1|  PREDICTED: uncharacterized protein LOC100814186    203   9e-58    
ref|XP_007137371.1|  hypothetical protein PHAVU_009G121700g             201   8e-57    
ref|XP_008465804.1|  PREDICTED: uncharacterized protein LOC103503399    201   1e-56    
ref|XP_004140330.1|  PREDICTED: uncharacterized protein LOC101220433    199   4e-56    
ref|XP_007148292.1|  hypothetical protein PHAVU_006G196000g             197   6e-56    
ref|XP_008233905.1|  PREDICTED: uncharacterized protein LOC103332917    199   9e-56    
ref|XP_010692561.1|  PREDICTED: uncharacterized protein LOC104905404    198   1e-55    
ref|XP_007018982.1|  C2H2-like zinc finger protein                      198   1e-55    
ref|XP_007224337.1|  hypothetical protein PRUPE_ppa020634mg             198   1e-55    
ref|XP_009148487.1|  PREDICTED: uncharacterized protein LOC103871909    196   2e-55    
emb|CDY49785.1|  BnaCnng17980D                                          195   2e-55    
gb|ACU18642.1|  unknown                                                 197   3e-55    Glycine max [soybeans]
ref|XP_003523462.1|  PREDICTED: uncharacterized protein LOC100817333    197   4e-55    
gb|KHN47051.1|  hypothetical protein glysoja_018418                     197   4e-55    
ref|XP_009415763.1|  PREDICTED: uncharacterized protein LOC103996...    195   7e-55    
ref|XP_010547020.1|  PREDICTED: uncharacterized protein LOC104818915    194   1e-54    
ref|XP_006847058.1|  hypothetical protein AMTR_s00017p00197580          192   3e-54    
ref|XP_009367352.1|  PREDICTED: uncharacterized protein LOC103957012    194   3e-54    
emb|CDX97964.1|  BnaA06g07150D                                          192   3e-54    
gb|KDP32761.1|  hypothetical protein JCGZ_12053                         194   4e-54    
ref|XP_009341672.1|  PREDICTED: uncharacterized protein LOC103933706    194   4e-54    
ref|XP_004500590.1|  PREDICTED: uncharacterized protein LOC101506200    194   5e-54    
ref|XP_006580848.1|  PREDICTED: uncharacterized protein LOC102660699    192   5e-54    
ref|XP_006351923.1|  PREDICTED: uncharacterized protein LOC102601509    192   1e-53    
ref|XP_002513814.1|  nucleic acid binding protein, putative             192   3e-53    Ricinus communis
ref|XP_008338788.1|  PREDICTED: uncharacterized protein LOC103401854    192   5e-53    
ref|XP_008361552.1|  PREDICTED: uncharacterized protein LOC103425243    191   5e-53    
ref|XP_009790722.1|  PREDICTED: uncharacterized protein LOC104238136    190   7e-53    
ref|XP_010091348.1|  hypothetical protein L484_020150                   190   2e-52    
ref|XP_004290833.1|  PREDICTED: uncharacterized protein LOC101294815    190   2e-52    
gb|KHN46084.1|  hypothetical protein glysoja_030085                     189   2e-52    
ref|XP_010930890.1|  PREDICTED: uncharacterized protein LOC105051938    188   2e-52    
ref|XP_003601091.1|  hypothetical protein MTR_3g072920                  190   2e-52    
emb|CBI19068.3|  unnamed protein product                                186   3e-52    
ref|XP_011012508.1|  PREDICTED: uncharacterized protein LOC105116747    188   7e-52    
ref|XP_002306613.2|  hypothetical protein POPTR_0005s16070g             188   7e-52    Populus trichocarpa [western balsam poplar]
ref|XP_002974384.1|  hypothetical protein SELMODRAFT_15610              182   9e-52    
ref|XP_004250566.1|  PREDICTED: uncharacterized protein LOC101254557    187   1e-51    
ref|XP_009587911.1|  PREDICTED: uncharacterized protein LOC104085...    186   2e-51    
ref|XP_009366983.1|  PREDICTED: uncharacterized protein LOC103956687    187   2e-51    
gb|EYU22924.1|  hypothetical protein MIMGU_mgv1a006553mg                187   3e-51    
ref|XP_009383565.1|  PREDICTED: uncharacterized protein LOC103971297    184   5e-51    
ref|XP_002284394.3|  PREDICTED: uncharacterized protein LOC100257501    186   1e-50    Vitis vinifera
ref|XP_002276294.1|  PREDICTED: uncharacterized protein LOC100250572    184   2e-50    Vitis vinifera
ref|XP_006435171.1|  hypothetical protein CICLE_v10001255mg             184   3e-50    
ref|XP_010104443.1|  hypothetical protein L484_016042                   183   3e-50    
ref|XP_011027602.1|  PREDICTED: uncharacterized protein LOC105127850    183   4e-50    
ref|XP_009414851.1|  PREDICTED: uncharacterized protein LOC103995858    182   4e-50    
ref|XP_011074672.1|  PREDICTED: uncharacterized protein LOC105159...    183   5e-50    
ref|XP_011074673.1|  PREDICTED: uncharacterized protein LOC105159...    183   6e-50    
ref|XP_010272869.1|  PREDICTED: uncharacterized protein LOC104608536    182   9e-50    
ref|XP_006473648.1|  PREDICTED: uncharacterized protein LOC102626182    182   9e-50    
ref|XP_009389508.1|  PREDICTED: uncharacterized protein LOC103976050    181   9e-50    
gb|AAF16645.1|AC011661_23  T23J18.16                                    185   2e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695422.1|  PREDICTED: uncharacterized protein LOC104908063    181   3e-49    
ref|XP_008781482.1|  PREDICTED: uncharacterized protein LOC103701262    180   4e-49    
gb|EPS60213.1|  hypothetical protein M569_14592                         179   5e-49    
emb|CDP07405.1|  unnamed protein product                                180   5e-49    
ref|XP_010274362.1|  PREDICTED: uncharacterized protein LOC104609687    179   6e-49    
ref|XP_007226467.1|  hypothetical protein PRUPE_ppa1027229mg            177   6e-49    
emb|CDP12442.1|  unnamed protein product                                183   1e-48    
ref|XP_007160670.1|  hypothetical protein PHAVU_001G007100g             179   2e-48    
ref|XP_010268701.1|  PREDICTED: uncharacterized protein LOC104605577    179   2e-48    
gb|KHF97950.1|  Ribosomal L11 methyltransferase                         179   2e-48    
ref|XP_010063350.1|  PREDICTED: uncharacterized protein LOC104450474    179   2e-48    
ref|XP_009399179.1|  PREDICTED: uncharacterized protein LOC103983649    177   3e-48    
ref|XP_007017790.1|  C2H2-like zinc finger protein                      178   3e-48    
ref|XP_002510523.1|  nucleic acid binding protein, putative             177   5e-48    Ricinus communis
ref|XP_002306922.2|  hypothetical protein POPTR_0005s25950g             177   6e-48    Populus trichocarpa [western balsam poplar]
ref|XP_010544461.1|  PREDICTED: uncharacterized protein LOC104817077    178   6e-48    
ref|XP_009628578.1|  PREDICTED: uncharacterized protein LOC104118897    177   8e-48    
gb|KDP36933.1|  hypothetical protein JCGZ_08224                         177   8e-48    
gb|EYU36782.1|  hypothetical protein MIMGU_mgv1a007577mg                176   1e-47    
gb|KHG11079.1|  Exodeoxyribonuclease 7 large subunit                    176   1e-47    
ref|XP_009107404.1|  PREDICTED: uncharacterized protein LOC103833057    176   2e-47    
ref|XP_009783030.1|  PREDICTED: uncharacterized protein LOC104231688    176   3e-47    
emb|CDY16999.1|  BnaA08g03630D                                          175   3e-47    
ref|XP_004499248.1|  PREDICTED: uncharacterized protein LOC101513058    175   4e-47    
gb|KFK29074.1|  hypothetical protein AALP_AA7G085300                    175   5e-47    
ref|XP_010539850.1|  PREDICTED: uncharacterized protein LOC104813789    175   5e-47    
ref|XP_002990476.1|  hypothetical protein SELMODRAFT_236040             173   6e-47    
ref|XP_009616115.1|  PREDICTED: uncharacterized protein LOC104108715    174   1e-46    
ref|XP_010268436.1|  PREDICTED: uncharacterized protein LOC104605392    174   1e-46    
ref|XP_002983777.1|  hypothetical protein SELMODRAFT_268776             173   2e-46    
gb|AFK49400.1|  unknown                                                 173   2e-46    
ref|XP_003589472.1|  hypothetical protein MTR_1g024980                  173   2e-46    
gb|AFW60009.1|  hypothetical protein ZEAMMB73_700752                    173   2e-46    
ref|XP_003545035.1|  PREDICTED: uncharacterized protein LOC100782665    172   3e-46    
ref|XP_008221271.1|  PREDICTED: uncharacterized protein LOC103321258    172   4e-46    
ref|XP_004291367.1|  PREDICTED: uncharacterized protein LOC101308...    172   5e-46    
ref|XP_004291366.1|  PREDICTED: uncharacterized protein LOC101308...    172   5e-46    
emb|CDY17799.1|  BnaC08g04130D                                          172   5e-46    
gb|AAF99784.1|AC012463_1  T2E6.3                                        172   7e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335106.1|  PREDICTED: uncharacterized protein LOC103927864    172   8e-46    
ref|XP_006393516.1|  hypothetical protein EUTSA_v10011499mg             172   9e-46    
ref|XP_003550423.1|  PREDICTED: uncharacterized protein LOC100816726    171   1e-45    
ref|XP_008364931.1|  PREDICTED: uncharacterized protein LOC103428594    171   1e-45    
ref|XP_002302254.2|  hypothetical protein POPTR_0002s08810g             170   3e-45    Populus trichocarpa [western balsam poplar]
ref|XP_009118945.1|  PREDICTED: uncharacterized protein LOC103843923    170   4e-45    
ref|XP_010927412.1|  PREDICTED: uncharacterized protein LOC105049460    169   6e-45    
ref|XP_009404894.1|  PREDICTED: uncharacterized protein LOC103988098    169   7e-45    
ref|XP_009781815.1|  PREDICTED: uncharacterized protein LOC104230649    169   9e-45    
ref|XP_010412646.1|  PREDICTED: uncharacterized protein LOC104698978    162   1e-44    
emb|CDY06723.1|  BnaA10g05020D                                          168   2e-44    
emb|CDY20903.1|  BnaC06g01230D                                          168   2e-44    
ref|XP_010061047.1|  PREDICTED: uncharacterized protein LOC104448832    168   3e-44    
ref|XP_002887608.1|  zinc finger family protein                         168   3e-44    
ref|XP_008387941.1|  PREDICTED: uncharacterized protein LOC103450383    167   3e-44    
gb|KFK42002.1|  hypothetical protein AALP_AA2G199600                    168   3e-44    
ref|XP_006342234.1|  PREDICTED: uncharacterized protein LOC102602448    166   3e-44    
ref|XP_010533772.1|  PREDICTED: uncharacterized protein LOC104809457    167   4e-44    
ref|XP_001755532.1|  predicted protein                                  167   6e-44    
gb|KCW67946.1|  hypothetical protein EUGRSUZ_F01643                     168   6e-44    
ref|XP_006307600.1|  hypothetical protein CARUB_v10009224mg             166   8e-44    
ref|XP_004238353.1|  PREDICTED: uncharacterized protein LOC101261325    166   1e-43    
ref|XP_001781064.1|  predicted protein                                  165   2e-43    
ref|XP_010428604.1|  PREDICTED: uncharacterized protein LOC104713223    166   2e-43    
emb|CDX73189.1|  BnaC06g36370D                                          164   7e-43    
ref|XP_002894076.1|  predicted protein                                  164   8e-43    
ref|XP_010500301.1|  PREDICTED: uncharacterized protein LOC104777702    164   9e-43    
ref|XP_007016151.1|  Zinc finger family protein isoform 1               162   2e-42    
gb|KGN49158.1|  hypothetical protein Csa_6G516660                       160   3e-42    
emb|CDY47503.1|  BnaAnng09010D                                          162   3e-42    
ref|XP_010471696.1|  PREDICTED: uncharacterized protein LOC104751448    163   3e-42    
ref|XP_010461583.1|  PREDICTED: uncharacterized protein LOC104742289    162   3e-42    
ref|XP_006300451.1|  hypothetical protein CARUB_v10020159mg             163   3e-42    
emb|CAE01804.2|  OSJNBa0039K24.23                                       162   5e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029003.1|  PREDICTED: uncharacterized protein LOC105128859    161   5e-42    
ref|NP_001054349.2|  Os04g0690100                                       162   6e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003637135.1|  hypothetical protein MTR_073s0023                  160   6e-42    
ref|XP_010416465.1|  PREDICTED: uncharacterized protein LOC104702316    162   6e-42    
ref|XP_010533365.1|  PREDICTED: uncharacterized protein LOC104809174    161   7e-42    
ref|XP_009415764.1|  PREDICTED: uncharacterized protein LOC103996...    160   8e-42    
emb|CAJ86349.1|  H0814G11.16                                            161   1e-41    
emb|CAB53477.1|  CAA30374.1 protein                                     162   2e-41    
ref|XP_010227348.1|  PREDICTED: uncharacterized protein LOC100835063    161   2e-41    
ref|XP_006857263.1|  hypothetical protein AMTR_s00199p00026650          159   3e-41    
ref|XP_010262797.1|  PREDICTED: uncharacterized protein LOC104601227    158   3e-41    
ref|XP_010920259.1|  PREDICTED: uncharacterized protein LOC105044151    159   6e-41    
ref|XP_004155663.1|  PREDICTED: uncharacterized protein LOC101232431    157   7e-41    
ref|NP_177700.1|  C2H2-like zinc finger protein                         159   7e-41    
ref|XP_008366236.1|  PREDICTED: uncharacterized protein LOC103429889    157   8e-41    
gb|KGN60029.1|  hypothetical protein Csa_3G872110                       158   1e-40    
ref|XP_004959963.1|  PREDICTED: uncharacterized protein LOC101760650    158   1e-40    
ref|XP_002447373.1|  hypothetical protein SORBIDRAFT_06g033920          159   1e-40    
ref|XP_008466489.1|  PREDICTED: uncharacterized protein LOC103503882    157   1e-40    
ref|XP_010256618.1|  PREDICTED: uncharacterized protein LOC104596971    156   1e-40    
ref|XP_006390280.1|  hypothetical protein EUTSA_v10018514mg             157   2e-40    
ref|XP_006653914.1|  PREDICTED: uncharacterized protein LOC102717340    157   3e-40    
gb|KHG03483.1|  Gastrula zinc finger xFG20-1                            156   3e-40    
ref|XP_002525610.1|  conserved hypothetical protein                     157   3e-40    
ref|XP_004162557.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   3e-40    
emb|CBI15987.3|  unnamed protein product                                154   3e-40    
ref|XP_008439943.1|  PREDICTED: uncharacterized protein LOC103484579    155   4e-40    
ref|XP_002449060.1|  hypothetical protein SORBIDRAFT_05g004260          157   4e-40    
ref|XP_007146728.1|  hypothetical protein PHAVU_006G064800g             155   7e-40    
ref|XP_006848143.1|  hypothetical protein AMTR_s00029p00226800          155   8e-40    
ref|XP_003552964.1|  PREDICTED: uncharacterized protein LOC100785244    155   8e-40    
gb|ADE77090.1|  unknown                                                 148   1e-39    
ref|XP_002279930.1|  PREDICTED: uncharacterized protein LOC100248366    154   1e-39    
ref|XP_007205378.1|  hypothetical protein PRUPE_ppa007316mg             154   1e-39    
ref|XP_004500239.1|  PREDICTED: uncharacterized protein LOC101489748    154   2e-39    
ref|XP_009381996.1|  PREDICTED: uncharacterized protein LOC103970083    155   2e-39    
ref|XP_011032141.1|  PREDICTED: uncharacterized protein LOC105131066    153   3e-39    
ref|NP_001130437.1|  uncharacterized protein LOC100191534               154   4e-39    
ref|XP_004143213.1|  PREDICTED: uncharacterized protein LOC101205506    152   5e-39    
ref|XP_002301980.1|  zinc finger family protein                         153   5e-39    
ref|XP_009773098.1|  PREDICTED: uncharacterized protein LOC104223368    152   6e-39    
ref|XP_010685594.1|  PREDICTED: uncharacterized protein LOC104899985    153   6e-39    
ref|XP_009128127.1|  PREDICTED: uncharacterized protein LOC103852976    154   6e-39    
ref|XP_002314116.2|  zinc finger family protein                         152   7e-39    
ref|XP_002299819.2|  hypothetical protein POPTR_0001s25700g             152   8e-39    
ref|XP_004978793.1|  PREDICTED: uncharacterized protein LOC101758746    152   1e-38    
ref|XP_006350826.1|  PREDICTED: uncharacterized protein LOC102585494    151   2e-38    
ref|XP_006488495.1|  PREDICTED: uncharacterized protein LOC102614196    151   2e-38    
ref|XP_009630930.1|  PREDICTED: uncharacterized protein LOC104120793    151   2e-38    
gb|KDP46520.1|  hypothetical protein JCGZ_08492                         151   2e-38    
ref|XP_006425041.1|  hypothetical protein CICLE_v10028631mg             151   2e-38    
ref|XP_010104669.1|  hypothetical protein L484_022047                   150   2e-38    
ref|XP_004160204.1|  PREDICTED: uncharacterized protein LOC101225986    152   4e-38    
emb|CDY39052.1|  BnaA02g17410D                                          151   5e-38    
ref|XP_011035183.1|  PREDICTED: uncharacterized protein LOC105133068    149   7e-38    
ref|XP_006662766.1|  PREDICTED: vitellogenin-1-like                     150   1e-37    
ref|XP_008464051.1|  PREDICTED: uncharacterized protein LOC103502032    149   1e-37    
ref|XP_009106219.1|  PREDICTED: uncharacterized protein LOC103832017    149   4e-37    
emb|CDY13543.1|  BnaC02g23540D                                          148   4e-37    
gb|ACG40182.1|  nucleic acid binding protein                            148   5e-37    
ref|XP_004487251.1|  PREDICTED: 60 kDa chaperonin-like                  147   8e-37    
ref|NP_001170391.1|  uncharacterized protein LOC100384377               145   1e-36    
ref|XP_004241174.1|  PREDICTED: uncharacterized protein LOC101259160    145   3e-36    
tpg|DAA39042.1|  TPA: hypothetical protein ZEAMMB73_315461              146   3e-36    
ref|XP_006294390.1|  hypothetical protein CARUB_v10023405mg             143   1e-35    
emb|CDP09169.1|  unnamed protein product                                143   1e-35    
ref|XP_004294270.1|  PREDICTED: uncharacterized protein LOC101298583    143   1e-35    
gb|EPS63133.1|  hypothetical protein M569_11653                         141   2e-35    
ref|XP_009413758.1|  PREDICTED: uncharacterized protein LOC103994997    144   2e-35    
ref|XP_010033020.1|  PREDICTED: uncharacterized protein LOC104422399    142   4e-35    
emb|CDX97869.1|  BnaC04g40700D                                          142   4e-35    
ref|XP_011083531.1|  PREDICTED: uncharacterized protein LOC105166030    142   6e-35    
gb|ABR17969.1|  unknown                                                 141   7e-35    
ref|XP_010510450.1|  PREDICTED: uncharacterized protein LOC104786...    141   8e-35    
ref|XP_010469925.1|  PREDICTED: uncharacterized protein LOC104749911    141   1e-34    
ref|XP_004975007.1|  PREDICTED: uncharacterized protein LOC101752639    142   1e-34    
emb|CDY51355.1|  BnaA04g28490D                                          140   2e-34    
ref|XP_009141016.1|  PREDICTED: uncharacterized protein LOC103864982    139   3e-34    
ref|XP_009144357.1|  PREDICTED: uncharacterized protein LOC103868017    139   3e-34    
ref|NP_001052042.1|  Os04g0115500                                       140   3e-34    
emb|CDY02000.1|  BnaC04g15010D                                          139   4e-34    
ref|XP_008807585.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   4e-34    
emb|CAH65967.1|  OSIGBa0112G01.5                                        140   4e-34    
emb|CAE01948.2|  OSJNBa0073L13.11                                       140   5e-34    
emb|CDY45464.1|  BnaA05g12370D                                          140   5e-34    
ref|XP_002879225.1|  zinc finger family protein                         139   6e-34    
gb|AAX93009.1|  Zinc finger, C2H2 type, putative                        139   8e-34    
gb|EEC76661.1|  hypothetical protein OsI_14623                          139   8e-34    
gb|EAZ17571.1|  hypothetical protein OsJ_33107                          139   8e-34    
ref|NP_001065851.1|  Os11g0169400                                       139   8e-34    
gb|EMS48497.1|  hypothetical protein TRIUR3_33494                       139   9e-34    
ref|XP_010414362.1|  PREDICTED: uncharacterized protein LOC104700533    138   9e-34    
ref|XP_011078217.1|  PREDICTED: uncharacterized protein LOC105162016    137   1e-33    
gb|EAY80095.1|  hypothetical protein OsI_35265                          138   2e-33    
ref|XP_006410025.1|  hypothetical protein EUTSA_v10016804mg             136   3e-33    
ref|XP_004136493.1|  PREDICTED: uncharacterized protein LOC101222539    137   5e-33    
emb|CAN78296.1|  hypothetical protein VITISV_004661                     133   1e-32    
ref|XP_011093689.1|  PREDICTED: uncharacterized protein LOC105173594    134   1e-32    
ref|XP_009374344.1|  PREDICTED: uncharacterized protein LOC103963270    130   2e-32    
gb|KGN47095.1|  hypothetical protein Csa_6G187395                       129   2e-32    
ref|XP_009383982.1|  PREDICTED: uncharacterized protein LOC103971641    134   3e-32    
ref|XP_008220547.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   2e-31    
gb|KFK24151.1|  hypothetical protein AALP_AAs50253U000800               131   2e-31    
emb|CBI18978.3|  unnamed protein product                                127   1e-30    
gb|AFN53664.1|  hypothetical protein                                    130   1e-30    
ref|XP_009587912.1|  PREDICTED: uncharacterized protein LOC104085...    127   4e-30    
ref|XP_002446048.1|  hypothetical protein SORBIDRAFT_06g000970          129   4e-30    
ref|XP_010521929.1|  PREDICTED: uncharacterized protein LOC104800723    128   5e-30    
ref|NP_565684.1|  uncharacterized protein                               127   5e-30    
ref|XP_010664902.1|  PREDICTED: uncharacterized protein LOC100252363    127   9e-30    
ref|XP_007027256.1|  Zinc finger protein-related, putative              124   3e-29    
ref|XP_008800782.1|  PREDICTED: uncharacterized protein LOC103715055    125   3e-29    
ref|XP_006836766.1|  hypothetical protein AMTR_s00088p00164330          119   3e-28    
ref|NP_001183873.1|  hypothetical protein                               122   5e-28    
tpg|DAA38734.1|  TPA: hypothetical protein ZEAMMB73_389881              122   7e-28    
ref|XP_008662980.1|  PREDICTED: uncharacterized protein LOC103641406    122   1e-27    
ref|XP_010107589.1|  hypothetical protein L484_024445                   120   1e-27    
ref|XP_004298653.1|  PREDICTED: uncharacterized protein LOC101312632    119   2e-27    
ref|XP_007214730.1|  hypothetical protein PRUPE_ppa025552mg             118   3e-27    
gb|KDP25640.1|  hypothetical protein JCGZ_20796                         118   4e-27    
ref|XP_007039901.1|  Uncharacterized protein TCM_016010                 117   5e-27    
ref|XP_010049497.1|  PREDICTED: uncharacterized protein LOC104438...    116   5e-27    
ref|XP_006474947.1|  PREDICTED: uncharacterized protein LOC102622846    117   7e-27    
ref|XP_007206972.1|  hypothetical protein PRUPE_ppb019575mg             117   1e-26    
ref|XP_003538725.1|  PREDICTED: uncharacterized protein LOC100804686    116   2e-26    
gb|EMS60608.1|  hypothetical protein TRIUR3_17948                       111   2e-26    
ref|XP_002529781.1|  conserved hypothetical protein                     115   3e-26    
ref|XP_003611279.1|  hypothetical protein MTR_5g012220                  115   3e-26    
ref|XP_006452516.1|  hypothetical protein CICLE_v10009089mg             115   3e-26    
ref|XP_009611022.1|  PREDICTED: uncharacterized protein LOC104104594    115   3e-26    
ref|XP_008369784.1|  PREDICTED: uncharacterized protein LOC103433317    115   5e-26    
ref|XP_007020619.1|  Nucleic acid binding protein, putative             114   6e-26    
ref|XP_008239445.1|  PREDICTED: uncharacterized protein LOC103338041    115   9e-26    
gb|KDO84846.1|  hypothetical protein CISIN_1g047748mg                   114   1e-25    
ref|XP_010264226.1|  PREDICTED: uncharacterized protein LOC104602302    113   2e-25    
ref|XP_002465507.1|  hypothetical protein SORBIDRAFT_01g040170          115   2e-25    
ref|XP_010259004.1|  PREDICTED: uncharacterized protein LOC104598566    113   2e-25    
ref|XP_008227113.1|  PREDICTED: uncharacterized protein LOC103326644    112   2e-25    
gb|EPS70876.1|  hypothetical protein M569_03883                         112   2e-25    
ref|XP_010239273.1|  PREDICTED: uncharacterized protein LOC100843588    112   3e-25    
gb|KDO62214.1|  hypothetical protein CISIN_1g021474mg                   113   3e-25    
ref|XP_004511668.1|  PREDICTED: uncharacterized protein LOC101497253    112   5e-25    
gb|ACF81889.1|  unknown                                                 111   7e-25    
gb|EYU27418.1|  hypothetical protein MIMGU_mgv1a012105mg                111   8e-25    
emb|CBI19851.3|  unnamed protein product                                113   9e-25    
ref|XP_004245743.1|  PREDICTED: uncharacterized protein LOC101248807    111   1e-24    
gb|EYU30305.1|  hypothetical protein MIMGU_mgv1a023120mg                111   1e-24    
ref|XP_009794944.1|  PREDICTED: uncharacterized protein LOC104241704    111   1e-24    
ref|XP_010653533.1|  PREDICTED: uncharacterized protein LOC104880052    108   1e-24    
ref|NP_001132864.1|  uncharacterized protein LOC100194357 precursor     112   1e-24    
ref|XP_007157337.1|  hypothetical protein PHAVU_002G061700g             110   2e-24    
ref|XP_009358174.1|  PREDICTED: uncharacterized protein LOC103948830    111   2e-24    
ref|XP_004147591.1|  PREDICTED: uncharacterized protein LOC101215943    110   2e-24    
ref|XP_003517429.1|  PREDICTED: uncharacterized protein LOC100820460    110   3e-24    
ref|XP_006355482.1|  PREDICTED: uncharacterized protein LOC102579011    110   3e-24    
ref|XP_008437118.1|  PREDICTED: uncharacterized protein LOC103482634    109   5e-24    
ref|XP_009419669.1|  PREDICTED: uncharacterized protein LOC103999603    110   6e-24    
gb|EYU33961.1|  hypothetical protein MIMGU_mgv1a025193mg                109   8e-24    
ref|XP_002529050.1|  nucleic acid binding protein, putative             106   1e-23    
ref|XP_011095504.1|  PREDICTED: uncharacterized protein LOC105174942    107   1e-23    
gb|EYU38823.1|  hypothetical protein MIMGU_mgv1a008195mg                109   1e-23    
ref|XP_008238578.1|  PREDICTED: uncharacterized protein LOC103337198    108   2e-23    
ref|XP_010910017.1|  PREDICTED: uncharacterized protein LOC105035988    108   2e-23    
ref|XP_007209406.1|  hypothetical protein PRUPE_ppa009247mg             107   3e-23    
ref|XP_010055520.1|  PREDICTED: uncharacterized protein LOC104443708    107   4e-23    
ref|XP_009376027.1|  PREDICTED: uncharacterized protein LOC103964782    106   4e-23    
ref|XP_010093698.1|  hypothetical protein L484_019038                   106   5e-23    
ref|XP_006440355.1|  hypothetical protein CICLE_v10021633mg             106   5e-23    
ref|XP_008381153.1|  PREDICTED: uncharacterized protein LOC103444024    106   6e-23    
ref|XP_011070099.1|  PREDICTED: uncharacterized protein LOC105155826    106   6e-23    
gb|EYU18571.1|  hypothetical protein MIMGU_mgv1a019057mg                106   7e-23    
ref|XP_002265516.2|  PREDICTED: uncharacterized protein LOC100257409    106   7e-23    
gb|EPS65892.1|  hypothetical protein M569_08885                         103   8e-23    
ref|NP_001049642.1|  Os03g0264600                                       107   8e-23    
ref|XP_010053442.1|  PREDICTED: uncharacterized protein LOC104441888    105   9e-23    
emb|CDP09926.1|  unnamed protein product                                106   1e-22    
gb|EAY89352.1|  hypothetical protein OsI_10856                          107   1e-22    
ref|XP_008373900.1|  PREDICTED: sulfated surface glycoprotein 185...    105   1e-22    
ref|XP_003550900.1|  PREDICTED: uncharacterized protein LOC100792099    105   2e-22    
ref|XP_009777439.1|  PREDICTED: uncharacterized protein LOC104227009    104   3e-22    
ref|XP_010256232.1|  PREDICTED: uncharacterized protein LOC104596678    102   4e-22    
ref|XP_002888021.1|  hypothetical protein ARALYDRAFT_475095             103   4e-22    
ref|NP_176441.1|  uncharacterized protein                               103   5e-22    
ref|XP_009347507.1|  PREDICTED: sulfated surface glycoprotein 185...    103   5e-22    
ref|XP_004516850.1|  PREDICTED: uncharacterized protein LOC101501278    102   8e-22    
ref|XP_006477236.1|  PREDICTED: uncharacterized protein LOC102619008    102   1e-21    
ref|XP_010676163.1|  PREDICTED: uncharacterized protein LOC104892044    102   1e-21    
gb|EYU24746.1|  hypothetical protein MIMGU_mgv1a019540mg                102   1e-21    
ref|XP_004984691.1|  PREDICTED: uncharacterized protein LOC101780280    103   2e-21    
ref|XP_011018284.1|  PREDICTED: uncharacterized protein LOC105121376    101   2e-21    
ref|XP_003525562.1|  PREDICTED: uncharacterized protein LOC100811674    101   3e-21    
ref|XP_006302657.1|  hypothetical protein CARUB_v10020761mg             101   3e-21    
ref|XP_006368187.1|  hypothetical protein POPTR_0001s00380g             101   3e-21    
gb|KDP39238.1|  hypothetical protein JCGZ_00995                         100   3e-21    
gb|KEH31656.1|  zinc finger (C2H2 type) family protein, putative        100   4e-21    
gb|EAZ26359.1|  hypothetical protein OsJ_10241                          102   5e-21    
ref|XP_002303513.1|  hypothetical protein POPTR_0003s11110g             100   6e-21    
ref|XP_007142380.1|  hypothetical protein PHAVU_008G275400g             100   7e-21    
ref|XP_010448871.1|  PREDICTED: uncharacterized protein LOC104731250  99.4    1e-20    
gb|EMT25648.1|  hypothetical protein F775_03002                       99.8    2e-20    
ref|XP_010675882.1|  PREDICTED: uncharacterized protein LOC104891823  98.6    2e-20    
ref|XP_010480999.1|  PREDICTED: uncharacterized protein LOC104759815    100   2e-20    
ref|XP_010434022.1|  PREDICTED: uncharacterized protein LOC104718060  98.2    2e-20    
ref|XP_010313934.1|  PREDICTED: uncharacterized protein LOC101267000  97.8    3e-20    
ref|XP_009409488.1|  PREDICTED: uncharacterized protein LOC103991687    100   3e-20    
ref|XP_011033942.1|  PREDICTED: uncharacterized protein LOC105132265  98.6    3e-20    
ref|XP_002869819.1|  hypothetical protein ARALYDRAFT_492613           97.8    3e-20    
ref|XP_010439314.1|  PREDICTED: uncharacterized protein LOC104722787  98.2    3e-20    
ref|XP_010533774.1|  PREDICTED: uncharacterized protein LOC104809462  98.2    3e-20    
ref|XP_010430306.1|  PREDICTED: uncharacterized protein LOC104714589  97.8    4e-20    
gb|KFK40596.1|  hypothetical protein AALP_AA2G016100                  97.8    4e-20    
ref|XP_003544700.1|  PREDICTED: uncharacterized protein LOC100779612  97.4    5e-20    
ref|XP_010473469.1|  PREDICTED: uncharacterized protein LOC104752910  97.4    6e-20    
ref|XP_010418244.1|  PREDICTED: uncharacterized protein LOC104703858  97.4    6e-20    
gb|AAR20741.1|  At4g22560                                             96.7    9e-20    
ref|NP_193987.1|  uncharacterized protein                             96.7    1e-19    
ref|XP_010097276.1|  hypothetical protein L484_009508                 97.1    1e-19    
ref|XP_006284350.1|  hypothetical protein CARUB_v10005522mg           95.9    1e-19    
ref|XP_003558290.1|  PREDICTED: uncharacterized protein LOC100821543  97.8    2e-19    
gb|EMT04641.1|  hypothetical protein F775_05339                       96.7    4e-19    
ref|XP_004491475.1|  PREDICTED: uncharacterized protein LOC101502304  94.7    4e-19    
ref|XP_010644542.1|  PREDICTED: uncharacterized protein LOC104877617  93.6    4e-19    
ref|XP_010539705.1|  PREDICTED: uncharacterized protein LOC104813695  94.7    4e-19    



>ref|XP_006365876.1| PREDICTED: uncharacterized protein LOC102601024 [Solanum tuberosum]
Length=417

 Score =   332 bits (850),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 7/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW   S   N+ NG+ERILKVHNMQK LA+FEEYRE VKIKASKLAKKH
Sbjct  219  SRKIVEIICRTSW---SKPENSSNGIERILKVHNMQKVLAQFEEYRELVKIKASKLAKKH  275

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF GTTVEC+LG N SSSLCTSEKC VCRIL+ GF+IKKEINGGVGVFT
Sbjct  276  PRCLADGNELLRFFGTTVECSLGINSSSSLCTSEKCKVCRILQHGFSIKKEINGGVGVFT  335

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RALEAIEE    N  + RKALIVCRVIAGRVHRPLENV+EL GQSGFDSLAGKVG
Sbjct  336  ASTSGRALEAIEE----NMLSWRKALIVCRVIAGRVHRPLENVQELIGQSGFDSLAGKVG  391

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL P+ALLPCFVVICK+
Sbjct  392  LYSNIEELYLLSPKALLPCFVVICKS  417



>ref|XP_004232757.1| PREDICTED: uncharacterized protein LOC101266475 [Solanum lycopersicum]
Length=421

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 181/206 (88%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS    S   N+ NG+ERILKVHNMQK LA+FEEYRE VKIKASKLAKKH
Sbjct  220  SRKIVEIICRTSC---SKPENSSNGIERILKVHNMQKVLAQFEEYRELVKIKASKLAKKH  276

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF GTTVEC+LG N SSSLCTSEKC VCRIL+RGF+IKKEINGGVGVFT
Sbjct  277  PRCLADGNELLRFFGTTVECSLGMNSSSSLCTSEKCKVCRILQRGFSIKKEINGGVGVFT  336

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RALEAIEE+   N  + RKALIVCRVIAGRVHRPLENV+EL GQSGFDSLAGKVG
Sbjct  337  ASTSGRALEAIEEND-ENILSCRKALIVCRVIAGRVHRPLENVQELMGQSGFDSLAGKVG  395

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL P+ALLPCFVVICK+
Sbjct  396  LYSNIEELYLLSPKALLPCFVVICKS  421



>ref|XP_009588899.1| PREDICTED: uncharacterized protein LOC104086354 [Nicotiana tomentosiformis]
Length=420

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS    S   NN NG+ERILKVHNMQK LA+FEEYRE VKIKASKLAKKH
Sbjct  220  SRKIVEIICRTSC---SKPENNSNGIERILKVHNMQKVLAQFEEYRELVKIKASKLAKKH  276

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+EC+LG N +SSLCTSEKC VCRILR GF+IKKEINGGVGVFT
Sbjct  277  PRCLADGNELLRFYGTTLECSLGMNGASSLCTSEKCKVCRILRHGFSIKKEINGGVGVFT  336

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RALEAIEE+   +  + RKALIVCRVIAGRVHRPLENV+EL GQSGFDSLAGKVG
Sbjct  337  ASTSGRALEAIEEND--DSLSLRKALIVCRVIAGRVHRPLENVQELIGQSGFDSLAGKVG  394

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ +ALLPCFVVICK+
Sbjct  395  LYSNIEELYLLNSKALLPCFVVICKS  420



>ref|XP_009765356.1| PREDICTED: uncharacterized protein LOC104216918 [Nicotiana sylvestris]
Length=420

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS    S   NN NG+ RILKVHNMQK LA+FEEYRE VKIKASKLAKKH
Sbjct  220  SRKIVEIICRTSC---SKPENNSNGIVRILKVHNMQKVLAQFEEYRELVKIKASKLAKKH  276

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTVEC+LG N SSSLCTSEKC VCRILR GF+IKKEINGGV VFT
Sbjct  277  PRCLADGNELLRFYGTTVECSLGMNGSSSLCTSEKCKVCRILRHGFSIKKEINGGVAVFT  336

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RALEAIEE+   +  + RKALIVCRVIAGRVHRPLENV+EL GQSGFDSLAGKVG
Sbjct  337  ASTSGRALEAIEEND--DNISLRKALIVCRVIAGRVHRPLENVQELIGQSGFDSLAGKVG  394

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ +ALLPCFVVICK+
Sbjct  395  LYSNIEELYLLNSKALLPCFVVICKS  420



>emb|CBI41096.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N+  C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  186  SRKIVEIICRTSW-LKSENS--CGRIERVLKVHNMQKTLARFEEYREIVKIKASKLPKKH  242

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SSSLCTS+KC+VCRILR GF+ KKE+NGGVGVFT
Sbjct  243  PRCLADGNELLRFHGTTIACSLGMNGSSSLCTSDKCSVCRILRHGFSTKKEVNGGVGVFT  302

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS  A E+I+ +   NQ   R ALIVCRVIAGRVHRPLEN++ELAGQSGFDSLAGKVG
Sbjct  303  TSTSGSAFESIKLNE-ENQSVGR-ALIVCRVIAGRVHRPLENIQELAGQSGFDSLAGKVG  360

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P ALLPCFVVICK 
Sbjct  361  VYSNIEELYLLNPIALLPCFVVICKP  386



>ref|XP_010647488.1| PREDICTED: uncharacterized protein LOC100244205 [Vitis vinifera]
Length=418

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N+  C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  218  SRKIVEIICRTSW-LKSENS--CGRIERVLKVHNMQKTLARFEEYREIVKIKASKLPKKH  274

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SSSLCTS+KC+VCRILR GF+ KKE+NGGVGVFT
Sbjct  275  PRCLADGNELLRFHGTTIACSLGMNGSSSLCTSDKCSVCRILRHGFSTKKEVNGGVGVFT  334

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS  A E+I+ +   NQ   R ALIVCRVIAGRVHRPLEN++ELAGQSGFDSLAGKVG
Sbjct  335  TSTSGSAFESIKLNE-ENQSVGR-ALIVCRVIAGRVHRPLENIQELAGQSGFDSLAGKVG  392

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P ALLPCFVVICK 
Sbjct  393  VYSNIEELYLLNPIALLPCFVVICKP  418



>emb|CDP19908.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS ++KSDN  N  G+ERILKVHNMQKTLA+FE+YRE VKIKASKLAKKH
Sbjct  217  SRKIVEIICRTS-SSKSDN--NAGGIERILKVHNMQKTLAQFEDYRETVKIKASKLAKKH  273

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTVEC LG N S+SLCTS+KC VC+ILR GF   KE N G+GVFT
Sbjct  274  PRCLADGNELLRFHGTTVECPLGMNGSASLCTSDKCGVCQILRHGFPTNKESNNGIGVFT  333

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS+RA E++E S   ++ + RKALIVCRVIAGRVH+PL+NV+ELAGQSGFDSLAGKVG
Sbjct  334  ASTSNRAFESVEVSD--DKTSLRKALIVCRVIAGRVHKPLDNVQELAGQSGFDSLAGKVG  391

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +YSN+EEL+LL+ +ALLPCFVVICK
Sbjct  392  LYSNIEELYLLNAKALLPCFVVICK  416



>gb|AFK40972.1| unknown [Medicago truncatula]
Length=437

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  237  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLQKKH  293

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  294  PRCLADGNELLRFYGTTVACSLGLNGSSSLCLSEKCWVCRIIRSGFSAKKELKGGIGVFT  353

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     N+ + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  354  TSTSGRAFESIE--IFDNEPSLRKALIVCRVIAGRVHRPLENIQEMASQTGFDSLAGKVG  411

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK+
Sbjct  412  LYSNIEELYLLNPRALLPCFVVICKS  437



>ref|XP_002317560.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE98172.1| zinc finger family protein [Populus trichocarpa]
Length=439

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  239  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYRETVKIKASKLPKKH  295

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
            +RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+ GGVGVFT
Sbjct  296  SRCIADGNELLRFYGTTVACSLGINGSSSLCISEKCRVCRIIRNGFSAKKELKGGVGVFT  355

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +  + RKALIVCRVIAGRVHRPLEN++E++GQ+GFDSLAGKVG
Sbjct  356  TSTSGRAFESIE--IFEDDPSTRKALIVCRVIAGRVHRPLENIQEISGQTGFDSLAGKVG  413

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK+
Sbjct  414  LYSNIEELYLLNPRALLPCFVVICKS  439



>ref|XP_003607708.1| C2H2 zinc finger protein [Medicago truncatula]
 ref|XP_003636713.1| C2H2 zinc finger protein [Medicago truncatula]
 gb|AES89905.1| C2H2-like zinc finger protein [Medicago truncatula]
Length=437

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  237  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLQKKH  293

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  294  PRCLADGNELLRFYGTTVACSLGLNGSSSLCLSEKCCVCRIIRSGFSAKKELKGGIGVFT  353

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     N+ + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  354  TSTSGRAFESIE--IFDNEPSLRKALIVCRVIAGRVHRPLENIQEMASQTGFDSLAGKVG  411

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK+
Sbjct  412  LYSNIEELYLLNPRALLPCFVVICKS  437



>ref|XP_010267823.1| PREDICTED: uncharacterized protein LOC104604941 [Nelumbo nucifera]
 ref|XP_010267824.1| PREDICTED: uncharacterized protein LOC104604941 [Nelumbo nucifera]
 ref|XP_010267825.1| PREDICTED: uncharacterized protein LOC104604941 [Nelumbo nucifera]
Length=425

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW       +NC  +ER+LKVHNMQKTLA FEEYRE VK+KASKL KKH
Sbjct  225  SRKIVEIICRTSWL---KTESNCGRIERVLKVHNMQKTLARFEEYREMVKMKASKLPKKH  281

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SS+LC S+KC+VCRI+R GF+ KKEI GG+GVFT
Sbjct  282  PRCLADGNELLRFYGTTVACSLGMNGSSNLCVSDKCSVCRIIRHGFSTKKEIKGGIGVFT  341

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKALIVCRVIAGRVHRPLEN +ELAGQ+GFDSLAGKVG
Sbjct  342  TSTSGRAFESIELYE--ENLSVRKALIVCRVIAGRVHRPLENFQELAGQTGFDSLAGKVG  399

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  400  LYSNIEELYLLNPRALLPCFVVICKP  425



>gb|KDP39034.1| hypothetical protein JCGZ_00791 [Jatropha curcas]
Length=434

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  234  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C+LG N SSSLC SEKC+VCRI+R GF+ KKE+ GG+GVFT
Sbjct  291  PRCIADGNELLRFYGTTIACSLGVNGSSSLCVSEKCSVCRIIRNGFSAKKELKGGIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKALI+CRVIAGRVHRPLEN++E++GQ+GFDSLAGKVG
Sbjct  351  TSTSGRAFESIE--IFEEDQSIRKALILCRVIAGRVHRPLENIQEISGQTGFDSLAGKVG  408

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  409  LYSNIEELYLLNPRALLPCFVVICKP  434



>ref|XP_007132990.1| hypothetical protein PHAVU_011G142000g [Phaseolus vulgaris]
 gb|ESW04984.1| hypothetical protein PHAVU_011G142000g [Phaseolus vulgaris]
Length=439

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  239  SRKIVEIICRTSWL-KSEN--QCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLQKKH  295

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  296  PRCLADGNELLRFYGTTVACSLGLNGSSSLCLSEKCCVCRIIRNGFSAKKELKGGIGVFT  355

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     ++ + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  356  TSTSGRAFESIEIFD--DEPSLRKALIVCRVIAGRVHRPLENIQEMAAQTGFDSLAGKVG  413

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  414  LYSNIEELYLLNPRALLPCFVVICKP  439



>ref|XP_010241023.1| PREDICTED: uncharacterized protein LOC104585747 [Nelumbo nucifera]
Length=429

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  +ER+LKVHNMQKTLA FEEYRE VK+KASKL KKH
Sbjct  229  SRKIVEIICRTSWL-KSEN--NCGRIERVLKVHNMQKTLARFEEYREMVKMKASKLPKKH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SS+LC  EKC+VCRI+R GF+ KKE+ GG+GVFT
Sbjct  286  PRCLADGNELLRFYGTTVACSLGMNGSSNLCMLEKCSVCRIIRHGFSTKKELKGGIGVFT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+     +  + +KALIVCRVIAGRVHRPLEN +ELAGQ+GFDSLAGKVG
Sbjct  346  TSTSGRAFESIQLYE--DDPSVKKALIVCRVIAGRVHRPLENFQELAGQTGFDSLAGKVG  403

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +YSN+EEL+LL+PRALLPCFVVIC+
Sbjct  404  LYSNIEELYLLNPRALLPCFVVICR  428



>ref|NP_001240057.1| uncharacterized protein LOC100787790 [Glycine max]
 gb|ACU18688.1| unknown [Glycine max]
 gb|KHN47840.1| hypothetical protein glysoja_029258 [Glycine soja]
Length=441

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  241  SRKIVEIICRTSWL-KSEN--QCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLQKKH  297

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  298  PRCLADGNELLRFYGTTVSCSLGLNGSSSLCLSEKCCVCRIIRNGFSAKKELKGGIGVFT  357

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+ +    + + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  358  TSTSGRAFESIDIT--CEEPSLRKALIVCRVIAGRVHRPLENIQEMAAQTGFDSLAGKVG  415

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  416  LYSNIEELYLLNPRALLPCFVVICKP  441



>gb|KHN20446.1| hypothetical protein glysoja_036162 [Glycine soja]
Length=442

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  242  SRKIVEIICRTSWL-KSEN--QCGRIERVLKVHNMQKTLARFEEYRETVKIKASKLQKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GT+V C+LG N SS+LC SEKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  299  PRCLADGNELLRFYGTSVSCSLGLNGSSTLCLSEKCCVCRIIRNGFSAKKELKGGIGVFT  358

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE      + + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  359  TSTSGRAFESIE--IIGEEPSLRKALIVCRVIAGRVHRPLENIQEMAAQTGFDSLAGKVG  416

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  417  LYSNIEELYLLNPRALLPCFVVICKP  442



>ref|XP_004505426.1| PREDICTED: uncharacterized protein LOC101514605 [Cicer arietinum]
Length=427

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  227  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLQKKH  283

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ K E+ GG+GVFT
Sbjct  284  PRCLADGNELLRFYGTTVSCSLGLNGSSSLCLSEKCCVCRIIRNGFSAKNELKGGIGVFT  343

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     ++ + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  344  TSTSGRAFECIE--ILDDEPSLRKALIVCRVIAGRVHRPLENIQEMASQTGFDSLAGKVG  401

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  402  LYSNIEELYLLNPRALLPCFVVICKP  427



>ref|XP_010062955.1| PREDICTED: uncharacterized protein LOC104450201 [Eucalyptus grandis]
 gb|KCW70112.1| hypothetical protein EUGRSUZ_F03418 [Eucalyptus grandis]
Length=432

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT W  KS+N    N +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  231  SRKIVEIICRTGWL-KSENQGG-NRIERVLKVHNMQKTLARFEEYREAVKIKASKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C LG + SSSLCTSE+C VCRI+R GF++KKE  GG+GVFT
Sbjct  289  PRCLADGNELLRFYGTTVACPLGLDGSSSLCTSERCCVCRIVRHGFSVKKESKGGIGVFT  348

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+  +  +    RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  349  TSTSGRAFESID--AVEDVPTVRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  406

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YS++EEL+LL+PRALLPCFVVICK 
Sbjct  407  LYSHIEELYLLNPRALLPCFVVICKP  432



>ref|XP_006452135.1| hypothetical protein CICLE_v10008310mg [Citrus clementina]
 ref|XP_006475291.1| PREDICTED: uncharacterized protein LOC102608520 [Citrus sinensis]
 gb|ESR65375.1| hypothetical protein CICLE_v10008310mg [Citrus clementina]
Length=442

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW     + N+C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  242  SRKIVEIICRTSWL---KSENHCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N  SSLC  EKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  299  PRCLADGNELLRFYGTTVACSLGLNGCSSLCVLEKCCVCRIIRNGFSTKKELKGGIGVFT  358

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +  + RKAL+VCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  359  TSTSGRAFESIE--IVEDDPSIRKALMVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  416

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  417  LYSNIEELYLLNPRALLPCFVVICKP  442



>ref|XP_007021103.1| Transcription factor [Theobroma cacao]
 gb|EOY12628.1| Transcription factor [Theobroma cacao]
Length=438

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  238  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  294

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI++ GF+ KKE+  G+GVFT
Sbjct  295  PRCLADGNELLRFYGTTVACSLGLNGSSSLCISEKCCVCRIIKNGFSAKKELKEGIGVFT  354

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +    RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  355  TSTSGRAFESIE--ILEDDPFIRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  412

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  413  LYSNIEELYLLNPRALLPCFVVICKP  438



>emb|CBI20489.3| unnamed protein product [Vitis vinifera]
Length=392

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTL  FEEYRE VK KASKL KKH
Sbjct  192  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLGRFEEYREMVKTKASKLPKKH  248

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C LG N SS+LC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  249  PRCLADGNELLRFYGTTMTCALGVNGSSNLCISDKCCVCRIIRHGFSAKKELKGGIGVFT  308

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKALIVCRVIAGRVHRPLEN++++AGQSGFDSLAGKVG
Sbjct  309  TSTSGRAFESIEVYD--EDPSIRKALIVCRVIAGRVHRPLENIQDMAGQSGFDSLAGKVG  366

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  367  LYSNIEELYLLNPRALLPCFVVICKP  392



>gb|KHG08884.1| Zinc finger and BTB domain-containing 16 [Gossypium arboreum]
Length=432

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQKTLA FE+YRE VKIKASKL KKH
Sbjct  232  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQKTLARFEDYREMVKIKASKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+  G+GVFT
Sbjct  289  PRCIADGNELLRFYGTTVACSLGLNGSSSLCISEKCCVCRIIRNGFSAKKELKEGLGVFT  348

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+     +  + RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  349  TSTSGRAFESIQ--ILEDDPSIRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  406

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  407  LYSNIEELYLLNPRALLPCFVVICKP  432



>ref|XP_006370600.1| hypothetical protein POPTR_0001s44130g [Populus trichocarpa]
 gb|ERP67169.1| hypothetical protein POPTR_0001s44130g [Populus trichocarpa]
Length=440

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVH+MQKTLA FEEYRE VKIKASKL KKH
Sbjct  240  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHSMQKTLARFEEYREMVKIKASKLPKKH  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF++KKE+ GGVGVFT
Sbjct  297  PRCIADGNELLRFYGTTVACSLGVNGSSSLCVSEKCCVCRIIRNGFSVKKELKGGVGVFT  356

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +    RKALIVCRVIAGRVHRPLEN++E++ Q+GFDSLAGKVG
Sbjct  357  TSTSGRAFECIE--IFEDDPCIRKALIVCRVIAGRVHRPLENIQEISSQTGFDSLAGKVG  414

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICK+
Sbjct  415  LYSNIEELYLLNPKALLPCFVVICKS  440



>ref|XP_009355567.1| PREDICTED: uncharacterized protein LOC103946569 [Pyrus x bretschneideri]
Length=445

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQ+TLA FEEYRE VKIKASKL KKH
Sbjct  245  SRKIVEIICRTSW-LKSEN--HCRRIERVLKVHNMQRTLARFEEYREIVKIKASKLPKKH  301

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C LG N SSSLC SEKC+VCRI+R GF+ KKE+  GVGVFT
Sbjct  302  PRCIADGNELLRFYGTTVACALGLNGSSSLCVSEKCSVCRIIRNGFSAKKELKQGVGVFT  361

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA EAIE        + RKALIVCRVIAGRVH+PLEN++E+AGQ GFDSLAGK+G
Sbjct  362  TSTSGRAFEAIE--VLEEDASVRKALIVCRVIAGRVHKPLENIQEIAGQMGFDSLAGKMG  419

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCF+VICK 
Sbjct  420  LYSNIEELYLLNPRALLPCFLVICKP  445



>ref|XP_010644321.1| PREDICTED: uncharacterized protein LOC100260605 [Vitis vinifera]
Length=429

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW     + N+C  +ER+LKVHNMQKTL  FEEYRE VK KASKL KKH
Sbjct  229  SRKIVEIICRTSWL---KSENHCGRIERVLKVHNMQKTLGRFEEYREMVKTKASKLPKKH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C LG N SS+LC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  286  PRCLADGNELLRFYGTTMTCALGVNGSSNLCISDKCCVCRIIRHGFSAKKELKGGIGVFT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKALIVCRVIAGRVHRPLEN++++AGQSGFDSLAGKVG
Sbjct  346  TSTSGRAFESIEVYD--EDPSIRKALIVCRVIAGRVHRPLENIQDMAGQSGFDSLAGKVG  403

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  404  LYSNIEELYLLNPRALLPCFVVICKP  429



>ref|XP_008386033.1| PREDICTED: uncharacterized protein LOC103448548 [Malus domestica]
Length=442

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQ+TLA FEEYRE VKIKASKLAKKH
Sbjct  242  SRKIVEIICRTSW-LKSEN--HCGRIERVLKVHNMQRTLARFEEYREIVKIKASKLAKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC+VCRI+R GF+ KKE+  GVGVF 
Sbjct  299  PRCIADGNELLRFYGTTVACSLGLNGSSSLCVSEKCSVCRIIRNGFSAKKELKEGVGVFX  358

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA EAIE        + RKALIVCRVIAGRVH+PLEN++E+AGQ GFDSLAGK+G
Sbjct  359  TSTSGRAFEAIE--ILEEDASVRKALIVCRVIAGRVHKPLENIQEIAGQMGFDSLAGKMG  416

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCF+VICK 
Sbjct  417  LYSNIEELYLLNPRALLPCFLVICKP  442



>gb|KDO41851.1| hypothetical protein CISIN_1g013455mg [Citrus sinensis]
Length=442

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW     + N+C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  242  SRKIVEIICRTSWL---KSENHCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N  SSLC  EKC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  299  PRCLADGNELLRFYGTTVACSLGLNGCSSLCVLEKCCVCRIIRNGFSTKKELKGGIGVFT  358

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +  + RKAL+VCRVIAGRVHRPLEN++ +AGQ+GFDSLAGKVG
Sbjct  359  TSTSGRAFESIE--IVEDDPSIRKALMVCRVIAGRVHRPLENIQGMAGQTGFDSLAGKVG  416

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  417  LYSNIEELYLLNPRALLPCFVVICKP  442



>emb|CAN83989.1| hypothetical protein VITISV_039126 [Vitis vinifera]
Length=429

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  M R+LKVHNMQKTL  FEEYRE VK KAS L KKH
Sbjct  229  SRKIVEIICRTSW-LKSEN--HCGRMXRVLKVHNMQKTLGRFEEYREMVKTKASXLPKKH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C LG N SS+LC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  286  PRCLADGNELLRFYGTTMTCALGVNGSSNLCISDKCCVCRIIRHGFSAKKELKGGIGVFT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKALIVCRVIAGRVHRPLEN++++AGQSGFDSLAGKVG
Sbjct  346  TSTSGRAFESIEVYD--EDPSIRKALIVCRVIAGRVHRPLENIQDMAGQSGFDSLAGKVG  403

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  404  LYSNIEELYLLNPRALLPCFVVICKP  429



>ref|XP_006830064.1| hypothetical protein AMTR_s00125p00062940 [Amborella trichopoda]
 gb|ERM97480.1| hypothetical protein AMTR_s00125p00062940 [Amborella trichopoda]
Length=422

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  222  SRKIVEIICRTSWL-KSEN--NCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  278

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+G+T+ C+LG N  S+LC SEKC+VCRI+R GF+ KKE  GG+GVFT
Sbjct  279  PRCLADGNELLRFYGSTITCSLGMNGFSNLCNSEKCSVCRIIRHGFSTKKEGKGGIGVFT  338

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE        + RKAL+VCRVIAGRVHRPL+N++ L+GQSGFDS+AGKVG
Sbjct  339  TSTSGRAYESIEL--FEENPSLRKALLVCRVIAGRVHRPLDNMQALSGQSGFDSVAGKVG  396

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  397  LYSNIEELYLLNPRALLPCFVVICKP  422



>ref|XP_011095310.1| PREDICTED: uncharacterized protein LOC105174809 [Sesamum indicum]
Length=433

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW     + N+C  ++R+LKVHNMQKTLA FE+YRE VKIKASKL KKH
Sbjct  233  SRKIVEIICRSSWL---KSENHCVRIDRVLKVHNMQKTLARFEDYRETVKIKASKLPKKH  289

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC S+KC VCRI+R GF+ K+E+  GVGVFT
Sbjct  290  PRCLADGNELLRFYGTTLACSLGINGSSSLCVSDKCCVCRIIRDGFSTKRELKDGVGVFT  349

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I  + C +  + RKALIVCRVIAGRVHRPLEN++E++GQ+GFDSLAGKVG
Sbjct  350  TSTSGRAFESI--AMCEDDASLRKALIVCRVIAGRVHRPLENIQEISGQTGFDSLAGKVG  407

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICK 
Sbjct  408  LYSNIEELYLLNPKALLPCFVVICKT  433



>emb|CDY28761.1| BnaA02g09530D [Brassica napus]
Length=447

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  241  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  297

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N GVGVFT
Sbjct  298  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSAKREKNNGVGVFT  357

Query  628  ASTSSRALEAI--EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLA  461
            ASTS RA E+I  EE         RK LIVCRVIAGRVHRP+ENVEE+ G   SGFDSLA
Sbjct  358  ASTSGRAFESILVEEGDGERTVTVRKVLIVCRVIAGRVHRPVENVEEMNGLMMSGFDSLA  417

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y+NVEEL+LL+PRALLPCFVVICK+
Sbjct  418  GKVGLYTNVEELYLLNPRALLPCFVVICKS  447



>ref|XP_010694273.1| PREDICTED: uncharacterized protein LOC104907097 [Beta vulgaris 
subsp. vulgaris]
Length=499

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHN QKT+A FEEYRE VKIKASKLAKKH
Sbjct  299  SRKIVEIICRTSW-LKSEN--HCGRIERVLKVHNTQKTIARFEEYREMVKIKASKLAKKH  355

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG + SSSLC SEKC VCRI+R GF  KKEI  GVGVFT
Sbjct  356  PRCLADGNELLRFYGTTVACSLGIDGSSSLCISEKCCVCRIIRHGFYTKKEIKSGVGVFT  415

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +  + +KALIVCRVIAGRVHRPLENV+ELAGQ+GFDSLAGKVG
Sbjct  416  TSTSGRAFEGIEFFD--DDASIKKALIVCRVIAGRVHRPLENVQELAGQTGFDSLAGKVG  473

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YS++EEL+LL+PRALLPCFVVICK 
Sbjct  474  LYSSIEELYLLNPRALLPCFVVICKP  499



>ref|XP_010092302.1| hypothetical protein L484_021164 [Morus notabilis]
 gb|EXB50936.1| hypothetical protein L484_021164 [Morus notabilis]
Length=443

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N      +ER+LKVHNMQKTLA FEE+RE VKIKASKL KKH
Sbjct  243  SRKIVEIICRTSWL-KSEN--QFGRIERVLKVHNMQKTLARFEEHREMVKIKASKLPKKH  299

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC SEKC+VCRI+R GF+ KKE+  GVGVFT
Sbjct  300  PRCLADGNELLRFYGTTLACSLGLNGSSSLCVSEKCSVCRIIRNGFSAKKELKEGVGVFT  359

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+          RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  360  TSTSGRAFESID--IFEEDPTLRKALIVCRVIAGRVHRPLENIQEIAGQTGFDSLAGKVG  417

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  418  LYSNIEELYLLNPRALLPCFVVICKP  443



>emb|CDY06635.1| BnaC02g13590D [Brassica napus]
Length=440

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  236  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  292

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N GVGVFT
Sbjct  293  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSAKREKNNGVGVFT  352

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLAGK  455
            ASTS RA E+I       +   RK LIVCRVIAGRVHRP+ENVEE+ G   SGFDSLAGK
Sbjct  353  ASTSGRAFESILVEEDDGERTVRKVLIVCRVIAGRVHRPVENVEEMNGLMMSGFDSLAGK  412

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            VG+Y+NVEEL+LL+PRALLPCFVVICK+
Sbjct  413  VGLYTNVEELYLLNPRALLPCFVVICKS  440



>ref|XP_008452316.1| PREDICTED: uncharacterized protein LOC103493380 [Cucumis melo]
Length=435

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N +    +ER+LKVHNMQ+TLA FEEYRE VKIKASKL KKH
Sbjct  234  SRKIVEIICRTSW-LKSENQSG--RIERVLKVHNMQRTLARFEEYRETVKIKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C LG N SSSLC SEKC VCRI+R GF+ K E+  G+GVFT
Sbjct  291  PRCLADGNELLRFYGTTVACLLGLNGSSSLCISEKCCVCRIIRNGFSAKTEMEEGIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS+RA  +I+ S   ++G  RKA+IVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  351  TSTSARAFSSIKGSG-GDEGMTRKAMIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  409

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  410  LHSNIEELYLLNPRALLPCFVVICKP  435



>ref|XP_009392680.1| PREDICTED: uncharacterized protein LOC103978555 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=445

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW       ++C  +ER+LKVHNMQKTL+ FEEYRE VK KASKLAKKH
Sbjct  242  SRKIVEIICRASWLKPE---SSCIRIERVLKVHNMQKTLSRFEEYRELVKNKASKLAKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SSSLC+SEKCNVCRI+R GF+ KKE+ GG+GVFT
Sbjct  299  PRCLADGNELLRFHGTTMACSLGTNGSSSLCSSEKCNVCRIIRHGFSAKKEVKGGIGVFT  358

Query  628  ASTSSRALEAIEESSCANQGAA-RKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
             STS RA E IE     +   + +KAL+VCRVIAGRVH+PL+N +ELAG SGFDS+AGKV
Sbjct  359  TSTSGRAFETIETYDDDDGDPSIKKALLVCRVIAGRVHKPLDNYQELAGHSGFDSMAGKV  418

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
            G+Y+N+EEL+LL+PRALLPCFVVIC+
Sbjct  419  GLYANIEELYLLNPRALLPCFVVICR  444



>ref|XP_011048266.1| PREDICTED: uncharacterized protein LOC105142368 [Populus euphratica]
Length=440

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 173/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVH+MQKTLA FEEYRE VKIKASKL KKH
Sbjct  240  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHSMQKTLARFEEYREMVKIKASKLPKKH  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC S+KC VCRI+R GF+ KKE+ GGVGVFT
Sbjct  297  PRCMADGNELLRFYGTTVACSLGVNGSSSLCASDKCCVCRIIRNGFSAKKELKGGVGVFT  356

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +    RKALIVCRVIAGRVHRPLE+++E++ Q+GFDSLAGKVG
Sbjct  357  TSTSGRAFECIE--IFEDDPCIRKALIVCRVIAGRVHRPLEDIQEISSQTGFDSLAGKVG  414

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICK+
Sbjct  415  LYSNIEELYLLNPKALLPCFVVICKS  440



>ref|XP_004149303.1| PREDICTED: uncharacterized protein LOC101208986 [Cucumis sativus]
 gb|KGN56194.1| hypothetical protein Csa_3G098560 [Cucumis sativus]
Length=435

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N +    +ER+LKVHNMQ+TLA FEEYRE VKIKASKL KKH
Sbjct  234  SRKIVEIICRTSWL-KSENQSG--RIERVLKVHNMQRTLARFEEYRETVKIKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C LG N SSSLC SEKC VCRI+R GF+ K E+  G+GVFT
Sbjct  291  PRCLADGNELLRFYGTTVGCLLGLNGSSSLCISEKCCVCRIIRNGFSAKTEMEEGIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS+RA  +I+ S   ++G  RKA+IVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  351  TSTSARAFSSIKGSG-GDEGMTRKAMIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  409

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  410  LHSNIEELYLLNPRALLPCFVVICKP  435



>emb|CDP05812.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW     + ++C  +E++LKVHNMQKTLA FEEYRE VK+KASKL KKH
Sbjct  231  SRKIVEIICRSSWL---KSESHCGRIEKVLKVHNMQKTLARFEEYREMVKVKASKLPKKH  287

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N +SSLC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  288  PRCLADGNELLRFYGTTIACSLGMNGASSLCASDKCCVCRIIRNGFSTKKELKGGIGVFT  347

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE          RKALIVCRVIAGRVHRPLEN++E+ GQ+GFDSLAGKVG
Sbjct  348  TSTSGRAFESIEIFEV--DPTIRKALIVCRVIAGRVHRPLENMQEMIGQTGFDSLAGKVG  405

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  406  LYSNIEELYLLNPRALLPCFVVICKT  431



>gb|KFK27073.1| hypothetical protein AALP_AA8G330700 [Arabis alpina]
Length=458

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW       N C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  255  SRKIVEIICRTSWLKAE---NQCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  311

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N G+GVFT
Sbjct  312  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSAKREKNNGIGVFT  371

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLAGKV  452
            ASTS RA E+I  S        RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDSLAGKV
Sbjct  372  ASTSRRAFESIMISDGDGDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDSLAGKV  431

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G+Y+NVEEL+LL+P+ALLPCFVVICK+
Sbjct  432  GLYTNVEELYLLNPKALLPCFVVICKS  458



>ref|XP_009127078.1| PREDICTED: uncharacterized protein LOC103851949 [Brassica rapa]
Length=473

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  267  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  323

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N GVGVFT
Sbjct  324  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSAKREKNNGVGVFT  383

Query  628  ASTSSRALEAI--EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLA  461
            ASTS RA E+I  EE         RK LIVCRVIAGRVHRP+ENVEE+ G   SGFDSLA
Sbjct  384  ASTSGRAFESILVEEGDGERTVTVRKVLIVCRVIAGRVHRPVENVEEVNGLMMSGFDSLA  443

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y+NVEEL+LL+PRALLPCFVVICK+
Sbjct  444  GKVGLYTNVEELYLLNPRALLPCFVVICKS  473



>ref|XP_008776712.1| PREDICTED: uncharacterized protein LOC103696776 [Phoenix dactylifera]
Length=432

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRTS   KS+++     +ER+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  232  SRKIVEMICRTSL-VKSESSRW--RIERVLKVHNMQKTLARFEEYREMVKIRASKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N +SSLC SEKC+VCRI+R GF++KKE+NGG+GVFT
Sbjct  289  PRCLADGNELLRFYGTTIGCSLGMNGTSSLCASEKCSVCRIIRHGFSMKKELNGGIGVFT  348

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +  + +KAL+VCRVIAGRVH+PL+N +ELAGQSGFDSLAGKVG
Sbjct  349  TSTSGRAFESIE--IYGDDSSIKKALLVCRVIAGRVHKPLDNFQELAGQSGFDSLAGKVG  406

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+N+EEL+LL+P+ALLPCFVVICK+
Sbjct  407  LYANIEELYLLNPQALLPCFVVICKS  432



>ref|XP_004167219.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208986 
[Cucumis sativus]
Length=435

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N +    +ER+LKVHNMQ+TLA FEEYRE VKIKASKL KKH
Sbjct  234  SRKIVEIICRTSW-LKSENQSG--RIERVLKVHNMQRTLARFEEYRETVKIKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C LG N SSSLC SEKC VCRI+R GF+ K E+  G+GVFT
Sbjct  291  PRCLADGNELLRFYGTTVGCLLGLNGSSSLCISEKCCVCRIIRNGFSAKTEMEEGIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS+RA  +I+ S   ++G  RKA+IVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  351  TSTSARAFSSIKGSG-GDEGMTRKAMIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  409

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  410  LHSNIEELYLLNPRALLPCFVVICKP  435



>ref|XP_009392663.1| PREDICTED: uncharacterized protein LOC103978555 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392672.1| PREDICTED: uncharacterized protein LOC103978555 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=462

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW       ++C  +ER+LKVHNMQKTL+ FEEYRE VK KASKLAKKH
Sbjct  259  SRKIVEIICRASWLKPE---SSCIRIERVLKVHNMQKTLSRFEEYRELVKNKASKLAKKH  315

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SSSLC+SEKCNVCRI+R GF+ KKE+ GG+GVFT
Sbjct  316  PRCLADGNELLRFHGTTMACSLGTNGSSSLCSSEKCNVCRIIRHGFSAKKEVKGGIGVFT  375

Query  628  ASTSSRALEAIEESSCANQGAA-RKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
             STS RA E IE     +   + +KAL+VCRVIAGRVH+PL+N +ELAG SGFDS+AGKV
Sbjct  376  TSTSGRAFETIETYDDDDGDPSIKKALLVCRVIAGRVHKPLDNYQELAGHSGFDSMAGKV  435

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
            G+Y+N+EEL+LL+PRALLPCFVVIC+
Sbjct  436  GLYANIEELYLLNPRALLPCFVVICR  461



>emb|CDY29286.1| BnaC01g19380D [Brassica napus]
Length=411

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 167/206 (81%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRTSW       N C  ++RILKVHNMQKTLA FEEYR+ VK +ASKL KKH
Sbjct  210  SRKIVEMICRTSWL---KTENQCGRIDRILKVHNMQKTLARFEEYRDTVKNRASKLQKKH  266

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTTV C LG N  +SLC+SEKC VCRI+R GF++K+E+N G+GVFT
Sbjct  267  PRCIADGNELLRFHGTTVSCVLGVNGCTSLCSSEKCCVCRIIRNGFSVKREMNNGIGVFT  326

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RA E+IE     +    RKALIVCRVIAGRVHRP+ENVEE+ G +GFDSLAGKVG
Sbjct  327  ASTSGRAFESIEMDG-GDGTTERKALIVCRVIAGRVHRPVENVEEMGGLNGFDSLAGKVG  385

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+NVEEL+LL+ RALLPCFVVICK 
Sbjct  386  LYTNVEELYLLNSRALLPCFVVICKP  411



>ref|XP_009776647.1| PREDICTED: uncharacterized protein LOC104226368 [Nicotiana sylvestris]
Length=429

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW     +      +ER+LKVHN QKTLA FEEYRE VKIKASKL KKH
Sbjct  229  SRKIVEIICRSSWLKSESHVGR---IERVLKVHNTQKTLARFEEYREMVKIKASKLPKKH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C LG N + SLC S+KC VCRI+R GF  KKE+ GG+GVFT
Sbjct  286  PRCIADGNELLRFYGTTLACGLGMNGTCSLCVSDKCCVCRIIRNGFTTKKELKGGIGVFT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS+RA E IE S   +  + RKALIVCRV+AGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  346  TSTSARAYECIELSE--DDPSLRKALIVCRVVAGRVHRPLENIQEMAGQTGFDSLAGKVG  403

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  404  VYSNIEELYLLNPRALLPCFVVICKA  429



>ref|XP_009593520.1| PREDICTED: uncharacterized protein LOC104090171 [Nicotiana tomentosiformis]
Length=429

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW     +      +ER+LKVHN QKTLA FEEYRE VK+KASKL KKH
Sbjct  229  SRKIVEIICRSSWLKSESHVGR---IERVLKVHNTQKTLARFEEYREMVKVKASKLPKKH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C LG N + SLC S+KC VCRI+R GF  KKE+ GG+GVFT
Sbjct  286  PRCIADGNELLRFYGTTLACGLGMNGTCSLCVSDKCCVCRIIRNGFTTKKELKGGIGVFT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS+RA E IE S   +  + RKALIVCRV+AGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  346  TSTSARAYECIELSD--DDPSLRKALIVCRVVAGRVHRPLENIQEMAGQTGFDSLAGKVG  403

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  404  VYSNIEELYLLNPRALLPCFVVICKA  429



>ref|XP_009346469.1| PREDICTED: uncharacterized protein LOC103938197 [Pyrus x bretschneideri]
Length=444

 Score =   296 bits (757),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQ+TLA FEEYRE VK KASKL KKH
Sbjct  244  SRKIVEIICRTSW-LKSEN--HCGRIERVLKVHNMQRTLARFEEYREMVKTKASKLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C LG N SSSLC  EKC+VCRI+R GF+ KKE+  GVGVFT
Sbjct  301  PRCIADGNELLRFYGTTVACCLGLNGSSSLCALEKCSVCRIIRNGFSAKKELKEGVGVFT  360

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA EAI+          RKALIVCRVIAGRVH+PLEN++E+AGQ+GFDSLAGK+G
Sbjct  361  TSTSGRAFEAIQ--ILEEDATLRKALIVCRVIAGRVHKPLENIQEIAGQTGFDSLAGKMG  418

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCF+VICK 
Sbjct  419  LYSNIEELYLLNPRALLPCFLVICKP  444



>ref|XP_008780304.1| PREDICTED: uncharacterized protein LOC103700112, partial [Phoenix 
dactylifera]
Length=209

 Score =   287 bits (735),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR   A    + ++C  +ER+LKVHNMQKTLA FEEYRE VK++ASKL KKH
Sbjct  9    SRKIVEIICR---ANLVKSESSCWRIERVLKVHNMQKTLARFEEYREMVKLRASKLPKKH  65

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N +SSLC+SEKCN+C I+R GF+ KKE+ GG+GVFT
Sbjct  66   PRCLADGNELLRFYGTTVACSLGTNGTSSLCSSEKCNICWIIRYGFSTKKELKGGIGVFT  125

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     +    +KAL+VCRVIAGRVH+PL+N +ELAG+SGFD+LAGKVG
Sbjct  126  TSTSGRAFESIEIYE--DDPNIKKALLVCRVIAGRVHKPLDNFQELAGESGFDALAGKVG  183

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+N+EEL+LL PRALLPCFVVICK+
Sbjct  184  LYANIEELYLLSPRALLPCFVVICKS  209



>dbj|BAJ33911.1| unnamed protein product [Thellungiella halophila]
Length=487

 Score =   296 bits (758),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  281  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  337

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+S+CT+EKC VCRI+R GF+ K+E N G+GVFT
Sbjct  338  PRCLADGNELLRFHGTTVACGLGINGSTSICTAEKCCVCRIIRNGFSAKREKNNGIGVFT  397

Query  628  ASTSSRALEAIEESSCANQG---AARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLA  461
            ASTS RA E+I  +     G     RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDSLA
Sbjct  398  ASTSGRAFESIVVNGGDQNGDDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDSLA  457

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y+NVEEL+LL+PRALLPCFVVICK+
Sbjct  458  GKVGLYTNVEELYLLNPRALLPCFVVICKS  487



>ref|XP_006401551.1| hypothetical protein EUTSA_v10013387mg [Eutrema salsugineum]
 gb|ESQ43004.1| hypothetical protein EUTSA_v10013387mg [Eutrema salsugineum]
Length=487

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  281  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  337

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+S+CT+EKC VCRI+R GF+ K+E N G+GVFT
Sbjct  338  PRCLADGNELLRFHGTTVACGLGINGSTSICTAEKCCVCRIIRNGFSAKREKNNGIGVFT  397

Query  628  ASTSSRALEAIEESSCANQG---AARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLA  461
            ASTS RA E+I  +     G     RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDSLA
Sbjct  398  ASTSGRAFESIVVNGGDQNGDDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDSLA  457

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y+NVEEL+LL+PRALLPCFVVICK+
Sbjct  458  GKVGLYTNVEELYLLNPRALLPCFVVICKS  487



>ref|XP_011096128.1| PREDICTED: uncharacterized protein LOC105175392 [Sesamum indicum]
Length=412

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 172/205 (84%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR S  T+ DN  +  G+ERILKVHNMQKTLA+FEEYRE VKIKASKL KKH
Sbjct  212  SRRIVEIICRAS-CTRPDN--HSGGVERILKVHNMQKTLAQFEEYRELVKIKASKLPKKH  268

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHG+TVEC+LG   SSSLCTS+KC VCRILR GF+ KKE++ GVGVFT
Sbjct  269  PRCLADGNELLRFHGSTVECSLGMKGSSSLCTSDKCRVCRILRYGFSTKKELSEGVGVFT  328

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RA ++I+        + RKALIVCRVIAGRVHRP+EN++++ GQSGFDSLAGKVG
Sbjct  329  ASTSGRAFDSIQ--VLDGNPSLRKALIVCRVIAGRVHRPVENIQDIVGQSGFDSLAGKVG  386

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            ++S++EEL+LL PRALLPCFVVI K
Sbjct  387  VHSSIEELYLLSPRALLPCFVVIYK  411



>gb|EYU27848.1| hypothetical protein MIMGU_mgv1a007181mg [Erythranthe guttata]
Length=416

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS  TK +N +   G+ERILKVHNMQKTLA+FEEYRE VKIKASKL KKH
Sbjct  211  SRKIVEIICRTS--TKPENHHRSTGIERILKVHNMQKTLAQFEEYREVVKIKASKLLKKH  268

Query  808  ARCLADGNELLRFHGTTVECNLGANDSS-SLCTSEKCNVCRILRRGFAIKKEI--NGGVG  638
             RCLADGNELLRFHG+T+EC+LG    S SLCTS++C VCRILR GF+ KKE+   GG+G
Sbjct  269  PRCLADGNELLRFHGSTLECSLGTKGGSCSLCTSDRCRVCRILRNGFSNKKEVVRGGGIG  328

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
            VFTASTS RA E+I+ +   +    RKALIVCRVIAGRVH+PLEN++EL GQ+GFDSLAG
Sbjct  329  VFTASTSGRAFESIQVAD-GDSSVVRKALIVCRVIAGRVHKPLENIQELVGQTGFDSLAG  387

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            KVG++SN+EEL+LL PRALLPCFVVI K 
Sbjct  388  KVGVHSNIEELYLLSPRALLPCFVVIYKP  416



>ref|XP_009143234.1| PREDICTED: uncharacterized protein LOC103866964 [Brassica rapa]
Length=426

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 166/206 (81%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRTSW       N C  ++RILKVHNMQKTLA FEEYR+ VK +ASKL KKH
Sbjct  225  SRKIVEMICRTSWL---KTENQCGRIDRILKVHNMQKTLARFEEYRDTVKNRASKLQKKH  281

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTTV C LG N  +SLC+SEKC VCRI+R GF++K+E+N G+GVFT
Sbjct  282  PRCIADGNELLRFHGTTVSCVLGVNGCTSLCSSEKCCVCRIIRNGFSVKREMNNGIGVFT  341

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RA E+I      +    RKALIVCRVIAGRVHRP+ENVEE+ G +GFDSLAGKVG
Sbjct  342  ASTSGRAFESIAMDG-GDGTTERKALIVCRVIAGRVHRPVENVEEMGGLNGFDSLAGKVG  400

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+NVEEL+LL+ RALLPCFVVICK 
Sbjct  401  LYTNVEELYLLNSRALLPCFVVICKP  426



>emb|CDX89265.1| BnaA01g16280D [Brassica napus]
Length=427

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 166/206 (81%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRTSW       N C  ++RILKVHNMQKTLA FEEYR+ VK +ASKL KKH
Sbjct  226  SRKIVEMICRTSWL---KTENQCGRIDRILKVHNMQKTLARFEEYRDTVKNRASKLQKKH  282

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTTV C LG N  +SLC+SEKC VCRI+R GF++K+E+N G+GVFT
Sbjct  283  PRCIADGNELLRFHGTTVSCVLGVNGCTSLCSSEKCCVCRIIRNGFSVKREMNNGIGVFT  342

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RA E+I      +    RKALIVCRVIAGRVHRP+ENVEE+ G +GFDSLAGKVG
Sbjct  343  ASTSGRAFESIAMDG-GDGTTERKALIVCRVIAGRVHRPVENVEEMGGLNGFDSLAGKVG  401

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+NVEEL+LL+ RALLPCFVVICK 
Sbjct  402  LYTNVEELYLLNSRALLPCFVVICKP  427



>ref|XP_008355355.1| PREDICTED: uncharacterized protein LOC103419013 [Malus domestica]
Length=444

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVHNMQ+TLA FEEYRE VK KASKL KKH
Sbjct  244  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHNMQRTLARFEEYREMVKTKASKLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C LG N SSSLC  EKC+VCRI+R GF+ KKE+  GVGVFT
Sbjct  301  PRCIADGNELLRFYGTTVACCLGLNGSSSLCVLEKCSVCRIIRNGFSAKKELKEGVGVFT  360

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA EAI+          RKALIVCRVIAGRVH+PLEN++E+ GQ+GFDSLAGK+G
Sbjct  361  TSTSGRAFEAIQ--ILEEDATLRKALIVCRVIAGRVHKPLENIQEITGQTGFDSLAGKMG  418

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCF+VICK 
Sbjct  419  LYSNIEELYLLNPRALLPCFLVICKP  444



>ref|XP_006280315.1| hypothetical protein CARUB_v10026238mg, partial [Capsella rubella]
 gb|EOA13213.1| hypothetical protein CARUB_v10026238mg, partial [Capsella rubella]
Length=515

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 171/209 (82%), Gaps = 6/209 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  310  SRKIVEIICRTSW-LKSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  366

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N G+GVFT
Sbjct  367  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSSKREKNSGIGVFT  426

Query  628  ASTSSRALEAI-EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLAG  458
            ASTS RA E+I  + S       RK LIVCRVIAGRVHRP+ENVEE+ G   SGFDSLAG
Sbjct  427  ASTSGRAFESILGDGSGDGDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMMSGFDSLAG  486

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            KVG+Y+NVEELFLL+P+ALLPCFVVICK+
Sbjct  487  KVGLYTNVEELFLLNPKALLPCFVVICKS  515



>ref|XP_009358074.1| PREDICTED: uncharacterized protein LOC103948743 [Pyrus x bretschneideri]
Length=444

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW  KS+N  +C  +ER+LKVHNMQ+TLA FEEYRE VK KASKL KKH
Sbjct  244  SRKIVEIICRASW-LKSEN--HCGRIERVLKVHNMQRTLARFEEYREMVKTKASKLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C LG N SSSLC  EKC+VCRI+R GF+ KKE+  GVGVFT
Sbjct  301  PRCIADGNELLRFYGTTVACCLGLNGSSSLCALEKCSVCRIIRNGFSAKKELKEGVGVFT  360

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA EAI+          RKALIVCRVIAGRVH+PLEN++E+AGQ+GFDSLAGK+G
Sbjct  361  TSTSGRAFEAIQ--ILEEDATLRKALIVCRVIAGRVHKPLENIQEIAGQTGFDSLAGKMG  418

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCF+VICK 
Sbjct  419  LYSNIEELYLLNPRALLPCFLVICKP  444



>ref|XP_002866053.1| hypothetical protein ARALYDRAFT_918600 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42312.1| hypothetical protein ARALYDRAFT_918600 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 173/212 (82%), Gaps = 10/212 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  267  SRKIVEIICRTSW-LKSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  323

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+SLCT+EKC VCRI+R GF+ K+E N GVGVFT
Sbjct  324  PRCLADGNELLRFHGTTVACGLGINGSTSLCTAEKCCVCRIIRNGFSSKREKNNGVGVFT  383

Query  628  ASTSSRALEAI-----EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDS  467
            ASTS RA E+I     +ES   ++   RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDS
Sbjct  384  ASTSGRAFESILVNGGDESGDVDR-TVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDS  442

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            LAGKVG+Y+NVEEL+LL+P+ALLPCFVVICK 
Sbjct  443  LAGKVGLYTNVEELYLLNPKALLPCFVVICKP  474



>gb|EYU19199.1| hypothetical protein MIMGU_mgv1a006892mg [Erythranthe guttata]
Length=427

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW  KS+N  +   ++R+LKVHNMQKTL  FE+YRE VKIKASKL KKH
Sbjct  227  SRKIVEIICRSSW-LKSEN--HSVRIDRVLKVHNMQKTLVRFEDYREAVKIKASKLPKKH  283

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C LG N SSSLC S+KC VCRI+R GF+ K+EI GGVGVFT
Sbjct  284  PRCLADGNELLRFHGTTIACTLGMNGSSSLCISDKCCVCRIIRNGFSNKREIKGGVGVFT  343

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     N  + RKALIVCRVIAGRVHRPLEN++E+A Q+GFDSLAGKVG
Sbjct  344  TSTSGRAFECIE--MLDNDVSIRKALIVCRVIAGRVHRPLENIQEMASQTGFDSLAGKVG  401

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ +ALLPCFVVICK 
Sbjct  402  MYSNIEELYLLNAKALLPCFVVICKT  427



>ref|XP_010443040.1| PREDICTED: uncharacterized protein LOC104725989 [Camelina sativa]
Length=471

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 172/213 (81%), Gaps = 10/213 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KSDN   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  262  SRKIVEIICRTSWL-KSDN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  318

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKK-EINGGVGVF  632
             RCLADGNELLRFHGTTV C LG N S+SLCT++KC+VCRI+R GF+ K+ E N G+GVF
Sbjct  319  PRCLADGNELLRFHGTTVACGLGINGSTSLCTADKCSVCRIIRNGFSAKREEKNNGIGVF  378

Query  631  TASTSSRALEAIEESSCANQGA-----ARKALIVCRVIAGRVHRPLENVEELAG-QSGFD  470
            TASTS RA E+I  +   +Q        RK LIVCRVIAGRVHRP+ENVEE+ G  SGFD
Sbjct  379  TASTSGRAFESILANGGDHQSGDVDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFD  438

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            SLAGKVG+Y+NVEEL+LL+P+ALLPCFVVICK 
Sbjct  439  SLAGKVGLYTNVEELYLLNPKALLPCFVVICKP  471



>ref|XP_010923995.1| PREDICTED: uncharacterized protein LOC105046939 [Elaeis guineensis]
Length=432

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  ++R+LKVHNMQKTL+ FEEYRE VK +ASKL KKH
Sbjct  232  SRKIVELICRTSL-VKSESS--CWRIDRVLKVHNMQKTLSRFEEYREMVKTRASKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N +SSLC SEKC+VC I+R GF+IKKE+N G+GVFT
Sbjct  289  PRCLADGNELLRFYGTTIACSLGMNGTSSLCASEKCSVCWIIRHGFSIKKELNEGIGVFT  348

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+IE     ++ + +KAL+VCRVIAGRVH+PL+N +ELAGQSGFDSLAGKVG
Sbjct  349  TSTSGRAFESIEIYE--DEPSIKKALLVCRVIAGRVHKPLDNFQELAGQSGFDSLAGKVG  406

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+N+EEL+LL+PRALLPCFVVICK+
Sbjct  407  LYANIEELYLLNPRALLPCFVVICKS  432



>ref|NP_200274.1| zinc finger-related protein [Arabidopsis thaliana]
 dbj|BAB09342.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK73988.1| AT5g54630/MRB17_13 [Arabidopsis thaliana]
 gb|AAM70576.1| AT5g54630/MRB17_13 [Arabidopsis thaliana]
 gb|AED96520.1| zinc finger-related protein [Arabidopsis thaliana]
Length=472

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 173/212 (82%), Gaps = 10/212 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  265  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  321

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTTV C LG N S+S+CT+EKC VCRI+R GF+ K+E N GVGVFT
Sbjct  322  PRCLADGNELLRFHGTTVACGLGINGSTSVCTAEKCCVCRIIRNGFSSKREKNNGVGVFT  381

Query  628  ASTSSRALEAI-----EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDS  467
            ASTS RA E+I     +ES   ++   RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDS
Sbjct  382  ASTSGRAFESILVNGGDESGDVDR-TVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDS  440

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            LAGKVG+Y+NVEEL+LL+P+ALLPCFVVICK 
Sbjct  441  LAGKVGLYTNVEELYLLNPKALLPCFVVICKP  472



>ref|XP_010520878.1| PREDICTED: uncharacterized protein LOC104799891 [Tarenaya hassleriana]
 ref|XP_010520879.1| PREDICTED: uncharacterized protein LOC104799892 [Tarenaya hassleriana]
Length=468

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  259  SRKIVEIICRTSWL-KSEN--NCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLPKKH  315

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N S+SLC SE C VCRI+R+GF+ K+E+N G+GVFT
Sbjct  316  PRCLADGNELLRFHGTTISCSLGLNGSTSLCMSETCCVCRIIRKGFSTKREMNNGIGVFT  375

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQ--SGFDSLAGK  455
             STS RA  +I E    ++  ARKALIVCRVIAGRVHRP+EN  E+ G   +GFDSLAGK
Sbjct  376  TSTSGRAFASISEGDDDDR-TARKALIVCRVIAGRVHRPVENPAEMNGLNVNGFDSLAGK  434

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            VG+YSNVEEL+LL+P++LLPCFVVICK 
Sbjct  435  VGLYSNVEELYLLNPKSLLPCFVVICKP  462



>ref|XP_009405930.1| PREDICTED: uncharacterized protein LOC103988958 [Musa acuminata 
subsp. malaccensis]
Length=436

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 167/205 (81%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRT W +K+D +  C  +ER+LKVHNMQKTL  FEEYRE VK+KASKL KKH
Sbjct  234  SRKIVEMICRTGW-SKTDGS--CGRIERVLKVHNMQKTLTLFEEYRETVKMKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SS LC SEKC+VC+I+R GF   +E  GG+GVFT
Sbjct  291  PRCLADGNELLRFHGTTIACSLGTNGSSGLCASEKCSVCQIIRHGFTGNEETKGGIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+IE     +  + +KAL+VCRVIAGRVH+PL+N +EL GQ  FDSLAGKVG
Sbjct  351  TSTSGRALESIETDE--DDTSVKKALLVCRVIAGRVHKPLDNYQELVGQCAFDSLAGKVG  408

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +Y+N+EEL+LL+P+ALLPCFVVICK
Sbjct  409  LYANIEELYLLNPKALLPCFVVICK  433



>gb|EEE55508.1| hypothetical protein OsJ_03710 [Oryza sativa Japonica Group]
Length=285

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 170/212 (80%), Gaps = 9/212 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKL KKH
Sbjct  77   SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLPKKH  133

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG A  SSSLC S+KC VCRI+R GF+ KKE   GVGVF
Sbjct  134  PRCLADGNELLRFHGATLSCALGGAAGSSSLCASDKCAVCRIIRHGFSAKKEGKAGVGVF  193

Query  631  TASTSSRALEAIEESSCA-----NQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS  467
            T STS RA E+IE S+ A     +  A RKAL+VCRVIAGRVH+PLEN++E AGQ+GFDS
Sbjct  194  TTSTSGRAYESIEASAGAVVGGDDPAATRKALLVCRVIAGRVHKPLENLKEFAGQTGFDS  253

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            LAGKVG YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  254  LAGKVGPYSNIEELYLLNPRALLPCFVVICKA  285



>gb|KGN57955.1| hypothetical protein Csa_3G406040 [Cucumis sativus]
Length=443

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT+   KS+N  N N +ER+ KVHNMQKTLA FEEYRE VKIKASKL+KKH
Sbjct  244  SRKIVEIICRTNLL-KSEN--NGNRIERVFKVHNMQKTLAGFEEYREMVKIKASKLSKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC S+KC+VCRI+R GF+ KK+I   VGVFT
Sbjct  301  PRCLADGNELLRFYGTTLACSLGLNGSSSLCISQKCSVCRIIRNGFSTKKDIKEEVGVFT  360

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E I+ +    + + +KALI+CRVIAGRVHRPLEN++++ GQSGFDSLAGKVG
Sbjct  361  TSTSGKAFETIKTT---EESSVKKALIICRVIAGRVHRPLENIQDMVGQSGFDSLAGKVG  417

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  418  LHSNIEELYLLNPRALLPCFVVICKP  443



>gb|ACB30362.1| transcription factor [Capsicum annuum]
Length=433

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW            +ER+LKVHN QKTLA FEEYRE VK KASKL KKH
Sbjct  233  SRKIVEIICRSSWLKSESQVGR---IERVLKVHNTQKTLARFEEYREMVKSKASKLPKKH  289

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C LG N S SLC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  290  PRCIADGNELLRFYGTTLACGLGMNGSCSLCISDKCCVCRIIRNGFSTKKELKGGIGVFT  349

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS  A E IE S      + RKALIVCRV+AGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  350  TSTSGSAYECIEMSK--EDPSLRKALIVCRVVAGRVHRPLENIQEMAGQTGFDSLAGKVG  407

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICKA
Sbjct  408  VYSNIEELYLLNPKALLPCFVVICKA  433



>ref|XP_010482869.1| PREDICTED: uncharacterized protein LOC104761480 [Camelina sativa]
Length=478

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  274  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  330

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKK-EINGGVGVF  632
             RCLADGNELLRFHGTTV C LG N S+S+CT++KC+VCRI+R GF+ K+ E N G+GVF
Sbjct  331  PRCLADGNELLRFHGTTVACGLGINGSTSICTADKCSVCRIIRNGFSAKREEKNNGIGVF  390

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLAGK  455
            TASTS RA E+I  +        RK LIVCRVIAGRVHRP+ENVEE+ G  SGFDSLAGK
Sbjct  391  TASTSGRAFESILVNGGDVDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGFDSLAGK  450

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            VG+Y+NVEEL+LL+P+ALLPCFVVICK 
Sbjct  451  VGLYTNVEELYLLNPKALLPCFVVICKP  478



>ref|XP_008784662.1| PREDICTED: uncharacterized protein LOC103703552 [Phoenix dactylifera]
Length=435

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 171/205 (83%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+IC+ S        + C  +ER+LKVH++Q+TLA FEEYRE VKIKA+KL KKH
Sbjct  235  SRKIVEIICKASLLKPE---SGCGRIERVLKVHSVQRTLARFEEYREMVKIKANKLPKKH  291

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SS+LCTSE+CNVCRI+R GF+ KKE+ GG+GVFT
Sbjct  292  PRCLADGNELLRFYGTTVSCSLGMNGSSNLCTSERCNVCRIIRHGFSTKKELKGGIGVFT  351

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+IE     +  ++RKAL+VCRVIAGRVH+P++N+++LA Q GFDS+AGKVG
Sbjct  352  TSTSGRALESIE--VFEDNPSSRKALLVCRVIAGRVHKPMDNLQDLASQPGFDSVAGKVG  409

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +Y+N+EELFLL+PRALLPCFVVICK
Sbjct  410  LYANIEELFLLNPRALLPCFVVICK  434



>ref|XP_010931855.1| PREDICTED: uncharacterized protein LOC105052658 [Elaeis guineensis]
Length=476

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 172/205 (84%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+IC+ S        ++C  +ER+LKVHN+Q+TLA FEEYRE VKIKASKL KKH
Sbjct  276  SRKIVEIICKASLLKPE---SSCGRIERVLKVHNVQRTLARFEEYREMVKIKASKLPKKH  332

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG + SS+LCTSEKCNVCRI+R GF+ KKE+ GG+GVFT
Sbjct  333  PRCLADGNELLRFYGTTVSCSLGMSGSSNLCTSEKCNVCRIIRHGFSTKKELKGGIGVFT  392

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+ E     +  ++RKAL+VCRVIAGRVH+P++N+++LA QSGFDS+AGKVG
Sbjct  393  TSTSGRALESTEVFD--DNPSSRKALLVCRVIAGRVHKPMDNLQDLASQSGFDSVAGKVG  450

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +Y+N+EEL+LL+PRALLPCFVVICK
Sbjct  451  LYANIEELYLLNPRALLPCFVVICK  475



>ref|XP_009386466.1| PREDICTED: uncharacterized protein LOC103973578 [Musa acuminata 
subsp. malaccensis]
Length=469

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW       ++C  ++R+LKVHNMQKTLA FEEYRE VK KA++LAKKH
Sbjct  268  SRKIVEIICRASWLKPE---SSCIRIDRVLKVHNMQKTLARFEEYRELVKNKANRLAKKH  324

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEI-NGGVGVF  632
             RCLADGNELLRF+GTT+ C+LG N SS LC+SEKC+VCRI+R GF+ K+EI  GG+GVF
Sbjct  325  PRCLADGNELLRFYGTTIACSLGTNGSSRLCSSEKCSVCRIIRHGFSTKREIAKGGIGVF  384

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T+STS RA + IE   C +  + +KAL+VCRVIAGRVH+PL+N +ELAGQSGFDS+AGK+
Sbjct  385  TSSTSGRAFQTIE--PCEDDNSTKKALLVCRVIAGRVHKPLDNYQELAGQSGFDSVAGKL  442

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
            G+Y+N+EEL+L +PRALLPCFVVIC+
Sbjct  443  GLYANIEELYLFNPRALLPCFVVICR  468



>ref|XP_004244163.1| PREDICTED: uncharacterized protein LOC101261138 [Solanum lycopersicum]
Length=427

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW            +ERILKVHN QKTLA FEEYRE VK KASKL KKH
Sbjct  227  SRKIVEIICRSSWLKSESQVGR---IERILKVHNTQKTLARFEEYREMVKNKASKLPKKH  283

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C LG N S  LC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  284  PRCIADGNELLRFYGTTLACGLGMNGSCCLCISDKCCVCRIIRNGFSTKKELKGGIGVFT  343

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS  A E IE S   +  + RKALIVCRV+AGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  344  TSTSGSAYECIEMSE--DDPSLRKALIVCRVVAGRVHRPLENIQEMAGQTGFDSLAGKVG  401

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICKA
Sbjct  402  VYSNIEELYLLNPKALLPCFVVICKA  427



>gb|KFK29232.1| hypothetical protein AALP_AA7G106800 [Arabis alpina]
Length=406

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 4/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS        N C  ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KKH
Sbjct  205  SRRIVEIICRTSVLKAE---NQCGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKKH  261

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVFT
Sbjct  262  PRCIADGNELLRFHGTTVACVLGINGSTSLCSSEKCCVCRIIRNGFSAKREMNNGIGVFT  321

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS RA E+IE     +    RK LIVCRVIAGRVHRP+ENVE++ G +GFDSLAGK+G
Sbjct  322  ASTSGRAFESIEIDG-GDPTTERKVLIVCRVIAGRVHRPVENVEQMGGLNGFDSLAGKLG  380

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +Y+NVEEL+LL+ RALLPCFVVICK 
Sbjct  381  LYTNVEELYLLNSRALLPCFVVICKP  406



>ref|XP_010448429.1| PREDICTED: uncharacterized protein LOC104730884 [Camelina sativa]
Length=479

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 172/214 (80%), Gaps = 11/214 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R+LKVHNMQKTLA FEEYRE VKI+ASKL KKH
Sbjct  269  SRKIVEIICRTSWL-KSEN--QCGRIDRVLKVHNMQKTLARFEEYRETVKIRASKLQKKH  325

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKK-EINGGVGVF  632
             RCLADGNELLRFHGTTV C LG N S+S+CT++KC+VCRI+R GF+ K+ E N G+GVF
Sbjct  326  PRCLADGNELLRFHGTTVACGLGINGSTSICTADKCSVCRIIRNGFSAKREEKNNGIGVF  385

Query  631  TASTSSRALEAIEESSCANQGA------ARKALIVCRVIAGRVHRPLENVEELAG-QSGF  473
            TASTS RA E+I  +   +Q         RK LIVCRVIAGRVHRP+ENVEE+ G  SGF
Sbjct  386  TASTSGRAFESILVNGGDHQSGDVVDRTVRKVLIVCRVIAGRVHRPVENVEEMNGLMSGF  445

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DSLAGKVG+Y+NVEEL+LL+P+ALLPCFVVICK 
Sbjct  446  DSLAGKVGLYTNVEELYLLNPKALLPCFVVICKP  479



>ref|XP_006360102.1| PREDICTED: uncharacterized protein LOC102605244 [Solanum tuberosum]
Length=430

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW            +ER+LKVHN QKTLA FEEYRE VK KASKL KKH
Sbjct  230  SRKIVEIICRSSWLKSESQVGR---IERVLKVHNTQKTLARFEEYREMVKSKASKLPKKH  286

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTT+ C LG N S  LC S+KC VCRI+R GF+ KKE+ GG+GVFT
Sbjct  287  PRCIADGNELLRFYGTTLACGLGMNGSCCLCISDKCCVCRIIRNGFSTKKELKGGIGVFT  346

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS  A E IE S   +  + RKALIVCRV+AGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  347  TSTSGSAYECIEMSE--DDPSLRKALIVCRVVAGRVHRPLENIQEMAGQTGFDSLAGKVG  404

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICKA
Sbjct  405  VYSNIEELYLLNPKALLPCFVVICKA  430



>gb|EPS67430.1| hypothetical protein M569_07344, partial [Genlisea aurea]
Length=402

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 11/205 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT+ A +S+N     G+ERILKVHNMQKTLA+FEEYRE VKIKASKL+KKH
Sbjct  209  SRRIVEIICRTT-AGRSEN-----GIERILKVHNMQKTLAQFEEYREVVKIKASKLSKKH  262

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHG  VEC LG   SSSLC SEKC VCRILR GF+  K+     GVFT
Sbjct  263  PRCLADGNELLRFHGAAVECRLGVKGSSSLCISEKCRVCRILRYGFSTNKKETSSAGVFT  322

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            A+TS+RALE+I+     N   ARKAL+VCRVIAGRVHRPLENV+E+ GQ+GFDS+AGKVG
Sbjct  323  AATSTRALESIQ-----NSDGARKALVVCRVIAGRVHRPLENVKEMVGQTGFDSVAGKVG  377

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
            +  N+EEL+LL PRALLPCFVVI K
Sbjct  378  VQGNIEELYLLSPRALLPCFVVIYK  402



>ref|XP_004152032.1| PREDICTED: uncharacterized protein LOC101213316 [Cucumis sativus]
Length=492

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT+   KS+N  N N +ER+ KVHNMQKTLA FEEYRE VKIKASKL+KKH
Sbjct  293  SRKIVEIICRTNLL-KSEN--NGNRIERVFKVHNMQKTLAGFEEYREMVKIKASKLSKKH  349

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC S+KC+VCRI+R GF+ KK+I   VGVFT
Sbjct  350  PRCLADGNELLRFYGTTLACSLGLNGSSSLCISQKCSVCRIIRNGFSTKKDIKEEVGVFT  409

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E I+ +    + + +KALI+CRVIAGRVHRPLEN++++ GQSGFDSLAGKVG
Sbjct  410  TSTSGKAFETIKTT---EESSVKKALIICRVIAGRVHRPLENIQDMVGQSGFDSLAGKVG  466

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  467  LHSNIEELYLLNPRALLPCFVVICKP  492



>ref|XP_008454573.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103494961 
[Cucumis melo]
Length=441

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT+   KS+N  N N +ER+ KVHNMQKTLA FEEYRE VKIKASKL+KKH
Sbjct  242  SRKIVEIICRTNLL-KSEN--NGNRIERVFKVHNMQKTLAGFEEYREMVKIKASKLSKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC S+KC+VCRI+R GF+ KK++   VGVFT
Sbjct  299  PRCLADGNELLRFYGTTLACSLGLNGSSSLCISQKCSVCRIIRNGFSAKKDMKEEVGVFT  358

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E IE +    + + +KALI+CRVIAGRVHRPLEN++++ GQ+GFDSLAGKVG
Sbjct  359  TSTSGKAFETIETT---EESSLKKALIICRVIAGRVHRPLENIQDVVGQAGFDSLAGKVG  415

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL PRALLPCFVVICK 
Sbjct  416  LHSNIEELYLLSPRALLPCFVVICKP  441



>ref|XP_004163521.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213316 
[Cucumis sativus]
Length=534

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT+   KS+N  N N +ER+ KVHNMQKTLA FEEYRE VKIKASKL+KKH
Sbjct  335  SRKIVEIICRTNL-LKSEN--NGNRIERVFKVHNMQKTLAGFEEYREMVKIKASKLSKKH  391

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTT+ C+LG N SSSLC S+KC+VCRI+R GF+ KK+I   VGVFT
Sbjct  392  PRCLADGNELLRFYGTTLACSLGLNGSSSLCISQKCSVCRIIRNGFSTKKDIKEEVGVFT  451

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E I+ +    + + +KALI+CRVIAGRVHRPLEN++++ GQSGFDSLAGKVG
Sbjct  452  TSTSGKAFETIKTT---EESSVKKALIICRVIAGRVHRPLENIQDMVGQSGFDSLAGKVG  508

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            ++SN+EEL+LL+PRALLPCFVVICK 
Sbjct  509  LHSNIEELYLLNPRALLPCFVVICKP  534



>ref|XP_011097935.1| PREDICTED: uncharacterized protein LOC105176736 [Sesamum indicum]
Length=439

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 8/206 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR++W T   + N+C  ++R+LKVHNMQKTLA FE+YRE VKIKAS+LAKKH
Sbjct  242  SRKIVEIICRSNWLT---SENHCVRIDRVLKVHNMQKTLARFEDYREAVKIKASELAKKH  298

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGT + C+LG N SSSLC S+KC VCRI+R GF++ K   G VGVFT
Sbjct  299  PRCLADGNELLRFHGTNLACSLGMNGSSSLCVSDKCCVCRIIRYGFSMLK---GKVGVFT  355

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE +  A+Q   RKALIVCRVIAGRVHRPLEN++++AGQ+GFDSLAGKVG
Sbjct  356  TSTSGRAFELIEINE-ADQ-FMRKALIVCRVIAGRVHRPLENIQDMAGQTGFDSLAGKVG  413

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+P+ALLPCFVVICK 
Sbjct  414  LYSNIEELYLLNPKALLPCFVVICKT  439



>ref|XP_002869573.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45832.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=430

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 169/207 (82%), Gaps = 8/207 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T N  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  229  SRKIVEIICRTSWL----KTENQGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  284

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVF
Sbjct  285  HPRCIADGNELLRFHGTTVACALGINGSTSLCSSEKCCVCRIIRNGFSAKREMNNGIGVF  344

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLAGK  455
            TASTS RA E+I        G+ RKALIVCRVIAGRVHRP+EN+EE+ G  +GFDSLAGK
Sbjct  345  TASTSERAFESIVIDD--GGGSDRKALIVCRVIAGRVHRPVENLEEMGGLLNGFDSLAGK  402

Query  454  VGIYSNVEELFLLDPRALLPCFVVICK  374
            VG+Y+NVEEL+LL+ RALLPCFV+ICK
Sbjct  403  VGLYTNVEELYLLNSRALLPCFVLICK  429



>ref|XP_010928416.1| PREDICTED: uncharacterized protein LOC105050187 [Elaeis guineensis]
Length=433

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 172/208 (83%), Gaps = 7/208 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+LKVHNMQKTLA FEEYRE VK++ASKL KKH
Sbjct  231  SRKIVEIICRTSL-VKSESS--CWRIERVLKVHNMQKTLARFEEYREMVKLRASKLPKKH  287

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEING--GVGV  635
             RCLADGNELLRF+GTT+ C+LG N +SSLC+SEKCNVC+I+R GF  KKE+ G  G+GV
Sbjct  288  PRCLADGNELLRFYGTTIACSLGMNGTSSLCSSEKCNVCQIIRYGFPTKKELKGGIGIGV  347

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGK  455
            FT STS RA E+IE     +    +KAL+VCRVIAGRVH+PL+N +ELAG+SGFDSLAGK
Sbjct  348  FTTSTSGRAFESIEIYE--DDPNVKKALLVCRVIAGRVHKPLDNFQELAGESGFDSLAGK  405

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            VG+Y++ EEL+LL PRALLPCFVVICK+
Sbjct  406  VGLYASFEELYLLSPRALLPCFVVICKS  433



>ref|XP_004295788.1| PREDICTED: uncharacterized protein LOC101312619 [Fragaria vesca 
subsp. vesca]
Length=465

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 174/209 (83%), Gaps = 11/209 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  +ER+LKVHNMQ+TLA FEEYRE VKIKA+KL KKH
Sbjct  265  SRKIVEIICRTSWL-KSEN--NCGRIERVLKVHNMQRTLARFEEYRETVKIKATKLPKKH  321

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+  GVGVFT
Sbjct  322  PRCIADGNELLRFYGTTVACSLGLNSSSSLCVSEKCCVCRIIRNGFSAKKELKEGVGVFT  381

Query  628  ASTSSRALEAI---EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
             STS+RA E I   EE  C      RKALIVCRVIAGRVH+PLEN++E+AGQ+GFDSLAG
Sbjct  382  TSTSARAYECIEILEEDPC-----IRKALIVCRVIAGRVHKPLENIKEIAGQTGFDSLAG  436

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            K+G+YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  437  KMGLYSNIEELYLLNPRALLPCFVVICKP  465



>ref|XP_006413099.1| hypothetical protein EUTSA_v10025260mg [Eutrema salsugineum]
 gb|ESQ54552.1| hypothetical protein EUTSA_v10025260mg [Eutrema salsugineum]
Length=431

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 167/207 (81%), Gaps = 6/207 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW   S + N    ++RILKVHNM KTLA FEEYR+ VK +ASKL KKH
Sbjct  230  SRKIVEIICRTSW---SKSENQGERIDRILKVHNMHKTLARFEEYRDTVKSRASKLQKKH  286

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVFT
Sbjct  287  PRCIADGNELLRFHGTTVACVLGVNGSTSLCSSEKCCVCRIIRNGFSAKREMNNGIGVFT  346

Query  628  ASTSSRALEAIEESSCANQGAA-RKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            ASTS RA E+I  +   ++G   RKALIVCRVIAGRVHRP+ENVEE    +GFDSLAGKV
Sbjct  347  ASTSGRAFESI--AIAGDEGKTERKALIVCRVIAGRVHRPVENVEETGWLNGFDSLAGKV  404

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G+Y+NVEEL+LL+ RALLPCFVVICK 
Sbjct  405  GLYTNVEELYLLNSRALLPCFVVICKP  431



>ref|NP_567769.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
 emb|CAA19718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79579.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04797.1| At4g27240 [Arabidopsis thaliana]
 dbj|BAH30541.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85315.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
Length=431

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 168/208 (81%), Gaps = 8/208 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T N  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  230  SRRIVEIICRTSWL----KTENQGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  285

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVF
Sbjct  286  HPRCIADGNELLRFHGTTVACALGINGSTSLCSSEKCCVCRIIRNGFSAKREMNNGIGVF  345

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG-QSGFDSLAGK  455
            TASTS RA E+I        G  RKALIVCRVIAGRVHRP+ENVEE+ G  SGFDSLAGK
Sbjct  346  TASTSERAFESI--VIGDGGGGDRKALIVCRVIAGRVHRPVENVEEMGGLLSGFDSLAGK  403

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            VG+Y+NVEEL+LL+ RALLPCFV+ICK 
Sbjct  404  VGLYTNVEELYLLNSRALLPCFVLICKP  431



>gb|EEC71610.1| hypothetical protein OsI_04015 [Oryza sativa Indica Group]
Length=485

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 170/212 (80%), Gaps = 9/212 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKL KKH
Sbjct  277  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLPKKH  333

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG A  SSSLC S+KC VCRI+R GF+ KKE   GVGVF
Sbjct  334  PRCLADGNELLRFHGATLSCALGGAAGSSSLCASDKCAVCRIIRHGFSAKKEGKAGVGVF  393

Query  631  TASTSSRALEAIEESSCA-----NQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS  467
            T STS RA E+IE S+ A     +  A RKAL+VCRVIAGRVH+PLEN++E AGQ+GFDS
Sbjct  394  TTSTSGRAYESIEASAGAVVGGDDPAATRKALLVCRVIAGRVHKPLENLKEFAGQTGFDS  453

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            LAGKVG YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  454  LAGKVGPYSNIEELYLLNPRALLPCFVVICKA  485



>ref|XP_007211726.1| hypothetical protein PRUPE_ppa006039mg [Prunus persica]
 gb|EMJ12925.1| hypothetical protein PRUPE_ppa006039mg [Prunus persica]
Length=431

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  +ER+LKVHNMQ+TLA FEEYRE VK+KASKL KKH
Sbjct  231  SRKIVEIICRTSWL-KSEN--NCGRIERVLKVHNMQRTLARFEEYREMVKMKASKLPKKH  287

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+  GVGVFT
Sbjct  288  PRCIADGNELLRFYGTTVACSLGLNSSSSLCVSEKCCVCRIIRNGFSAKKELKEGVGVFT  347

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+        + RK LIVCRVIAGRVH+PLEN++E+AGQ+GFDSLAGK+G
Sbjct  348  TSTSGRAFESIQ--ILEEDPSIRKVLIVCRVIAGRVHKPLENIQEIAGQTGFDSLAGKMG  405

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  406  LYSNIEELYLLNPRALLPCFVVICKP  431



>ref|NP_001044471.1| Os01g0785900 [Oryza sativa Japonica Group]
 dbj|BAB92595.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06385.1| Os01g0785900 [Oryza sativa Japonica Group]
 dbj|BAG92260.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 170/212 (80%), Gaps = 9/212 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKL KKH
Sbjct  277  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLPKKH  333

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG A  SSSLC S+KC VCRI+R GF+ KKE   GVGVF
Sbjct  334  PRCLADGNELLRFHGATLSCALGGAAGSSSLCASDKCAVCRIIRHGFSAKKEGKAGVGVF  393

Query  631  TASTSSRALEAIEESSCA-----NQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS  467
            T STS RA E+IE S+ A     +  A RKAL+VCRVIAGRVH+PLEN++E AGQ+GFDS
Sbjct  394  TTSTSGRAYESIEASAGAVVGGDDPAATRKALLVCRVIAGRVHKPLENLKEFAGQTGFDS  453

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            LAGKVG YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  454  LAGKVGPYSNIEELYLLNPRALLPCFVVICKA  485



>ref|XP_010438645.1| PREDICTED: uncharacterized protein LOC104722207 [Camelina sativa]
Length=437

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 169/210 (80%), Gaps = 10/210 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T +  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  234  SRKIVEIICRTSWL----KTEHHGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  289

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVF
Sbjct  290  HPRCIADGNELLRFHGTTVACALGINGSTSLCSSEKCCVCRIIRNGFSSKREMNNGIGVF  349

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQS---GFDSLA  461
            TASTS RA E+I      N G  RKALIVCRVIAGRVHRP+EN+EE++  S   GFDSLA
Sbjct  350  TASTSERAFESIVIGD--NGGGDRKALIVCRVIAGRVHRPMENLEEMSSGSLLNGFDSLA  407

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y++VEEL+LL+ RALLPCFV+ICK 
Sbjct  408  GKVGLYTHVEELYLLNSRALLPCFVLICKP  437



>ref|XP_008244332.1| PREDICTED: uncharacterized protein LOC103342485 [Prunus mume]
Length=434

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  NC  +ER+LKVHNMQ+TLA FEEYRE VK+KASKL KKH
Sbjct  234  SRKIVEIICRTSWL-KSEN--NCGRIERVLKVHNMQRTLARFEEYREMVKMKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF+ KKE+   VGVFT
Sbjct  291  PRCIADGNELLRFYGTTVACSLGLNSSSSLCVSEKCCVCRIIRNGFSAKKELKEWVGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E+I+        + RKALIVCRVIAGRVH+PLEN++E+AGQ+GFDSLAGK+G
Sbjct  351  TSTSGRAFESIQ--ILEEDPSIRKALIVCRVIAGRVHKPLENIQEIAGQTGFDSLAGKMG  408

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  409  LYSNIEELYLLNPRALLPCFVVICKP  434



>ref|XP_010433392.1| PREDICTED: uncharacterized protein LOC104717513 [Camelina sativa]
Length=434

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 169/210 (80%), Gaps = 11/210 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T +  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  232  SRKIVEIICRTSWL----KTEHHGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  287

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVF
Sbjct  288  HPRCIADGNELLRFHGTTVACALGINGSTSLCSSEKCCVCRIIRNGFSSKREMNNGIGVF  347

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQS---GFDSLA  461
            TASTS RA E+I      + G  RKALIVCRVIAGRVHRP+EN+EE++  S   GFDSLA
Sbjct  348  TASTSERAFESI---VIGDNGGDRKALIVCRVIAGRVHRPVENLEEMSSGSLLNGFDSLA  404

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y++VEEL+LL+ RALLPCFV+ICK 
Sbjct  405  GKVGLYTHVEELYLLNSRALLPCFVLICKP  434



>emb|CDY18344.1| BnaC09g30940D [Brassica napus]
Length=453

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 167/209 (80%), Gaps = 6/209 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  ++R++KVHNMQKT+A FEEY E  KI+ASKL KKH
Sbjct  248  SRKIVEIICRTSWL-KSEN--QCGKIDRVMKVHNMQKTIARFEEYGETAKIRASKLQKKH  304

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEI-NGGVGVF  632
             RCLADGNELLRFHGTTV C LG N ++S+CT+EKC VCRI+R GF+ K+E  N GVGVF
Sbjct  305  PRCLADGNELLRFHGTTVACGLGINGTTSVCTAEKCCVCRIIRNGFSAKREKNNNGVGVF  364

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLAG  458
            TASTS RA E++  +        RK LIVCRV+AGRVHRP+ENVEE+ G   SGFDSLAG
Sbjct  365  TASTSGRAFESVLNNEGDVDRTVRKVLIVCRVVAGRVHRPVENVEEMNGLMMSGFDSLAG  424

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            KVG+Y+NVEEL+LL+PRALLPCFV+ICK 
Sbjct  425  KVGLYTNVEELYLLNPRALLPCFVIICKP  453



>ref|XP_006644817.1| PREDICTED: uncharacterized protein LOC102701492 [Oryza brachyantha]
Length=287

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 166/214 (78%), Gaps = 11/214 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKL KKH
Sbjct  77   SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLPKKH  133

Query  808  ARCLADGNELLRFHGTTVECNLG--ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGV  635
             RCLADGNELLRFHG T+ C LG  A  SSSLC S+KC VCRI+R GF+ +KE   GVGV
Sbjct  134  PRCLADGNELLRFHGATLSCALGGAAGSSSSLCASDKCAVCRIIRHGFSARKEGKAGVGV  193

Query  634  FTASTSSRALEAIEESSCANQ------GAARKALIVCRVIAGRVHRPLENVEELAGQSGF  473
            FT STS RA E+IE              A R+AL+VCRVIAGRVH+PLEN++E AGQ+GF
Sbjct  194  FTTSTSGRAYESIEVPGVGGGGGGDDPAATRRALLVCRVIAGRVHKPLENLKEFAGQTGF  253

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DSLAGKVG YSN+EEL+LL+PRALLPCFVVICKA
Sbjct  254  DSLAGKVGPYSNIEELYLLNPRALLPCFVVICKA  287



>ref|XP_009419613.1| PREDICTED: uncharacterized protein LOC103999553 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+IC+ SW  KS+++  C  +ER+LKVHNMQKTL +FEEYRE VKI+ASKL KKH
Sbjct  214  SRKIVEIICKASW-LKSESS--CGRLERVLKVHNMQKTLTQFEEYREMVKIRASKLPKKH  270

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SS+LCTS+KCNVCRILR GF+ +KE+ GG+G+FT
Sbjct  271  PRCLADGNELLRFYGTTVCCSLGINGSSNLCTSDKCNVCRILRHGFSKRKEMKGGLGMFT  330

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+++     +  + RKAL++CRVIAGRVH+P++ ++ LAGQ GFDS+AGKVG
Sbjct  331  TSTSRRALESVQ--VLEDHPSIRKALLICRVIAGRVHKPMDKLQNLAGQCGFDSVAGKVG  388

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
             Y+++EEL+LL+ RALLPCFVVICK 
Sbjct  389  PYASIEELYLLNARALLPCFVVICKP  414



>ref|XP_009419608.1| PREDICTED: uncharacterized protein LOC103999553 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419609.1| PREDICTED: uncharacterized protein LOC103999553 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419610.1| PREDICTED: uncharacterized protein LOC103999553 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419611.1| PREDICTED: uncharacterized protein LOC103999553 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419612.1| PREDICTED: uncharacterized protein LOC103999553 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=428

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+IC+ SW  KS+++  C  +ER+LKVHNMQKTL +FEEYRE VKI+ASKL KKH
Sbjct  228  SRKIVEIICKASW-LKSESS--CGRLERVLKVHNMQKTLTQFEEYREMVKIRASKLPKKH  284

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG N SS+LCTS+KCNVCRILR GF+ +KE+ GG+G+FT
Sbjct  285  PRCLADGNELLRFYGTTVCCSLGINGSSNLCTSDKCNVCRILRHGFSKRKEMKGGLGMFT  344

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+++     +  + RKAL++CRVIAGRVH+P++ ++ LAGQ GFDS+AGKVG
Sbjct  345  TSTSRRALESVQ--VLEDHPSIRKALLICRVIAGRVHKPMDKLQNLAGQCGFDSVAGKVG  402

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
             Y+++EEL+LL+ RALLPCFVVICK 
Sbjct  403  PYASIEELYLLNARALLPCFVVICKP  428



>ref|XP_006283760.1| hypothetical protein CARUB_v10004841mg [Capsella rubella]
 gb|EOA16658.1| hypothetical protein CARUB_v10004841mg [Capsella rubella]
Length=435

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 169/209 (81%), Gaps = 8/209 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T N  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  232  SRKIVEIICRTSWL----KTENQGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  287

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGTTV C LG N S+SLC+SEKC VCRI+R GF+ K+E+N G+GVF
Sbjct  288  HPRCIADGNELLRFHGTTVACALGINGSTSLCSSEKCCVCRIIRNGFSAKREMNNGIGVF  347

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAG--QSGFDSLAG  458
            TASTS RA E+I        G  RKALIVCRVIAGRVHRP+EN+EE++G   +GFDSLAG
Sbjct  348  TASTSERAFESIVIGD-GGGGGDRKALIVCRVIAGRVHRPVENLEEMSGLLLNGFDSLAG  406

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            KVG+Y++VEEL+LL+ RALLPCFV+ICK 
Sbjct  407  KVGLYTHVEELYLLNSRALLPCFVLICKP  435



>ref|XP_004970210.1| PREDICTED: uncharacterized protein LOC101769772 [Setaria italica]
Length=497

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 169/216 (78%), Gaps = 13/216 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKL KKH
Sbjct  285  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLPKKH  341

Query  808  ARCLADGNELLRFHGTTVECNLGAND--SSSLCTSEKCNVCRILRRGFAIKKEINGGVGV  635
             RCLADGNELLRFHG T+ C LGA    SSSLC S++C VCRI+R GF+ +KE   GVGV
Sbjct  342  PRCLADGNELLRFHGATLSCALGAGSGASSSLCASDRCAVCRIIRHGFSARKEGKAGVGV  401

Query  634  FTASTSSRALEAIE---ESSCANQGA-----ARKALIVCRVIAGRVHRPLENVEELAGQS  479
            FT STS RA E+IE    +SC + GA      RKAL+VCRVIAGRVH+PLEN+ E AGQ+
Sbjct  402  FTTSTSGRAFESIEAPPPASCGDDGADPAAAPRKALLVCRVIAGRVHKPLENLREFAGQT  461

Query  478  GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  462  GFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICKP  497



>ref|XP_003543285.1| PREDICTED: uncharacterized protein LOC100800127 [Glycine max]
Length=439

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  239  SRKIVEIICRTSWL-KSEN--QCGRIERVLKVHNMQKTLARFEEYRELVKIKASKLPKKH  295

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG + SSSLC SEKC VCRI+R GF+ K+E+ GG+GVFT
Sbjct  296  PRCLADGNELLRFYGTTVACSLGLSGSSSLCLSEKCCVCRIIRNGFSAKEELKGGIGVFT  355

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +  + RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  356  TSTSGRAFECIEVFD--HDPSLRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  413

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ RALLPCFVVICK 
Sbjct  414  LYSNIEELYLLNARALLPCFVVICKP  439



>gb|KHN36742.1| hypothetical protein glysoja_001473 [Glycine soja]
Length=439

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N   C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  239  SRKIVEIICRTSWL-KSEN--QCGRIERVLKVHNMQKTLARFEEYRELVKIKASKLPKKH  295

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG + SSSLC SEKC VCRI+R GF+ K+E+ GG+GVFT
Sbjct  296  PRCLADGNELLRFYGTTVACSLGLSGSSSLCLSEKCCVCRIIRNGFSAKEELKGGIGVFT  355

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +  + RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  356  TSTSGRAFECIEVFD--HDPSLRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  413

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ RALLPCFVVICK 
Sbjct  414  LYSNIEELYLLNARALLPCFVVICKP  439



>ref|XP_010448164.1| PREDICTED: uncharacterized protein LOC104730664 [Camelina sativa]
Length=437

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 167/210 (80%), Gaps = 9/210 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR IVE+ICRTSW      T +  G ++RILKVHNMQKTLA FEEYR+ VKI+ASKL KK
Sbjct  233  SRKIVEIICRTSWL----KTEHHGGRIDRILKVHNMQKTLARFEEYRDTVKIRASKLQKK  288

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ADGNELLRFHGT V C LG N S+SLC+SEKC VCRI+R GF+ K+E+N GVGVF
Sbjct  289  HPRCIADGNELLRFHGTAVACALGINGSTSLCSSEKCCVCRIIRNGFSSKREMNNGVGVF  348

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQS---GFDSLA  461
            TASTS RA E+I        G  RKALIVCRVIAGRVHRP+EN+EE++  S   GFDSLA
Sbjct  349  TASTSERAFESIVVGD-NGGGGDRKALIVCRVIAGRVHRPVENLEEMSSGSLLNGFDSLA  407

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GKVG+Y++VEEL+LL+ RALLPCFV+ICK 
Sbjct  408  GKVGLYTHVEELYLLNSRALLPCFVLICKP  437



>ref|XP_002305640.1| hypothetical protein POPTR_0004s03040g [Populus trichocarpa]
 gb|EEE86151.1| hypothetical protein POPTR_0004s03040g [Populus trichocarpa]
Length=386

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 165/206 (80%), Gaps = 8/206 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT W     + NNC  +ER+LKVHNMQ TL +FEE+RE VKIKASKL  KH
Sbjct  183  SRRIVELICRTRWL---QSENNCVTIERVLKVHNMQMTLVQFEEHREMVKIKASKLPTKH  239

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEING-GVGVF  632
            +RCLADGNELLRFHGTTV C+LG N SSSLC  EKC VC+ILR GF   K++NG GVG+F
Sbjct  240  SRCLADGNELLRFHGTTVACSLGLNGSSSLCRMEKCGVCQILRHGFT-DKDVNGIGVGIF  298

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T STS RALE++E S   +    RKAL++CRVIAGRVHRPLENV+E+AGQSGFDSLAGK 
Sbjct  299  TTSTSGRALESVEVSQ--DNQDVRKALLLCRVIAGRVHRPLENVQEIAGQSGFDSLAGKA  356

Query  451  GIYSN-VEELFLLDPRALLPCFVVIC  377
            G  S+ +EEL+LL+P+ALLPCFVV C
Sbjct  357  GQNSHLLEELYLLNPKALLPCFVVTC  382



>ref|XP_002518577.1| transcription factor, putative [Ricinus communis]
 gb|EEF43964.1| transcription factor, putative [Ricinus communis]
Length=403

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 162/203 (80%), Gaps = 9/203 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW     N  N   +ER+LKVHNMQ T+A+FEEYRE VKIKASKL  +H
Sbjct  209  SRRIVEIICRASWLKSEANFVN---IERVLKVHNMQVTIAQFEEYRELVKIKASKLPTRH  265

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
            +RCLADGNELLRFHGTT+ C+LG N S SLCT EKC VC+ILR GF  K      +GVFT
Sbjct  266  SRCLADGNELLRFHGTTISCSLGMNGSYSLCTEEKCGVCQILRHGFCRKD-----IGVFT  320

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RALE+I ESS  +  +ARKAL+VCRVIAGRVH+PL N +E+AGQSGFDSLAGKVG
Sbjct  321  TSTSGRALESI-ESSEDSHSSARKALLVCRVIAGRVHKPLGNFQEIAGQSGFDSLAGKVG  379

Query  448  IYSNVEELFLLDPRALLPCFVVI  380
             +SN+EEL+LL+P+ALLPCFVVI
Sbjct  380  QHSNIEELYLLNPKALLPCFVVI  402



>ref|XP_010052462.1| PREDICTED: uncharacterized protein LOC104441152 [Eucalyptus grandis]
 gb|KCW76463.1| hypothetical protein EUGRSUZ_D00857 [Eucalyptus grandis]
Length=415

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 167/205 (81%), Gaps = 5/205 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+ IVE+IC+TSW  KS++++ C  +ER+LKVHNMQ+TLA FEEYRE VKI+ASKL+KKH
Sbjct  215  SKRIVEIICQTSW-LKSEHSS-CGHIERVLKVHNMQRTLARFEEYREMVKIRASKLSKKH  272

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GT V C+LGAN SS LC    C VCRILR GF  KKE+ GGVG+FT
Sbjct  273  PRCMADGNELLRFYGTAVACSLGAN-SSGLCDLSNCAVCRILRHGFPSKKELAGGVGIFT  331

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            +STS RA E+I+      +   RKAL+VCRVIAGRVH+P+EN+ E+A  SGFDSLAGKVG
Sbjct  332  SSTSGRAFESIKLGDGDER--LRKALVVCRVIAGRVHKPVENIHEMASLSGFDSLAGKVG  389

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
             YS++EEL+L +PRALLPCFVVICK
Sbjct  390  QYSSIEELYLWNPRALLPCFVVICK  414



>gb|EPS71826.1| hypothetical protein M569_02932, partial [Genlisea aurea]
Length=401

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 163/207 (79%), Gaps = 15/207 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR      +++  + NG+ERILKVHNMQKTLA+FEEYRE VKIKASKL KKH
Sbjct  209  SRRIVEIICR------ANSGRSENGIERILKVHNMQKTLAQFEEYRELVKIKASKLTKKH  262

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHG  VEC LG   SSSLC SEKC VCRILR GF+ +KEI+    VFT
Sbjct  263  PRCLADGNELLRFHGAAVECRLGQKGSSSLCISEKCRVCRILRYGFSTRKEIS---AVFT  319

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEEL-AGQSGFDSLAGKV  452
            ASTS RALE+++ S     G  RKAL+VCRVIAGRVHRPLEN++E+  G +GFDSLAGKV
Sbjct  320  ASTSGRALESVKAS-----GGERKALVVCRVIAGRVHRPLENLQEMVGGPTGFDSLAGKV  374

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G+  N+EEL+LL PRALLPCFVVI K 
Sbjct  375  GVQGNIEELYLLSPRALLPCFVVIYKP  401



>ref|XP_006592887.1| PREDICTED: uncharacterized protein LOC100816798 [Glycine max]
 gb|KHN27986.1| hypothetical protein glysoja_007718 [Glycine soja]
Length=436

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+    C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  236  SRKIVEIICRTSWL-KSEK--QCGRIERVLKVHNMQKTLARFEEYRELVKIKASKLPKKH  292

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C+LG + SSSLC SEKC VCRI+R GF+ K+E+ GGVGVFT
Sbjct  293  PRCLADGNELLRFYGTTVACSLGLSGSSSLCLSEKCYVCRIIRNGFSAKEELKGGVGVFT  352

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E I+     +  + RKALIVCRVIAGRVHRPLEN++E+AGQ+GFDSLAGKVG
Sbjct  353  TSTSGRAFECIK--VFDHDPSLRKALIVCRVIAGRVHRPLENIQEMAGQTGFDSLAGKVG  410

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            +YSN+EEL+LL+ R LLPCFVVICK 
Sbjct  411  LYSNIEELYLLNSRGLLPCFVVICKP  436



>ref|XP_009418763.1| PREDICTED: uncharacterized protein LOC103998881 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVEMICRTSW    +  ++C  +ER+LK+HNMQ+ LA+FEEYRE +K+KASKL KKH
Sbjct  234  SRKIVEMICRTSWL---NTGSSCRQIERVLKIHNMQRNLAQFEEYRETIKLKASKLPKKH  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNE LRFHGT + C+LG+N SSSLCTSEKC+VC+I+R GF+ KKE  G +GVFT
Sbjct  291  PRCLADGNEHLRFHGTAIACSLGSNGSSSLCTSEKCSVCQIIRHGFSSKKESKGRIGVFT  350

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             ST  RALE+IE  +C +  + +KAL+VCRVIAGRVH+PL+  +EL G+S FDS+AGK+G
Sbjct  351  TSTCGRALESIE--TCEDDPSVKKALLVCRVIAGRVHKPLDTYQELVGRSAFDSMAGKIG  408

Query  448  IYSNVEELFLLDPRALLPCFVVICKA  371
            IY ++EEL+LLDP ALLPCFVVICK 
Sbjct  409  IYGSIEELYLLDPSALLPCFVVICKP  434



>gb|EAZ38050.1| hypothetical protein OsJ_22395 [Oryza sativa Japonica Group]
Length=393

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 10/210 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR +VE+IC+  WA     T N  G +ER++KVHN ++++A FEE+RE VK KA++L+KK
Sbjct  188  SRKVVEIICKAGWA----KTENALGRIERVVKVHNAERSVARFEEFREAVKGKAARLSKK  243

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RCLADGNELLRFH TT+ C+LGA DSS+LCTS  C+VCRI+R GF+  +EI  GVGVF
Sbjct  244  HPRCLADGNELLRFHATTLACSLGAGDSSTLCTSGSCSVCRIIRHGFSATREIKDGVGVF  303

Query  631  TASTSSRALEAI----EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSL  464
            T STS RALE I    +    AN G  RKAL+VCRV+AGR+HRPLEN++E+A Q GFDS+
Sbjct  304  TTSTSKRALECIAGDGDGDEAANAG-VRKALLVCRVVAGRIHRPLENLQEVAAQPGFDSV  362

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            AGKVG Y+++EEL+LL+PRALLPCFVVICK
Sbjct  363  AGKVGAYASIEELYLLNPRALLPCFVVICK  392



>ref|XP_011003391.1| PREDICTED: uncharacterized protein LOC105110150 [Populus euphratica]
Length=407

 Score =   271 bits (692),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 163/206 (79%), Gaps = 8/206 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRT W     + NNC  +ER+LKVHNMQ TL +FEE+RE VKIKASKL  KH
Sbjct  204  SRRIVELICRTRWL---QSENNCVTIERVLKVHNMQMTLVQFEEHREMVKIKASKLPTKH  260

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEING-GVGVF  632
            +RCLADGNELLRFHGTTV C+LG N SSSLC  EKC VC+ILR GF   K++NG GVG+F
Sbjct  261  SRCLADGNELLRFHGTTVACSLGLNGSSSLCRMEKCGVCQILRHGFT-DKDVNGIGVGIF  319

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T STS RALE++E S   +    RKAL++CRVIAGRV RPLEN +E+AGQSGFDSLAGK 
Sbjct  320  TTSTSGRALESVEASQ--DNQDVRKALLLCRVIAGRVRRPLENAQEIAGQSGFDSLAGKA  377

Query  451  GIYSN-VEELFLLDPRALLPCFVVIC  377
            G  S+ +EEL+LL+P+ALLPCFVV C
Sbjct  378  GQNSHLLEELYLLNPKALLPCFVVTC  403



>gb|EEC81194.1| hypothetical protein OsI_24208 [Oryza sativa Indica Group]
Length=465

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 10/210 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR +VE+IC+  WA     T N  G +ER++KVHN ++++A FEE+RE VK KA++L+KK
Sbjct  260  SRKVVEIICKAGWA----KTENALGRIERVVKVHNAERSVARFEEFREAVKGKAARLSKK  315

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RCLADGNELLRFH TT+ C+LGA DSS+LCTS  C+VCRI+R GF+  +EI  GVGVF
Sbjct  316  HPRCLADGNELLRFHATTLACSLGAGDSSTLCTSGSCSVCRIIRHGFSATREIKDGVGVF  375

Query  631  TASTSSRALEAI----EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSL  464
            T STS RALE I    +    AN G  RKAL+VCRV+AGR+HRPLEN++E+A Q GFDS+
Sbjct  376  TTSTSKRALECIAGDGDGDEAANAG-VRKALLVCRVVAGRIHRPLENLQEVAAQPGFDSV  434

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            AGKVG Y+++EEL+LL+PRALLPCFVVICK
Sbjct  435  AGKVGTYASIEELYLLNPRALLPCFVVICK  464



>ref|NP_001058385.1| Os06g0683000 [Oryza sativa Japonica Group]
 dbj|BAD45547.1| zinc finger (C2H2 type) protein-like [Oryza sativa Japonica Group]
 dbj|BAD45906.1| zinc finger (C2H2 type) protein-like [Oryza sativa Japonica Group]
 dbj|BAF20299.1| Os06g0683000 [Oryza sativa Japonica Group]
 dbj|BAG97252.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99838.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 10/210 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNG-MERILKVHNMQKTLAEFEEYRERVKIKASKLAKK  812
            SR +VE+IC+  WA     T N  G +ER++KVHN ++++A FEE+RE VK KA++L+KK
Sbjct  260  SRKVVEIICKAGWA----KTENALGRIERVVKVHNAERSVARFEEFREAVKGKAARLSKK  315

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RCLADGNELLRFH TT+ C+LGA DSS+LCTS  C+VCRI+R GF+  +EI  GVGVF
Sbjct  316  HPRCLADGNELLRFHATTLACSLGAGDSSTLCTSGSCSVCRIIRHGFSATREIKDGVGVF  375

Query  631  TASTSSRALEAI----EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSL  464
            T STS RALE I    +    AN G  RKAL+VCRV+AGR+HRPLEN++E+A Q GFDS+
Sbjct  376  TTSTSKRALECIAGDGDGDEAANAG-VRKALLVCRVVAGRIHRPLENLQEVAAQPGFDSV  434

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            AGKVG Y+++EEL+LL+PRALLPCFVVICK
Sbjct  435  AGKVGAYASIEELYLLNPRALLPCFVVICK  464



>ref|XP_002458613.1| hypothetical protein SORBIDRAFT_03g036720 [Sorghum bicolor]
 gb|EES03733.1| hypothetical protein SORBIDRAFT_03g036720 [Sorghum bicolor]
Length=523

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 164/220 (75%), Gaps = 17/220 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKL KKH
Sbjct  307  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLPKKH  363

Query  808  ARCLADGNELLRFHGTTVECNLGANDS--SSLCTSEKCNVCRILRRGFAIKKEINGGVGV  635
             RCLADGNELLRFHG T+ C LG   S  SSLC S+KC VCRI+R GF+ KKE   GVGV
Sbjct  364  PRCLADGNELLRFHGATLSCALGGAGSGNSSLCASDKCAVCRIIRHGFSAKKEGKAGVGV  423

Query  634  FTASTSSRALEAIEESSCANQG------------AARKALIVCRVIAGRVHRPLENVEEL  491
            FT STS RA E+IE +     G              RKAL+VCRVIAGRVH+PL+N++E 
Sbjct  424  FTTSTSGRAFESIEAAPGPGAGDDGADQLQLGTTTTRKALLVCRVIAGRVHKPLDNLKEF  483

Query  490  AGQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
             GQ+GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  484  VGQTGFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICKP  523



>ref|XP_006657258.1| PREDICTED: uncharacterized protein LOC102713921 [Oryza brachyantha]
Length=454

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 167/213 (78%), Gaps = 10/213 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR +VE+IC+  W  KS+N      +ER+LKVHN ++++A FEE+RE VK +A++L KKH
Sbjct  245  SRKVVEIICKAGWP-KSENA--LGRVERVLKVHNAERSVARFEEFRETVKGRAARLPKKH  301

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFH TT+ C+LGA DSSS+CTS  C+VCRI+R GF+  +E+  GVGVFT
Sbjct  302  PRCLADGNELLRFHATTLSCSLGAGDSSSICTSGSCSVCRIIRHGFSATREVRDGVGVFT  361

Query  628  ASTSSRALEAIEES-------SCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFD  470
             STS RALE I+E+       + A     RKAL+VCRV+AGR+HRPLEN++++A Q GFD
Sbjct  362  TSTSKRALECIQETGAGAGDEAEAANAGVRKALLVCRVVAGRIHRPLENLQDVAAQPGFD  421

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AGKVG Y+++EEL+LL+PRALLPCFVVICK+
Sbjct  422  SVAGKVGAYASIEELYLLNPRALLPCFVVICKS  454



>gb|KDP20826.1| hypothetical protein JCGZ_21297 [Jatropha curcas]
Length=412

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 166/205 (81%), Gaps = 7/205 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR SW  KS+   NC  +E+ILKVHNMQ  +A+FEE+RE VKIKASKL  +H
Sbjct  214  SRKIVEIICRASW-LKSEA--NCIRIEKILKVHNMQSRIAQFEEHREIVKIKASKLPTRH  270

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SS LCT E C+VC+ILR GF +KK++  G+GV+T
Sbjct  271  PRCLADGNELLRFHGTTIACSLGLNGSSCLCTMENCDVCQILRNGF-LKKDLKDGIGVYT  329

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
            ASTS +ALE IE S    + ++RKAL+VCRVIAGRVH+PLEN +E+AGQSGFDSLAG  G
Sbjct  330  ASTSGKALECIEFSE--EKSSSRKALLVCRVIAGRVHKPLENFQEIAGQSGFDSLAGNYG  387

Query  448  IYS-NVEELFLLDPRALLPCFVVIC  377
              + ++EEL+LL+P+ALLPCFVVIC
Sbjct  388  HQNCSIEELYLLNPKALLPCFVVIC  412



>emb|CAN59868.1| hypothetical protein VITISV_013440 [Vitis vinifera]
Length=435

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 150/178 (84%), Gaps = 5/178 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N+  C  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  218  SRKIVEIICRTSW-LKSENS--CGRIERVLKVHNMQKTLARFEEYREIVKIKASKLPKKH  274

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRFHGTT+ C+LG N SSSLCTS+KC+VCRILR GF+ KKE+NGGVGVFT
Sbjct  275  PRCLADGNELLRFHGTTIACSLGMNGSSSLCTSDKCSVCRILRHGFSTKKEVNGGVGVFT  334

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGK  455
             STS  A E+I+ +   NQ   R ALIVCRVIAGRVHRPLEN++ELAGQSGFDSLAGK
Sbjct  335  TSTSGSAFESIKLNE-ENQSLGR-ALIVCRVIAGRVHRPLENIQELAGQSGFDSLAGK  390



>ref|XP_003564368.1| PREDICTED: uncharacterized protein LOC100825897 [Brachypodium 
distachyon]
Length=489

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 165/222 (74%), Gaps = 19/222 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKL KKH
Sbjct  271  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKMKASKLPKKH  327

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS--------LCTSEKCNVCRILRRGFAIKKEI  653
             RCLADGNELLRFHG T+ C LGA+  S         LC S+KC VCRI+R GF+ KKE 
Sbjct  328  PRCLADGNELLRFHGATLSCALGASSGSGSSSSSGSSLCASDKCAVCRIIRHGFSSKKEG  387

Query  652  NGGVGVFTASTSSRALEAIEESSCA-----NQG---AARKALIVCRVIAGRVHRPLENVE  497
              G+GVFT STS RA E + + +       +QG     RKAL+VCRVIAGRVH+PL+N++
Sbjct  388  KAGLGVFTTSTSGRAFECVADEAAGVVDDEHQGQGQGTRKALLVCRVIAGRVHKPLDNLK  447

Query  496  ELAGQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            E  GQ+GFDSLAGKVG Y+N+EEL+LL+PRALLPCFVVICK 
Sbjct  448  EFVGQTGFDSLAGKVGPYANIEELYLLNPRALLPCFVVICKP  489



>ref|NP_001146839.1| MRP interacting1 [Zea mays]
 emb|CAR92508.1| C2H2 zinc finger protein [Zea mays]
 gb|AFW84875.1| C2H2 zinc finger protein [Zea mays]
Length=501

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 165/218 (76%), Gaps = 15/218 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK++ASKL KKH
Sbjct  287  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLRASKLPKKH  343

Query  808  ARCLADGNELLRFHGTTVECNL-----GANDSSSLCTSEKCNVCRILRRGFAIKKEINGG  644
             RCLADGNELLRFHGTT+ C L     G   SS LC S+KC VCRI+R GF+ +KE   G
Sbjct  344  PRCLADGNELLRFHGTTLSCALGGGGGGGGGSSRLCASDKCAVCRIIRHGFSGRKEGKTG  403

Query  643  VGVFTASTSSRALEAIEESSCAN------QGAARKALIVCRVIAGRVHRPLENVEELAGQ  482
            VGVFT STS RA E+IE +           G  R+AL+VCRVIAGRVH+PL+N++E AGQ
Sbjct  404  VGVFTTSTSGRAFESIEAAGADGAGAGSVSGTTRRALLVCRVIAGRVHKPLDNLKEFAGQ  463

Query  481  S-GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            + GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVICK 
Sbjct  464  TMGFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICKP  501



>gb|EPS69596.1| hypothetical protein M569_05170, partial [Genlisea aurea]
Length=433

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICR+SW  KS+    C  +ER+LKVHNMQ+T+  FEEYRE VK KA KLAKKH
Sbjct  231  SRKIVEIICRSSWP-KSEQPRRCVRIERVLKVHNMQRTVGRFEEYREAVKAKAGKLAKKH  289

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEIN----GGV  641
             RCLADGNELLRF+GTTV C+LG N SSSLC ++KC+VCRI++ GF  K+EI+    GG+
Sbjct  290  PRCLADGNELLRFYGTTVACSLGLNGSSSLCAADKCSVCRIIKDGFCSKREISGGGGGGI  349

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
            GVFT S+S  ALE+I+E         RKALIVCRVIAGRVHRPLEN++E+AGQ GFDSLA
Sbjct  350  GVFTTSSSETALESIDECP-----GTRKALIVCRVIAGRVHRPLENIQEIAGQIGFDSLA  404

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICK  374
            GKVG+YSN+EEL+LL+P+ALLPCFV++C+
Sbjct  405  GKVGLYSNIEELYLLNPKALLPCFVIVCR  433



>dbj|BAK05649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 164/213 (77%), Gaps = 10/213 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKL KKH
Sbjct  276  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLPKKH  332

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGF------AIKKEING  647
             RCLADGNELLRFHG T+ C LG+  +SSLC S+KC VCRI+R GF        KKE   
Sbjct  333  PRCLADGNELLRFHGATLSCALGSAGASSLCASDKCAVCRIIRHGFSSSSNSNSKKEGKA  392

Query  646  GVGVFTASTSSRALEA-IEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFD  470
             VGVFT STS RA E+  EE + A  G AR+AL+VCRVIAGRVH+PLENV E  GQ+GFD
Sbjct  393  SVGVFTTSTSGRAFESADEEDAPAAAGGARRALLVCRVIAGRVHKPLENVREFVGQTGFD  452

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            SLAGKVG Y+N+EEL+LL+PRALLPCFVVICK 
Sbjct  453  SLAGKVGPYANIEELYLLNPRALLPCFVVICKP  485



>ref|XP_006370599.1| hypothetical protein POPTR_0001s44130g [Populus trichocarpa]
 gb|ERP67168.1| hypothetical protein POPTR_0001s44130g [Populus trichocarpa]
Length=421

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 5/182 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW  KS+N  +C  +ER+LKVH+MQKTLA FEEYRE VKIKASKL KKH
Sbjct  240  SRKIVEIICRTSWL-KSEN--HCGRIERVLKVHSMQKTLARFEEYREMVKIKASKLPKKH  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF+GTTV C+LG N SSSLC SEKC VCRI+R GF++KKE+ GGVGVFT
Sbjct  297  PRCIADGNELLRFYGTTVACSLGVNGSSSLCVSEKCCVCRIIRNGFSVKKELKGGVGVFT  356

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS RA E IE     +    RKALIVCRVIAGRVHRPLEN++E++ Q+GFDSLAGKV 
Sbjct  357  TSTSGRAFECIE--IFEDDPCIRKALIVCRVIAGRVHRPLENIQEISSQTGFDSLAGKVT  414

Query  448  IY  443
            ++
Sbjct  415  LF  416



>ref|XP_002522818.1| transcription factor, putative [Ricinus communis]
 gb|EEF39516.1| transcription factor, putative [Ricinus communis]
Length=385

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 149/209 (71%), Gaps = 39/209 (19%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTSW       NNC  +ER+LKVHNMQKTLA FEEYRE VKIKASKL KKH
Sbjct  213  SRKIVEIICRTSWL---KGENNCGRIERVLKVHNMQKTLARFEEYREMVKIKASKLPKKH  269

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLR                            I+R GF+ KKE+ GG+GVFT
Sbjct  270  PRCIADGNELLR----------------------------IIRNGFSAKKELKGGIGVFT  301

Query  628  ASTSSRALEAIE---ESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
             STS RA E++E   E  C      RKALIVCRVIAGRVH+PLEN++E++GQ+GFDSLAG
Sbjct  302  TSTSGRAFESVEIFEEDPCI-----RKALIVCRVIAGRVHKPLENIQEISGQTGFDSLAG  356

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
            KVG+YSN+EEL+LL+P+ALLPCFVVICK 
Sbjct  357  KVGLYSNIEELYLLNPKALLPCFVVICKP  385



>ref|XP_007025908.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY28530.1| Transcription factor, putative [Theobroma cacao]
Length=411

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 156/209 (75%), Gaps = 11/209 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+ IVE+IC+TS      +      +ERILKVHNMQ++LA+FE+YRE VKIKA+KL+KKH
Sbjct  203  SKKIVELICQTSLL---GSETEFGPIERILKVHNMQRSLAQFEDYREMVKIKANKLSKKH  259

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RCLADGNELLRF+GTTV C++G  ++SS CT +KC +C+ILR GF+  ++ NG  GVFT
Sbjct  260  PRCLADGNELLRFYGTTVACSIGMKNTSSPCTLKKCGICQILRHGFSTMEKSNGFRGVFT  319

Query  628  ASTSSRALEAI---EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
            +S   RALE I   EE+ C      RKAL+VCRVIAGRV  PLEN +E+A QS FDSLAG
Sbjct  320  SSIGKRALECIELDEENRC-----LRKALVVCRVIAGRVQNPLENAQEMASQSSFDSLAG  374

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA  371
                +SN+EEL+ L+PRAL PCFVVICK 
Sbjct  375  NFDSHSNIEELYSLNPRALFPCFVVICKP  403



>tpg|DAA57325.1| TPA: hypothetical protein ZEAMMB73_591981, partial [Zea mays]
Length=234

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 165/219 (75%), Gaps = 16/219 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKLAKKH
Sbjct  19   SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLAKKH  75

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG    SS   + +KC VCRI+R GF+ +KE  GGVGVF
Sbjct  76   PRCLADGNELLRFHGATLSCALGGGSGSSSLCASDKCAVCRIIRHGFSARKEGKGGVGVF  135

Query  631  TASTSSRALEAIEESSCA------------NQGAARKALIVCRVIAGRVHRPLENVEELA  488
            T STS RA E+I E+  A              G AR+AL+VCRVIAGRVH+PL+N++E  
Sbjct  136  TTSTSGRAFESIVEAPPAIGVGDDDGAGQLGLGTARRALLVCRVIAGRVHKPLDNLKEFV  195

Query  487  GQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GQ+GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVIC+ 
Sbjct  196  GQTGFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICRP  234



>tpg|DAA57326.1| TPA: hypothetical protein ZEAMMB73_591981, partial [Zea mays]
Length=236

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 165/219 (75%), Gaps = 16/219 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKLAKKH
Sbjct  21   SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLAKKH  77

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG    SS   + +KC VCRI+R GF+ +KE  GGVGVF
Sbjct  78   PRCLADGNELLRFHGATLSCALGGGSGSSSLCASDKCAVCRIIRHGFSARKEGKGGVGVF  137

Query  631  TASTSSRALEAIEESSCA------------NQGAARKALIVCRVIAGRVHRPLENVEELA  488
            T STS RA E+I E+  A              G AR+AL+VCRVIAGRVH+PL+N++E  
Sbjct  138  TTSTSGRAFESIVEAPPAIGVGDDDGAGQLGLGTARRALLVCRVIAGRVHKPLDNLKEFV  197

Query  487  GQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GQ+GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVIC+ 
Sbjct  198  GQTGFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICRP  236



>emb|CDM84498.1| unnamed protein product [Triticum aestivum]
Length=486

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 165/214 (77%), Gaps = 11/214 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKLAKKH
Sbjct  276  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLAKKH  332

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFA------IKKEING  647
             RCLADGNELLRFHG T+ C LG+  +SSLC S+KC VCRI+R GF+       KK+   
Sbjct  333  PRCLADGNELLRFHGATLCCALGSAGASSLCASDKCAVCRIIRHGFSSSSSPNAKKDGKA  392

Query  646  GVGVFTASTSSRALEAI--EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGF  473
             VGVFT STS RA EA   E+   A  G AR+AL+VCRVIAGRVH+PLENV E  GQ+GF
Sbjct  393  SVGVFTTSTSGRAFEAADEEDDPAAAAGGARRALLVCRVIAGRVHKPLENVREFVGQTGF  452

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DSLAGKVG Y+N+EEL+LL+PRALLPCFVVICK 
Sbjct  453  DSLAGKVGPYANIEELYLLNPRALLPCFVVICKP  486



>ref|NP_001151870.1| MRP interacting2 [Zea mays]
 ref|XP_008673012.1| PREDICTED: MRP interacting2 isoform X1 [Zea mays]
 gb|ACG44702.1| nucleic acid binding protein [Zea mays]
 emb|CAR92509.1| C2H2 zinc finger protein [Zea mays]
 tpg|DAA57324.1| TPA: C2H2 zinc finger proteinucleic acid binding protein [Zea 
mays]
Length=505

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 165/219 (75%), Gaps = 16/219 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TL+ FEEYRE VK+KASKLAKKH
Sbjct  290  SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLAKKH  346

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFHG T+ C LG    SS   + +KC VCRI+R GF+ +KE  GGVGVF
Sbjct  347  PRCLADGNELLRFHGATLSCALGGGSGSSSLCASDKCAVCRIIRHGFSARKEGKGGVGVF  406

Query  631  TASTSSRALEAIEESSCA------------NQGAARKALIVCRVIAGRVHRPLENVEELA  488
            T STS RA E+I E+  A              G AR+AL+VCRVIAGRVH+PL+N++E  
Sbjct  407  TTSTSGRAFESIVEAPPAIGVGDDDGAGQLGLGTARRALLVCRVIAGRVHKPLDNLKEFV  466

Query  487  GQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            GQ+GFDSLAGKVG YSN+EEL+LL+PRALLPCFVVIC+ 
Sbjct  467  GQTGFDSLAGKVGPYSNIEELYLLNPRALLPCFVVICRP  505



>gb|EYU33591.1| hypothetical protein MIMGU_mgv1a020366mg [Erythranthe guttata]
Length=353

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 150/207 (72%), Gaps = 7/207 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+IC +S   K +  + C  +ER+LK+HN QKTL  FE+YRE VK KA++   KH
Sbjct  153  SRKIVEIICGSS---KLNPESRCITIERVLKIHNTQKTLTRFEDYREMVKTKANEHPNKH  209

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEIN-GGVGVF  632
             RCLADGNEL+ F+GT +EC+LG N SS LC S +C VC I+R GF  K+EI  G +GVF
Sbjct  210  PRCLADGNELMMFYGTILECSLGINGSSGLCASGRCCVCIIIRNGFPAKREIKLGQMGVF  269

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTS RA E+I E  C N+   RKALIVCRVIAGRVH PL N+  L   + +DSLA KV
Sbjct  270  TASTSGRAFESI-EIDCENEPLVRKALIVCRVIAGRVHLPLRNI--LESSNLYDSLADKV  326

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S +EEL+LL P+ALLPCFVV+CKA
Sbjct  327  GSDSEIEELYLLSPKALLPCFVVVCKA  353



>gb|EMT06139.1| hypothetical protein F775_16699 [Aegilops tauschii]
Length=232

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 161/213 (76%), Gaps = 10/213 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IVE+ICRTS   KS+++  C  +ER+ KVHN Q+TLA FEEYRE VK+KASKLAKKH
Sbjct  23   SRKIVEIICRTSL-LKSESS--CVRIERVFKVHNTQRTLARFEEYREAVKLKASKLAKKH  79

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKK-----EINGG  644
             RCLADG+ELLRFHG T+ C LG+  +SSLC S+KC VCRI+R GF+        +   G
Sbjct  80   PRCLADGHELLRFHGATLACALGSAGASSLCASDKCAVCRIIRHGFSSSSSKKDGKAGAG  139

Query  643  VGVFTASTSSRALEAI--EESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFD  470
            VGVFT STS RA E+   E+   A  G AR+AL+VCRVIAGRVH+PLENV E  GQ+GFD
Sbjct  140  VGVFTTSTSGRAFESADEEDDPAAAAGGARRALLVCRVIAGRVHKPLENVREFVGQTGFD  199

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            SLAGKVG  +N+E L LL+PRALLPCFVVICK 
Sbjct  200  SLAGKVGPCANIEGLSLLNPRALLPCFVVICKP  232



>gb|KHN19066.1| hypothetical protein glysoja_029928 [Glycine soja]
Length=281

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 1/205 (0%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR I+E IC +  ++ +++ N    ++ ILKV N+ KTLA FEEYR +VK  A KL KKH
Sbjct  63   SRQIIETICGSGTSSINNSENMVGQIDCILKVLNVPKTLACFEEYRAKVKDNAEKLQKKH  122

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTT+ C+LG N SSSLCT + C +C+ILR GF   KE +G  GV+T
Sbjct  123  PRCVADGNELLRFHGTTISCSLGTN-SSSLCTLDYCGICQILRNGFFTNKEFHGASGVYT  181

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E+I   +   +  ARK++IVCRVIAGR++ PLE +EE    S FDSL+    
Sbjct  182  TSTSRKAFESISIMTSHERPFARKSVIVCRVIAGRIYSPLEEIEEERADSEFDSLSENTN  241

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
             +S+ EEL++L+P+ALLPCFV+I K
Sbjct  242  GHSDAEELYVLNPKALLPCFVIIYK  266



>ref|XP_008646660.1| PREDICTED: uncharacterized protein LOC103628187 [Zea mays]
 gb|AFW69112.1| hypothetical protein ZEAMMB73_507406 [Zea mays]
Length=430

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 148/204 (73%), Gaps = 8/204 (4%)
 Frame = -2

Query  979  IVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHARC  800
            +VE+I    W       +    +ER++KVH+M++ +  F+EY E VK +A++L  KH RC
Sbjct  232  VVELIYSVGWPNPEAALDR---VERVVKVHSMERRVDRFKEYMEEVKGRAARLPNKHPRC  288

Query  799  LADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGF-AIKKEINGGVGVFTAS  623
            +ADGNELL+FHGTTV C+LG+  S S+CTS  CNVCRI+R GF A +K  N G GVFT S
Sbjct  289  VADGNELLQFHGTTVSCSLGSGGSHSVCTSSLCNVCRIIRHGFSATRKSRNSGGGVFTTS  348

Query  622  TSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV-EELAGQSGFDSLAGKVGI  446
            TS  ALE ++E+S      A+ AL+VCRVIAGR+HRPLE + ++ A Q GFDS+AG+VG 
Sbjct  349  TSRHALECLQETSGV---GAKHALLVCRVIAGRIHRPLEKLSQDFAVQPGFDSVAGQVGD  405

Query  445  YSNVEELFLLDPRALLPCFVVICK  374
             S++EEL+LL+P ALLPCFVVICK
Sbjct  406  DSSIEELYLLNPSALLPCFVVICK  429



>ref|XP_006595420.1| PREDICTED: uncharacterized protein LOC102659726 [Glycine max]
Length=261

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 1/205 (0%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR I+E IC +  ++ +++ N    ++ ILKV N+ KTLA FEEYR +VK  A KL KKH
Sbjct  43   SRQIIETICGSGTSSINNSENMVGQIDCILKVLNVPKTLACFEEYRAKVKDNAEKLQKKH  102

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTT+ C+LG N SSSLCT + C +C+ILR GF   KE +G  GV+T
Sbjct  103  PRCVADGNELLRFHGTTISCSLGTN-SSSLCTLDYCGICQILRNGFFTNKEFHGASGVYT  161

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             STS +A E+I   +   +  ARK++IVCRVIAGR++ PLE +EE    S FDSL+    
Sbjct  162  TSTSRKAFESISIMTSHERPFARKSVIVCRVIAGRIYSPLEEIEEERADSEFDSLSENTN  221

Query  448  IYSNVEELFLLDPRALLPCFVVICK  374
             +S+ EEL++L+P+ALLPCFV+I K
Sbjct  222  GHSDAEELYVLNPKALLPCFVIIYK  246



>ref|XP_006417351.1| hypothetical protein EUTSA_v10007989mg [Eutrema salsugineum]
 gb|ESQ35704.1| hypothetical protein EUTSA_v10007989mg [Eutrema salsugineum]
Length=365

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC TS++ K   +   N +  ILK+ N+Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  161  SRTTVELICNTSYSHKLAKSKG-NTISAILKIQNLQRVVAEFEDYRELVKIRANKLSKKH  219

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS-LCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNELL FHGT + C LG + SSS LC S++C VC ILR GF  K   +G  GVF
Sbjct  220  SRCMADGNELLGFHGTALSCALGLSKSSSNLCFSDQCGVCHILRNGFNPKTRPDGIKGVF  279

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TAS S  ALE+IE     N+G+  KAL++CRVIAGRVH+P++  E+  G S FDSLA K+
Sbjct  280  TASNSFTALESIEIDQGRNRGSL-KALVLCRVIAGRVHKPMQKFEDPFGFSEFDSLALKM  338

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S VEEL+LL  +ALLPCFV+I K 
Sbjct  339  GPSSRVEELYLLSTKALLPCFVIIFKP  365



>ref|NP_172616.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
 dbj|BAH30286.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28744.1| C2H2 type zinc finger protein [Arabidopsis thaliana]
Length=365

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K       N +  I K+ N+Q+ +A+FE+YRE VKI+A+KL+KKH
Sbjct  161  SRTTVELICNTGYSHKLGKMKG-NNISAIFKIQNLQRVVADFEDYRELVKIRANKLSKKH  219

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGTT+ C LG +N SS+LC S+ C VC ILR GF+ K   +G  GV 
Sbjct  220  SRCMADGNEFLGFHGTTLSCTLGFSNSSSNLCFSDHCEVCHILRHGFSPKTRPDGIKGVL  279

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTSS ALE+IE     N+G+   A+++CRVIAGRVH+P++  E   G S FDSLA KV
Sbjct  280  TASTSSTALESIETDQGRNRGSL-IAVVLCRVIAGRVHKPMQTFENSLGFSEFDSLALKV  338

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S +EEL+LL  +ALLPCFV+I K 
Sbjct  339  GQNSRIEELYLLSTKALLPCFVIIFKP  365



>ref|XP_003547115.2| PREDICTED: uncharacterized protein LOC100792577 [Glycine max]
Length=280

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR I+E IC +  ++  ++ N    ++ ILKV N+ KT A FEEYRE+VK  A KL KKH
Sbjct  63   SRQIIETICGSGTSSIINSENMLGQIDCILKVLNVPKTFACFEEYREKVKDNADKLQKKH  122

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTT+ C+LG N SSSLCT + C +C+ILR GF+  KE +G +GV+T
Sbjct  123  PRCVADGNELLRFHGTTIACSLGTN-SSSLCTLDYCGICQILRNGFSTNKEFHGALGVYT  181

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV-  452
             STS +A E+I   +   +   RK++IVCRVIAG++H PL   EE    S FDSLA K+ 
Sbjct  182  TSTSGKAFESISIMTSHERPFPRKSVIVCRVIAGKIHSPL---EEERVDSEFDSLAEKIN  238

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
            G  S+ EEL++L+P+ALLPCFVVI K
Sbjct  239  GHSSDAEELYVLNPKALLPCFVVIYK  264



>ref|XP_004485667.1| PREDICTED: uncharacterized protein LOC101513827 [Cicer arietinum]
Length=379

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 144/206 (70%), Gaps = 10/206 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKK-  812
            SR IVE IC +  ++ S   +    ++ ILKVHNM K+   FEEYRE +KIK++KL  K 
Sbjct  182  SRQIVETICGSGTSSVSSELSQ---IDCILKVHNMSKSFTCFEEYREMIKIKSNKLHHKN  238

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            H RC+ DGNELLRFHGT++ C+LG N S SLCT + C VC+ILR GF+  KE  G +GV+
Sbjct  239  HPRCMVDGNELLRFHGTSIACSLGTNSSYSLCTLDYCGVCQILRHGFSTNKEFQGALGVY  298

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T STS +A ++I    C  +   RK++IVCRVIAGRVH P E   +    SGFDSLA K+
Sbjct  299  TTSTSGKAFDSIR--LCDERPFTRKSVIVCRVIAGRVHCPFEEKVD----SGFDSLAEKI  352

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
              +S++EEL+LL+P+ALLPCFVVI K
Sbjct  353  SNHSDIEELYLLNPKALLPCFVVIYK  378



>ref|XP_002892647.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68906.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K   T   N +  ILK+ ++Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  158  SRTTVELICNTGFSHKLGKTKG-NNISAILKIQSLQRVVAEFEDYRELVKIRANKLSKKH  216

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGT++ C  G +N SS+LC S++C VC ILR GF+ K   +G  GV 
Sbjct  217  SRCMADGNEFLGFHGTSLSCAHGLSNSSSNLCFSDQCGVCHILRHGFSPKTRPDGIKGVL  276

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TAS+SS AL+ IE     N+G+  KA+++CRVIAGRVH+P++  E+  G S FDSLA KV
Sbjct  277  TASSSSAALKTIETDQGRNRGSL-KAVVLCRVIAGRVHKPMQKFEDPLGFSEFDSLALKV  335

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S +EEL+LL  +ALLPCFV+I K 
Sbjct  336  GPNSRIEELYLLSNKALLPCFVIIFKP  362



>ref|XP_010476073.1| PREDICTED: uncharacterized protein LOC104755399 [Camelina sativa]
 ref|XP_010476074.1| PREDICTED: uncharacterized protein LOC104755399 [Camelina sativa]
 ref|XP_010476075.1| PREDICTED: uncharacterized protein LOC104755399 [Camelina sativa]
 ref|XP_010476076.1| PREDICTED: uncharacterized protein LOC104755399 [Camelina sativa]
Length=362

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K   T   N +  ILK+ N+Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  157  SRTTVELICNTGYSHKHGKTKG-NNISAILKIQNLQRVVAEFEDYREVVKIRANKLSKKH  215

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS-LCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGTT+ C LG+++SSS LC S++C VC ILR GF+ K   +G  GV 
Sbjct  216  SRCMADGNEFLGFHGTTLSCTLGSSNSSSNLCFSDQCGVCHILRHGFSAKTRPDGIKGVL  275

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTS+ ALE IE +       + KA+++CRVIAGRVH+P+   E+ +G S FDSLA K+
Sbjct  276  TASTSTTALECIEITDQRRNIGSLKAVVLCRVIAGRVHKPMHKFEDPSGFSDFDSLALKM  335

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S +EE FLL  +ALLPCFV+I K 
Sbjct  336  GPNSRIEEFFLLSTKALLPCFVIIFKP  362



>ref|XP_003593384.1| hypothetical protein MTR_2g010860 [Medicago truncatula]
 gb|AES63635.1| C2H2-like zinc finger protein [Medicago truncatula]
Length=378

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 142/208 (68%), Gaps = 11/208 (5%)
 Frame = -2

Query  988  SRNIVEMICR--TSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLA-  818
            SR IVE IC   TS+ +      +C     ILKVHNM KT   FEEYRE VKI A+KL  
Sbjct  177  SRKIVETICESGTSFISSELWQIDC-----ILKVHNMPKTFQCFEEYREMVKINANKLQI  231

Query  817  KKHARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVG  638
            K HARCL DGNELL FHGT + C+LG N S SLCT + C VC+ILR GF+  KE  G +G
Sbjct  232  KNHARCLVDGNELLMFHGTNIACSLGINGSYSLCTLDYCGVCQILRHGFSTNKEFQGALG  291

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
            V+T+STS +A ++I  S    +   RKA+I+CRVIAGRVH P E ++E    SGFDS A 
Sbjct  292  VYTSSTSGKAFDSIMLSD--ERAFTRKAVIMCRVIAGRVHCPFEEIQEKI-DSGFDSFAE  348

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICK  374
            K+  +SN+EEL LL+P+ALLPCFVVI K
Sbjct  349  KISDHSNIEELCLLNPKALLPCFVVIYK  376



>ref|XP_010492899.1| PREDICTED: uncharacterized protein LOC104770204 [Camelina sativa]
 ref|XP_010492909.1| PREDICTED: uncharacterized protein LOC104770204 [Camelina sativa]
 ref|XP_010492916.1| PREDICTED: uncharacterized protein LOC104770204 [Camelina sativa]
Length=364

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K   T   N +  ILK+ N+Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  157  SRTTVELICSTGYSHKLGKTKG-NNISAILKIQNLQRVVAEFEDYRELVKIRANKLSKKH  215

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS-LCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGTT+ C LG+++SSS LC S++C VC ILR GF+ K   +G  GV 
Sbjct  216  SRCMADGNEFLGFHGTTLSCALGSSNSSSNLCFSDQCGVCHILRHGFSAKTSPDGIKGVL  275

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTSSRALE IE +       + KA+++CRVIAGRVH+P++  E+ +G S FDSLA K+
Sbjct  276  TASTSSRALECIEITDQRMNIGSLKAVVLCRVIAGRVHKPMQKFEDPSGFSEFDSLALKM  335

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S  EE FL   +ALLPCFV+I K 
Sbjct  336  GPNSRTEEFFLSSTKALLPCFVIIFKP  362



>gb|KHN33614.1| hypothetical protein glysoja_005656 [Glycine soja]
Length=398

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR I+E IC +  ++  ++ N    ++ ILKV N+ KT A FEEYRE+VK  A KL KKH
Sbjct  181  SRQIIETICGSGTSSIINSENMLGQIDCILKVLNVPKTFACFEEYREKVKDNADKLQKKH  240

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFHGTT+ C+LG N SSSLCT + C +C+ILR GF+  KE +G +GV+T
Sbjct  241  PRCVADGNELLRFHGTTIACSLGTN-SSSLCTLDYCGICQILRNGFSTNKEFHGALGVYT  299

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV-  452
             STS +A E+I   +   +   RK++IVCRVIAG++H PL   EE    S FDSLA K+ 
Sbjct  300  TSTSGKAFESISIMTSHERPFPRKSVIVCRVIAGKIHSPL---EEERVDSEFDSLAEKIN  356

Query  451  GIYSNVEELFLLDPRALLPCFVVICK  374
            G  S+ EEL++L+P+ALLPCFVVI K
Sbjct  357  GHSSDAEELYVLNPKALLPCFVVIYK  382



>ref|XP_002437461.1| hypothetical protein SORBIDRAFT_10g027550 [Sorghum bicolor]
 gb|EER88828.1| hypothetical protein SORBIDRAFT_10g027550 [Sorghum bicolor]
Length=432

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 19/215 (9%)
 Frame = -2

Query  979  IVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAK--KHA  806
            +VE+I    W       +    +ER++KVH++++ +  F+EY E VK +A+KL    KH 
Sbjct  225  VVELIYSAGWPNPEAALDR---VERVVKVHSLERRVDRFKEYMEEVKGRAAKLPNNNKHP  281

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFTA  626
            RC+ADGNELL+FHGTTV C+LGA  S S+CTS  CNVCRI+R GF+     NGGVGVFT 
Sbjct  282  RCVADGNELLQFHGTTVSCSLGAGGSHSVCTSSLCNVCRIIRHGFS----RNGGVGVFTT  337

Query  625  STSSRALEAIEESSCAN---------QGAARKALIVCRVIAGRVHRPLENV-EELAGQSG  476
            STS  AL+ ++E+  A           G  + AL VCRVIAGR+HRPLE + ++ A Q G
Sbjct  338  STSKHALDCLQETGAAGGGTGEDGPADGGVKHALFVCRVIAGRIHRPLEKLRQDAAVQPG  397

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            FDS+AG+VG  S++EEL+LL+P ALLPCFVVICKA
Sbjct  398  FDSVAGQVGGDSSIEELYLLNPSALLPCFVVICKA  432



>ref|XP_006306543.1| hypothetical protein CARUB_v10012610mg [Capsella rubella]
 gb|EOA39441.1| hypothetical protein CARUB_v10012610mg [Capsella rubella]
Length=364

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K   T   N +  ILK+ N+Q+ +A FE+YRE VKI+A+KL+KKH
Sbjct  158  SRTTVELICNTGYSHKLGKTKG-NNILAILKIQNLQRVVAGFEDYRELVKIRANKLSKKH  216

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS--LCTSEKCNVCRILRRGFAIKKEINGGVGV  635
            +RC+ADGNE L FHGT++ C LG +D+SS  LC S++C VC ILR GF  K   +G  GV
Sbjct  217  SRCMADGNEFLGFHGTSLSCALGLSDNSSSNLCFSDQCGVCHILRHGFIPKTRPDGIKGV  276

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGK  455
             TASTSS AL  IE         + KA+++CRVIAGRVH+P+   E+  G S FDSLA K
Sbjct  277  LTASTSSTALGCIENMDQRMNRGSLKAVVLCRVIAGRVHKPMHKFEDPCGFSEFDSLALK  336

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
            +G  S +EE FLL  +ALLPCFV+I K 
Sbjct  337  MGPNSRIEEFFLLSTKALLPCFVIIFKP  364



>ref|XP_010668146.1| PREDICTED: uncharacterized protein LOC104885139 [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 150/216 (69%), Gaps = 15/216 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKL--AK  815
            SR ++EMI +  W     N  N   ++RILKVHN Q  +A+FEEYRE VKI+A+KL  +K
Sbjct  194  SRKVIEMIFKAGWT----NFENRGRIDRILKVHNPQTKVAQFEEYREMVKIRANKLQHSK  249

Query  814  KHARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGV-G  638
            KH R LADGNELLRF+GTT+ C+LG   SSSLCT + CN+C ILR GF+ ++ IN  + G
Sbjct  250  KHPRLLADGNELLRFYGTTIACSLGKKGSSSLCTLQICNICCILRHGFSTQEGINHSILG  309

Query  637  VFTASTSSRALEAIE---ESSCANQGAARKALIVCRVIAGRVHRPL-ENVEELAG--QSG  476
            +FT STS RA  +I+   E +  +    RK LIVCRVIAGRVHRP+ E++ +  G  +SG
Sbjct  310  IFTTSTSERAYRSIDMGVEETENHSKVFRKGLIVCRVIAGRVHRPMVEHIPDFVGGRRSG  369

Query  475  FDSLAGKV--GIYSNVEELFLLDPRALLPCFVVICK  374
            FDSLAG +     S VEEL++L   ALLPCFV+ICK
Sbjct  370  FDSLAGNLESNNSSLVEELYVLKSTALLPCFVIICK  405



>gb|AES63636.2| C2H2-like zinc finger protein [Medicago truncatula]
Length=368

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 142/214 (66%), Gaps = 14/214 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IV +IC       S        ++ ILKVHNM KTLA FEEYRE VKI A+KL   H
Sbjct  147  SRQIVGIICGNGTNLVSSELRQ---IDCILKVHNMPKTLACFEEYREIVKINANKLHVNH  203

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEIN-------  650
             RCLADGNELL FHGT + C+LG N+S SLC  + C VC+ILR GF+   E         
Sbjct  204  PRCLADGNELLMFHGTNIACSLGINNSFSLCDLDYCGVCQILRHGFSTNMEFQGAQGRNG  263

Query  649  --GGVGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG  476
              G +GV+T S S +A E+I    C ++   RK++IVCRVIAGRV  PLE ++E    SG
Sbjct  264  PEGALGVYTTSISGKAFESIIR-LCDDEAFTRKSVIVCRVIAGRVLCPLEEIQENV-DSG  321

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            FDSLAG++ +YS++EEL+LL+P+ALLPCFVVI K
Sbjct  322  FDSLAGRISVYSDIEELYLLNPKALLPCFVVIYK  355



>ref|XP_010458547.1| PREDICTED: uncharacterized protein LOC104739790 [Camelina sativa]
 ref|XP_010458548.1| PREDICTED: uncharacterized protein LOC104739790 [Camelina sativa]
Length=362

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 145/207 (70%), Gaps = 2/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC    + K   T   N +  ILK+ N+Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  157  SRTTVELICNIGHSHKLGKTKGSN-ISAILKIKNLQRVVAEFEDYRELVKIRANKLSKKH  215

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSS-LCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGTT+ C LG+++SSS LC S++C VC ILR GF+ K   +G  GV 
Sbjct  216  SRCMADGNEFLGFHGTTLSCALGSSNSSSNLCFSDQCGVCHILRHGFSAKTRPDGIKGVL  275

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTSS  LE IE +       + KA+++CRVIAGRVH+P++  E+  G S FDSLA K+
Sbjct  276  TASTSSTDLECIEITDQRTNIGSLKAVVLCRVIAGRVHKPMQKFEDPCGFSEFDSLALKI  335

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G  S +EE FLL  +ALLPCFV+I K 
Sbjct  336  GPNSKIEEFFLLSTKALLPCFVIIFKP  362



>ref|XP_003593385.1| hypothetical protein MTR_2g010870 [Medicago truncatula]
Length=450

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 142/214 (66%), Gaps = 14/214 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR IV +IC       S        ++ ILKVHNM KTLA FEEYRE VKI A+KL   H
Sbjct  229  SRQIVGIICGNGTNLVSSELRQ---IDCILKVHNMPKTLACFEEYREIVKINANKLHVNH  285

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEIN-------  650
             RCLADGNELL FHGT + C+LG N+S SLC  + C VC+ILR GF+   E         
Sbjct  286  PRCLADGNELLMFHGTNIACSLGINNSFSLCDLDYCGVCQILRHGFSTNMEFQGAQGRNG  345

Query  649  --GGVGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG  476
              G +GV+T S S +A E+I    C ++   RK++IVCRVIAGRV  PLE ++E    SG
Sbjct  346  PEGALGVYTTSISGKAFESIIR-LCDDEAFTRKSVIVCRVIAGRVLCPLEEIQENV-DSG  403

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            FDSLAG++ +YS++EEL+LL+P+ALLPCFVVI K
Sbjct  404  FDSLAGRISVYSDIEELYLLNPKALLPCFVVIYK  437



>gb|KHN09177.1| hypothetical protein glysoja_025638 [Glycine soja]
Length=293

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 144/204 (71%), Gaps = 13/204 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL+KKH
Sbjct  98   SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLSKKH  154

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF   K   GG G+ 
Sbjct  155  PRCIADGNELLRFHCTSFNCSLGLNGSSNLCNSIPQCNVCSIIKHGF---KVTGGGAGIL  211

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A    ++++C ++   ++A++VCRVIAGRV +   N+ E  G   +DS+A  V
Sbjct  212  TTATSGKAH---DKAACVDESEEKRAMLVCRVIAGRVKK---NIAEGGGMEEYDSVAAAV  265

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G YSN++EL + +PRA+LPCFVVI
Sbjct  266  GAYSNLDELVVSNPRAILPCFVVI  289



>gb|KDO80746.1| hypothetical protein CISIN_1g014111mg [Citrus sinensis]
Length=430

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 150/208 (72%), Gaps = 18/208 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN Q+T+A+FEEYR+ +K KA+KL KKH
Sbjct  232  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQRTIAKFEEYRDSIKAKATKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S  +CNVC I++ GF + +E N G+   
Sbjct  289  PRCIADGNELLRFHCTTFTCSLGLNGSSNLCNSIPQCNVCSIIKNGFKVTQETNKGLRGN  348

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSL  464
            G+ T +TS +A     + +    G+  +A++VCRVIAGRV + +E N+EE      +DS+
Sbjct  349  GILTTATSGKA----HDKAGVEDGSDARAMLVCRVIAGRVKKSMEGNLEE------YDSV  398

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            AG +G+YSN++EL++ +P+A+LPCFVVI
Sbjct  399  AGAMGMYSNLDELYVFNPKAILPCFVVI  426



>ref|XP_006434130.1| hypothetical protein CICLE_v10001224mg [Citrus clementina]
 gb|ESR47370.1| hypothetical protein CICLE_v10001224mg [Citrus clementina]
Length=430

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 150/208 (72%), Gaps = 18/208 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN Q+T+A+FEEYR+ +K KA+KL KKH
Sbjct  232  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQRTIAKFEEYRDSIKAKATKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S  +CNVC I++ GF + +E N G+   
Sbjct  289  PRCIADGNELLRFHCTTFTCSLGLNGSSNLCNSIPQCNVCSIIKNGFKVTQETNKGLRGN  348

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSL  464
            G+ T +TS +A     + +    G+  +A++VCRVIAGRV + +E N+EE      +DS+
Sbjct  349  GILTTATSGKA----HDKAGVEDGSDARAMLVCRVIAGRVKKSMEGNLEE------YDSV  398

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            AG +G+YSN++EL++ +P+A+LPCFVVI
Sbjct  399  AGAMGMYSNLDELYVFNPKAILPCFVVI  426



>ref|XP_006472721.1| PREDICTED: uncharacterized protein LOC102614418 [Citrus sinensis]
Length=430

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 18/208 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN Q+T+A+FEEYR+ +K KA+KL KKH
Sbjct  232  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQRTIAKFEEYRDSIKAKATKLPKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S  +CNVC I++ GF + +E N G+   
Sbjct  289  PRCIADGNELLRFHCTTFTCSLGLNGSSNLCNSIPQCNVCSIIKNGFKVTQETNKGLRGN  348

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSL  464
            G+ T +TS +A     + +    G+  +A++VCRVIAGRV + +E N+EE      +DS+
Sbjct  349  GILTTATSGKA----HDKAGVEDGSDARAMLVCRVIAGRVKKSMEGNLEE------YDSV  398

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            AG +G+YSN++EL + +P+A+LPCFVVI
Sbjct  399  AGAMGMYSNLDELHVFNPKAILPCFVVI  426



>ref|XP_003526611.1| PREDICTED: uncharacterized protein LOC100814186 [Glycine max]
Length=423

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 144/204 (71%), Gaps = 13/204 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL+KKH
Sbjct  228  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLSKKH  284

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF +     GG G+ 
Sbjct  285  PRCIADGNELLRFHCTSFNCSLGLNGSSNLCNSIPQCNVCSIIKHGFKV---TGGGAGIL  341

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A    ++++C ++   ++A++VCRVIAGRV +   N+ E  G   +DS+A  V
Sbjct  342  TTATSGKAH---DKAACVDESEEKRAMLVCRVIAGRVKK---NIAEGGGMEEYDSVAAAV  395

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G YSN++EL + +PRA+LPCFVVI
Sbjct  396  GAYSNLDELVVSNPRAILPCFVVI  419



>ref|XP_007137371.1| hypothetical protein PHAVU_009G121700g [Phaseolus vulgaris]
 gb|ESW09365.1| hypothetical protein PHAVU_009G121700g [Phaseolus vulgaris]
Length=424

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 140/204 (69%), Gaps = 17/204 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+  FEEYR+ +K KA+KL KKH
Sbjct  233  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITRFEEYRDSIKAKATKLPKKH  289

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF    ++ GG G+ 
Sbjct  290  PRCIADGNELLRFHCTSFACSLGLNGSSNLCNSIPQCNVCSIIKHGF----KVTGGTGIL  345

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A     + +C ++   ++A++VCRVIAGRV +  E      G   +DS+AG V
Sbjct  346  TTATSGKA----HDKACVDEIEEKRAMLVCRVIAGRVKKNAE-----GGMEEYDSVAGAV  396

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G YSN++EL + +PRA+LPCFVVI
Sbjct  397  GAYSNLDELVVFNPRAILPCFVVI  420



>ref|XP_008465804.1| PREDICTED: uncharacterized protein LOC103503399 [Cucumis melo]
Length=427

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 146/207 (71%), Gaps = 14/207 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  +ERILKV N  KT+++FEEYR+ +K KA+KL KK+
Sbjct  227  SKNIVEIIFQSSWLKK--QTPICK-IERILKVQNTPKTISKFEEYRDSIKAKATKLPKKY  283

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEING---GV  641
             RC+ADGNELLRFH TT+ C+LG N SS+LC+S  +CNVC I++ GF +  E  G   G 
Sbjct  284  PRCIADGNELLRFHCTTLNCSLGFNGSSNLCSSIPQCNVCSIIKNGFKVAAEATGGDSGK  343

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
            G+ T +TS +A +++  SS  + G  ++A++VCRVIAGRV +  E   E      +DSLA
Sbjct  344  GILTTATSGKAHDSVGVSS--DGGDDKRAMLVCRVIAGRVKKSPEGSME-----DYDSLA  396

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVI  380
            G  G+YSN++EL++  P+A+LPCFVVI
Sbjct  397  GAAGMYSNLDELYVFSPKAILPCFVVI  423



>ref|XP_004140330.1| PREDICTED: uncharacterized protein LOC101220433 [Cucumis sativus]
 ref|XP_004161649.1| PREDICTED: uncharacterized protein LOC101227125 [Cucumis sativus]
 gb|KGN50968.1| hypothetical protein Csa_5G375760 [Cucumis sativus]
Length=427

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 146/207 (71%), Gaps = 14/207 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  +ERILKV N  KT+++FEEYR+ +K KA+KL KK+
Sbjct  227  SKNIVEIIFQSSWLKK--QTPICK-IERILKVQNTPKTISKFEEYRDSIKAKATKLPKKY  283

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEING---GV  641
             RC+ADGNELLRFH TT+ C+LG N SS+LC+S  +CNVC I++ GF +  E  G   G 
Sbjct  284  PRCIADGNELLRFHCTTLNCSLGFNGSSNLCSSIPQCNVCSIIKNGFKMAAEATGGDAGK  343

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
            G+ T +TS +A +++  SS  + G  ++A++VCRVIAGRV +  E   E      +DSLA
Sbjct  344  GILTTATSGKAHDSVGVSS--DGGNNKRAMLVCRVIAGRVKKSSEGSME-----DYDSLA  396

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVI  380
            G  G+YSN++EL++  P+A+LPCFVVI
Sbjct  397  GAAGMYSNLDELYVFSPKAILPCFVVI  423



>ref|XP_007148292.1| hypothetical protein PHAVU_006G196000g [Phaseolus vulgaris]
 gb|ESW20286.1| hypothetical protein PHAVU_006G196000g [Phaseolus vulgaris]
Length=391

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 145/207 (70%), Gaps = 11/207 (5%)
 Frame = -2

Query  988  SRNIVEMIC--RTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAK  815
            SR I+E IC  R+ ++        C     ILKV NM KT A FEEYRE+VK KA KL K
Sbjct  176  SRQIIETICGTRSVYSESMLGEIGC-----ILKVLNMPKTFACFEEYREKVKEKAEKLKK  230

Query  814  KHARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGV  635
            KH RC+ADGNELLRFHGTT+ C+LG N S +LCT E C +C+ILR GF+  KE  G +GV
Sbjct  231  KHPRCVADGNELLRFHGTTIACSLGINSSYTLCTLEYCGICQILRHGFSSNKEFKGALGV  290

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGK  455
            +T STS +A E+I   +   +  +RK++IVCRVIAGR++ PLE VEE    S FDSLA K
Sbjct  291  YTTSTSGKAFESISIMTSHERPFSRKSIIVCRVIAGRIYSPLEGVEERC-DSEFDSLAEK  349

Query  454  VGIYSNVEELFLLDPRALLPCFVVICK  374
            +   ++VEEL++L+PRALLPCFVVI K
Sbjct  350  I---NDVEELYVLNPRALLPCFVVIYK  373



>ref|XP_008233905.1| PREDICTED: uncharacterized protein LOC103332917 [Prunus mume]
Length=441

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 149/209 (71%), Gaps = 15/209 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+++FEEYRE +K KA+KL KKH
Sbjct  238  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQKTISKFEEYRESIKAKATKLPKKH  294

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CN+C I++ GF    + +G +   
Sbjct  295  PRCIADGNELLRFHSTTFVCSLGLNGSSNLCNSIPHCNICSIIKNGF---NKFSGDLIED  351

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELA--GQSGFDS  467
            G+ T +TS RA    +++  A + + ++A++VCRVIAGRV + +E+   +   G   +DS
Sbjct  352  GILTTATSGRAH---DKAVVAAEDSGKRAMLVCRVIAGRVKKNMEDGIGIGPIGMEEYDS  408

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  409  VAGAVGVYSNLDELYVFNPKAILPCFVVI  437



>ref|XP_010692561.1| PREDICTED: uncharacterized protein LOC104905404 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 142/204 (70%), Gaps = 11/204 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+ +FEEYR+ +K KA++L KKH
Sbjct  244  SKNIVEIIFQSSWLKK--QTPVCQ-IDRILKVHNTQKTINKFEEYRDSIKFKATRLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
            ARC+ADGNELLRFH ++  C+LG + SS+LC S   CNVC I++ GF +  E   G G+ 
Sbjct  301  ARCIADGNELLRFHCSSFMCSLGLDGSSNLCNSIPNCNVCSIIKNGFKLADEGPAGKGIL  360

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA    +++    +   R+A++VCRVIAGRV +  E      G   +DS+AG  
Sbjct  361  TTATSGRAH---DQADVGVEEHDRRAMLVCRVIAGRVKKSPEG----GGAEEYDSVAGAT  413

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G+YSN++EL++ +P+A+LPCFVVI
Sbjct  414  GVYSNLDELYVFNPKAILPCFVVI  437



>ref|XP_007018982.1| C2H2-like zinc finger protein [Theobroma cacao]
 gb|EOY16207.1| C2H2-like zinc finger protein [Theobroma cacao]
Length=441

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 147/210 (70%), Gaps = 20/210 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN  KT+++FEEYR+ +K KA+KL KKH
Sbjct  241  SKNIVEIIFQSSWLKK--QTPICQ-IDRILKVHNTSKTISKFEEYRDSIKSKATKLPKKH  297

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LCTS   CNVC I++ GF + +E++GG    
Sbjct  298  PRCIADGNELLRFHCTTFACSLGLNGSSNLCTSIPNCNVCSIIKNGFKVAQELSGGSNGK  357

Query  640  GVFTASTSSRALE---AIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFD  470
            G+ T +TS +A +    +EE      G  ++A++VCRVIAGRV + +E   E       D
Sbjct  358  GILTTATSGKAHDMAAGVEEI-----GNDKRAMLVCRVIAGRVKKSMEGSME-----DCD  407

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            S+A  VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  408  SVASAVGVYSNLDELYVFNPKAILPCFVVI  437



>ref|XP_007224337.1| hypothetical protein PRUPE_ppa020634mg [Prunus persica]
 gb|EMJ25536.1| hypothetical protein PRUPE_ppa020634mg [Prunus persica]
Length=436

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 148/209 (71%), Gaps = 15/209 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+++FEEYRE +K KA+KL KKH
Sbjct  233  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQKTISKFEEYRESIKAKATKLPKKH  289

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CN+C I++ GF    + +G +   
Sbjct  290  PRCIADGNELLRFHSTTFVCSLGLNGSSNLCNSIPHCNICSIIKNGF---NKFSGDLIED  346

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELA--GQSGFDS  467
            G+ T +TS RA    +++  A +   ++A++VCRVIAGRV + +E+   +   G   +DS
Sbjct  347  GILTTATSGRAH---DKAVVAAEDNGKRAMLVCRVIAGRVKKNMEDSIGIGPIGMEEYDS  403

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  404  VAGAVGVYSNLDELYVFNPKAILPCFVVI  432



>ref|XP_009148487.1| PREDICTED: uncharacterized protein LOC103871909 [Brassica rapa]
Length=358

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC   ++ K   T   N +  ILKV N+Q+ +AEFE+YRE VKI+A+KL+KKH
Sbjct  147  SRTTVELICNRGYSHKLGKTKGSN-VSAILKVQNLQRVVAEFEKYRELVKIRATKLSKKH  205

Query  808  ARCLADGNELLRFHGTTVEC---NLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVG  638
            +RC+ADGNE L FHGTT+ C       + SS+LC S++C VC+ILR GFA K   +G  G
Sbjct  206  SRCVADGNEFLGFHGTTLSCSLGLSSNSGSSNLCFSDQCGVCQILRHGFASKTRQDGIKG  265

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
            V TAS    ALE IE     ++G   KA+++CRVIAGRVH+P++  E+  G S FDSLA 
Sbjct  266  VLTASACYAALEGIEMERGRSRGGV-KAVVLCRVIAGRVHKPMKKFEDPNGFSEFDSLAL  324

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA*N  365
            KVG  + +EEL+LL  +ALLPCFV+I K  N
Sbjct  325  KVGPNAILEELYLLRTKALLPCFVIIFKPRN  355



>emb|CDY49785.1| BnaCnng17980D [Brassica napus]
Length=358

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC   ++ K   T  CN +  ILKV N+Q+ +AEFE YRE VKI+A+KL+KKH
Sbjct  147  SRTTVELICNRGYSDKLGKTKGCN-VSAILKVQNLQRVVAEFENYRELVKIRATKLSKKH  205

Query  808  ARCLADGNELLRFHGTTVEC---NLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVG  638
            +RC+ADGNE L FHGTT+ C       + SS+LC S++C VC+ILR GFA K   +G  G
Sbjct  206  SRCVADGNEFLGFHGTTLSCSLGLSSNSGSSNLCFSDQCGVCKILRHGFASKTRQDGIKG  265

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAG  458
            V TAS  S ALE IE     ++GA R A+++CRVIAGRVH+P++  E+    S F SLA 
Sbjct  266  VLTASACSAALEGIEMERGRSRGALR-AVVLCRVIAGRVHKPMKKFEDPNVFSEFGSLAL  324

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICKA*N  365
            KVG  + +EEL+LL  +ALLPCFV++ K  N
Sbjct  325  KVGPNAILEELYLLSTKALLPCFVIVFKPRN  355



>gb|ACU18642.1| unknown [Glycine max]
Length=426

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 143/206 (69%), Gaps = 18/206 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL+KKH
Sbjct  232  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLSKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF    ++ GG G+ 
Sbjct  289  PRCIADGNELLRFHCTSFNCSLGLNGSSNLCNSIPQCNVCSIIKHGF----KVTGGAGIL  344

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS--LAG  458
            T +TS +A    ++++C  +   ++A++VCRVIAGRV +  E      G   +DS  +AG
Sbjct  345  TTATSGKAH---DKAACVEESEEKRAMLVCRVIAGRVKKNAE-----GGMEEYDSVAVAG  396

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
             VG YSN++EL + +P+A+LPCFVVI
Sbjct  397  AVGAYSNLDELLVFNPKAILPCFVVI  422



>ref|XP_003523462.1| PREDICTED: uncharacterized protein LOC100817333 [Glycine max]
Length=426

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 143/206 (69%), Gaps = 18/206 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL+KKH
Sbjct  232  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLSKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF    ++ GG G+ 
Sbjct  289  PRCIADGNELLRFHCTSFNCSLGLNGSSNLCNSIPQCNVCSIIKHGF----KVTGGAGIL  344

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS--LAG  458
            T +TS +A    ++++C  +   ++A++VCRVIAGRV +  E      G   +DS  +AG
Sbjct  345  TTATSGKAH---DKAACVEESEEKRAMLVCRVIAGRVKKNAE-----GGMEEYDSVAVAG  396

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
             VG YSN++EL + +P+A+LPCFVVI
Sbjct  397  AVGAYSNLDELLVFNPKAILPCFVVI  422



>gb|KHN47051.1| hypothetical protein glysoja_018418 [Glycine soja]
Length=426

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 143/206 (69%), Gaps = 18/206 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL+KKH
Sbjct  232  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLSKKH  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T+  C+LG N SS+LC S  +CNVC I++ GF    ++ GG G+ 
Sbjct  289  PRCIADGNELLRFHCTSFNCSLGLNGSSNLCNSIPQCNVCSIIKHGF----KVTGGAGIL  344

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDS--LAG  458
            T +TS +A    ++++C  +   ++A++VCRVIAGRV +  E      G   +DS  +AG
Sbjct  345  TTATSGKAH---DKAACVEESEEKRAMLVCRVIAGRVKKNAE-----GGMEEYDSVAVAG  396

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
             VG YSN++EL + +P+A+LPCFVVI
Sbjct  397  AVGAYSNLDELLVFNPKAILPCFVVI  422



>ref|XP_009415763.1| PREDICTED: uncharacterized protein LOC103996567 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=393

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 146/207 (71%), Gaps = 20/207 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K   T  C  ++RILKVHN  +TL  FE+YR+ +KIKASKLA+KH
Sbjct  206  SRNIVEIIFQSSWLKK--QTPVCK-IDRILKVHNTNRTLTRFEDYRDSIKIKASKLARKH  262

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRFH TT  C++G + +++LC S  KC++C I+R GF I  + +G +G  
Sbjct  263  PRCTADGNELLRFHCTTFMCSIGLDGATNLCNSIPKCSLCSIVRDGFKI--DSHGRIG--  318

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA +A      A+  + + A++VCRVIAGRV R  +++EE      +DS AG  
Sbjct  319  TMATSGRAHDA------ADNVSDKTAMLVCRVIAGRVKRKQDDLEE------YDSAAGMA  366

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            GIYSN++ELF+ DP+A+LPCFVVI ++
Sbjct  367  GIYSNLDELFVFDPKAILPCFVVIYRS  393



>ref|XP_010547020.1| PREDICTED: uncharacterized protein LOC104818915 [Tarenaya hassleriana]
Length=365

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 134/207 (65%), Gaps = 3/207 (1%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR +VE+IC    +  SD T     +  ILK+HNMQKT+AEFE YRE +KI++S+L KKH
Sbjct  161  SRQVVELICNIGSSIISDKTRA--NIMAILKLHNMQKTIAEFENYRETIKIRSSRLPKKH  218

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILR-RGFAIKKEINGGVGVF  632
             RCLADGNE L FHGTT+ C+LG N   +        +  IL   GF+ K   +G  GV 
Sbjct  219  PRCLADGNEFLGFHGTTLACSLGLNHKKNNIFFTIIEINHILDLHGFSSKTRTDGVNGVL  278

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
              S S  ALE IE           +AL++CRVIAGRVH+PL+  E+ +G S FDS+A K+
Sbjct  279  VTSMSVSALECIEMDRSGRSRRIVRALVLCRVIAGRVHKPLKRFEQFSGYSAFDSVAAKM  338

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G+ S++EEL+LL  +ALLPCFV+I K+
Sbjct  339  GLNSSIEELYLLSTKALLPCFVIIFKS  365



>ref|XP_006847058.1| hypothetical protein AMTR_s00017p00197580 [Amborella trichopoda]
 gb|ERN08639.1| hypothetical protein AMTR_s00017p00197580 [Amborella trichopoda]
Length=359

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 147/217 (68%), Gaps = 26/217 (12%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  +   T  C  ++RILKVHN QKT+  FE+YR+ VK KA+KL KKH
Sbjct  150  SRNIVEIIFQSSWLKE---TPVCK-IDRILKVHNSQKTINRFEDYRDTVKSKANKLPKKH  205

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF  TT  C++G N SSSLC S  CNVC I++ GF + K      G+ T
Sbjct  206  PRCIADGNELLRFFCTTFSCSIGTNGSSSLCNS-VCNVCNIIKNGFKVDKN----EGIIT  260

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEE--------LAGQS--  479
             ++S +A +++E    A +   R+A++VCRVIAGRV +  E  E+        ++GQ   
Sbjct  261  TASSGKAHDSMETELGAGE---RRAMLVCRVIAGRVKKNQEATEDGFCGGFDSVSGQGGL  317

Query  478  ----GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
                GFDS+AG+ G+YS+++ELF+ +PRA+LPCFVVI
Sbjct  318  YSSLGFDSVAGQAGLYSSLDELFVFNPRAILPCFVVI  354



>ref|XP_009367352.1| PREDICTED: uncharacterized protein LOC103957012 [Pyrus x bretschneideri]
Length=443

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 147/213 (69%), Gaps = 23/213 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL KKH
Sbjct  240  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQKTITKFEEYRDAIKAKATKLPKKH  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF    + +G +   
Sbjct  297  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSIPHCNVCSIIKNGF---NKFSGELTEQ  353

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE------NVEELAGQS  479
            G+ T +TS RA    +++  A +   ++A++VCRVIAGRV + LE      NV    G  
Sbjct  354  GILTTATSGRAH---DKAVVAAEEGDKRAMLVCRVIAGRVKKSLEGSVGNGNV----GME  406

Query  478  GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
             +DS+AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  407  EYDSVAGAVGVYSNLDELYVFNPKAILPCFVVI  439



>emb|CDX97964.1| BnaA06g07150D [Brassica napus]
Length=359

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 144/212 (68%), Gaps = 6/212 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC   ++ K   T   N +  ILKV N+Q+ +AEFE YRE VKI+A+KL+KKH
Sbjct  147  SRTTVELICNRGYSHKLGKTKGSN-VSAILKVQNLQRVVAEFENYRELVKIRATKLSKKH  205

Query  808  ARCLADGNELLRFHGTTVEC----NLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGV  641
            +RC+ADGNE L FHGTT+ C    +  +  SS+LC S++C VC+ILR GFA +   +G  
Sbjct  206  SRCVADGNEFLGFHGTTLSCSLGLSSNSGSSSNLCFSDQCGVCQILRHGFASETGQDGIK  265

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
            GV TAS    ALE IE     ++G   KA+++CRVIAGRVH+P++  E+  G S FDSLA
Sbjct  266  GVLTASACYAALEGIEMERGRSRGGV-KAVVLCRVIAGRVHKPMKKFEDPNGFSEFDSLA  324

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA*N  365
             KVG  + +EEL+LL  +ALLPCFV+I K  N
Sbjct  325  LKVGPNAILEELYLLRTKALLPCFVIIFKPRN  356



>gb|KDP32761.1| hypothetical protein JCGZ_12053 [Jatropha curcas]
Length=442

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 150/210 (71%), Gaps = 19/210 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN Q+T+ +FEEYR+ +K KA+KL KKH
Sbjct  241  SKNIVEIIFQSSWLKKEAPI--CQ-IDRILKVHNTQRTITKFEEYRDSIKAKANKLQKKH  297

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRF+ T+  C+LG N SS+LC S   CNVC I++ GF  K+   GGV   
Sbjct  298  PRCIADGNELLRFYCTSFACSLGLNGSSNLCNSIPHCNVCSIIKNGF--KESTTGGVHGH  355

Query  640  GVFTASTSSRALE--AIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFD  470
            G+ T +TS +A +  A+ E S  N  + ++A++VCRVIAGRV + +E N+EE      +D
Sbjct  356  GILTTATSGKAHDKAALLEDSNGNN-SDKRAMLVCRVIAGRVKKSMEGNMEE------YD  408

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            S+AG +G+YSN++EL++ +P+A+LPCFVVI
Sbjct  409  SVAGAMGVYSNLDELYVFNPKAILPCFVVI  438



>ref|XP_009341672.1| PREDICTED: uncharacterized protein LOC103933706 [Pyrus x bretschneideri]
Length=448

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 147/213 (69%), Gaps = 23/213 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL KKH
Sbjct  245  SKNIVEIIFQSSWLKK--QTPICK-IDRILKVHNTQKTITKFEEYRDSIKAKATKLPKKH  301

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF    + +G +   
Sbjct  302  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSIPHCNVCSIIKNGF---NKFSGELTEQ  358

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE------NVEELAGQS  479
            G+ T +TS RA    +++  A +   ++A++VCRVIAGRV + LE      NV    G  
Sbjct  359  GILTTATSGRAH---DKAVVAAEEGDKRAMLVCRVIAGRVKKSLEGSVGNGNV----GME  411

Query  478  GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
             +DS+AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  412  EYDSVAGAVGVYSNLDELYVFNPKAILPCFVVI  444



>ref|XP_004500590.1| PREDICTED: uncharacterized protein LOC101506200 [Cicer arietinum]
Length=445

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 143/213 (67%), Gaps = 19/213 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+ L+KKH
Sbjct  238  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVHNTQKTITKFEEYRDSIKAKATNLSKKH  294

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N SS+LC S  +CNVC I++ GF    ++NGG G+ 
Sbjct  295  PRCIADGNELLRFHCTTFMCSLGLNGSSNLCNSTPQCNVCSIIKHGF----KMNGGDGIL  350

Query  631  TASTSSRALEAIEE----SSCANQ----GAARKALIVCRVIAGRVHRPLENVEELAGQSG  476
            T +TS +A +          C N     G  ++A++VCRVIAGRV +   N+E   G   
Sbjct  351  TTATSGKAHDKATSVLVCGGCDNNNNESGDEKRAMLVCRVIAGRVKK--NNMEGGGGMEE  408

Query  475  FDSLAGK-VGIYSNVEELFLLDPRALLPCFVVI  380
             DS+AG  VG YSN++EL++ +PRA+LPCFVVI
Sbjct  409  CDSVAGDVVGAYSNLDELYVYNPRAILPCFVVI  441



>ref|XP_006580848.1| PREDICTED: uncharacterized protein LOC102660699 [Glycine max]
Length=362

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 136/200 (68%), Gaps = 9/200 (5%)
 Frame = -2

Query  979  IVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHARC  800
            I++ IC+ +      +   C     +L+V N Q+T A FEE R  V+ KA +L  +H RC
Sbjct  169  IIQQICKDNLIESKASQIEC-----VLRVQNKQETFACFEESRGMVRTKAERLQNEHPRC  223

Query  799  LADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFTAST  620
            + DGNELLRFHGTT+ C+LG N SS+LCT E+C VC+ILR GF+  KE +G +GV+T ST
Sbjct  224  MVDGNELLRFHGTTIACSLGLNGSSTLCTLEQCGVCQILRHGFSANKEFHGALGVYTTST  283

Query  619  SSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVGIYS  440
            S +A+++I  S   N+   R  +++CRVIAGR+H PL+ ++E+  +  FDSL  K+   S
Sbjct  284  SEKAIDSICSS---NKSVRRMCVMLCRVIAGRIHNPLQEIKEMV-EPEFDSLVKKMSDQS  339

Query  439  NVEELFLLDPRALLPCFVVI  380
             +EEL +L+PRA+LPCF+V+
Sbjct  340  EIEELIVLNPRAVLPCFLVM  359



>ref|XP_006351923.1| PREDICTED: uncharacterized protein LOC102601509 [Solanum tuberosum]
Length=411

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 139/214 (65%), Gaps = 11/214 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K   T  C  ++RILK+HN   T++ FEEYRE +K+KA+ L KKH
Sbjct  200  SRNIVEIIFQSSWLNKK--TPVCK-IDRILKIHNTPTTISRFEEYREAIKVKATNLVKKH  256

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGV--GV  635
             RC+ADGNELLRFH TT  C+LG N SS+LCT   CNVC +++ GF +    + G   G+
Sbjct  257  PRCIADGNELLRFHCTTFMCSLGLNGSSNLCTVPNCNVCALIKNGFKLATTTHHGTKKGI  316

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG------F  473
             T +TS +A +         +   ++A++VCRVIAGRV + L+        +       +
Sbjct  317  LTTATSGKAHDNARVVVEEEEEEEKRAMLVCRVIAGRVKKTLDGNNNNNNNNNSNNLEEY  376

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DS+ G  G+YSN++EL++ +P+A+LPCFVVI K+
Sbjct  377  DSIGGAAGLYSNLDELYVFNPKAILPCFVVIYKS  410



>ref|XP_002513814.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF48397.1| nucleic acid binding protein, putative [Ricinus communis]
Length=441

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 151/211 (72%), Gaps = 21/211 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN Q+T+++FEEYR+ +K KA+KL KK+
Sbjct  240  SKNIVEIIFQSSWLKKQAPV--CQ-IDRILKVHNTQRTISKFEEYRDSIKAKATKLPKKY  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRF+ T+  C+LG N S++LC S   CNVC I++ GF   KE + GV   
Sbjct  297  PRCIADGNELLRFYCTSFTCSLGLNGSNNLCNSIPHCNVCSIIKSGF---KESSTGVVNG  353

Query  640  -GVFTASTSSRALE--AIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGF  473
             G+ T +TS +A +  AI E   ++  + R+A++VCRVIAGRV + +E N+EE      +
Sbjct  354  NGILTTATSGKAHDEAAISEDK-SDGNSERRAMLVCRVIAGRVKKSMEGNMEE------Y  406

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            DS+AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  407  DSVAGAVGVYSNLDELYVFNPKAILPCFVVI  437



>ref|XP_008338788.1| PREDICTED: uncharacterized protein LOC103401854 [Malus domestica]
Length=449

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 15/209 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN Q T+ +FEEYR+ +K KA+KL KKH
Sbjct  246  SKNIVEIIFQSSWLKKE--TPICK-IDRILKVHNTQNTITKFEEYRDSIKAKATKLPKKH  302

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF         +G+ 
Sbjct  303  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSIPHCNVCSIIKNGFNKFSGELTELGIL  362

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-----FDS  467
            T +TS RA    +++  A +   ++A++VCRVIAGRV +   NVE   G        +DS
Sbjct  363  TTATSGRAH---DKAVVAAEEGDKRAMLVCRVIAGRVKK---NVEGSVGNGNVGMEEYDS  416

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  417  VAGAVGVYSNLDELYVFNPKAILPCFVVI  445



>ref|XP_008361552.1| PREDICTED: uncharacterized protein LOC103425243 [Malus domestica]
Length=449

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 15/209 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN Q T+ +FEEYR+ +K KA+KL KKH
Sbjct  246  SKNIVEIIFQSSWLKKE--TPICK-IDRILKVHNTQNTITKFEEYRDSIKAKATKLPKKH  302

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF         +G+ 
Sbjct  303  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSIPHCNVCSIIKNGFNKFSGELTELGIL  362

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-----FDS  467
            T +TS RA    +++  A +   ++A++VCRVIAGRV +   NVE   G        +DS
Sbjct  363  TTATSGRAH---DKAVVAAEEGDKRAMLVCRVIAGRVKK---NVEGSVGNGNVGMEEYDS  416

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  417  VAGAVGVYSNLDELYVFNPKAILPCFVVI  445



>ref|XP_009790722.1| PREDICTED: uncharacterized protein LOC104238136 [Nicotiana sylvestris]
Length=413

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 140/208 (67%), Gaps = 11/208 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K   T  C  ++RILK+ N  +T++ FEEYR+ +K KA+ L KKH
Sbjct  214  SRNIVEIIFQSSWLNKK--TPVCK-IDRILKIRNTPRTISRFEEYRDGIKAKATNLPKKH  270

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRFH TT  C+LG N SS+LCT   CN+C I++ GF +        G+ T
Sbjct  271  PRCIADGNELLRFHCTTFMCSLGLNGSSNLCTVPNCNICTIIKNGFKLATTDGTKKGILT  330

Query  628  ASTSSRALEAIE-ESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSLAGK  455
             +TS +A ++        +    ++A++VCRVIAGRV + L+ N+EE      +DS+AG 
Sbjct  331  TATSGKAHDSTRVVPDDDDDDNDKRAMLVCRVIAGRVKKNLDGNLEE------YDSIAGA  384

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
             G+YSN++EL++ +P+A+LPCFVVI K 
Sbjct  385  AGVYSNLDELYVFNPKAILPCFVVIYKG  412



>ref|XP_010091348.1| hypothetical protein L484_020150 [Morus notabilis]
 gb|EXB44338.1| hypothetical protein L484_020150 [Morus notabilis]
Length=430

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 141/204 (69%), Gaps = 14/204 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN QKT+ +FEEYR+ +K KA+KL KK+
Sbjct  236  SKNIVEIIFQSSWLKKQAPV--CK-IDRILKVHNTQKTITKFEEYRDAIKAKATKLPKKN  292

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH  T+ C+LG   SS+LC S   CN+C I++ GF +  E  GG G+ 
Sbjct  293  PRCVADGNELLRFHCATLRCSLGLKGSSNLCNSGPTCNICSIIKNGFRVAGEPTGG-GIL  351

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A + +     A +  AR A++VCRVIAGRV + +E   E      +DS+AG V
Sbjct  352  TTATSGKAHDGV---GGAGEDEAR-AMLVCRVIAGRVKKSMEGALE-----EYDSVAGAV  402

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G+YSN++EL++ + RA+LPCFVVI
Sbjct  403  GVYSNLDELYVFNARAILPCFVVI  426



>ref|XP_004290833.1| PREDICTED: uncharacterized protein LOC101294815 [Fragaria vesca 
subsp. vesca]
Length=443

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 15/211 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLA---  818
            S+NIVE+I ++SW  K      C  ++RILKVHN QKT+++FEEYR+ +K KA+KL    
Sbjct  236  SKNIVEIIFQSSWLKKQAPI--CK-IDRILKVHNTQKTISKFEEYRDSIKAKATKLQLPN  292

Query  817  KKHARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGG  644
            KKH RC+ADGNELLRFH TT +C+LG N SS+LC S   CNVC I++ GF + + E+ G 
Sbjct  293  KKHPRCIADGNELLRFHCTTFDCSLGLNGSSNLCNSIPSCNVCSIIKNGFKVDRSELAGS  352

Query  643  VGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG---F  473
              + T +TS RA +  E +  A  G  R+A++VCRVIAGRV +  +      G  G   +
Sbjct  353  SEILTTATSGRAHDMAEVA--AEDG--RRAMLVCRVIAGRVKKNADGQGGGGGGGGVEEY  408

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            DS+AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  409  DSVAGAVGVYSNLDELYVFNPKAILPCFVVI  439



>gb|KHN46084.1| hypothetical protein glysoja_030085 [Glycine soja]
Length=417

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = -2

Query  979  IVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHARC  800
            I++ IC+ +      +   C     +L+V N Q+T A FEE R  V+ KA +L  +H RC
Sbjct  169  IIQQICKDNLIESKASQIEC-----VLRVQNKQETFACFEESRGMVRTKAERLQNEHPRC  223

Query  799  LADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFTAST  620
            + DGNELLRFHGTT+ C+LG N SS+LCT E+C VC+ILR GF+  KE +G +GV+T ST
Sbjct  224  MVDGNELLRFHGTTIACSLGLNGSSTLCTLEQCGVCQILRHGFSANKEFHGALGVYTTST  283

Query  619  SSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVGIYS  440
            S +A+++I  S   N+   R  +++CRVIAGR+H PL+ ++E+  +  FDSL  K+   S
Sbjct  284  SEKAIDSICSS---NKSVRRMCVMLCRVIAGRIHNPLQEIKEMV-EPEFDSLVKKMSDQS  339

Query  439  NVEELFLLDPRALLPCFV  386
             +EEL +L+PRA+LPCF+
Sbjct  340  EIEELIVLNPRAVLPCFL  357



>ref|XP_010930890.1| PREDICTED: uncharacterized protein LOC105051938 [Elaeis guineensis]
Length=393

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 143/204 (70%), Gaps = 18/204 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIV++I ++SW  K      C  ++RILKVH+ QKT+AEFE YR+ +K +A+K+AKKH
Sbjct  203  SRNIVDIIFQSSWLKKEPPM--CK-IDRILKVHSTQKTIAEFENYRDSIKSRANKVAKKH  259

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N S++LC S  +C+VC I+R GF    +I+    + 
Sbjct  260  PRCIADGNELLRFHCTTFACSLGLNGSTNLCQSVPQCHVCSIIRNGF----KIDSLGKIQ  315

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA +  + +S      A++A++VCRVIAGRV +  + +EE       DS+A + 
Sbjct  316  TMATSGRAHDMAQIAS----DDAKRAMLVCRVIAGRVKKSQDALEEC------DSVANQA  365

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            GIYSN++ELF+ DP+A+LPCFVV+
Sbjct  366  GIYSNLDELFVFDPKAILPCFVVV  389



>ref|XP_003601091.1| hypothetical protein MTR_3g072920 [Medicago truncatula]
 gb|AES71342.1| nucleic acid-binding protein [Medicago truncatula]
Length=452

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 144/208 (69%), Gaps = 14/208 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKV N QKT+ +FEEYR+ +K KA+ L+KKH
Sbjct  250  SKNIVEIIFHSSWLKKQSPV--CK-IDRILKVQNTQKTITKFEEYRDSIKAKATNLSKKH  306

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N SS+LC S  +CNVC I++ GF    ++NGG G+ 
Sbjct  307  PRCIADGNELLRFHCTTFVCSLGLNGSSNLCNSTSQCNVCGIIKHGF----KLNGGDGIL  362

Query  631  TASTSSRALE---AIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSL-  464
            T +TS +A +   ++ + S    G  ++A++VCRVIAGRV + +E    +  +  +DS+ 
Sbjct  363  TTATSGKAHDKASSVLDVSGCESGDEKRAMLVCRVIAGRVKKNMEGGSNVMEE--YDSVS  420

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            AG  G YSN++EL++ +PRA+LPCFVVI
Sbjct  421  AGDAGAYSNLDELYVNNPRAILPCFVVI  448



>emb|CBI19068.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 139/204 (68%), Gaps = 7/204 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN  KT+++FEEYR+ +K KA+KL KKH
Sbjct  102  SKNIVEIIFQSSWLKKQAPV--CK-IDRILKVHNTPKTISKFEEYRDSIKTKATKLQKKH  158

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C++G N SS+LC S   C++C I++ GF +   + G  G+ 
Sbjct  159  PRCVADGNELLRFHCTTFVCSIGLNGSSNLCNSIPSCSICSIIKNGFKVAGGVPGK-GIL  217

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A ++   S        ++A++VCRVIAGRV +    +E       FDS+AG  
Sbjct  218  TTATSGKAHDSSRMS--LPDDNEKRAMLVCRVIAGRVKKSATQLEGGVCTEEFDSVAGVG  275

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G+YSN++EL++ +P+A+LPCFVVI
Sbjct  276  GVYSNLDELYVSNPKAILPCFVVI  299



>ref|XP_011012508.1| PREDICTED: uncharacterized protein LOC105116747 [Populus euphratica]
Length=436

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 144/207 (70%), Gaps = 14/207 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN Q+T+++FEEYR+ +K KA+KL KK 
Sbjct  236  SKNIVEIIFQSSWLKKQAPV--CK-IDRILKVHNTQRTISKFEEYRDSIKAKATKLPKKQ  292

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGF--AIKKEINGGVG  638
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF  +  ++ NG  G
Sbjct  293  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSVPNCNVCSIIKNGFKESTTRDDNGR-G  351

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSLA  461
            + T +TS +A +    S   N  + R+A++VCRVIAGRV + +E N E+      +DS+A
Sbjct  352  ILTTATSGKAHDKATISEDGNGESERRAMLVCRVIAGRVKKSMEGNAED------YDSVA  405

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVI  380
              + +YSN++EL++ +PRA+LPCFVVI
Sbjct  406  TGMEVYSNLDELYVSNPRAILPCFVVI  432



>ref|XP_002306613.2| hypothetical protein POPTR_0005s16070g [Populus trichocarpa]
 gb|EEE93609.2| hypothetical protein POPTR_0005s16070g [Populus trichocarpa]
Length=444

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 145/207 (70%), Gaps = 14/207 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K  +   C  ++RILKVHN Q+T+++FEEYR+ +K KA+KL KK 
Sbjct  237  SKNIVEIIFQSSWLKKQASI--CK-IDRILKVHNTQRTISKFEEYRDSIKAKATKLPKKQ  293

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGF--AIKKEINGGVG  638
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF  +  ++ NG  G
Sbjct  294  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSVPHCNVCSIIKNGFKESTTRDDNGH-G  352

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSLA  461
            + T +TS +A +    S   N  + ++A++VCRVIAGRV + +E N E+      +DS+A
Sbjct  353  ILTTATSGKAHDKATISEDGNGDSEKRAMLVCRVIAGRVKKSMEGNAED------YDSVA  406

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVI  380
              + +YSN++EL++ +PRA+LPCFVVI
Sbjct  407  TGMEVYSNLDELYVSNPRAILPCFVVI  433



>ref|XP_002974384.1| hypothetical protein SELMODRAFT_15610, partial [Selaginella moellendorffii]
 gb|EFJ24606.1| hypothetical protein SELMODRAFT_15610, partial [Selaginella moellendorffii]
Length=217

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 138/207 (67%), Gaps = 8/207 (4%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDN--TNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAK  815
            S+NIVE+I RTSW  K D         +ER+LKV+N  +T++ FEEYR+ VK +AS L K
Sbjct  14   SKNIVEIIFRTSWLKKRDEGIPEASPKIERVLKVNNTHRTISRFEEYRDAVKSRASSLPK  73

Query  814  KHARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGV  635
            KHARC+ADGNELLRFH  T+EC+LGA+ SSS+C S  C+ CRI++ GF           +
Sbjct  74   KHARCIADGNELLRFHAATLECSLGAHGSSSICASPACSACRIIKSGFRGSGGGG--SMI  131

Query  634  FTASTSSRALEAIE--ESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
             T +TS RA ++++  E    +      A++VCRVIAGR+H+      +    SGFDS+A
Sbjct  132  HTTATSGRAHDSLQTKERLDLSDEDDLHAMLVCRVIAGRMHKGFGG--DAVVPSGFDSIA  189

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVI  380
            G++G +SNV++L++   RA+LPCFVV+
Sbjct  190  GEMGPFSNVDDLYVTSSRAVLPCFVVV  216



>ref|XP_004250566.1| PREDICTED: uncharacterized protein LOC101254557 [Solanum lycopersicum]
Length=403

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 140/214 (65%), Gaps = 11/214 (5%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K   T  C  ++RILK+HN   T++ FEEYRE +K+KA+ L KKH
Sbjct  192  SRNIVEIIFQSSWLNKK--TPVCK-IDRILKIHNTPTTISRFEEYREAIKVKATNLVKKH  248

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV--G  638
             RC+ADGNELLRFH TT  C+LG N SS+LCTS   CNVC +++ GF +      G   G
Sbjct  249  PRCIADGNELLRFHCTTFMCSLGLNGSSNLCTSIPNCNVCNLIKNGFKLSTTTQHGTKKG  308

Query  637  VFTASTSSRALE-AIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG----F  473
            + T +TS +A + A        +   ++A++VCRVIAGRV + L+        S     +
Sbjct  309  ILTTATSGKAHDNARVVEEEMVEEEEKRAMLVCRVIAGRVKKNLDGNNNNNNNSNNLEEY  368

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DS+ G  G+YSN++EL++ +P+A+LPCFVVI K+
Sbjct  369  DSIGGAAGLYSNLDELYVFNPKAILPCFVVIYKS  402



>ref|XP_009587911.1| PREDICTED: uncharacterized protein LOC104085555 isoform X1 [Nicotiana 
tomentosiformis]
Length=402

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 139/207 (67%), Gaps = 12/207 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K   T  C  ++RILK+ N   T++ FEEYR+ +K KA+ L KKH
Sbjct  206  SRNIVEIIFQSSWLNKK--TPVCK-IDRILKIRNTPTTISRFEEYRDGIKSKATNLPKKH  262

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
             RC+ADGNELLRF  TT  C+LG N SS+LCT   CNVC I++ GF +        G+ T
Sbjct  263  PRCIADGNELLRFLCTTFICSLGLNGSSNLCTLPNCNVCTIIKNGFKLATTDGTKKGILT  322

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSLAGKV  452
             +TS +A ++    S  +    ++A++VCRVIAGRV + L+ N+EE      +DS+AG  
Sbjct  323  TATSGKAHDSTRVVS--HDDNDKRAMLVCRVIAGRVKKTLDGNLEE------YDSIAGAA  374

Query  451  GIYSNVEELFLLDPRALLPCFVVICKA  371
            G+YSN++EL++ +P+A+LPCFVVI K 
Sbjct  375  GVYSNLDELYVFNPKAILPCFVVIYKG  401



>ref|XP_009366983.1| PREDICTED: uncharacterized protein LOC103956687 [Pyrus x bretschneideri]
Length=447

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 147/215 (68%), Gaps = 27/215 (13%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVH+ Q T+ +FEEYR+ +K KA+KL KKH
Sbjct  244  SKNIVEIIFQSSWLKKE--TPICK-IDRILKVHSTQNTITKFEEYRDSIKAKATKLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF    + +G +   
Sbjct  301  PRCIADGNELLRFHCTTFACSLGLNGSSNLCNSIPHCNVCSIIKNGF---NKFSGELTEQ  357

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE--------NVEELAG  485
            G+ T +TS RA    +++  A +   ++A++VCRVIAGRV + +E        ++EE   
Sbjct  358  GILTTATSGRAH---DKAVVAAEEGDKRAMLVCRVIAGRVKKTVEGSVGNGNVSMEE---  411

Query  484  QSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
               +DS+AG VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  412  ---YDSVAGAVGVYSNLDELYVFNPKAILPCFVVI  443



>gb|EYU22924.1| hypothetical protein MIMGU_mgv1a006553mg [Erythranthe guttata]
Length=439

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 139/205 (68%), Gaps = 15/205 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKV N  KT+++FEEYR+ +K KA+KL KKH
Sbjct  244  SKNIVEIIFQSSWLKKQAPV--CK-IDRILKVQNTPKTISKFEEYRDAIKAKATKLPKKH  300

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RCLADGNELLRFH TT+ C+LG N SS+LC S   C+VC I++ GF +        G+ 
Sbjct  301  PRCLADGNELLRFHCTTLVCSLGLNGSSNLCNSIPNCSVCSIVKNGFKVVTSEVSAKGIL  360

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-PLENVEELAGQSGFDSLAGK  455
            T +TS +A     +S        ++A++VCRVIAGRV + P  N E+      +DS+AG 
Sbjct  361  TTATSGKA----HDSCGVGLDDGKRAMLVCRVIAGRVKKNPDVNSED------YDSVAGA  410

Query  454  VGIYSNVEELFLLDPRALLPCFVVI  380
            VG+YSN++EL++ +P+A+LPCFVVI
Sbjct  411  VGVYSNLDELYVFNPKAILPCFVVI  435



>ref|XP_009383565.1| PREDICTED: uncharacterized protein LOC103971297 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 138/204 (68%), Gaps = 18/204 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNI+E+I ++SW    + T  C  +ERILKVHN QK +A FE+YR+ +K KA+KL KKH
Sbjct  194  SRNIIEIIFQSSWL--KNQTPVCK-IERILKVHNTQKAIARFEDYRDSIKAKANKLTKKH  250

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEK-CNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH  T  C+LG N S++LC S K CNVC I+R GF ++++      + 
Sbjct  251  PRCVADGNELLRFHCATFACSLGINGSTNLCQSIKHCNVCSIIRDGFKVEEQGR----IQ  306

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA +    SS       ++A++VCRVIAGRV +  + VEE      FDS+AG  
Sbjct  307  TMATSGRAHDMARISS----DHEKRAMLVCRVIAGRVKKNQDAVEE------FDSMAGPA  356

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
              YSN+++LF+ +P A+LPCFVVI
Sbjct  357  VTYSNLDQLFVFNPNAILPCFVVI  380



>ref|XP_002284394.3| PREDICTED: uncharacterized protein LOC100257501 [Vitis vinifera]
Length=489

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 139/204 (68%), Gaps = 7/204 (3%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN  KT+++FEEYR+ +K KA+KL KKH
Sbjct  288  SKNIVEIIFQSSWLKKQAPV--CK-IDRILKVHNTPKTISKFEEYRDSIKTKATKLQKKH  344

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C++G N SS+LC S   C++C I++ GF +   + G  G+ 
Sbjct  345  PRCVADGNELLRFHCTTFVCSIGLNGSSNLCNSIPSCSICSIIKNGFKVAGGVPGK-GIL  403

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A ++   S        ++A++VCRVIAGRV +    +E       FDS+AG  
Sbjct  404  TTATSGKAHDSSRMS--LPDDNEKRAMLVCRVIAGRVKKSATQLEGGVCTEEFDSVAGVG  461

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            G+YSN++EL++ +P+A+LPCFVVI
Sbjct  462  GVYSNLDELYVSNPKAILPCFVVI  485



>ref|XP_002276294.1| PREDICTED: uncharacterized protein LOC100250572 [Vitis vinifera]
Length=419

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 136/208 (65%), Gaps = 14/208 (7%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FEE R+ VK++A+   KK+ 
Sbjct  221  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEECRDAVKVRANNNTKKNP  277

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C LG+  SSSLC S   C VC I+R GF  K       GV T
Sbjct  278  RCAADGNELLRFHCTTLTCALGSRGSSSLCGSVPGCGVCTIIRHGFQGK--AGEAKGVRT  335

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG--FDSLAGK  455
              +S RA + +    C +    R+A++VCRVIAGRV R  ++  +  G S   +DS+AG 
Sbjct  336  TDSSGRAHDCLP---CTD---GRRAMLVCRVIAGRVKRMADDAPDEDGASAGSYDSVAGY  389

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
             GIYSN+E+LF+ +PRA+LPCFVVI KA
Sbjct  390  SGIYSNLEDLFVFNPRAILPCFVVIYKA  417



>ref|XP_006435171.1| hypothetical protein CICLE_v10001255mg [Citrus clementina]
 gb|ESR48411.1| hypothetical protein CICLE_v10001255mg [Citrus clementina]
Length=426

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  +  N+  C  +ERILKVHN Q+T+  FE+ R+ VK +A    +K+
Sbjct  228  SRNIVEIIFKSSWLKQ--NSPMCK-IERILKVHNTQRTIQRFEDCRDAVKTRALNSTRKN  284

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRFH TT+ CNLG+  SS+LC S   C+VC I+R GF  K+      GV 
Sbjct  285  PRCAADGNELLRFHCTTLSCNLGSRGSSTLCGSVPGCSVCTIIRHGFQGKE----CKGVR  340

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQSGFDSLA  461
            T ++S RA ++++  +C ++   R+A++VCRVIAGRV R  ++    E+      +DS+A
Sbjct  341  TTASSGRAHDSLK--NCTDE---RRAMLVCRVIAGRVRRVTDDAPSEEDSVSGGSYDSVA  395

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            G  G+YSN+EELF+ +PRA+LPCFVVI K+
Sbjct  396  GYTGVYSNLEELFVFNPRAILPCFVVIYKS  425



>ref|XP_010104443.1| hypothetical protein L484_016042 [Morus notabilis]
 gb|EXC00976.1| hypothetical protein L484_016042 [Morus notabilis]
Length=419

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 140/213 (66%), Gaps = 19/213 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  214  RNIVEIIFKSSWLKKD---NPIFKIERILKVHNTQRTIQRFEDCRDAVKARALGSTRKNP  270

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEING-GVGVF  632
            RC ADGNELLRFH TT+ C LGA  +SSLC S   C VC I+R GF  K    G G GV+
Sbjct  271  RCAADGNELLRFHCTTLSCALGARGASSLCGSVPGCGVCTIIRHGFQGKNGGAGEGKGVW  330

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR------PLENVEELAGQSGFD  470
            T ++S RA ++++   C +    R+A++VCRVIAGRV R      P E+   LA  S +D
Sbjct  331  TTASSGRAHDSLK---CTD---GRRAMLVCRVIAGRVKRVADDAAPEEDSVSLA--SSYD  382

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AG  GIYSN+EEL + +PRA+LPCFVVI KA
Sbjct  383  SVAGYAGIYSNLEELTVFNPRAILPCFVVIYKA  415



>ref|XP_011027602.1| PREDICTED: uncharacterized protein LOC105127850 [Populus euphratica]
Length=425

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 140/209 (67%), Gaps = 18/209 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I  +SW  K      C  ++RILKVHN Q+T+++FEEYR+ +K KA+KL KK 
Sbjct  225  SKNIVEIIFHSSWLKKQAPI--CK-IDRILKVHNTQRTISKFEEYRDSIKAKATKLPKKQ  281

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C++G N SSSLC S   C VC I++ GF   K+  GG    
Sbjct  282  PRCIADGNELLRFHCTTFACSVGLNGSSSLCISVPNCKVCSIIKNGF---KDPTGGDDNG  338

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDS  467
             G+ T +TS +A +        N  + ++A++ CRVIAGRV + +E N+E+      +DS
Sbjct  339  HGILTTATSGKAHDKATTLEDGNGDSEKRAMLGCRVIAGRVKKSMEGNIED------YDS  392

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +A  + +YSN++EL++ +PRA+LPCFVVI
Sbjct  393  VAAGMEVYSNLDELYVFNPRAILPCFVVI  421



>ref|XP_009414851.1| PREDICTED: uncharacterized protein LOC103995858 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 142/206 (69%), Gaps = 19/206 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKA-SKLAKK  812
            SRNI+E+I ++SW    + T  C  ++RILKVHN  K +  FE+YR+ +K KA +KLAKK
Sbjct  205  SRNIIEIIFQSSWL--KNQTPVCK-IDRILKVHNTPKAITRFEDYRDSIKTKADNKLAKK  261

Query  811  HARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGV  635
            H RC+ADGNELLRFH TT+ C+LG N S++LC S E+C+VC I+R GF    +++    V
Sbjct  262  HPRCVADGNELLRFHCTTLACSLGFNGSTNLCQSMERCDVCSIIRDGF----KLDEAGKV  317

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLEN-VEELAGQSGFDSLAG  458
             T +TS RA +    SS   +   ++A++VCRVIAGRV +  ++ V+E      FDS+AG
Sbjct  318  QTMATSGRAHDMARVSSSDEE---KRAMLVCRVIAGRVKKKSQDAVDE------FDSVAG  368

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
              G YSN++ELF+  P+A+LPCFVVI
Sbjct  369  SAGTYSNIDELFVFSPKAILPCFVVI  394



>ref|XP_011074672.1| PREDICTED: uncharacterized protein LOC105159339 isoform X1 [Sesamum 
indicum]
Length=442

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 135/215 (63%), Gaps = 24/215 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKVHN ++T+  FE+YR+ VKI+A+  AK++
Sbjct  240  SRNIVEIIFKSSWLKKD---NPICKIERILKVHNTRRTIQRFEDYRDAVKIRANSSAKRN  296

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
            ARC ADGNELLRFH  T+ C+LGA  SSSLC S   C VC I+R GF   K      GV 
Sbjct  297  ARCAADGNELLRFHAATLTCSLGARGSSSLCGSIPACGVCTIIRHGFQGSKI----SGVR  352

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE--------NVEELAGQSG  476
            T ++S RA +      C      R+A++VCRVIAGRV R  E        N    AG   
Sbjct  353  TTASSGRAHD------CLGGSGTRRAMLVCRVIAGRVKRVAEDSAADEDGNAAPAAGS--  404

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +DSLA   G+YSN+EEL++   RA+LPCFVVI KA
Sbjct  405  YDSLASYAGVYSNLEELYVFSSRAILPCFVVIYKA  439



>ref|XP_011074673.1| PREDICTED: uncharacterized protein LOC105159339 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 135/215 (63%), Gaps = 24/215 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKVHN ++T+  FE+YR+ VKI+A+  AK++
Sbjct  234  SRNIVEIIFKSSWLKKD---NPICKIERILKVHNTRRTIQRFEDYRDAVKIRANSSAKRN  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
            ARC ADGNELLRFH  T+ C+LGA  SSSLC S   C VC I+R GF   K      GV 
Sbjct  291  ARCAADGNELLRFHAATLTCSLGARGSSSLCGSIPACGVCTIIRHGFQGSKI----SGVR  346

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE--------NVEELAGQSG  476
            T ++S RA +      C      R+A++VCRVIAGRV R  E        N    AG   
Sbjct  347  TTASSGRAHD------CLGGSGTRRAMLVCRVIAGRVKRVAEDSAADEDGNAAPAAGS--  398

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +DSLA   G+YSN+EEL++   RA+LPCFVVI KA
Sbjct  399  YDSLASYAGVYSNLEELYVFSSRAILPCFVVIYKA  433



>ref|XP_010272869.1| PREDICTED: uncharacterized protein LOC104608536 [Nelumbo nucifera]
Length=411

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 144/208 (69%), Gaps = 13/208 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K  +   C  ++RILKVHN QKT+  FE+YRE +K KASKLAKKH
Sbjct  208  SRNIVEIIFQSSWLKKQASV--CK-VDRILKVHNSQKTITRFEDYRESIKAKASKLAKKH  264

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C++G N SS+LC S  +CNVC I+R GF I    + G  + 
Sbjct  265  PRCVADGNELLRFHCTTFVCSIGMNGSSNLCNSIPQCNVCSIIRNGFKIPAG-DAGSAIC  323

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSG---FDSL  464
            T +TS +A     +++       ++A++VCRVIAGRV R  + N EE+  Q     FDS+
Sbjct  324  TTATSGKA----HDNAQIKTDDDKRAMLVCRVIAGRVKRTQDTNSEEIMNQKNSEEFDSV  379

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            AG  GIYSN++EL++ +P+A+LPCFVVI
Sbjct  380  AGPTGIYSNLDELYVFNPKAILPCFVVI  407



>ref|XP_006473648.1| PREDICTED: uncharacterized protein LOC102626182 [Citrus sinensis]
Length=407

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  +  ++  C  +ERILKVHN Q+T+  FE+ R+ VK +A    +K+
Sbjct  209  SRNIVEIIFKSSWLKQ--DSPMCK-IERILKVHNTQRTIQRFEDCRDAVKTRALNSTRKN  265

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRFH TT+ CNLG+  SS+LC S   C+VC I+R GF  K+      GV 
Sbjct  266  PRCAADGNELLRFHCTTLSCNLGSRGSSTLCGSVPGCSVCTIIRHGFQGKE----CKGVR  321

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQSGFDSLA  461
            T ++S RA ++++  +C ++   R+A++VCRVIAGRV R  ++    E+      +DS+A
Sbjct  322  TTASSGRAHDSLK--NCTDE---RRAMLVCRVIAGRVRRVTDDAPSEEDSVSGGSYDSVA  376

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            G  G+YSN+EELF+ +PRA+LPCFVVI K+
Sbjct  377  GYTGVYSNLEELFVFNPRAILPCFVVIYKS  406



>ref|XP_009389508.1| PREDICTED: uncharacterized protein LOC103976050 [Musa acuminata 
subsp. malaccensis]
Length=394

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 138/208 (66%), Gaps = 20/208 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNI+E+I ++SW    + T  C  ++RILKVHN QK +  FE+YR+ +K+KA+KL KKH
Sbjct  204  SRNIIEIIFQSSWL--KNQTPVCK-IDRILKVHNTQKAITRFEDYRDSIKMKANKLGKKH  260

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEK-CNVCRILRRGFAIKKEINGGVG-V  635
             RC+ADGNELLRF+ TT  C+LG + S+SLC S K CNVC I+R GF + +     +G +
Sbjct  261  PRCVADGNELLRFYSTTCACSLGLHRSTSLCQSIKHCNVCSIIRDGFKVDE-----LGKI  315

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGK  455
             T +TS  A +    SS        +A++VCRVIAGRV +  E  EE      FDS+ G 
Sbjct  316  RTMATSGMAHDMAHASS----DDENRAMLVCRVIAGRVKKSQEAAEE------FDSVTGV  365

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
             G YSN++ELF+  P+A+LPCFVVI ++
Sbjct  366  AGAYSNMDELFVFSPKAILPCFVVIYRS  393



>gb|AAF16645.1|AC011661_23 T23J18.16 [Arabidopsis thaliana]
Length=679

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SR  VE+IC T ++ K       N +  I K+ N+Q+ +A+FE+YRE VKI+A+KL+KKH
Sbjct  161  SRTTVELICNTGYSHKLGKMKG-NNISAIFKIQNLQRVVADFEDYRELVKIRANKLSKKH  219

Query  808  ARCLADGNELLRFHGTTVECNLG-ANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVF  632
            +RC+ADGNE L FHGTT+ C LG +N SS+LC S+ C VC ILR GF+ K   +G  GV 
Sbjct  220  SRCMADGNEFLGFHGTTLSCTLGFSNSSSNLCFSDHCEVCHILRHGFSPKTRPDGIKGVL  279

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            TASTSS ALE+IE     N+G+   A+++CRVIAGRVH+P++  E   G S FDSLA KV
Sbjct  280  TASTSSTALESIETDQGRNRGSL-IAVVLCRVIAGRVHKPMQTFENSLGFSEFDSLALKV  338



>ref|XP_010695422.1| PREDICTED: uncharacterized protein LOC104908063 [Beta vulgaris 
subsp. vulgaris]
Length=440

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 140/216 (65%), Gaps = 26/216 (12%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK+KA+   KK+ 
Sbjct  235  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEDCRDMVKLKANNNTKKNP  291

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C+LGA  SS+LC S   C VC I+R GF       G  GV T
Sbjct  292  RCAADGNELLRFHCTTLTCSLGARGSSNLCGSVPGCGVCTIIRHGF------QGNKGVRT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPL------ENVEELAGQSG---  476
             ++S RA ++++   C +    R+A++VCRVIAGRV R        E +  L G SG   
Sbjct  346  TASSGRAHDSLD---CTD---GRRAMLVCRVIAGRVKRSANDAPAEEEILSLEGPSGGSA  399

Query  475  -FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
             +DS+AG  GIYSN+E+L +++P+A+LPCFVVI K 
Sbjct  400  AYDSVAGSAGIYSNLEDLAVINPKAILPCFVVIYKT  435



>ref|XP_008781482.1| PREDICTED: uncharacterized protein LOC103701262 [Phoenix dactylifera]
Length=396

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 19/205 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K      C  ++RILKV + QKT+AEFE YR+ +K +A+K+AKKH
Sbjct  205  SRNIVEIIFQSSWLKKEPPV--CK-IDRILKVRSTQKTIAEFEIYRDSIKSRANKVAKKH  261

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG + S++LC S  +CNVC I+R GF    +++    + 
Sbjct  262  PRCIADGNELLRFHCTTFACSLGLSGSTNLCQSAPQCNVCSIIRDGF----KMDSLGKIQ  317

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA +    +S    G A++A++VCRVIAGRV +  + +EE       DS+A + 
Sbjct  318  TMATSGRAHDMARIAS----GDAKRAMLVCRVIAGRVKKSQDALEEC------DSVANQA  367

Query  451  G-IYSNVEELFLLDPRALLPCFVVI  380
            G +YSN++ELF+ DP+A+LPCFVV+
Sbjct  368  GVVYSNLDELFVFDPKAILPCFVVV  392



>gb|EPS60213.1| hypothetical protein M569_14592, partial [Genlisea aurea]
Length=350

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 135/214 (63%), Gaps = 18/214 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKV N Q+T+  FE+YR+ VKI+A+  A+K 
Sbjct  144  SRNIVEIIFKSSWLMKD---NPICKIERILKVQNTQRTIQRFEDYRDAVKIRATARARKD  200

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCT-SEKCNVCRILRRGFAIKKEINGGVGVF  632
            ARC ADGNELLRF G ++ C LG+  S+SLC+    C VC I+R GF   K      G+ 
Sbjct  201  ARCAADGNELLRFRGASLACALGSRGSTSLCSGGASCGVCTIIRHGFQGSK----FAGIR  256

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-------F  473
            T ++S RA + +       +  AR+A++VCRVIAGRV R  E  E+   Q G       +
Sbjct  257  TTASSGRAHDCV---LVGGESEARRAMLVCRVIAGRVQRAAEGGEDEEQQDGGAAEGKNY  313

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DS+A   G+YSN+EELF+   RA+LPCFVVI K+
Sbjct  314  DSVASVAGVYSNLEELFVFSSRAILPCFVVIYKS  347



>emb|CDP07405.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 139/213 (65%), Gaps = 18/213 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKV N Q+T+  FE+ R+ VKI+A+  +KK+
Sbjct  203  SRNIVEIIFKSSWLKKD---NPICSIERILKVQNTQRTIQRFEDCRDAVKIRANSNSKKN  259

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRFH T++ C LGA  SSSLC S   C VC I+R GF    + N   GV 
Sbjct  260  PRCAADGNELLRFHCTSLTCPLGARGSSSLCGSVPGCGVCAIIRHGF----QGNKSSGVR  315

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQ---SGFD  470
            T ++S RA + +   +       R+A++VCRVIAGRV R  ++    E+ AG      +D
Sbjct  316  TTASSGRAHDCLGLGT----DGGRRAMLVCRVIAGRVKRMADDAAVEEDDAGTLAAGSYD  371

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AG  G+YSN+EEL++ +PRA+LPCFVVI KA
Sbjct  372  SVAGYAGVYSNLEELYVFNPRAILPCFVVIYKA  404



>ref|XP_010274362.1| PREDICTED: uncharacterized protein LOC104609687 [Nelumbo nucifera]
Length=402

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 141/204 (69%), Gaps = 13/204 (6%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K      C  ++RILKVHN QKT+  FE+YRE +K KASKLAKKH
Sbjct  207  SRNIVEIIFQSSWLKKQAAV--CK-IDRILKVHNSQKTITRFEDYRESIKAKASKLAKKH  263

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C++G N SS+LC S  +CN+C I+R GF +    + G G+ 
Sbjct  264  PRCVADGNELLRFHCTTFVCSIGMNGSSNLCNSIPQCNICNIIRNGFKVPTG-DAGAGIC  322

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS +A +  +  S  +    ++A++VCRVIAGRV R     ++      FDS+AG  
Sbjct  323  TTATSGKAHDNAQIKSEDD----KRAMLVCRVIAGRVKR----TQDTNPAEEFDSVAGPT  374

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            GIYSN++EL++ +P+A+LPCFVVI
Sbjct  375  GIYSNLDELYVFNPKAILPCFVVI  398



>ref|XP_007226467.1| hypothetical protein PRUPE_ppa1027229mg, partial [Prunus persica]
 gb|EMJ27666.1| hypothetical protein PRUPE_ppa1027229mg, partial [Prunus persica]
Length=291

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 139/213 (65%), Gaps = 17/213 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  +   C  +ERILKVHN Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  85   RNIVEIIFKSSWQKK--DIPICK-IERILKVHNTQRTIQRFEDCRDAVKNRALGTTRKNP  141

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH  ++ C LGA  SSSLC S   C VC I+R GF  K    GG GV T
Sbjct  142  RCAADGNELLRFHCASISCTLGARGSSSLCGSVPGCGVCTIIRHGFQGKAGGEGGKGVRT  201

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-----PLEN--VEELAGQSGFD  470
             ++S RA +++   SC +    R+A++VCRVIAGRV R     P E   +  L+    +D
Sbjct  202  TASSGRAHDSL---SCMD---GRRAMLVCRVIAGRVRRIADDAPTEEDALSSLSAPGSYD  255

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AG VGIYSN+EEL + +PRA+LPCFVVI KA
Sbjct  256  SVAGFVGIYSNLEELVVYNPRAILPCFVVIYKA  288



>emb|CDP12442.1| unnamed protein product [Coffea canephora]
Length=661

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 141/212 (67%), Gaps = 28/212 (13%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN  KT++ FEEYR+ +K KA+K  KKH
Sbjct  265  SKNIVEIIFQSSWLKK--QTPVCK-IDRILKVHNTSKTVSRFEEYRDSIKDKATKHTKKH  321

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEIN-----G  647
             RC+ADGNELLRFH TT  C+LG N SS+LC S   CNVC I++ GF +  E +      
Sbjct  322  PRCIADGNELLRFHCTTFMCSLGLNGSSNLCNSIPNCNVCSIIKNGFKVTGEFSLAGEVT  381

Query  646  GVGVFTASTSSRALE----AIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQ  482
            G  + T +TS +A +     +E+         ++A++VCRVIAGRV R LE ++EE    
Sbjct  382  GKAILTTATSGKAHDNARVVLEDD--------KRAMLVCRVIAGRVKRNLEGSLEE----  429

Query  481  SGFDSLAGKVGIYSNVEELFLLDPRALLPCFV  386
              +DS+AG  G+YSN++EL++ +P+A+LPCFV
Sbjct  430  --YDSVAGAAGVYSNLDELYVFNPKAILPCFV  459



>ref|XP_007160670.1| hypothetical protein PHAVU_001G007100g [Phaseolus vulgaris]
 gb|ESW32664.1| hypothetical protein PHAVU_001G007100g [Phaseolus vulgaris]
Length=408

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 134/211 (64%), Gaps = 15/211 (7%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FEE R+ VK +A    KK+ 
Sbjct  202  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEECRDTVKNRALSSTKKNP  258

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGG--VGV  635
            RC ADGNELLRFH TT+ C LGA  SSSLC S   C VC I+R GF      +     GV
Sbjct  259  RCAADGNELLRFHCTTLTCALGARGSSSLCASVPGCGVCTIIRHGFQGGGGGDHAKVKGV  318

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV----EELAGQSGFDS  467
             T ++S RA +++    C +    R+A++VCRVIAGRV R  E+     EE    + +DS
Sbjct  319  GTTASSGRAHDSV---VCGD--GTRRAMLVCRVIAGRVKRVAEDTPPSEEEHVSVASYDS  373

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  GIYSN+EEL + +P+A+LPCFVVI K
Sbjct  374  VAGYAGIYSNLEELVVFNPKAILPCFVVIYK  404



>ref|XP_010268701.1| PREDICTED: uncharacterized protein LOC104605577 [Nelumbo nucifera]
Length=410

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 136/208 (65%), Gaps = 17/208 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK + S   KK+ 
Sbjct  215  RNIVEIIFKSSWLKKD---NPLCKIERILKVHNTQRTIQRFEDCRDAVKARVSNNTKKNP  271

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C LGA  ++SLC S   C VC I+R GF  K  +  G GV T
Sbjct  272  RCAADGNELLRFHCTTLSCALGARGTTSLCGSIPGCGVCTIIRHGFPGK--VQEGKGVRT  329

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV--EELAGQSGFDSLAGK  455
             ++S RA +++           R+A++VCRVIAGRV R  ++V  EE   +  +DS+AG 
Sbjct  330  TASSGRAHDSL------GSVEGRRAMLVCRVIAGRVKRVADDVATEE---EGVYDSVAGY  380

Query  454  VGIYSNVEELFLLDPRALLPCFVVICKA  371
             G+Y+N+EEL + +PRA+LPCFVVI KA
Sbjct  381  AGVYTNLEELIVFNPRAILPCFVVIYKA  408



>gb|KHF97950.1| Ribosomal L11 methyltransferase [Gossypium arboreum]
Length=425

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 143/222 (64%), Gaps = 29/222 (13%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK +A    +K+A
Sbjct  213  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEDCRDAVKTRALNSTRKNA  269

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV----  641
            RC ADGNELLRFH TT+ C+LGA  SSSLC S   C VC I+++GF  K    GGV    
Sbjct  270  RCAADGNELLRFHCTTLSCSLGARGSSSLCGSIPGCGVCTIIKQGFQKK---GGGVAAAS  326

Query  640  ---GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR------PLE--NVEE  494
               GV T ++S RA ++++   C +    R+A++VCRVIAGRV R      P E  N   
Sbjct  327  EFKGVCTTASSGRAHDSLK---CTD---GRRAMLVCRVIAGRVKRVSEDAPPFEEDNSGG  380

Query  493  LAGQSG-FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +A  +G +DSLA   G+YSN+EEL + +PRA+LPCFVVI KA
Sbjct  381  VAAATGLYDSLAAYAGVYSNLEELVVFNPRAILPCFVVIYKA  422



>ref|XP_010063350.1| PREDICTED: uncharacterized protein LOC104450474 [Eucalyptus grandis]
 gb|KCW70562.1| hypothetical protein EUGRSUZ_F03752 [Eucalyptus grandis]
Length=427

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 139/205 (68%), Gaps = 20/205 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K   T  C  ++RILKVHN QKT+++FEEYR+ +K KA+K   K+
Sbjct  237  SKNIVEIIFQSSWLKK--QTPVCK-IDRILKVHNTQKTISKFEEYRDSIKAKATK---KN  290

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH T   C+LG + SS+LC S  +CNVC I+R GF + +E     G+ 
Sbjct  291  PRCIADGNELLRFHCTMFSCSLGLDGSSNLCNSIPQCNVCNIIRNGFKVGEE-----GIL  345

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDSLAGK  455
            T +TS RA +             R A++VCRVIAGRV + +E ++EE      +DS AG 
Sbjct  346  TTATSGRAHDNASLVMKTEDDETR-AMLVCRVIAGRVKKNMEGSMEE------YDSAAGA  398

Query  454  VGIYSNVEELFLLDPRALLPCFVVI  380
             G+YSN++EL++ +PRA+LPCFVVI
Sbjct  399  CGLYSNLDELYVFNPRAILPCFVVI  423



>ref|XP_009399179.1| PREDICTED: uncharacterized protein LOC103983649 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 135/203 (67%), Gaps = 18/203 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            R IVE+I ++SW  K   T  C  +ERILKVHN  KT+A FE+YR+ +K KASKLAK+H 
Sbjct  197  RKIVEIIFQSSWLKK--RTPACR-IERILKVHNTSKTMARFEDYRDSIKSKASKLAKRHP  253

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            R  ADGNELLRFH TT  C LG N +++LC S  +C++C I+R GF    + +    + T
Sbjct  254  RSTADGNELLRFHCTTFRCTLGLNGATNLCDSIPQCSLCSIIRDGF----KADAAGSIRT  309

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKVG  449
             +TS RA +A E  +  N+   R A++VCRVIAGRV R  E  EE      +DS AG  G
Sbjct  310  MATSGRAHDA-EHVTSENE---RIAMLVCRVIAGRVRRSQEAEEE------YDSAAGITG  359

Query  448  IYSNVEELFLLDPRALLPCFVVI  380
             +SN++E+F+ +P+A+LPCFVVI
Sbjct  360  AHSNLDEMFVFNPKAILPCFVVI  382



>ref|XP_007017790.1| C2H2-like zinc finger protein [Theobroma cacao]
 gb|EOY15015.1| C2H2-like zinc finger protein [Theobroma cacao]
Length=413

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 134/214 (63%), Gaps = 18/214 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  206  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEDCRDAVKTRALNSTRKNP  262

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIK---KEINGGVG  638
            RC ADGNELLRFH TT+ C+LGA  SSSLC +   C VC I+R+GF  K     +    G
Sbjct  263  RCAADGNELLRFHCTTLTCSLGARGSSSLCGAVPGCGVCTIIRQGFQNKGGSAAVADFKG  322

Query  637  VFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-----PLENVEELAGQSGF  473
            V T ++S RA +++      N    R+A++VCRVIAGRV R     PLE          +
Sbjct  323  VRTTASSGRAHDSL------NCKDGRRAMLVCRVIAGRVKRVTDDAPLEEDNSSVSAGSY  376

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            DSLA   G+YSN+EEL + +PRA+LPCFVVI KA
Sbjct  377  DSLAAYAGVYSNLEELVVFNPRAILPCFVVIYKA  410



>ref|XP_002510523.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF52710.1| nucleic acid binding protein, putative [Ricinus communis]
Length=406

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 136/211 (64%), Gaps = 18/211 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK +A    KK+ 
Sbjct  205  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEDCRDAVKTRALNSTKKNP  261

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTSEK-CNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C+LGA  SSSLC S   C VC I+R GF  K+      GV T
Sbjct  262  RCAADGNELLRFHCTTLSCSLGARGSSSLCGSIPCCGVCTIIRHGFQGKE----CKGVRT  317

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-----PLENVEELAGQSGFDSL  464
             ++S RA +++    C +    R+A++VCRVIAGRV R     P    E LA    +DS+
Sbjct  318  TASSGRAHDSLL--GCTD---GRRAMLVCRVIAGRVKRVADDTPPAEEEALAAAGSYDSV  372

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            AG  GIYSN+EELF+ +PRA+LPCFVVI  A
Sbjct  373  AGYAGIYSNLEELFVFNPRAILPCFVVIYSA  403



>ref|XP_002306922.2| hypothetical protein POPTR_0005s25950g [Populus trichocarpa]
 gb|EEE93918.2| hypothetical protein POPTR_0005s25950g [Populus trichocarpa]
Length=413

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 20/213 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N C  +ERILKV+N Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  210  RNIVEIIFKSSWVRKD---NPCCKIERILKVNNTQRTIQRFEDCRDAVKARALSSTRKNP  266

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C+LG+  SS+LC S   C +C I+R GF  K+      GV T
Sbjct  267  RCAADGNELLRFHCTTLTCSLGSRGSSTLCGSIPGCGICTIIRHGFQGKE----CKGVRT  322

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-------PLENVEELAGQSGFD  470
             ++S RA +++    C ++   R+A++VCRVIAGRV R       P E+    A    +D
Sbjct  323  TASSGRAHDSL--LGCTDE---RRAMLVCRVIAGRVKRVAEDAPPPEEDGASSAAAGSYD  377

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AG  GIYSN+EEL + +PRA+LPCFVVI KA
Sbjct  378  SVAGYAGIYSNLEELSVFNPRAILPCFVVIYKA  410



>ref|XP_010544461.1| PREDICTED: uncharacterized protein LOC104817077 [Tarenaya hassleriana]
Length=446

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 140/212 (66%), Gaps = 14/212 (7%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKV N Q T+++FEEYR+ +K KA+KL +K+
Sbjct  237  SKNIVEIIFQSSWLKKQAPI--CK-IDRILKVRNTQSTISKFEEYRDAIKAKATKLPRKN  293

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLC--TSEKCNVCRILRRGFAIKKEINGGVGV  635
             RC+ADGNELLRFH TTV C+LG   +++LC  +S  C VC I++ GF  K +  G  G+
Sbjct  294  PRCVADGNELLRFHCTTVSCHLGLRSATNLCNDSSPSCRVCAIIKTGFGDKGQ--GKNGI  351

Query  634  FTASTSSRALEAIE-ESSCANQGAARKALIVCRVIAGRVHR--PLENVEELAGQSG----  476
             T +TS RA ++ + + S        +A++VCRVIAGRV +    E      G  G    
Sbjct  352  LTTATSGRAHDSWDAQDSRVGSVEGERAMLVCRVIAGRVKKCGGGEGYNRNFGGDGVGEE  411

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +DS+AG VG YSN++EL++ DP+A+LPCFVVI
Sbjct  412  YDSVAGDVGAYSNLDELYVFDPKAILPCFVVI  443



>ref|XP_009628578.1| PREDICTED: uncharacterized protein LOC104118897 [Nicotiana tomentosiformis]
Length=405

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 142/219 (65%), Gaps = 24/219 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKVHN ++ + +FE+YR+ VK++A+   KK+
Sbjct  195  SRNIVEIIFKSSWLKKD---NPICKIERILKVHNTKRIIHKFEDYRDAVKLRATVNGKKN  251

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS---EKCNVCRILRRGFAIKKEINGGVG  638
             RC ADGNELLRF+ TT+ C+LGA  +S+LC+S     C VC I+R GF  +   N   G
Sbjct  252  PRCAADGNELLRFYCTTLTCSLGAKGTSNLCSSVCTPGCGVCTIIRHGF--QGNNNKVCG  309

Query  637  VFTASTSSRALEAIEESSCANQGA-ARKALIVCRVIAGRVHRPLENV--EELAGQSG---  476
            V T ++S RA +      C   GA  R+A++VCRVIAGRV R  E+    E +G SG   
Sbjct  310  VRTTASSGRAHD------CLGSGADGRRAMLVCRVIAGRVKRVAEDTAATEESGGSGLSA  363

Query  475  ----FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
                +DS+ G   +YSN+EEL++ +PRA+LPCFVVI KA
Sbjct  364  AANLYDSVVGYSDVYSNLEELYVFNPRAILPCFVVIYKA  402



>gb|KDP36933.1| hypothetical protein JCGZ_08224 [Jatropha curcas]
Length=403

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 18/211 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKV N Q+T+  FE+ RE VK +A    KK+ 
Sbjct  202  RNIVEIIFKSSWLKKD---NPIFKIERILKVQNTQRTIQRFEDCREAVKTRALNSTKKNP  258

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C+LGA  SS+LC S   C VC I+R GF  K+      GV T
Sbjct  259  RCAADGNELLRFHCTTLTCSLGARGSSNLCGSIPACGVCTIIRHGFQGKE----CKGVRT  314

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQSG--FDSL  464
             ++S RA +++    C +    R+A++VCRVIAGRV R  E+    EE A  +G  +DS+
Sbjct  315  TASSGRAHDSL--LGCTD---GRRAMLVCRVIAGRVKRSAEDAPPPEENAVPAGGSYDSV  369

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            AG  GIYSN+EELF+ +PRA+LPCFVVI  A
Sbjct  370  AGCAGIYSNLEELFVFNPRAILPCFVVIYNA  400



>gb|EYU36782.1| hypothetical protein MIMGU_mgv1a007577mg [Erythranthe guttata]
Length=403

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 134/215 (62%), Gaps = 22/215 (10%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKAS---KLA  818
            SR+IVE+I ++SW  K    N    +ERILKVHN  + +  FE+YR+ VK +AS     A
Sbjct  199  SRDIVEIIFKSSWLKKD---NPVCQIERILKVHNTHRKIQRFEDYRDSVKARASISNNSA  255

Query  817  KKHARCLADGNELLRFHGTTVECNLGANDSSSLC-TSEKCNVCRILRRGFAIKKEINGGV  641
            K++ RC ADGNELLRFH  T+ C LGA+ SSSLC +S  C VC I+R GF    + N   
Sbjct  256  KRNPRCAADGNELLRFHSATLACPLGAHGSSSLCGSSPPCGVCTIIRHGF----QGNSKS  311

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-----  476
            G+ T +TS RA        C    A R A++VCRVIAG+V R + + +E  G +      
Sbjct  312  GIRTTATSGRAAR-----DCLGGSATRGAMLVCRVIAGKVKR-VGDADEDGGAAAPIAGS  365

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +DSL G  G+YSN+EEL++   RA+LPCFVVI KA
Sbjct  366  YDSLGGCAGVYSNIEELYVFSSRAILPCFVVIYKA  400



>gb|KHG11079.1| Exodeoxyribonuclease 7 large subunit [Gossypium arboreum]
Length=426

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 137/219 (63%), Gaps = 23/219 (11%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  211  RNIVEIIFKSSWLKKD---NPICKIERILKVHNNQRTIQRFEDCRDAVKTRALNSTRKNP  267

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV----  641
            RC ADGNELLRFH TT+ C+LGA  SSSLC S   C VC I+R+GF  K E         
Sbjct  268  RCAADGNELLRFHCTTLSCSLGARGSSSLCGSIPGCGVCTIIRQGFQNKGEGTAPAAEFK  327

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR------PLEN---VEELA  488
            GV T ++S RA ++I+ +        R+A++VCRVIAGRV R      PLE+       +
Sbjct  328  GVVTTASSGRAHDSIKRTD------GRRAMLVCRVIAGRVKRVADEAPPLEDENSSGVSS  381

Query  487  GQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
                +DS+A   G+YSN+EE+ + +PRA+LPCFVVI KA
Sbjct  382  SAGSYDSVAAYAGVYSNLEEIVVFNPRAILPCFVVIYKA  420



>ref|XP_009107404.1| PREDICTED: uncharacterized protein LOC103833057 [Brassica rapa]
Length=418

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 137/211 (65%), Gaps = 16/211 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K     N   +ERILKVHN Q+T+  FE+ R+ VK  A    +K  
Sbjct  213  RNIVDIIFKSSWLRKDSPIYN---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEP  269

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGGV---  641
            R  ADGNELLRFH TTV C+LG+  S+SLC++   C VC I+R GF  K   + GG    
Sbjct  270  RSAADGNELLRFHCTTVSCSLGSRGSTSLCSNFPGCRVCTIIRHGFHAKTLRLGGGANEI  329

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-FDS  467
             GV T ++S RA +A   S C +Q   R+A++VCRVIAGRV R   + +E    SG +DS
Sbjct  330  KGVRTTASSGRAHDA---SRCFDQ---RRAMLVCRVIAGRVRRVQSDAQEDENGSGSYDS  383

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  G+Y+N+++L + +P+A+LPCFVVI K
Sbjct  384  VAGPAGVYTNLDDLVVFNPKAILPCFVVIYK  414



>ref|XP_009783030.1| PREDICTED: uncharacterized protein LOC104231688 [Nicotiana sylvestris]
Length=446

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 139/225 (62%), Gaps = 32/225 (14%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKVHN ++T+  FE+ R+ VKI A    KK+
Sbjct  232  SRNIVEIIFKSSWLKKE---NPICKIERILKVHNTKRTIQRFEDCRDAVKIHAVATGKKN  288

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRF+ T++ C+LGA  SSSLC S   C VC ++R GF   K      GV 
Sbjct  289  PRCAADGNELLRFYCTSLTCSLGARGSSSLCGSVPSCGVCTLIRHGFQGSKT----SGVR  344

Query  631  TASTSSRALEAIEESSCANQG-AARKALIVCRVIAGRVHRPLENV-------EELAGQSG  476
            T ++S RA +      C   G A R+A++VCRVIAGRV +P ++V       EE    S 
Sbjct  345  TTASSGRAHD------CLGSGIAKRRAMLVCRVIAGRVKQPAKDVAASPTMEEETCSSSA  398

Query  475  ----------FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
                      +DS+AG  GIYSN+EEL++ +PRA+LPCFVVI +A
Sbjct  399  SGLLTNGSAIYDSVAGYAGIYSNLEELYVFNPRAILPCFVVIYEA  443



>emb|CDY16999.1| BnaA08g03630D [Brassica napus]
Length=414

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 136/211 (64%), Gaps = 16/211 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV +I ++SW  K     N   +ERILKVHN Q+T+  FE+ R+ VK  A    +K  
Sbjct  209  RNIVNIIFKSSWLRKDSPIYN---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEP  265

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGGV---  641
            R  ADGNELLRFH TTV C+LG+  S+SLC++   C VC I+R GF  K   + GG    
Sbjct  266  RSAADGNELLRFHCTTVSCSLGSRGSTSLCSNFPGCRVCTIIRHGFHAKTLRLGGGANEI  325

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-FDS  467
             GV T ++S RA +A   S C +Q   R+A++VCRVIAGRV R   + +E    SG +DS
Sbjct  326  KGVRTTASSGRAHDA---SRCFDQ---RRAMLVCRVIAGRVRRVQSDAQEDENGSGSYDS  379

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  G+Y+N+++L + +P+A+LPCFVVI K
Sbjct  380  VAGPAGVYTNLDDLVVFNPKAILPCFVVIYK  410



>ref|XP_004499248.1| PREDICTED: uncharacterized protein LOC101513058 [Cicer arietinum]
Length=410

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 136/208 (65%), Gaps = 15/208 (7%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  +   +  C  +ERILKVHN Q+T+  FEE R+ VK +A+   KK+ 
Sbjct  210  RNIVEIIFKSSWLKR--ESPMCK-IERILKVHNTQRTIQRFEECRDTVKSRATNTTKKNP  266

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLC-TSEKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH  T+ C LGA  SSSLC T   C VC I+R GF  K       GV T
Sbjct  267  RCAADGNELLRFHSATLTCALGARGSSSLCATVPGCGVCTIIRHGFQNKG------GVRT  320

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPL-ENVEELAGQSG--FDSLAG  458
             ++S RA +   E  C  +  +R+A++VCRVIAGRV R   E   +L+ + G  +DS+AG
Sbjct  321  NASSGRAHDYSVE-RCEEED-SRRAMLVCRVIAGRVKRVAEEGAPQLSEEEGVSYDSVAG  378

Query  457  KVGIYSNVEELFLLDPRALLPCFVVICK  374
              GIYSN+EEL + +PRA+LPCFVVI K
Sbjct  379  YAGIYSNLEELTVFNPRAILPCFVVIYK  406



>gb|KFK29074.1| hypothetical protein AALP_AA7G085300 [Arabis alpina]
Length=411

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 139/222 (63%), Gaps = 28/222 (13%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K   + N   +ERILKVHN Q+T+  FE+ R+ VK +A    +K  
Sbjct  196  RNIVDIIFKSSWLRKDSPSYN---IERILKVHNTQRTIQRFEDCRDAVKSRALASTRKEP  252

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK--------EI  653
            R  ADGNELLRFH TTV C+LG+  S+SLC++   C VC I+R GF  K         E 
Sbjct  253  RSAADGNELLRFHCTTVSCSLGSRGSTSLCSAIPGCRVCTIIRHGFHAKTVRLGNVNAEA  312

Query  652  NGGV----GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-----PLENV  500
             GG     GV T ++S RA +A   S C +Q   R+A++VCRVIAGRV R     P  N 
Sbjct  313  CGGPKETKGVKTTASSGRAHDA---SRCFDQ---RRAMLVCRVIAGRVRRMQSDAPHPNE  366

Query  499  EELAGQSGFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            EE  G   +DS+AG  G+Y+N+++L + +PRA+LPCFVVI K
Sbjct  367  EE-CGSGSYDSVAGAAGVYTNLDDLVVFNPRAILPCFVVIYK  407



>ref|XP_010539850.1| PREDICTED: uncharacterized protein LOC104813789 [Tarenaya hassleriana]
Length=438

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 141/208 (68%), Gaps = 24/208 (12%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  ++  C  +ERILKVHN Q+T+  FE+ R+ VK +A +  +K A
Sbjct  243  RNIVEIIFKSSWLKK--DSPMCK-IERILKVHNTQRTIQRFEDCRDAVKARALQTPRKDA  299

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C LG++ SS+LC++   C VC ++RRGF       G  GV T
Sbjct  300  RCAADGNELLRFHCTTLGCTLGSS-SSALCSAIPGCGVCTLIRRGF-------GPGGVRT  351

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQ-----SGFDSL  464
             ++S RA +++ +      G+ ++A++VCRVIAGRV RP+  VE+ A +       +DSL
Sbjct  352  TASSGRAHDSVRDV-----GSGQRAMLVCRVIAGRVKRPV--VEDQAAEEENCGGAYDSL  404

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVI  380
            A   G+YSN+EEL + +PRA+LPCFVVI
Sbjct  405  AVNGGVYSNLEELLVFNPRAILPCFVVI  432



>ref|XP_002990476.1| hypothetical protein SELMODRAFT_236040 [Selaginella moellendorffii]
 gb|EFJ08353.1| hypothetical protein SELMODRAFT_236040 [Selaginella moellendorffii]
Length=359

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 146/209 (70%), Gaps = 17/209 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNI+E+I R+SW + + +      +ER+LKVHN Q+TLA FE+YR+ VK++A+ +A+K+
Sbjct  162  SRNIIEIIFRSSWISSNSSIGR---IERVLKVHNSQRTLARFEDYRDSVKLRANCMARKN  218

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
            ARC+ADGNELLRF+G++V C LGA+ SSS+C+   C++CRI+R GF  K       G+ T
Sbjct  219  ARCIADGNELLRFYGSSVACPLGAHGSSSVCSLAHCSICRIIRSGFVSKNT----KGICT  274

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR---PLENVEELAG-QSGFDSLA  461
             +TSS A   +EES   N G  ++A++VCRVIAGR +R       + E++G  +G+DS+ 
Sbjct  275  TATSSSA--HVEESFGGNAG--KRAMVVCRVIAGRSYRTSCSTNGIGEISGCPNGYDSVV  330

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICK  374
            G  GI S+   L + +PRA+LPCFVVI K
Sbjct  331  G--GIGSDGGSLVVFNPRAVLPCFVVIYK  357



>ref|XP_009616115.1| PREDICTED: uncharacterized protein LOC104108715 [Nicotiana tomentosiformis]
Length=444

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 139/225 (62%), Gaps = 32/225 (14%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K    N    +ERILKVHN ++T+  FE+ R+ VKI A    KK+
Sbjct  230  SRNIVEIIFKSSWLKKD---NPICKIERILKVHNTKRTIQRFEDCRDAVKIHAVATGKKN  286

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC ADGNELLRF+ T++ C+LGA  SSSLC S   C VC ++R GF   K      GV 
Sbjct  287  PRCAADGNELLRFYCTSLTCSLGARGSSSLCGSLPSCGVCSLIRHGFQGSKT----SGVR  342

Query  631  TASTSSRALEAIEESSCANQGAA-RKALIVCRVIAGRVHRPLENV-------EELAGQSG  476
            T ++S RA +      C   G A R+A++VCRVIAGR+ +  ++V       EE    SG
Sbjct  343  TTASSGRAHD------CLGSGTAKRRAMLVCRVIAGRIKQTAKDVAASPTTEEETCSGSG  396

Query  475  ----------FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
                      +DS+AG  GIYSN+EEL++ +PRA+LPCFVVI +A
Sbjct  397  SGLLTNGSAIYDSVAGYAGIYSNLEELYVFNPRAILPCFVVIYEA  441



>ref|XP_010268436.1| PREDICTED: uncharacterized protein LOC104605392 [Nelumbo nucifera]
Length=416

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 135/213 (63%), Gaps = 17/213 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FE+ R+ VK + S   KK+ 
Sbjct  215  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEDCRDAVKARVSNSTKKNP  271

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH TT+ C LGA  S+SLC     C VC I+R GF  K  ++   GV T
Sbjct  272  RCAADGNELLRFHCTTLTCELGARGSTSLCGCIPGCGVCTIIRHGFPGK--VHDSKGVRT  329

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQSGF--DSL  464
             ++S +A +++           R+A++VCRVIAGRV R  ++    EE    + +  DS+
Sbjct  330  TASSGKAHDSL------GSVEGRRAMLVCRVIAGRVKRIADDAPADEESMSTATYECDSV  383

Query  463  AGKVGIYSNVEELFLLDPRALLPCFVVICKA*N  365
            AG  G+Y+N EELF+ +PRA+LPCFVVI KA N
Sbjct  384  AGYAGVYTNHEELFIFNPRAILPCFVVIYKALN  416



>ref|XP_002983777.1| hypothetical protein SELMODRAFT_268776 [Selaginella moellendorffii]
 gb|EFJ15273.1| hypothetical protein SELMODRAFT_268776 [Selaginella moellendorffii]
Length=408

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 146/209 (70%), Gaps = 17/209 (8%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNI+E+I R+SW + + +      +ER+LKVHN Q+TLA FE+YR+ VK++A+ +A+K+
Sbjct  211  SRNIIEIIFRSSWISSNSSIGR---IERVLKVHNSQRTLARFEDYRDSVKLRANCMARKN  267

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFT  629
            ARC+ADGNELLRF+G++V C LGA+ SSS+C+   C++CRI+R GF  K       G+ T
Sbjct  268  ARCIADGNELLRFYGSSVACPLGAHGSSSVCSLAHCSICRIIRSGFVSKNT----KGICT  323

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR---PLENVEELAG-QSGFDSLA  461
             +TSS A   +EES   N G  ++A++VCRVIAGR +R       + E++G  +G+DS+ 
Sbjct  324  TATSSSA--HVEESFGGNAG--KRAMVVCRVIAGRSYRTSCSTNGIGEISGCPNGYDSVV  379

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICK  374
            G  GI S+   L + +PRA+LPCFVVI K
Sbjct  380  G--GIGSDGGSLVVFNPRAVLPCFVVIYK  406



>gb|AFK49400.1| unknown [Medicago truncatula]
Length=403

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 131/206 (64%), Gaps = 20/206 (10%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  +   T  C  +ERILKVHN Q+T+  FEE R+ VK +AS   KK+ 
Sbjct  209  RNIVEIIFKSSWLKR--ETPMCK-IERILKVHNTQRTIQRFEECRDAVKSRASNTTKKNP  265

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFTA  626
            RC ADGNELLRFH T++ C LGA+ SS+LC    C VC I+R GF  K       GV T 
Sbjct  266  RCAADGNELLRFHSTSLSCALGASGSSTLCAVPGCGVCNIIRHGFQKKG------GVKTN  319

Query  625  STSSRALE-AIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG---FDSLAG  458
            ++S RA + ++ E S       R+A++VCRVIAG+V R  E    +  +     FDS AG
Sbjct  320  ASSGRAHDNSVGEDS-------RRAMLVCRVIAGKVKRVAEEGARVVSEEEMVCFDSTAG  372

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
              G YSN+E+L + +PRA+LPCFVVI
Sbjct  373  NAGSYSNLEDLTVFNPRAILPCFVVI  398



>ref|XP_003589472.1| hypothetical protein MTR_1g024980 [Medicago truncatula]
 gb|AES59723.1| C2H2-like zinc finger protein [Medicago truncatula]
Length=403

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 131/206 (64%), Gaps = 20/206 (10%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  +   T  C  +ERILKVHN Q+T+  FEE R+ VK +AS   KK+ 
Sbjct  209  RNIVEIIFKSSWLKR--ETPMCK-IERILKVHNTQRTIQRFEECRDAVKSRASNTTKKNP  265

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTSEKCNVCRILRRGFAIKKEINGGVGVFTA  626
            RC ADGNELLRFH T++ C LGA+ SS+LC    C VC I+R GF  K       GV T 
Sbjct  266  RCAADGNELLRFHSTSLSCALGASGSSTLCAVPGCGVCNIIRHGFQKKG------GVKTN  319

Query  625  STSSRALE-AIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG---FDSLAG  458
            ++S RA + ++ E S       R+A++VCRVIAG+V R  E    +  +     FDS AG
Sbjct  320  ASSGRAHDNSVGEDS-------RRAMLVCRVIAGKVKRVAEEGARVVSEEEMVCFDSTAG  372

Query  457  KVGIYSNVEELFLLDPRALLPCFVVI  380
              G YSN+E+L + +PRA+LPCFVVI
Sbjct  373  NAGSYSNLEDLTVFNPRAILPCFVVI  398



>gb|AFW60009.1| hypothetical protein ZEAMMB73_700752 [Zea mays]
 gb|AIB04764.1| C2H2 transcription factor, partial [Zea mays]
Length=419

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 137/221 (62%), Gaps = 25/221 (11%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKAS--KLA-  818
            SRNI+E+I ++SW  K      C  ++RILKV+N  +TLA FEEYR+ VK +A   +LA 
Sbjct  209  SRNIIEIIFQSSWLKKQSPV--CK-VDRILKVNNTPRTLARFEEYRDAVKARAGAEQLAV  265

Query  817  -----KKHARCLADGNELLRFHGTTVECNLGANDSSSLCTSE-KCNVCRILRRGFAIKKE  656
                  +H RC ADGNELLRFH  T+ C+LG N ++ LC +   C  C I+R GF+    
Sbjct  266  AAANSNRHPRCTADGNELLRFHCATLACSLGLNGATHLCDAAGTCAACGIIRDGFSSG--  323

Query  655  INGGVGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG  476
                 GV T +TS RA +A E  +  ++    +A++VCRVIAGRV RP E V E    + 
Sbjct  324  -----GVLTMATSGRAHDAAEAGAGLDEETTPRAMLVCRVIAGRVKRPKEAVPEEEAVAD  378

Query  475  ------FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
                  +DS+AG  G+YSN+EEL + +PRA+LPCFVV+ KA
Sbjct  379  AAEESEYDSVAGSAGVYSNLEELLVFNPRAILPCFVVVYKA  419



>ref|XP_003545035.1| PREDICTED: uncharacterized protein LOC100782665 [Glycine max]
Length=414

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 134/209 (64%), Gaps = 13/209 (6%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FEE R+ VK +A    KK+ 
Sbjct  210  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEECRDTVKNRALGSTKKNP  266

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEING----GV  641
            RC ADGNELLRFH TT+ C LGA  SSSLC S   C+VC I+R GF       G      
Sbjct  267  RCAADGNELLRFHCTTLTCALGARGSSSLCASVPGCSVCTIIRHGFQGGCGGGGDHARAK  326

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLA  461
            GV T ++S RA +++    C +  A R+A++VCRVIAGRV R +E+         +DS+A
Sbjct  327  GVRTTASSGRAHDSV---VCGD--ATRRAMLVCRVIAGRVKRVVEDAPSEEEHVSYDSVA  381

Query  460  GKVGIYSNVEELFLLDPRALLPCFVVICK  374
            G  GIYSN+EEL + +P+A+LPCFVVI K
Sbjct  382  GYAGIYSNLEELVVFNPKAILPCFVVIYK  410



>ref|XP_008221271.1| PREDICTED: uncharacterized protein LOC103321258 [Prunus mume]
Length=435

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 138/213 (65%), Gaps = 17/213 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  +   C  +ERILKVHN Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  229  RNIVEIIFKSSWQKK--DIPICK-IERILKVHNTQRTIQRFEDCRDAVKNRALGTTRKNP  285

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVFT  629
            RC ADGNELLRFH  ++ C LGA  SSSLC S   C VC I+R GF  K    GG GV T
Sbjct  286  RCAADGNELLRFHCASISCTLGARGSSSLCGSVPGCGVCTIIRHGFQGKAGGEGGKGVRT  345

Query  628  ASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR-----PLEN--VEELAGQSGFD  470
             ++S RA +++   SC +    R+A++VCRVIAGRV R     P E   +  L+    +D
Sbjct  346  TASSGRAHDSL---SCTD---GRRAMLVCRVIAGRVRRIADDAPTEEDALSSLSAPGSYD  399

Query  469  SLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            S+AG  G+YSN+EEL + +PRA+LPCFVVI +A
Sbjct  400  SVAGFAGLYSNLEELVVYNPRAILPCFVVIYQA  432



>ref|XP_004291367.1| PREDICTED: uncharacterized protein LOC101308537 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 138/215 (64%), Gaps = 19/215 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  ++  C  +ERILKV N Q+T+  FE+ R+ VK +A   A+K+ 
Sbjct  204  RNIVEIIFKSSWLKK--DSPICR-IERILKVQNTQRTIQRFEDCRDAVKNRALNSARKNP  260

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIK--KEINGGVGV  635
            RC ADGNELLRFH T++ C LGA  S++LC S   C VC  +R GF      E+ G  GV
Sbjct  261  RCAADGNELLRFHCTSISCPLGARGSTNLCGSVPGCGVCTTIRHGFQGHGGGEVVGSKGV  320

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-------  476
             T ++S RA +++    C +    R+A++VCRVIAGRV R  E+  E  G +        
Sbjct  321  RTTASSGRAHDSLH---CTD---GRRAMLVCRVIAGRVRRVAEDAAEEEGVTASSSAGGT  374

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +DS+AG  G++SN+EEL + +PRA+LPCFVVI KA
Sbjct  375  YDSVAGYAGVFSNLEELVVFNPRAILPCFVVIYKA  409



>ref|XP_004291366.1| PREDICTED: uncharacterized protein LOC101308537 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 138/215 (64%), Gaps = 19/215 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  ++  C  +ERILKV N Q+T+  FE+ R+ VK +A   A+K+ 
Sbjct  223  RNIVEIIFKSSWLKK--DSPICR-IERILKVQNTQRTIQRFEDCRDAVKNRALNSARKNP  279

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIK--KEINGGVGV  635
            RC ADGNELLRFH T++ C LGA  S++LC S   C VC  +R GF      E+ G  GV
Sbjct  280  RCAADGNELLRFHCTSISCPLGARGSTNLCGSVPGCGVCTTIRHGFQGHGGGEVVGSKGV  339

Query  634  FTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-------  476
             T ++S RA +++    C +    R+A++VCRVIAGRV R  E+  E  G +        
Sbjct  340  RTTASSGRAHDSLH---CTD---GRRAMLVCRVIAGRVRRVAEDAAEEEGVTASSSAGGT  393

Query  475  FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +DS+AG  G++SN+EEL + +PRA+LPCFVVI KA
Sbjct  394  YDSVAGYAGVFSNLEELVVFNPRAILPCFVVIYKA  428



>emb|CDY17799.1| BnaC08g04130D [Brassica napus]
Length=434

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 136/211 (64%), Gaps = 16/211 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K     N   +ERILKVHN Q+T+  FE+ R+ VK  A    +K  
Sbjct  229  RNIVDIIFKSSWLRKDSPIYN---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEP  285

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGGV---  641
            R  ADGNELLRF  TTV C+LG+  S+SLC++   C VC I+R GF  K   + GG    
Sbjct  286  RSAADGNELLRFQCTTVSCSLGSRGSTSLCSNFPGCRVCTIIRHGFHAKTLRLGGGANEI  345

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSG-FDS  467
             GV T ++S RA +A   S C +Q   R+A++VCRVIAGRV R   + +E    SG +DS
Sbjct  346  KGVRTTASSGRAHDA---SRCFDQ---RRAMLVCRVIAGRVRRVQSDAQEDENGSGSYDS  399

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  G+Y+N+++L + +P+A+LPCFVVI K
Sbjct  400  VAGPAGVYTNLDDLVVFNPKAILPCFVVIYK  430



>gb|AAF99784.1|AC012463_1 T2E6.3 [Arabidopsis thaliana]
 dbj|BAF00770.1| hypothetical protein [Arabidopsis thaliana]
Length=419

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 137/213 (64%), Gaps = 18/213 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K         +ERILKVHN Q+T+  FE+ R+ VK  A    +K A
Sbjct  212  RNIVDIIFKSSWLRKDSPIYK---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEA  268

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGG----  644
            R  ADGNELLRFH TTV C+LG+  S+S+C++   C VC I+R GF  K   +  G    
Sbjct  269  RSAADGNELLRFHCTTVSCSLGSRGSTSICSAIPGCRVCTIIRHGFHAKTVRVGNGEGKE  328

Query  643  --VGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV-EELAGQSGF  473
               GV T ++S RA +A+    C +Q   R+A++VCRVIAGRV R   +V E+ +G   +
Sbjct  329  EIKGVRTTASSGRAHDALR---CFDQ---RRAMLVCRVIAGRVRRVQSDVPEDESGSGSY  382

Query  472  DSLAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            DS+AG  G+Y+N+++L + +P+A+LPCFVVI K
Sbjct  383  DSVAGAAGVYTNLDDLVVYNPKAILPCFVVIYK  415



>ref|XP_009335106.1| PREDICTED: uncharacterized protein LOC103927864 [Pyrus x bretschneideri]
Length=431

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 140/218 (64%), Gaps = 22/218 (10%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  +   C  +ERILKV N Q+T+  FE+ R+ VK +A    +K  
Sbjct  220  RNIVEIIFKSSWLKK--DIPFCK-IERILKVQNTQRTIQRFEDCRDAVKNRALSSTRKDP  276

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK----EINGGV  641
            RC ADGNELLRFH  ++ C LGA  SSSLC S   C VC ++R GF  K     +  G  
Sbjct  277  RCAADGNELLRFHCASISCTLGARGSSSLCGSVPGCGVCTVIRHGFQGKAVAEGDQGGSK  336

Query  640  GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR------PLEN-VEELAGQ  482
            GV T ++S RA +++   +C +    R+A++VCRVIAGRV R      P E+ + +L+  
Sbjct  337  GVRTTASSGRAHDSL---NCTD---GRRAMLVCRVIAGRVRRIADGGPPEEDGLSQLSAA  390

Query  481  SG-FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
            +G +DS+AG  GIYSN+EEL + +PRA+LPCFVVI KA
Sbjct  391  AGSYDSVAGFAGIYSNLEELLVYNPRAILPCFVVIYKA  428



>ref|XP_006393516.1| hypothetical protein EUTSA_v10011499mg [Eutrema salsugineum]
 gb|ESQ30802.1| hypothetical protein EUTSA_v10011499mg [Eutrema salsugineum]
Length=429

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 135/211 (64%), Gaps = 16/211 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K         +ERILKVHN Q+T+  FE+ R+ VK  A    +K  
Sbjct  224  RNIVDIIFKSSWLRKDSPIYK---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEP  280

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGGV---  641
            R  ADGNELLRFH TTV C+LG+  S+SLC++   C VC I+R GF  K   + GG    
Sbjct  281  RSAADGNELLRFHCTTVSCSLGSRGSTSLCSNVPGCRVCTIIRHGFHAKTLRLGGGTNEI  340

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV-EELAGQSGFDS  467
             GV T ++S RA +A+    C +Q   R+A++VCRVIAGRV R   +  E+  G   +DS
Sbjct  341  KGVRTTASSGRAHDALR---CFDQ---RRAMLVCRVIAGRVRRVQSDAPEDEIGSGSYDS  394

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  G+Y+N+++L + +P+A+LPCFVVI K
Sbjct  395  VAGVAGVYTNLDDLVVFNPKAILPCFVVIYK  425



>ref|XP_003550423.1| PREDICTED: uncharacterized protein LOC100816726 [Glycine max]
Length=417

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 136/215 (63%), Gaps = 19/215 (9%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K    N    +ERILKVHN Q+T+  FEE R+ VK +A    KK+ 
Sbjct  207  RNIVEIIFKSSWLKKD---NPICKIERILKVHNTQRTIQRFEECRDTVKNRALGSTKKNP  263

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS--EKCNVCRILRRGFAIKKEING-----  647
            RC ADGNELLRFH TT+ C LGA  SSSLC S    C VC I+R GF       G     
Sbjct  264  RCAADGNELLRFHCTTLTCALGARGSSSLCASVHGSCGVCTIIRHGFQGGSCGGGSGDHG  323

Query  646  -GVGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENV---EELAGQS  479
               GV T ++S RA +++    C +  A R+A++VCRVIAGRV R +E+    EE    +
Sbjct  324  KAKGVRTTASSGRAHDSV---VCGD--ATRRAMLVCRVIAGRVKRVVEDAPSEEEHVSVA  378

Query  478  GFDSLAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
             +DS+AG  GIYSN+EEL + +P+A+LPCFVVI K
Sbjct  379  SYDSVAGYAGIYSNLEELVVFNPKAILPCFVVIYK  413



>ref|XP_008364931.1| PREDICTED: uncharacterized protein LOC103428594 [Malus domestica]
Length=433

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 140/219 (64%), Gaps = 23/219 (11%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIVE+I ++SW  K  +T  C  +E ILKV N Q+T+  FE+ R+ VK +A    +K+ 
Sbjct  221  RNIVEIIFKSSWLKK--DTPFCX-IEXILKVQNTQRTIQRFEDCRDAVKNRALXSTRKNP  277

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIK-----KEINGG  644
            RC ADGNELLRFH T++ C LGA  SSSLC S   C VC I+R GF  K      +  G 
Sbjct  278  RCAADGNELLRFHCTSISCTLGARGSSSLCDSVPGCGVCTIIRHGFQGKAVAEGDQGGGS  337

Query  643  VGVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHR------PLEN-VEELAG  485
             GV T ++S RA ++    +C +    R+A++VCRVIAGRV R      P E+ + +L  
Sbjct  338  KGVRTTASSGRAHDSF---NCTD---GRRAMLVCRVIAGRVRRIADDAPPEEDGLXQLXA  391

Query  484  QSG-FDSLAGKVGIYSNVEELFLLDPRALLPCFVVICKA  371
             +G +DS+AG  GIYSN+EEL + +P+A+LPCFVVI KA
Sbjct  392  AAGSYDSVAGFAGIYSNLEELVVYNPKAILPCFVVIYKA  430



>ref|XP_002302254.2| hypothetical protein POPTR_0002s08810g [Populus trichocarpa]
 gb|EEE81527.2| hypothetical protein POPTR_0002s08810g [Populus trichocarpa]
Length=432

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 142/209 (68%), Gaps = 18/209 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            S+NIVE+I ++SW  K      C  ++RILKVHN Q+T+++FEEYR+ +K KA+KL KK 
Sbjct  225  SKNIVEIIFQSSWLKKQAPI--CK-IDRILKVHNTQRTISKFEEYRDSIKAKAAKLPKKQ  281

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGV---  641
             RC+ADGNELLRFH TT  C++G N SS+LC S   C VC I++ GF   K+  GG    
Sbjct  282  PRCIADGNELLRFHCTTFACSIGLNGSSNLCISVPNCKVCSIIKNGF---KDPTGGDDNG  338

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLE-NVEELAGQSGFDS  467
             G+ T +TS +A +        N  + ++A++VCRVIAGRV + +E N+E+      +DS
Sbjct  339  HGILTTATSGKAHDKATTLEDGNGDSEKRAMLVCRVIAGRVKKSMEGNIED------YDS  392

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVI  380
            +A  + +YSN++EL++ +PRA+LPCFVVI
Sbjct  393  VAAGMEVYSNLDELYVFNPRAILPCFVVI  421



>ref|XP_009118945.1| PREDICTED: uncharacterized protein LOC103843923 [Brassica rapa]
Length=419

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 134/211 (64%), Gaps = 16/211 (8%)
 Frame = -2

Query  985  RNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKHA  806
            RNIV++I ++SW  K         +ERILKVHN Q+T+  FE+ R+ VK  A    +K  
Sbjct  214  RNIVDIIFKSSWLRKDGPLYK---IERILKVHNTQRTIQRFEDCRDAVKSHAHASTRKEP  270

Query  805  RCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKK-EINGGV---  641
            R  ADGNELLRFH TTV C+LG+  S+SLC++   C VC I+R GF  K   +  G    
Sbjct  271  RSAADGNELLRFHCTTVSCSLGSRGSTSLCSNIPGCRVCTIIRHGFHAKTLRLGSGSNEI  330

Query  640  -GVFTASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQS-GFDS  467
             GV T ++S RA +A+    C +Q   R+A++VCRVIAGRV R   +  E    S  +DS
Sbjct  331  KGVRTTASSGRAHDALR---CFDQ---RRAMLVCRVIAGRVRRGQSDAPEDENDSCSYDS  384

Query  466  LAGKVGIYSNVEELFLLDPRALLPCFVVICK  374
            +AG  GIY+NV++L +L+P+A+LPCFVVI K
Sbjct  385  VAGAAGIYTNVDDLAVLNPKAILPCFVVIYK  415



>ref|XP_010927412.1| PREDICTED: uncharacterized protein LOC105049460 [Elaeis guineensis]
Length=392

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 142/204 (70%), Gaps = 18/204 (9%)
 Frame = -2

Query  988  SRNIVEMICRTSWATKSDNTNNCNGMERILKVHNMQKTLAEFEEYRERVKIKASKLAKKH  809
            SRNIVE+I ++SW  K      C  ++RILKVHN QKT+A+FE+YR+ +K KASKLAKKH
Sbjct  202  SRNIVEIIFQSSWLKKQAPI--CE-IDRILKVHNTQKTIAKFEDYRDSIKSKASKLAKKH  258

Query  808  ARCLADGNELLRFHGTTVECNLGANDSSSLCTS-EKCNVCRILRRGFAIKKEINGGVGVF  632
             RC+ADGNELLRFH TT  C+LG N +++LC S   CNVC I+R GF  K ++ G +   
Sbjct  259  PRCIADGNELLRFHCTTFLCSLGLNGTTNLCDSIPYCNVCSIIRNGF--KGDVLGRIR--  314

Query  631  TASTSSRALEAIEESSCANQGAARKALIVCRVIAGRVHRPLENVEELAGQSGFDSLAGKV  452
            T +TS RA +  + SS       ++A++VCRVIAGRV R  + +EE       DS+AG  
Sbjct  315  TMATSGRAHDTAQISS----DDEKRAMLVCRVIAGRVKRNQDALEEC------DSVAGTA  364

Query  451  GIYSNVEELFLLDPRALLPCFVVI  380
            GIY+N++ELF+ + +A+LPCFVVI
Sbjct  365  GIYANLDELFVFNSKAILPCFVVI  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2233072069740