BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21878_g3_i1 len=1902 path=[3203:0-550 3754:551-576 5116:577-1901]

Length=1902
                                                                      Score     E

gb|ACC60982.1|  beta-galactosidase 2 precursor                          765   0.0      Petunia x hybrida [garden petunia]
ref|XP_009789713.1|  PREDICTED: beta-galactosidase 13-like              758   0.0      
ref|XP_009764615.1|  PREDICTED: beta-galactosidase 13-like              754   0.0      
ref|XP_009608903.1|  PREDICTED: beta-galactosidase 13-like              753   0.0      
ref|XP_010315380.1|  PREDICTED: beta-galactosidase 13-like              749   0.0      
ref|XP_009605185.1|  PREDICTED: beta-galactosidase 13-like              749   0.0      
dbj|BAO02512.1|  predicted beta-galactosidase ortholog                  749   0.0      
ref|XP_009784203.1|  PREDICTED: beta-galactosidase 13-like              748   0.0      
ref|XP_009631007.1|  PREDICTED: beta-galactosidase 13-like              748   0.0      
ref|XP_004248657.1|  PREDICTED: beta-galactosidase 13-like              742   0.0      
ref|XP_006366982.1|  PREDICTED: beta-galactosidase 13-like              740   0.0      
gb|EYU40437.1|  hypothetical protein MIMGU_mgv1a002461mg                727   0.0      
gb|EPS74283.1|  beta-galactosidase                                      721   0.0      
gb|EYU37950.1|  hypothetical protein MIMGU_mgv1a001345mg                716   0.0      
emb|CDO96919.1|  unnamed protein product                                716   0.0      
ref|XP_011092985.1|  PREDICTED: beta-galactosidase 13-like              709   0.0      
ref|XP_011092984.1|  PREDICTED: beta-galactosidase 13-like              710   0.0      
ref|XP_010028723.1|  PREDICTED: beta-galactosidase 13                   697   0.0      
gb|KCW55522.1|  hypothetical protein EUGRSUZ_I01412                     699   0.0      
ref|XP_006590856.1|  PREDICTED: beta-galactosidase 13-like isofor...    689   0.0      
ref|XP_006590857.1|  PREDICTED: beta-galactosidase 13-like isofor...    687   0.0      
ref|XP_002278545.1|  PREDICTED: beta-galactosidase 13                   688   0.0      Vitis vinifera
gb|KHN25472.1|  Beta-galactosidase 13                                   685   0.0      
ref|XP_002306183.1|  glycosyl hydrolase family 35 family protein        684   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006592069.1|  PREDICTED: beta-galactosidase 13-like              684   0.0      
ref|XP_011088601.1|  PREDICTED: beta-galactosidase 13                   682   0.0      
ref|XP_003607189.1|  Beta-galactosidase                                 677   0.0      
ref|XP_011046271.1|  PREDICTED: beta-galactosidase 13-like              677   0.0      
ref|XP_002312963.1|  glycosyl hydrolase family 35 family protein        677   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009374634.1|  PREDICTED: beta-galactosidase 13-like              672   0.0      
ref|XP_011046693.1|  PREDICTED: beta-galactosidase 13-like              673   0.0      
ref|XP_010066272.1|  PREDICTED: beta-galactosidase 13-like              670   0.0      
gb|KCW64119.1|  hypothetical protein EUGRSUZ_G01775                     672   0.0      
ref|XP_007041847.1|  Glycosyl hydrolase family 35 protein isoform 1     672   0.0      
ref|XP_010090335.1|  Beta-galactosidase 11                              672   0.0      
ref|XP_007131709.1|  hypothetical protein PHAVU_011G035300g             667   0.0      
ref|XP_007221604.1|  hypothetical protein PRUPE_ppa026900mg             662   0.0      
ref|XP_008447961.1|  PREDICTED: beta-galactosidase 13-like              660   0.0      
ref|XP_004144843.1|  PREDICTED: beta-galactosidase 13-like              657   0.0      
gb|KGN43246.1|  hypothetical protein Csa_7G011860                       658   0.0      
ref|XP_008224549.1|  PREDICTED: beta-galactosidase 13-like              659   0.0      
ref|XP_007224244.1|  hypothetical protein PRUPE_ppa019277mg             656   0.0      
ref|XP_008224548.1|  PREDICTED: beta-galactosidase 13-like              657   0.0      
ref|XP_010266335.1|  PREDICTED: beta-galactosidase 13-like              656   0.0      
gb|KDP29648.1|  hypothetical protein JCGZ_18810                         652   0.0      
ref|XP_004505828.1|  PREDICTED: beta-galactosidase 13-like              654   0.0      
ref|XP_008236010.1|  PREDICTED: beta-galactosidase 11-like              650   0.0      
ref|XP_007201748.1|  hypothetical protein PRUPE_ppa001308mg             649   0.0      
ref|XP_004298189.1|  PREDICTED: beta-galactosidase 13-like              644   0.0      
ref|XP_010029662.1|  PREDICTED: beta-galactosidase 13-like              645   0.0      
ref|XP_010941319.1|  PREDICTED: beta-galactosidase 11-like isofor...    646   0.0      
ref|XP_010941318.1|  PREDICTED: beta-galactosidase 11-like isofor...    645   0.0      
ref|XP_007137346.1|  hypothetical protein PHAVU_009G119400g             645   0.0      
ref|XP_004500729.1|  PREDICTED: beta-galactosidase 13-like              645   0.0      
gb|AES74289.2|  glycoside hydrolase family 35 protein                   644   0.0      
ref|XP_007137348.1|  hypothetical protein PHAVU_009G119600g             644   0.0      
gb|KHN33673.1|  Beta-galactosidase 13                                   642   0.0      
ref|XP_003523495.1|  PREDICTED: beta-galactosidase 13                   642   0.0      
gb|KCW56611.1|  hypothetical protein EUGRSUZ_I02332                     641   0.0      
ref|XP_010935389.1|  PREDICTED: beta-galactosidase 11-like              640   0.0      
ref|XP_009406477.1|  PREDICTED: beta-galactosidase 11-like              635   0.0      
ref|XP_009376956.1|  PREDICTED: beta-galactosidase 11-like              638   0.0      
ref|XP_008377743.1|  PREDICTED: beta-galactosidase 13                   637   0.0      
gb|AAS76480.1|  beta-galactosidase                                      637   0.0      Gossypium hirsutum [American cotton]
ref|XP_006486854.1|  PREDICTED: beta-galactosidase 13-like              636   0.0      
ref|XP_008347518.1|  PREDICTED: beta-galactosidase 13-like              634   0.0      
ref|XP_006422606.1|  hypothetical protein CICLE_v10030124mg             635   0.0      
ref|XP_003604038.1|  Beta-galactosidase                                 633   0.0      
ref|XP_004292170.1|  PREDICTED: beta-galactosidase 13-like              625   0.0      
gb|KDO71286.1|  hypothetical protein CISIN_1g045037mg                   627   0.0      
gb|KDO68060.1|  hypothetical protein CISIN_1g035496mg                   626   0.0      
ref|XP_006467171.1|  PREDICTED: beta-galactosidase 13-like              626   0.0      
ref|XP_006425408.1|  hypothetical protein CICLE_v10026929mg             626   0.0      
gb|KHG26973.1|  Beta-galactosidase 13 -like protein                     623   0.0      
ref|XP_008811843.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    623   0.0      
ref|XP_009386767.1|  PREDICTED: beta-galactosidase 11-like              618   0.0      
ref|XP_009419064.1|  PREDICTED: beta-galactosidase 11-like              614   0.0      
emb|CAC13966.1|  putative beta-galactosidase                            607   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006826593.1|  hypothetical protein AMTR_s00138p00054750          609   0.0      
ref|XP_008811847.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    608   0.0      
ref|XP_010548094.1|  PREDICTED: beta-galactosidase 11                   604   0.0      
gb|KFK30461.1|  hypothetical protein AALP_AA7G264100                    606   0.0      
ref|XP_010431800.1|  PREDICTED: beta-galactosidase 14                   606   0.0      
ref|XP_010530895.1|  PREDICTED: beta-galactosidase 11-like isofor...    601   0.0      
ref|XP_002886073.1|  beta-galactosidase 13                              601   0.0      
ref|XP_010690373.1|  PREDICTED: beta-galactosidase 13-like              600   0.0      
gb|AAD24606.1|  putative beta-galactosidase                             600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_179264.2|  beta-galactosidase 13                                 601   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299920.1|  hypothetical protein CARUB_v10016129mg             600   0.0      
ref|XP_010446366.1|  PREDICTED: beta-galactosidase 14-like              599   0.0      
emb|CAB64750.1|  putative beta-galactosidase                            599   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK30139.1|  hypothetical protein AALP_AA7G221900                    597   0.0      
gb|KDP29649.1|  hypothetical protein JCGZ_18811                         596   0.0      
sp|Q9SCU8.2|BGA14_ARATH  RecName: Full=Beta-galactosidase 14; Sho...    598   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002445734.1|  hypothetical protein SORBIDRAFT_07g024870          595   0.0      Sorghum bicolor [broomcorn]
ref|XP_010436953.1|  PREDICTED: beta-galactosidase 14-like isofor...    595   0.0      
ref|XP_010516330.1|  PREDICTED: beta-galactosidase 13 isoform X1        593   0.0      
ref|XP_010235388.1|  PREDICTED: beta-galactosidase 11-like              592   0.0      
ref|NP_195571.2|  beta-galactosidase 14                                 597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101935.1|  PREDICTED: beta-galactosidase 14                   593   0.0      
emb|CAB37515.1|  galactosidase like protein                             597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412163.1|  hypothetical protein EUTSA_v10024392mg             591   0.0      
ref|XP_010516339.1|  PREDICTED: beta-galactosidase 13 isoform X2        591   0.0      
ref|XP_010432357.1|  PREDICTED: beta-galactosidase 11-like              591   0.0      
emb|CDX72747.1|  BnaC07g47690D                                          592   0.0      
ref|XP_010690372.1|  PREDICTED: beta-galactosidase 14-like              590   0.0      
ref|XP_006409401.1|  hypothetical protein EUTSA_v10022550mg             590   0.0      
ref|XP_004974148.1|  PREDICTED: beta-galactosidase 11-like              589   0.0      
emb|CAN73625.1|  hypothetical protein VITISV_026637                     586   0.0      Vitis vinifera
emb|CDY22419.1|  BnaA06g37410D                                          593   0.0      
emb|CDY70118.1|  BnaA07g36410D                                          579   0.0      
ref|XP_010447011.1|  PREDICTED: beta-galactosidase 11                   587   0.0      
ref|XP_008677698.1|  PREDICTED: uncharacterized protein LOC100384...    587   0.0      
ref|XP_002867095.1|  beta-galactosidase 11                              587   0.0      
emb|CDX72512.1|  BnaC07g45340D                                          585   0.0      
ref|XP_008663872.1|  PREDICTED: uncharacterized protein LOC100194...    585   0.0      
ref|NP_567973.1|  beta-galactosidase 11                                 584   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437540.1|  PREDICTED: beta-galactosidase 11-like              584   0.0      
emb|CDY40650.1|  BnaA03g53130D                                          584   0.0      
ref|XP_009138336.1|  PREDICTED: beta-galactosidase 11-like              583   0.0      
dbj|BAK07425.1|  predicted protein                                      581   0.0      
ref|XP_009136326.1|  PREDICTED: beta-galactosidase 13                   580   0.0      
ref|XP_009107264.1|  PREDICTED: beta-galactosidase 11                   579   0.0      
emb|CDX75479.1|  BnaA01g02230D                                          579   0.0      
emb|CAA17766.1|  beta-galactosidase-like protein                        577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154292.1|  beta-galactosidase 14                              583   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285214.1|  hypothetical protein CARUB_v10006573mg             577   0.0      
ref|XP_009121204.1|  PREDICTED: beta-galactosidase 13-like              576   0.0      
ref|XP_009396587.1|  PREDICTED: beta-galactosidase 11-like              572   0.0      
gb|KFK36758.1|  hypothetical protein AALP_AA4G166000                    576   0.0      
emb|CDX69103.1|  BnaC01g03500D                                          575   0.0      
ref|XP_010489252.1|  PREDICTED: beta-galactosidase 13-like              574   0.0      
emb|CDY31414.1|  BnaA07g03490D                                          570   0.0      
gb|EMS61528.1|  Beta-galactosidase 11                                   570   0.0      
gb|EMT25927.1|  Beta-galactosidase 11                                   569   0.0      
emb|CDX89744.1|  BnaC03g46580D                                          573   0.0      
tpg|DAA40653.1|  TPA: hypothetical protein ZEAMMB73_851266              553   0.0      
ref|NP_001169479.1|  uncharacterized protein LOC100383352               550   0.0      Zea mays [maize]
ref|XP_006660363.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    556   0.0      
ref|XP_004959631.1|  PREDICTED: beta-galactosidase 12-like              555   0.0      
ref|XP_008668408.1|  PREDICTED: uncharacterized protein LOC100383...    551   0.0      
gb|EEE70132.1|  hypothetical protein OsJ_30164                          545   3e-180   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576777.1|  PREDICTED: beta-galactosidase 12-like              545   3e-180   
ref|XP_010468659.1|  PREDICTED: beta-galactosidase 13-like              544   4e-180   
ref|XP_010690706.1|  PREDICTED: beta-galactosidase 14-like              542   1e-179   
ref|XP_006660050.1|  PREDICTED: beta-galactosidase 12-like              541   5e-179   
gb|EEC84965.1|  hypothetical protein OsI_32205                          539   2e-178   Oryza sativa Indica Group [Indian rice]
ref|NP_001062440.1|  Os08g0549200                                       540   3e-178   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06282.1|  predicted protein                                      540   3e-178   
gb|EEE69115.1|  hypothetical protein OsJ_28192                          538   2e-177   Oryza sativa Japonica Group [Japonica rice]
sp|Q0IZZ8.2|BGA12_ORYSJ  RecName: Full=Beta-galactosidase 12; Sho...    539   4e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008653570.1|  PREDICTED: beta-galactosidase 12-like              536   5e-177   
emb|CAG30731.1|  beta-galactosidase precursor                           528   9e-174   Triticum monococcum [einkorn wheat]
emb|CAG30724.1|  putative beta-galactosidase precursor                  513   6e-168   Hordeum vulgare [barley]
tpg|DAA64336.1|  TPA: hypothetical protein ZEAMMB73_578897              508   3e-166   
ref|XP_004489161.1|  PREDICTED: beta-galactosidase 13-like              468   2e-155   
emb|CDY02241.1|  BnaA03g39260D                                          484   6e-155   
gb|EEC83995.1|  hypothetical protein OsI_30162                          482   2e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_006434247.1|  hypothetical protein CICLE_v10003478mg             473   5e-153   
ref|XP_007019136.1|  Beta-galactosidase isoform 1                       473   2e-152   
ref|XP_009376872.1|  PREDICTED: beta-galactosidase 16                   467   4e-151   
ref|XP_006472815.1|  PREDICTED: beta-galactosidase 16-like isofor...    468   8e-151   
ref|XP_008338665.1|  PREDICTED: beta-galactosidase 16 isoform X2        464   6e-150   
ref|XP_004171523.1|  PREDICTED: beta-galactosidase 16-like              463   1e-149   
ref|XP_008338663.1|  PREDICTED: beta-galactosidase 16 isoform X1        464   2e-149   
ref|XP_004149808.1|  PREDICTED: beta-galactosidase 16-like              464   2e-149   
ref|XP_006473025.1|  PREDICTED: beta-galactosidase 16-like              464   3e-149   
gb|EMS57945.1|  Beta-galactosidase 12                                   464   3e-149   
ref|XP_010419240.1|  PREDICTED: beta-galactosidase 16                   463   5e-149   
ref|XP_010428819.1|  PREDICTED: beta-galactosidase 16-like              463   5e-149   
gb|EMT17497.1|  Beta-galactosidase 12                                   462   9e-149   
ref|XP_006434246.1|  hypothetical protein CICLE_v10004034mg             461   3e-148   
ref|XP_006390092.1|  hypothetical protein EUTSA_v10018129mg             461   3e-148   
ref|NP_177866.2|  beta-galactosidase 16                                 461   5e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889142.1|  hypothetical protein ARALYDRAFT_476906             461   6e-148   
ref|XP_010471934.1|  PREDICTED: beta-galactosidase 16-like              460   1e-147   
gb|KDO80551.1|  hypothetical protein CISIN_1g004533mg                   456   4e-147   
ref|XP_007221984.1|  hypothetical protein PRUPE_ppa002839mg             452   4e-147   
ref|XP_007041849.1|  Beta-galactosidase 14 isoform 3                    454   6e-147   
gb|KDO80552.1|  hypothetical protein CISIN_1g003612mg                   456   4e-146   
ref|XP_009385110.1|  PREDICTED: beta-galactosidase 7                    454   1e-145   
ref|XP_010269108.1|  PREDICTED: beta-galactosidase 16-like              451   6e-145   
ref|XP_002520337.1|  beta-galactosidase, putative                       451   9e-145   Ricinus communis
ref|XP_008466742.1|  PREDICTED: beta-galactosidase 16 isoform X2        452   1e-144   
ref|XP_002284529.2|  PREDICTED: beta-galactosidase 16-like              451   4e-144   Vitis vinifera
ref|XP_010243519.1|  PREDICTED: beta-galactosidase 16                   451   4e-144   
ref|XP_008219605.1|  PREDICTED: beta-galactosidase 16                   450   7e-144   
gb|KGN47702.1|  hypothetical protein Csa_6G382900                       447   5e-143   
ref|XP_002306647.2|  beta-galactosidase family protein                  446   2e-142   Populus trichocarpa [western balsam poplar]
ref|XP_006301847.1|  hypothetical protein CARUB_v10022317mg             446   3e-142   
ref|XP_011003430.1|  PREDICTED: beta-galactosidase 16-like              445   3e-142   
ref|XP_011069386.1|  PREDICTED: beta-galactosidase 16                   445   4e-142   
emb|CAN64508.1|  hypothetical protein VITISV_004610                     444   5e-142   Vitis vinifera
ref|XP_010664184.1|  PREDICTED: beta-galactosidase 16-like              444   1e-141   
ref|XP_011003960.1|  PREDICTED: beta-galactosidase 16-like              444   1e-141   
ref|XP_008783343.1|  PREDICTED: beta-galactosidase 7-like               442   2e-141   
dbj|BAC43014.1|  unknown protein                                        444   3e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521778.1|  beta-galactosidase, putative                       443   4e-141   Ricinus communis
ref|XP_011027489.1|  PREDICTED: beta-galactosidase 16                   442   6e-141   
ref|NP_001132807.1|  uncharacterized protein LOC100194296               430   9e-141   Zea mays [maize]
ref|XP_002302225.2|  beta-galactosidase family protein                  441   2e-140   Populus trichocarpa [western balsam poplar]
ref|XP_007019138.1|  Beta-galactosidase                                 441   2e-140   
gb|EYU31765.1|  hypothetical protein MIMGU_mgv1a018569mg                438   4e-139   
ref|XP_011069425.1|  PREDICTED: beta-galactosidase 14-like              427   1e-138   
ref|XP_006351205.1|  PREDICTED: beta-galactosidase 16-like              436   2e-138   
ref|XP_008466741.1|  PREDICTED: beta-galactosidase 16 isoform X1        436   4e-138   
emb|CBI18990.3|  unnamed protein product                                433   3e-137   
ref|XP_010312841.1|  PREDICTED: beta-galactosidase 16                   433   3e-137   
tpg|DAA48742.1|  TPA: hypothetical protein ZEAMMB73_126543              429   6e-137   
ref|XP_007041848.1|  Beta-galactosidase 14 isoform 2                    424   1e-135   
ref|XP_002310540.2|  beta-galactosidase family protein                  429   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_004292712.1|  PREDICTED: beta-galactosidase 16-like              427   6e-135   
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   427   6e-135   
gb|KDP44674.1|  hypothetical protein JCGZ_19489                         425   6e-134   
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               425   8e-134   
gb|KHN27041.1|  Beta-galactosidase 3                                    424   1e-133   
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               424   2e-133   
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               423   3e-133   
gb|ABK24373.1|  unknown                                                 423   5e-133   Picea sitchensis
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    422   6e-133   
gb|AEC33272.1|  beta-galactosidase                                      419   6e-133   
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             421   2e-132   
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    421   2e-132   
ref|XP_010106660.1|  Beta-galactosidase 1                               421   3e-132   
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like               421   4e-132   
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   414   4e-132   
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   413   5e-132   
ref|XP_002514108.1|  beta-galactosidase, putative                       419   7e-132   Ricinus communis
gb|EYU22313.1|  hypothetical protein MIMGU_mgv1a001532mg                418   8e-132   
gb|KDP32835.1|  hypothetical protein JCGZ_12127                         417   1e-131   
ref|XP_002306893.1|  beta-galactosidase family protein                  419   1e-131   Populus trichocarpa [western balsam poplar]
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                   414   2e-131   
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               418   2e-131   
emb|CAC84109.1|  putative galactosidae                                  402   4e-131   Gossypium hirsutum [American cotton]
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg             412   4e-131   
gb|AAW47739.1|  beta-galactosidase                                      417   5e-131   Prunus persica
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               417   7e-131   
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          417   7e-131   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    417   7e-131   
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               417   8e-131   
gb|KHN41933.1|  Beta-galactosidase 3                                    417   8e-131   
ref|XP_006645099.1|  PREDICTED: beta-galactosidase 3-like               416   1e-130   
ref|XP_003523206.1|  PREDICTED: beta-galactosidase 10                   416   1e-130   
gb|AAG29193.1|AC078898_3  beta-galactosidase, putative                  414   1e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHN31190.1|  Beta-galactosidase 10                                   417   1e-130   
gb|AGR44464.1|  beta-D-galactosidase 5                                  412   2e-130   
gb|KHN00504.1|  Beta-galactosidase 3                                    416   2e-130   
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    416   2e-130   
ref|XP_010069008.1|  PREDICTED: beta-galactosidase 9 isoform X2         412   2e-130   
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    416   3e-130   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               416   3e-130   
ref|XP_010233215.1|  PREDICTED: beta-galactosidase 7                    415   3e-130   
ref|XP_010935391.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    410   4e-130   
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           414   6e-130   
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      414   9e-130   
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    414   1e-129   Vitis vinifera
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      414   1e-129   
emb|CDP01954.1|  unnamed protein product                                414   2e-129   
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               414   2e-129   
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      413   2e-129   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   413   2e-129   
ref|XP_007048525.1|  Beta-galactosidase 3                               413   2e-129   
ref|XP_008799173.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    413   2e-129   
gb|KDP31634.1|  hypothetical protein JCGZ_14859                         412   3e-129   
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   413   3e-129   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               412   5e-129   
ref|XP_007137754.1|  hypothetical protein PHAVU_009G153100g             412   5e-129   
ref|XP_006645100.1|  PREDICTED: beta-galactosidase 3-like               412   5e-129   
dbj|BAD91082.1|  beta-D-galactosidase                                   412   5e-129   Pyrus pyrifolia [sha li]
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 412   5e-129   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             412   6e-129   
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    412   7e-129   
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               412   7e-129   
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 412   7e-129   
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 412   7e-129   
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                407   8e-129   
gb|ADO34791.1|  beta-galactosidase STBG6                                412   8e-129   
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         412   9e-129   
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like               411   1e-128   
ref|NP_001234317.1|  TBG6 protein precursor                             411   1e-128   
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    411   1e-128   
ref|XP_002510455.1|  beta-galactosidase, putative                       411   2e-128   
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               411   2e-128   
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         410   2e-128   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             411   2e-128   
ref|XP_010069007.1|  PREDICTED: beta-galactosidase 9 isoform X1         412   2e-128   
emb|CDM85192.1|  unnamed protein product                                410   2e-128   
ref|XP_010232635.1|  PREDICTED: beta-galactosidase 3                    410   2e-128   
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               410   2e-128   
ref|XP_006856687.1|  hypothetical protein AMTR_s00054p00133410          410   3e-128   
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      410   4e-128   
gb|EMT22873.1|  Beta-galactosidase 3                                    410   4e-128   
dbj|BAF31233.1|  beta-D-galactosidase                                   410   4e-128   
dbj|BAJ34544.1|  unnamed protein product                                410   4e-128   
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    410   5e-128   
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    410   5e-128   
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             410   5e-128   
dbj|BAK02766.1|  predicted protein                                      409   5e-128   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             409   6e-128   
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               409   7e-128   
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               409   8e-128   
gb|KHN39301.1|  Beta-galactosidase 1                                    409   9e-128   
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    409   9e-128   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               409   9e-128   
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               409   9e-128   
ref|XP_006853356.1|  hypothetical protein AMTR_s00032p00109160          409   1e-127   
ref|XP_006351534.1|  PREDICTED: beta-galactosidase 3-like               409   1e-127   
emb|CAC44500.1|  beta-galactosidase                                     409   1e-127   
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                409   1e-127   
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 408   1e-127   
gb|EEC71891.1|  hypothetical protein OsI_04635                          409   1e-127   
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           408   2e-127   
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               409   2e-127   
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               408   2e-127   
ref|XP_007214623.1|  hypothetical protein PRUPE_ppa001345mg             404   2e-127   
ref|NP_001234303.1|  beta-galactosidase precursor                       408   2e-127   
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    408   2e-127   
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   408   2e-127   
ref|XP_011072090.1|  PREDICTED: beta-galactosidase 10                   409   2e-127   
ref|XP_006581786.1|  PREDICTED: beta-galactosidase 10-like              408   2e-127   
emb|CAB16852.1|  beta-galactosidase like protein                        408   2e-127   
ref|XP_006826783.1|  hypothetical protein AMTR_s00136p00108810          405   2e-127   
gb|ADO34792.1|  beta-galactosidase STBG7                                409   2e-127   
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               408   2e-127   
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    408   2e-127   
ref|NP_568001.1|  beta-galactosidase 3                                  408   2e-127   
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      408   2e-127   
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                406   3e-127   
gb|ADO34788.1|  beta-galactosidase STBG3                                407   3e-127   
ref|NP_001234307.1|  beta-galactosidase, chloroplastic precursor        408   3e-127   
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 407   3e-127   
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    407   3e-127   
ref|NP_001044964.1|  Os01g0875500                                       407   3e-127   
ref|XP_007012844.1|  Beta-galactosidase                                 407   4e-127   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             407   4e-127   
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      406   4e-127   
tpg|DAA56579.1|  TPA: beta-galactosidase isoform 1                      407   4e-127   
gb|KHN36067.1|  Beta-galactosidase 3                                    407   5e-127   
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               407   5e-127   
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    407   5e-127   
gb|ABV32545.1|  beta-galactosidase protein 2                            407   6e-127   
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      407   6e-127   
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             407   6e-127   
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             407   6e-127   
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               407   7e-127   
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    407   8e-127   
ref|XP_010113483.1|  Beta-galactosidase 3                               406   8e-127   
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      406   9e-127   
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               406   9e-127   
dbj|BAF31234.1|  beta-D-galactosidase                                   406   9e-127   
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    406   1e-126   
ref|XP_002456725.1|  hypothetical protein SORBIDRAFT_03g041450          406   1e-126   
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               406   1e-126   
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    406   1e-126   
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    406   1e-126   
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    406   1e-126   
gb|ACC64533.1|  beta-galactosidase 11                                   393   1e-126   
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               406   1e-126   
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 405   1e-126   
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               406   1e-126   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    405   2e-126   
ref|XP_002310279.2|  beta-galactosidase family protein                  405   2e-126   
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    405   2e-126   
gb|EMS61058.1|  Beta-galactosidase 7                                    405   2e-126   
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         404   2e-126   
gb|EMT22872.1|  Beta-galactosidase 3                                    403   2e-126   
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               405   2e-126   
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             405   2e-126   
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             405   2e-126   
dbj|BAG95687.1|  unnamed protein product                                407   3e-126   
ref|XP_008227597.1|  PREDICTED: beta-galactosidase 10                   405   3e-126   
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      405   3e-126   
ref|XP_006376211.1|  beta-galactosidase family protein                  403   4e-126   
ref|XP_008438342.1|  PREDICTED: beta-galactosidase 9 isoform X2         401   5e-126   
ref|XP_010243524.1|  PREDICTED: beta-galactosidase 10 isoform X1        405   5e-126   
gb|ABK96254.1|  unknown                                                 404   5e-126   
ref|XP_006385360.1|  beta-galactosidase 1 family protein                404   6e-126   
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         404   6e-126   
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       400   7e-126   
ref|XP_004961993.1|  PREDICTED: beta-galactosidase 7-like isoform X2    403   7e-126   
ref|XP_007214624.1|  hypothetical protein PRUPE_ppa001345mg             404   7e-126   
ref|NP_849506.1|  beta-galactosidase 3                                  404   1e-125   
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      403   1e-125   
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     404   1e-125   
emb|CDO97918.1|  unnamed protein product                                403   1e-125   
ref|XP_010274044.1|  PREDICTED: beta-galactosidase 9 isoform X1         404   1e-125   
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               403   2e-125   
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   403   2e-125   
ref|XP_010907797.1|  PREDICTED: beta-galactosidase 3 isoform X1         403   2e-125   
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    402   2e-125   
dbj|BAD91084.1|  beta-D-galactosidase                                   403   2e-125   
ref|XP_006854486.1|  hypothetical protein AMTR_s00175p00032740          404   2e-125   
ref|XP_004298203.1|  PREDICTED: beta-galactosidase 9-like               398   2e-125   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    402   2e-125   
gb|AHG94611.1|  beta-galactosidase                                      402   2e-125   
emb|CDP18451.1|  unnamed protein product                                399   2e-125   
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                402   2e-125   
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               403   3e-125   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    402   3e-125   
gb|KDP39343.1|  hypothetical protein JCGZ_01100                         404   3e-125   
ref|XP_008394191.1|  PREDICTED: beta-galactosidase 10                   402   4e-125   
ref|XP_009621448.1|  PREDICTED: beta-galactosidase 10                   402   4e-125   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             402   5e-125   
dbj|BAF01862.1|  beta-galactosidase like protein                        393   7e-125   
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   402   7e-125   
gb|KHN06610.1|  Beta-galactosidase                                      401   7e-125   
gb|KFK31109.1|  hypothetical protein AALP_AA6G069300                    401   8e-125   
gb|KDO75774.1|  hypothetical protein CISIN_1g037925mg                   400   9e-125   
ref|XP_006296364.1|  hypothetical protein CARUB_v10025536mg             402   1e-124   
ref|XP_004166954.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    395   1e-124   
ref|XP_006468221.1|  PREDICTED: beta-galactosidase 8-like               402   1e-124   
gb|AGR44466.1|  beta-D-galactosidase 7                                  401   1e-124   
ref|NP_001049068.1|  Os03g0165400                                       400   1e-124   
gb|AGW47883.1|  beta-galactosidase precursor                            400   1e-124   
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    400   2e-124   
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       399   2e-124   
ref|XP_003612092.1|  Beta-galactosidase                                 400   2e-124   
ref|XP_010911843.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    400   2e-124   
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      400   2e-124   
ref|XP_004147332.1|  PREDICTED: beta-galactosidase 3-like               400   2e-124   
gb|ADD62393.1|  beta-galactosidase 3                                    395   2e-124   
gb|EEE58382.1|  hypothetical protein OsJ_09539                          400   2e-124   
ref|XP_004970751.1|  PREDICTED: beta-galactosidase 3-like               400   2e-124   
gb|AAQ21370.1|  beta-galactosidase                                      392   2e-124   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               400   2e-124   
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               400   3e-124   
emb|CDY59693.1|  BnaC07g51120D                                          400   3e-124   
gb|KEH18344.1|  beta-galactosidase                                      399   3e-124   
ref|XP_010469543.1|  PREDICTED: beta-galactosidase 9 isoform X2         399   4e-124   
ref|XP_007024475.1|  Beta galactosidase 1                               399   4e-124   
ref|NP_001289210.1|  beta-galactosidase 10 precursor                    400   4e-124   
ref|XP_008438341.1|  PREDICTED: beta-galactosidase 9 isoform X1         400   4e-124   
gb|EEC74580.1|  hypothetical protein OsI_10152                          399   5e-124   
ref|XP_009355857.1|  PREDICTED: beta-galactosidase 10                   399   5e-124   
ref|XP_010090040.1|  hypothetical protein L484_027271                   399   5e-124   
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    399   6e-124   
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             399   6e-124   
gb|ACC60981.1|  beta-galactosidase 1 precursor                          399   7e-124   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             399   7e-124   
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          399   7e-124   
ref|XP_010052369.1|  PREDICTED: beta-galactosidase 6-like isoform X3    395   7e-124   
ref|XP_011043264.1|  PREDICTED: beta-galactosidase 6-like isoform X1    398   8e-124   
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               399   8e-124   
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               397   8e-124   
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               398   1e-123   
gb|AAM22973.1|AF499737_1  beta-galactosidase                            398   1e-123   
ref|XP_009767061.1|  PREDICTED: beta-galactosidase 10                   399   1e-123   
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              398   1e-123   
emb|CAN78072.1|  hypothetical protein VITISV_013292                     398   2e-123   
gb|AAQ62586.1|  putative beta-galactosidase                             399   2e-123   
emb|CBI19767.3|  unnamed protein product                                398   2e-123   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             397   2e-123   
gb|KHN47945.1|  Beta-galactosidase 9                                    399   2e-123   
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    397   2e-123   
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   398   2e-123   
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    397   3e-123   
ref|XP_006369293.1|  beta-galactosidase 1 family protein                397   3e-123   
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    397   3e-123   
ref|NP_001151478.1|  LOC100285111 precursor                             397   3e-123   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      397   3e-123   
gb|EAY89299.1|  hypothetical protein OsI_10800                          397   3e-123   
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         395   3e-123   
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      397   4e-123   
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    397   4e-123   
ref|XP_002527409.1|  beta-galactosidase, putative                       397   4e-123   
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     396   6e-123   
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                396   7e-123   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    396   7e-123   
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               396   7e-123   
ref|NP_001049591.1|  Os03g0255100                                       399   8e-123   
ref|XP_004970752.1|  PREDICTED: beta-galactosidase 7-like               395   8e-123   
ref|XP_006373075.1|  beta-galactosidase family protein                  397   9e-123   
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               395   1e-122   
gb|KHN32687.1|  Beta-galactosidase 1                                    395   1e-122   
ref|XP_010052368.1|  PREDICTED: beta-galactosidase 6-like isoform X2    394   1e-122   
ref|XP_006420948.1|  hypothetical protein CICLE_v10004268mg             392   1e-122   
emb|CBI35944.3|  unnamed protein product                                395   1e-122   
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      395   1e-122   
gb|AHC32021.1|  beta-galactosidase 3                                    397   1e-122   
gb|KHN09646.1|  Beta-galactosidase 3                                    408   1e-122   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    395   1e-122   
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               395   1e-122   
gb|AHL69742.1|  beta-galactosidase                                      395   1e-122   
ref|XP_004165591.1|  PREDICTED: beta-galactosidase 9-like               393   2e-122   
dbj|BAF02242.1|  putative galactosidase                                 387   2e-122   
gb|AET04139.2|  beta-galactosidase                                      397   2e-122   
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    395   2e-122   
ref|XP_003629663.1|  Beta-galactosidase                                 397   2e-122   
emb|CDY23785.1|  BnaC04g43370D                                          396   2e-122   
ref|XP_008383809.1|  PREDICTED: beta-galactosidase 8-like               395   2e-122   
gb|KDP20900.1|  hypothetical protein JCGZ_21371                         395   2e-122   
gb|KHN30042.1|  Beta-galactosidase 1                                    394   2e-122   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               394   3e-122   
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         393   3e-122   
ref|XP_010052367.1|  PREDICTED: beta-galactosidase 8-like isoform X1    394   3e-122   
ref|XP_002317239.1|  beta-galactosidase family protein                  394   4e-122   
gb|ACC64531.1|  beta-galactosidase 6                                    393   5e-122   
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 394   5e-122   
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 394   5e-122   
ref|XP_002881245.1|  hypothetical protein ARALYDRAFT_902346             395   5e-122   



>gb|ACC60982.1| beta-galactosidase 2 precursor [Petunia x hybrida]
Length=830

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/577 (60%), Positives = 440/577 (76%), Gaps = 2/577 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G T SSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTSSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT  + KIN D EIT FE     
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPTVQKINQDLEITVFEKPGST  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T +P+T+ FRG DYYLP KSVSILPDCK +++NTQ I++QHN R F  S+
Sbjct  374   DCAAFLTNNHTTQPSTIKFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFITSE  433

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              + NLKWEM+QE +PTI  LP K+  P E+Y+LTK T+DY W+ST + + + DLPMRPDI
Sbjct  434   KSKNLKWEMYQEKVPTIADLPLKNREPLELYSLTKDTSDYAWYSTSITLERHDLPMRPDI  493

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA+  F+NGE+ G+ HGNN+ K F+  +P+ LKPGTN IT L   + +PN
Sbjct  494   LPVLQIASMGHALAAFVNGEYVGFGHGNNIEKSFVFQKPIILKPGTNTITILAETVGFPN  553

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+ V +  LM G  DIT+N+W + +G  GEK +LFTEEGA+K +W PVT
Sbjct  554   SGAYMEKRFAGPRGVTIQGLMAGTLDITQNNWGHEVGVFGEKQELFTEEGAKKVQWTPVT  613

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYKT+FD PEGN+P+A+ M+KM KGM+WVNGKS+GRYW SFL+PLGQPTQ 
Sbjct  614   GPPKG-AVTWYKTYFDAPEGNNPVALKMDKMEKGMMWVNGKSLGRYWTSFLSPLGQPTQA  672

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKP NNLLV+FEE GG P +I+V  VNRDTICS + E +PP VK WER G +
Sbjct  673   EYHIPRAYLKPTNNLLVIFEETGGHPTNIEVQTVNRDTICSIITEYHPPHVKSWERSGTD  732

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F A  +DLK   HLTCPD K+++K+EFASYGNP+G CGN   G+C+  N++K+VE+ CLG
Sbjct  733   FVAVVEDLKSGAHLTCPDNKIIEKVEFASYGNPDGACGNLFNGNCNSANSLKVVEQHCLG  792

Query  1622  KTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCVRQ  1729
             K  C +P+E+ ++ E  KD CP I KTLAVQ KC ++
Sbjct  793   KNTCTIPIEREIYDEPSKDPCPNIFKTLAVQVKCGKK  829



>ref|XP_009789713.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=837

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/576 (60%), Positives = 437/576 (76%), Gaps = 3/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR +GDPP QRSAED++FSV RF++K+GT  NYYMY+GG NFG T SSFV+T 
Sbjct  258   TENWTAQYRTYGDPPAQRSAEDLAFSVARFFAKNGTLTNYYMYYGGTNFGRTSSSFVTTR  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL-  358
             YYDE P+D +G  RDPKWSHLRD HRAL+L ++ LLWGT  + KIN + EIT +E     
Sbjct  318   YYDEAPIDEFGLMRDPKWSHLRDLHRALRLSRRALLWGTPTVQKINENLEITVYEKPGPD  377

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              +CAAFL+NN+T  P+ + FRG +YYLP KS+SIL DCK +++NTQ +++QHN R F PS
Sbjct  378   HMCAAFLTNNHTKLPSNITFRGAEYYLPEKSISILADCKTVVYNTQTVVSQHNSRNFVPS  437

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + A NLKWE++QE IPTI  L  K+  P E+Y+LTK  +DY W+ST + +++RDLPMRPD
Sbjct  438   EKAKNLKWEIYQEKIPTIHDLALKNRDPLELYSLTKDKSDYAWYSTSINLDRRDLPMRPD  497

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL + SMGHA++ F+NG++ G+ HGNN+ K F+  QPV LKPG N IT L   + YP
Sbjct  498   ILPVLQIASMGHALVAFVNGQYVGFGHGNNIEKSFVFRQPVILKPGINHITLLAETIGYP  557

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME+R+AGP+ V L  LM G  DIT N W + +G  GEK +LFTEEGA+K KW  +
Sbjct  558   NSGAYMEKRFAGPRGVTLQGLMAGTLDITLNVWGHEVGVYGEKEQLFTEEGAKKVKWTSL  617

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TW KT+FD PEG DP+A+ M KM KGM+WVNGKS+GRYW SFL+PLGQPTQ
Sbjct  618   AG-PPPGPVTWLKTYFDAPEGTDPVALRMNKMQKGMMWVNGKSLGRYWASFLSPLGQPTQ  676

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR +LKPKNNLLVVFEE GG P++I+++ VNRDTICS + E +PP+VK WER G 
Sbjct  677   SEYHIPRAFLKPKNNLLVVFEETGGHPETIQIVTVNRDTICSMITEYHPPNVKYWERSGS  736

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +FRA  +DLK   HLTCPD  V++K+EFASYG+P+G CGNF  G+C+ PN+IK+ EK CL
Sbjct  737   KFRAVVEDLKAGAHLTCPDDNVIEKVEFASYGDPDGACGNFYIGNCTSPNSIKVAEKYCL  796

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCV  1723
             GK  C VPVE+ +F E  KD CP I KTLAVQ KCV
Sbjct  797   GKHTCSVPVEREVFDEPNKDPCPNIFKTLAVQVKCV  832



>ref|XP_009764615.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=829

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/575 (60%), Positives = 439/575 (76%), Gaps = 5/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G TGSSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTGSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT ++ KIN   EIT +E     
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPSVQKINQHLEITVYEKPGTD  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P T+ FRG +YYLP KSVSILPDCK +++NTQ I++QHN R F PS+
Sbjct  374   -CAAFLTNNHTTLPATIKFRGREYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFLPSE  432

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PTI  L  K+  P E+Y+LTK T+DY W+ST +  ++ DLPMRPDI
Sbjct  433   KAKNLKWEMYQEKVPTISDLSLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDI  492

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN I+ L   + +PN
Sbjct  493   LPVLQIASMGHALSAFVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPN  552

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+ + +  LM G  DIT+N+W + +G  GEK +LFTEEGA+K KW PV 
Sbjct  553   SGAYMEKRFAGPRGITVQGLMAGTLDITQNNWGHEVGVFGEKEQLFTEEGAKKVKWTPVN  612

Query  1082  GNHNTRRA-TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             G   T+ A TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYW SFL+PLGQPTQ
Sbjct  613   G--PTKGAVTWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQ  670

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKP NNLLV+FEE GG P++I+V +VNRDTICS + E +PP VK WER G 
Sbjct  671   FEYHIPRAFLKPTNNLLVIFEETGGHPETIEVQIVNRDTICSIITEYHPPHVKSWERSGT  730

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F A  +DLK   HLTCP  K+++K+EFASYGNP+G CGN   G+C+  N++K+VEK CL
Sbjct  731   DFVAVVEDLKSGAHLTCPSNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVVEKYCL  790

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             GK  C VP+E+ ++ E  KD CP I KTLAVQ KC
Sbjct  791   GKNTCTVPIEREVYDEASKDPCPNIFKTLAVQMKC  825



>ref|XP_009608903.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=837

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/576 (60%), Positives = 435/576 (76%), Gaps = 3/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR +GDPP QRSAED++FSV RF++K+GT  NYYMY+GG NFG T SSFV+T 
Sbjct  258   TENWTAQYRTYGDPPAQRSAEDLAFSVARFFAKNGTLTNYYMYYGGTNFGRTSSSFVTTR  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL-  358
             YYDE P+D +G  RDPKWSHLRD HRAL+L ++ LLWGT  + KIN + EIT +E     
Sbjct  318   YYDEAPLDEFGLMRDPKWSHLRDLHRALRLSRRALLWGTPTVQKINENLEITVYEKPGPD  377

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              +CAAFL+NN+T  P+ + FRG +YYLP KS+SIL DCK +++NTQ +++QHN R F PS
Sbjct  378   HMCAAFLTNNHTKLPSNITFRGAEYYLPEKSISILADCKTVVYNTQTVVSQHNSRNFVPS  437

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + A NLKWE++QE +PTI  L  K+  P E+Y+LTK  +DY W+ST + +++RDLPMRPD
Sbjct  438   EKAKNLKWEIYQEKVPTIHDLALKNRDPLELYSLTKDKSDYAWYSTSINLDRRDLPMRPD  497

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL + SMGHA++ F+NG++ G+ HGNN+ K F+  QPV LKPG N IT L   + YP
Sbjct  498   ILPVLQIASMGHALVAFVNGQYVGFGHGNNIEKSFVFRQPVVLKPGINHITLLAETIGYP  557

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME+R+AGP+ V L  LM G  DIT N W + +G  GEK +LFTEEGA+K KW  +
Sbjct  558   NSGAYMEKRFAGPRGVTLQGLMAGTLDITLNVWGHEVGVYGEKEQLFTEEGAKKVKWNSL  617

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TW KT+FD PEG DP+A+ M+KM KGM+WVNGKS+GRYW SFL+PLGQPTQ
Sbjct  618   AG-PPPGPVTWLKTYFDAPEGTDPVALRMDKMQKGMMWVNGKSLGRYWASFLSPLGQPTQ  676

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR +LKP NNLLVVFEE GG P+ I+++ VNRDTICS + E +PP+VK WER   
Sbjct  677   SEYHIPRAFLKPNNNLLVVFEETGGHPEIIQIVTVNRDTICSMITEYHPPNVKYWERSRS  736

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +FRA  +DLK   HLTCPD  V++K+EFASYG+P+G CGNF  G+C+ PN+IK+ EK CL
Sbjct  737   KFRAVVEDLKAGAHLTCPDDNVIEKVEFASYGDPDGACGNFYMGNCTSPNSIKVAEKYCL  796

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCV  1723
             GK  C +PVE+ +F E  KD CP I KTLAVQ KCV
Sbjct  797   GKHTCSIPVEREVFDEPNKDPCPNIFKTLAVQVKCV  832



>ref|XP_010315380.1| PREDICTED: beta-galactosidase 13-like [Solanum lycopersicum]
Length=775

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/575 (59%), Positives = 434/575 (75%), Gaps = 2/575 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QRSAED++FSV RF++K+GT  NYYMY GG NFG + SSFV+T 
Sbjct  197   TENWTAQYRTFGDPPSQRSAEDLAFSVARFFAKNGTLTNYYMYHGGTNFGRSSSSFVTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  RDPKWSHLRD HRAL+L ++ LLWG   + KIN D EIT +ENT   
Sbjct  257   YYDEAPLDEFGLMRDPKWSHLRDLHRALRLSRRALLWGNPTVQKINQDLEITVYENTGEH  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T +P+ + FRG +YYLP KSVSIL DCK +++NTQ +++QHN R F PS+
Sbjct  317   MCAAFLTNNHTTQPSNITFRGANYYLPEKSVSILADCKTVVYNTQTVVSQHNSRNFVPSE  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PT++ L  K+  P E+Y+LTK  +DY W+ST + +N+ DLPMR DI
Sbjct  377   KAKNLKWEMYQEKVPTVNELALKNREPLELYSLTKDKSDYAWYSTSINVNRHDLPMRSDI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
               VL V SMGHA+  F+NG++ G+ HGNN+ K F+  QP+ LK G NDIT L  ++ YPN
Sbjct  437   LTVLQVASMGHALAAFVNGQYIGFGHGNNIDKSFVFRQPIVLKRGVNDITLLGELVGYPN  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP++V +  LM G  DIT N W + +G  GEK ++FTEEGA+K KW PVT
Sbjct  497   SGAYMEKRFAGPRAVTIQGLMAGTLDITLNVWGHEVGVSGEKEQVFTEEGAKKVKWTPVT  556

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKT+FD PEG DP+A+ M+KM KGM+WVNGKS+GRYWVSFL+PLGQPTQ+
Sbjct  557   ATP-PGPVTWYKTYFDAPEGTDPVALKMDKMQKGMLWVNGKSLGRYWVSFLSPLGQPTQS  615

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYH+PR +LKP NNLLVVFEE GG P+ I+++ VNRDTICS + E +PP+VK +E  G +
Sbjct  616   EYHVPRAFLKPSNNLLVVFEETGGHPEKIEIVTVNRDTICSMITEYHPPNVKNFESSGSK  675

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F    +DLK   HLTCPD  V++K+EFASYG+P+G CGNF  G+C+  N+IK+ EK CLG
Sbjct  676   FCPVVEDLKAGAHLTCPDDNVIEKVEFASYGDPDGACGNFTMGTCTSQNSIKVAEKYCLG  735

Query  1622  KTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCV  1723
             K  C +P+E+  F E  KD CP I KTLAVQ KCV
Sbjct  736   KHTCTIPIERVTFDEPNKDPCPNIFKTLAVQVKCV  770



>ref|XP_009605185.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=829

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/575 (60%), Positives = 439/575 (76%), Gaps = 5/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G TGSSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTGSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT ++ KIN + EIT +E     
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPSVQKINQNLEITVYEKPGSD  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P T+ FRG +YYLP KSVSILPDCK +++NTQ I++QHN R F PS+
Sbjct  374   -CAAFLTNNHTTLPATIKFRGKEYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFLPSE  432

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PTI  LP K+  P E+Y+LTK T+DY W+ST +  ++ DLPMRPDI
Sbjct  433   KAKNLKWEMYQEKVPTISDLPLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDI  492

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN I+ L   + +PN
Sbjct  493   LPVLQIASMGHALSAFVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPN  552

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+ V +  LM+G  DIT N+W + +G  GEK +LFTEEGA+K KW PV 
Sbjct  553   SGAYMEKRFAGPRGVTVQGLMSGTLDITLNNWGHEVGVFGEKEQLFTEEGAKKVKWTPVN  612

Query  1082  GNHNTRRA-TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             G   T+ A TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYW SFL+PLGQPTQ
Sbjct  613   G--PTKGAVTWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQ  670

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKPKNNLLV+FEE GG P++I+V  VNRDTICS + E +PP VK W + G 
Sbjct  671   YEYHIPRAFLKPKNNLLVIFEETGGLPETIEVQTVNRDTICSIITEYHPPHVKSWGKSGT  730

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F A  +DLK   HLTCPD K+++K+EFASYGNP+G CGN   G+C+  N++K+ E+ CL
Sbjct  731   DFVAIVEDLKSGAHLTCPDNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVAERHCL  790

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             GK  C +P+E+ ++ E   D CP I KTLAVQ KC
Sbjct  791   GKNTCTIPIERQVYDEPSNDPCPNIFKTLAVQMKC  825



>dbj|BAO02512.1| predicted beta-galactosidase ortholog [Nicotiana alata]
Length=829

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/575 (60%), Positives = 437/575 (76%), Gaps = 5/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G T SSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTSSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT ++ KIN D EIT +E     
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPSVQKINQDLEITVYEKPGTD  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P T+ FRG +YYLP KSVSILPDCK +++NTQ I++QHN R F  S+
Sbjct  374   -CAAFLTNNHTTLPATIKFRGKEYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFIASE  432

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PTI  L  K+  P E+Y+LTK T+DY W+ST +  ++ DLPMRPDI
Sbjct  433   KAKNLKWEMYQEKVPTISDLSLKNKEPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDI  492

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN I+ L   + +PN
Sbjct  493   LPVLQIASMGHALSAFVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPN  552

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+ V +  LM G  D+T+N+W + +G  GEK +LFTEEG +K KW PV 
Sbjct  553   SGAYMEKRFAGPRGVTVQGLMAGTLDVTQNNWGHEVGVFGEKEQLFTEEGTKKVKWTPVN  612

Query  1082  GNHNTRRA-TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             G   T+ A TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYW SFL+PLGQPTQ
Sbjct  613   G--PTKGAVTWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQ  670

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKP NNLLV+FEE GG P++I+V  VNRDTICS + E +PP VK WER G 
Sbjct  671   FEYHIPRAFLKPTNNLLVIFEETGGHPETIEVQTVNRDTICSIITEYHPPHVKSWERSGT  730

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F A  +DLK   HLTCPD K+++K+EFASYGNP+G CGN   G+C+  N++K+VEK CL
Sbjct  731   DFVAVVEDLKSGAHLTCPDNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVVEKHCL  790

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             GK  C +P+E+ ++ E  KD CP + KTLAVQ KC
Sbjct  791   GKNTCTIPIEREVYDEPSKDPCPNMFKTLAVQMKC  825



>ref|XP_009784203.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=831

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/575 (60%), Positives = 437/575 (76%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY GG NFG TGSSFV+T 
Sbjct  256   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYHGGTNFGRTGSSFVTTR  315

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRA++L ++ LLWGT  + KI+ D EIT +E     
Sbjct  316   YYDEAPLDEFGLKREPKWSHLRDLHRAIRLSRRALLWGTPTVQKISQDLEITVWEKPGSD  375

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P+T+ FR  +YYLP KSVSILPDCK +++NTQ ++AQHN R F  S+
Sbjct  376   -CAAFLTNNHTKLPSTIKFRDQEYYLPEKSVSILPDCKTVVYNTQTVVAQHNSRNFIASE  434

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PTI+ LP K+  P E+Y+LTK T+DY W+ST +  N+ DLPMRPDI
Sbjct  435   KAKNLKWEMYQEKVPTINDLPLKNREPLELYSLTKDTSDYAWYSTSINFNRHDLPMRPDI  494

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PV+ + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN IT L   + +PN
Sbjct  495   LPVMSIASMGHALAAFVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNHITLLAETIGFPN  554

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+ + L  LM G  DIT N+W + +G  GEK ++FTEEGA+K KW PV+
Sbjct  555   SGAYMEKRFAGPRGITLQGLMAGTLDITLNNWGHKVGISGEKEQIFTEEGAKKVKWTPVS  614

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYWVSFL+PLGQPTQ+
Sbjct  615   G-PPPGPITWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWVSFLSPLGQPTQS  673

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKPK+NLLV+FEE GG P++IKV  VNRDTICS ++E  PP VK +ER G +
Sbjct  674   EYHIPRAFLKPKDNLLVIFEETGGLPETIKVQTVNRDTICSIISEYRPPSVKSFERSGSQ  733

Query  1442  FRATTDDLKPRMHLTCPD-AKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             F A  +DLK    L CP+  +V+KKIEFASYGNP+G CGN   G+C+ PN++K+VE+ CL
Sbjct  734   FNAIVEDLKSGAQLACPENNQVIKKIEFASYGNPDGACGNLYLGNCTSPNSLKVVEQHCL  793

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             GK  C +PVE+  F E  KD CP   KTLAVQAKC
Sbjct  794   GKNTCAIPVEREAFDELSKDPCPNTFKTLAVQAKC  828



>ref|XP_009631007.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=831

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/575 (60%), Positives = 439/575 (76%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY GG NFG TGSSFV+T 
Sbjct  256   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYHGGTNFGRTGSSFVTTR  315

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT  + KI+ D EIT +E     
Sbjct  316   YYDEAPLDEFGLKREPKWSHLRDLHRALRLSRRALLWGTPTVQKISHDLEITVWEKPGSD  375

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P+T+ FRG +YYLP KSVSILPDCK +++NTQ ++AQHN R F  S+
Sbjct  376   -CAAFLTNNHTKLPSTIKFRGQEYYLPEKSVSILPDCKTVVYNTQTVVAQHNSRNFIASE  434

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A NLKWEM+QE +PTI+ LP K+  P E+Y+LTK T+DY W+ST + +N+ DLPMRPDI
Sbjct  435   KAKNLKWEMYQEKVPTINDLPLKNREPLELYSLTKDTSDYAWYSTSINLNRHDLPMRPDI  494

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PV+ + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN IT L   + +PN
Sbjct  495   LPVMSIASMGHALAAFVNGEFVGFAHGNNIEKSFVFQKPVILKPGTNHITLLAETVGFPN  554

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+++ L  LM G  DI+ N+W + +G  GEK ++FTEEGA+K KW PV+
Sbjct  555   SGAYMEKRFAGPRAITLQGLMAGTLDISLNNWGHKVGIYGEKKQIFTEEGAKKVKWTPVS  614

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYWVSFL+PLGQPTQ+
Sbjct  615   G-PPPGPITWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWVSFLSPLGQPTQS  673

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKPK+NLLV+FEE GG  ++I+V  VNRDTICS ++E  PP VK +ER G +
Sbjct  674   EYHIPRAFLKPKDNLLVIFEETGGHSETIEVQTVNRDTICSIISEYRPPSVKSFERSGRQ  733

Query  1442  FRATTDDLKPRMHLTCPD-AKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             F A  +DLK    L CP+  +V+K+IEFASYGNP+G CGN   G+C+ PN++K+VEK CL
Sbjct  734   FNAIVEDLKSGAQLACPENNQVIKQIEFASYGNPDGACGNLYLGNCTSPNSLKVVEKHCL  793

Query  1619  GKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             GK  C +PVE+  F E  KD CP   KTLAVQAKC
Sbjct  794   GKNTCAIPVEREAFDELSKDPCPNTFKTLAVQAKC  828



>ref|XP_004248657.1| PREDICTED: beta-galactosidase 13-like [Solanum lycopersicum]
Length=829

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/577 (58%), Positives = 430/577 (75%), Gaps = 3/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+F+V RF++K+GT  NYYMY+GG N+G TGSSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFAVARFFAKNGTLTNYYMYYGGTNYGRTGSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT  + KI+ D EIT +E     
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPTVQKISADLEITVYEKQGTD  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFL+NN+T  P T+ FRG DYYLP KSVSILPDCK +++NTQ I++QHN R F  S+
Sbjct  374   -CTAFLTNNHTTNPATIKFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFVASE  432

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKWE +QE +PT   LP K+  P E+Y+LTK T+DY W+ST V   + DLPMRPDI
Sbjct  433   KAKGLKWEKYQEKVPTSSDLPLKNREPLELYSLTKDTSDYAWYSTSVTFERHDLPMRPDI  492

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA++ F+NGE+ G+ HGNN+ K F+  +PV LKPGTN I+ L   + +PN
Sbjct  493   LPVLQIASMGHALVAFVNGEYVGFGHGNNIEKGFVFQKPVVLKPGTNTISILAETVGFPN  552

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+++ +  LM G  DIT+N+W + +G  GEK KLFTEEGA+K KW PV+
Sbjct  553   SGAYMEKRFAGPRAITIQGLMAGTLDITQNNWGHEVGVFGEKEKLFTEEGAKKVKWTPVS  612

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  N    TWYKT FD PEGN+P+AV M+KM KGM+WVNG S+GRYW SFL+PLGQPTQ 
Sbjct  613   GPTNG-ATTWYKTTFDAPEGNNPLAVKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQF  671

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N+LVVFEE GG+P  I++  VNRDTICS + E +PP+VK WER G  
Sbjct  672   EYHIPRAFVKPTGNVLVVFEETGGNPADIEIQTVNRDTICSIITEYHPPNVKSWERSGTN  731

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F A  +DLK   HLTCPD K+++K+EFASYGNP+G CGN   G+C+   ++ + ++ CLG
Sbjct  732   FVAIVEDLKTGAHLTCPDNKIIEKVEFASYGNPDGACGNLAVGTCNSAKSMAVAQEKCLG  791

Query  1622  KTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCVRQ  1729
             K  C +P+E+ ++ E  KD CP I KTLAVQ KC  +
Sbjct  792   KNSCTIPIEREIYDEPSKDPCPNIFKTLAVQMKCANK  828



>ref|XP_006366982.1| PREDICTED: beta-galactosidase 13-like [Solanum tuberosum]
Length=829

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/574 (59%), Positives = 431/574 (75%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G T SSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTSSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT  + K+N D EIT +E     
Sbjct  314   YYDEAPLDEFGLFREPKWSHLRDLHRALRLSRRALLWGTPTVQKVNRDIEITIYEKKGSD  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T  P T+ FRG DYYLP KSVSILPDCK +++NTQ I++QHN R F  S+
Sbjct  374   -CAAFLTNNHTTNPATVKFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFVASE  432

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKWE +QE +PTI  L  K+  P E+YTLTK T+DY W+ST +  ++ DLPMRPDI
Sbjct  433   KAKGLKWEKYQEKVPTISELSLKNREPLELYTLTKDTSDYAWYSTSIKFDRHDLPMRPDI  492

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + SMGHA+  F+NGE+ G+ HGNN+ K F+  +P+ LKPGTN I+ L   + +PN
Sbjct  493   LPVLQIASMGHALAAFVNGEYIGFGHGNNIEKSFVFQKPIVLKPGTNTISILAETVGFPN  552

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+++ +  LM G  DIT+N W + +G  GEK +LF+EEGA+K KW PVT
Sbjct  553   SGAYMEKRFAGPRAITIQGLMAGTLDITQNDWGHEVGVFGEKEQLFSEEGAKKVKWTPVT  612

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  N    TWYKT F+ PEGN+P+AV M+KM KGM+WVNG S+GRYW SFL+PLGQPTQ 
Sbjct  613   GPTNG-AVTWYKTTFEAPEGNNPLAVKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQF  671

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKP +N+LVVFEE GG+P  I++  VNRDTICS + E +PP+VK WER G  
Sbjct  672   EYHIPRAFLKPTDNVLVVFEETGGNPADIEIQTVNRDTICSIITEYHPPNVKSWERSGTN  731

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F A  +DLK   HLTCPD K+++K+EFASYGNP+G CGN + G+C+   ++++ E+ CLG
Sbjct  732   FVAIVEDLKTGAHLTCPDDKIIEKVEFASYGNPDGACGNLIVGTCNSAKSMQVAEEKCLG  791

Query  1622  KTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             K  C +P+E+ ++ E  KD CP I KTLAVQ KC
Sbjct  792   KNSCTIPIEREIYDEPSKDPCPDIFKTLAVQMKC  825



>gb|EYU40437.1| hypothetical protein MIMGU_mgv1a002461mg [Erythranthe guttata]
Length=671

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/575 (57%), Positives = 428/575 (74%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGD P QR AED++FSV RF++++GT  NYYMY GG NFG T SSFV+T 
Sbjct  97    TENWTAQYRVFGDSPSQRPAEDLAFSVARFFTRNGTLNNYYMYHGGTNFGRTSSSFVTTR  156

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PK+ HLRD HRAL+L KKPLLWGT N+ KI+ D EITT+E    K
Sbjct  157   YYDEAPLDEFGLKREPKFGHLRDLHRALRLSKKPLLWGTQNVQKISKDLEITTYEKPGTK  216

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NNNT +P T+ FRG DYY+P KS+SILPDCK +++NTQ ++AQH+ R F  SK
Sbjct  217   ICVAFLTNNNTKEPGTIQFRGVDYYMPPKSISILPDCKTVVYNTQRVVAQHSSRNFVASK  276

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A   KWEM++E+IPT + L  KS +PKE+Y LT+ T+DY W+STR+ M K+DLPMR DI
Sbjct  277   KAKIHKWEMYKENIPTFNDLGVKSKSPKELYRLTRDTSDYAWYSTRINMEKQDLPMRADI  336

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH ++ F+NGE+ G+ HG+N+ K  +  +PVNLKPG NDI+ L   + +PN
Sbjct  337   LPVLQIASLGHGLMAFVNGEYIGFEHGSNIEKSLVFKKPVNLKPGVNDISLLAMTVGFPN  396

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+MERR+AGP+++ L  LM+GN DITKN WS  +G  GEK +L+TEEG++K KW P  
Sbjct  397   SGAYMERRFAGPRAISLEGLMSGNLDITKNHWSQEVGVNGEKTELYTEEGSKKVKWVPSN  456

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  +    TWYK +F+ PEGNDP+A+ M  M+KGM+W+NG +IGRYWVS+L+PLG+PTQ 
Sbjct  457   GKPSA--VTWYKAYFNAPEGNDPVAIRMTSMAKGMIWINGNNIGRYWVSYLSPLGKPTQE  514

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LK K NL+VVFEE GG P+ I+V++VNRDTICS ++E +PP +K WERK + 
Sbjct  515   EYHIPRSFLKAKRNLVVVFEETGGVPEKIEVVIVNRDTICSVISEFHPPHIKTWERKDNV  574

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             FRA  D +K    L+C D KV+  ++F S+G+ EG CG F  G C  P A K+VEK C+G
Sbjct  575   FRAIVDPVK-SAQLSCSDNKVIANVDFVSFGDVEGACGAFSPGKCDSPKARKLVEKMCMG  633

Query  1622  KTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKCV  1723
             K  C VP E+ + V+ G D CP + KTLA+Q  C 
Sbjct  634   KNTCTVPFEREVLVDAGNDSCPDVAKTLAIQVACA  668



>gb|EPS74283.1| beta-galactosidase, partial [Genlisea aurea]
Length=815

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/575 (57%), Positives = 426/575 (74%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGD P QRSAEDI+FSV RF++++GT  NYYMY GG NFG T SSFV+T 
Sbjct  243   TENWTAQYRVFGDSPSQRSAEDIAFSVARFFARNGTLNNYYMYHGGTNFGRTSSSFVTTR  302

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PK+ HLRD HRAL+L KKPLLWGT ++ KIN D EITT+E +   
Sbjct  303   YYDEAPLDEFGLKREPKFGHLRDLHRALRLSKKPLLWGTQHVQKINQDLEITTYEKSGSN  362

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NNNT + +++ FRG DY+LPAKS+SILPDCK ++FNTQ ++AQH+ R F PS+
Sbjct  363   ICVAFLTNNNTQEDSSIKFRGIDYFLPAKSISILPDCKTVVFNTQTVVAQHSSRNFVPSR  422

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A   KWE FQE+IP  +  P KS +PKE+Y  TK T+DY W+ST +  ++RDLPMR DI
Sbjct  423   KATIAKWEAFQEAIPEFEDFPLKSLSPKELYDFTKDTSDYAWYSTDINFDRRDLPMRVDI  482

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              P+L V S+GH ++ F+NGE+ G+ HG+N+ K F+   PVNLK G N I+ L   +  PN
Sbjct  483   KPILQVASLGHGLLAFVNGEYVGFGHGSNIEKSFVFRMPVNLKIGLNHISILAMTVGLPN  542

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+MERR+AGP+++ +   M GN DIT+  WS  +G  GE  ++FTEEG++K  W   +
Sbjct  543   SGAFMERRFAGPRAITIQGTMAGNLDITRTQWSQQVGVNGENAQVFTEEGSKKVTWSSSS  602

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                 T   TWYKT+FD PEG  P+AVNM  M KGM+WVNG++IGRYWVS+L+PLG+PTQ 
Sbjct  603   LKGGT-PITWYKTYFDAPEGRHPVAVNMTSMGKGMIWVNGRNIGRYWVSYLSPLGKPTQE  661

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKPKNNL+VVFEE GG+P+ IK++ VNRDTICS + E +PP V+ WERK ++
Sbjct  662   EYHIPRSYLKPKNNLMVVFEEIGGNPEEIKIVTVNRDTICSIITEYHPPHVQTWERKDNQ  721

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSF-PNAIKIVEKACL  1618
             FR+  D +K   +L CPD KV++K+EFAS+GN +G CG F  GSC +     +IVEK CL
Sbjct  722   FRSIVDPIKA-AYLNCPDGKVIEKVEFASFGNSDGACGAFQPGSCDYTAKPQQIVEKLCL  780

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             GKT+C +P E+   ++  KD CP I +TLAVQ KC
Sbjct  781   GKTDCAIPFEREQLMDSDKDSCPDISRTLAVQVKC  815



>gb|EYU37950.1| hypothetical protein MIMGU_mgv1a001345mg [Erythranthe guttata]
Length=836

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/581 (55%), Positives = 427/581 (73%), Gaps = 4/581 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AED++++V RF++++GT  NYYMY GG NFG T SSFV+T 
Sbjct  258   TENWTAQYRVFGDPPSQRAAEDLAYAVARFFARNGTLNNYYMYHGGTNFGRTSSSFVTTR  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PK+ HL+D H+AL+L KKPLLWGT N+  +  D EITT+E +   
Sbjct  318   YYDEAPLDEFGLKREPKFGHLKDLHKALRLSKKPLLWGTQNVQMVTRDLEITTYEKSGTN  377

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NN++ +   + FRG DYYLPAKS+SILPDCK +++NTQ ++AQH+ R FD SK
Sbjct  378   ICVAFLTNNHSREAMNIKFRGVDYYLPAKSISILPDCKTVVYNTQTVVAQHSSRNFDLSK  437

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              +    WEMF+E+IPT + LP KS +P+E+Y L + T+DY W+ST + ++KRDLPMR DI
Sbjct  438   TSKFRNWEMFKETIPTKNDLPIKSKSPRELYRLNQDTSDYAWYSTSINLDKRDLPMRADI  497

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
               VL + S+GHA + F+NGEF G+ HG+N+ K  +   P+NL PG NDIT L   +  PN
Sbjct  498   RSVLQIASLGHATVAFVNGEFVGFGHGSNIEKSHVFKNPINLHPGDNDITLLGMTVGLPN  557

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP++V L  LM+G  DIT+N W+  +G  GE +K+FTEEG++K KW P++
Sbjct  558   SGAYMEKRFAGPRAVTLEGLMSGTLDITRNHWAQQVGVNGENMKIFTEEGSKKVKWSPLS  617

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYK +FD PEGNDP+A+ M  M+KGMVWVNG +IGRYWVS+L+PLG+PTQ 
Sbjct  618   --ETPSPVTWYKAYFDAPEGNDPVALRMMSMAKGMVWVNGLNIGRYWVSYLSPLGKPTQE  675

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LK K+NL+VVFEE GG+P  I +++VNRDTICS + E +PP VK WERK ++
Sbjct  676   EYHIPRAYLKEKDNLVVVFEEIGGNPSKIDILVVNRDTICSVITEYHPPQVKTWERKDNK  735

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             FR+  D +K   +LTCPD KV+ K+EF ++G  EG CG F+ G C    A K+VE+ CLG
Sbjct  736   FRSIADPIKA-AYLTCPDKKVVTKVEFVTFGTVEGACGTFLPGKCDSTKAHKLVEELCLG  794

Query  1622  KTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGKED  1741
             K EC +P ++   V+   D CP I KTLAVQ +C R  K D
Sbjct  795   KVECTIPFDREDLVDSDNDSCPDIAKTLAVQVRCDRPNKSD  835



>emb|CDO96919.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/582 (56%), Positives = 425/582 (73%), Gaps = 5/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+F+V  F++++GT  NYYMY GG NFG T SSFV+T 
Sbjct  257   TENWTAQYRTFGDPPAQRAAEDIAFAVALFFARNGTLNNYYMYHGGTNFGRTSSSFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PK+ HLRD HRAL+L KK LLWGT ++ +I  D ++ T++N +++
Sbjct  317   YYDEAPLDEYGLPREPKFGHLRDLHRALRLSKKALLWGTPSVQQIEQDLQVITYDNPNVQ  376

Query  362   -LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              +CAAFL NN T  P T++FRG DYYLPAKS+SILPDCK +++NT  I +QHN R F+ S
Sbjct  377   NVCAAFLINNRTTTPATISFRGVDYYLPAKSISILPDCKTVVYNTVTIASQHNSRNFEES  436

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                G L WE F ESIP++D L  +S AP E+Y LTK T+DY W+ T +  +KRDLPM+  
Sbjct  437   SKVGVLDWEFFPESIPSMDQLSQESKAPLELYGLTKDTSDYAWYRTSIHFDKRDLPMKAG  496

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL   S+GHA++ F+NGE+ G+ HGNN+ K F+  +P++LKPG N+I+ L   + +P
Sbjct  497   VLPVLQALSLGHALLAFVNGEYIGFQHGNNIEKSFVFQKPISLKPGVNEISLLGMTVGFP  556

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME+R+AGP+ V L  LM+G  DIT N+W + +G  GE+L+ FTEEG+ K  W  +
Sbjct  557   NSGAYMEKRFAGPRVVTLQGLMSGTLDITMNNWKHQVGLNGERLQYFTEEGSSKVGWKKL  616

Query  1079  --TGNHNTRRA--TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLG  1246
                GN     A  TWYKT+FD PEGN P+A+ M+KM+KGM+WVNG++IGRYWVSFL+PLG
Sbjct  617   NAAGNLGGVNAPLTWYKTYFDAPEGNGPVAIQMDKMAKGMIWVNGRNIGRYWVSFLSPLG  676

Query  1247  QPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QPTQ+EYHIPR +LK   NLLVV EE GGDP  IK++ VNRDTICS + E +PP VK W 
Sbjct  677   QPTQSEYHIPRAFLKQTKNLLVVLEETGGDPREIKLVTVNRDTICSFITEYHPPQVKSWV  736

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R GD+ RA  +++    HL CP  KV+K IEFAS+G+P GVCG F  G C+ PNA++I E
Sbjct  737   RTGDQMRAVVENITSGAHLNCPGNKVIKAIEFASFGDPYGVCGTFAIGECNAPNALQIAE  796

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQG  1732
             + C GK EC +P++K LF    D CP I KTLAVQA+C   G
Sbjct  797   QYCKGKKECTIPMDKGLFFGANDACPHIAKTLAVQARCGNPG  838



>ref|XP_011092985.1| PREDICTED: beta-galactosidase 13-like [Sesamum indicum]
Length=770

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/576 (57%), Positives = 428/576 (74%), Gaps = 6/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSS-FVST  178
             TENWTAQYRVFGD P QR+AEDISF+V RF++++GT  NYYMY+GG+NFG T SS FV+T
Sbjct  197   TENWTAQYRVFGDTPSQRAAEDISFAVARFFTRNGTLNNYYMYYGGSNFGRTSSSSFVTT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYDE P+D YG  R+PK+ HLRD HRALKL KKPLL GT  + +I+ D EITT+E    
Sbjct  257   RYYDEAPLDEYGLRREPKFGHLRDLHRALKLSKKPLLRGTPKVERISQDLEITTYEKPSE  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              LC AFL+NN+T +  T++FRG DYYLP+KSVSILPDCK +++NT  I+AQH+ R F   
Sbjct  317   NLCVAFLTNNDTREAKTIHFRGKDYYLPSKSVSILPDCKTVVYNTAAIVAQHSSRNFVVP  376

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + A   KWEMF+E+IPTI+ L  ++PAPKE+Y+ TK  +DY W+ST + ++ RDLPMRPD
Sbjct  377   QQAKFSKWEMFKETIPTINDLKDRTPAPKELYSFTKDVSDYAWYSTSIKIDARDLPMRPD  436

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + P L + S+GHA++ F+NGE+ G+ HG+NV K  I  +PVNL  G NDIT L   + +P
Sbjct  437   VRPGLHIASLGHALLAFVNGEYIGFEHGSNVEKSHIFRKPVNLTAGDNDITLLAMTVGFP  496

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME+R+AGP++V L  LM+G  DIT N+W   +G  GEK+ ++TEEGA+  KW P 
Sbjct  497   NSGAYMEKRFAGPRAVTLEGLMSGTLDITNNNWGQQVGVNGEKVPVYTEEGAKTVKWVPF  556

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G  +    TWYKT+FD PEGN+P+A+ M  M+KGMVWVNG+SIGRYWVS+ +PLG+PTQ
Sbjct  557   AGTPSP--VTWYKTYFDAPEGNNPVALRMMSMAKGMVWVNGQSIGRYWVSYNSPLGRPTQ  614

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKPK+NLLVVFEE GG+P+ I +++VNRDTICS + E +PP V  WERKG+
Sbjct  615   EEYHIPRAFLKPKSNLLVVFEETGGNPEKIDILVVNRDTICSVITEYHPPSVNSWERKGN  674

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSC-SFPNAIKIVEKAC  1615
             E RA  + ++    LTCPD KV+KK+EF  +G  +G CG F  G C S   AIK+VE  C
Sbjct  675   ELRALVNPVR-EAELTCPDNKVIKKVEFVGFGEVDGACGAFKPGKCNSNSKAIKLVESLC  733

Query  1616  LGKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             LGK EC+VP E+   V+ GKD CP + KTLA+Q  C
Sbjct  734   LGKNECKVPFERERLVDVGKDACPDVSKTLAIQIAC  769



>ref|XP_011092984.1| PREDICTED: beta-galactosidase 13-like [Sesamum indicum]
Length=827

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/576 (57%), Positives = 428/576 (74%), Gaps = 6/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSS-FVST  178
             TENWTAQYRVFGD P QR+AEDISF+V RF++++GT  NYYMY+GG+NFG T SS FV+T
Sbjct  254   TENWTAQYRVFGDTPSQRAAEDISFAVARFFTRNGTLNNYYMYYGGSNFGRTSSSSFVTT  313

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYDE P+D YG  R+PK+ HLRD HRALKL KKPLL GT  + +I+ D EITT+E    
Sbjct  314   RYYDEAPLDEYGLRREPKFGHLRDLHRALKLSKKPLLRGTPKVERISQDLEITTYEKPSE  373

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              LC AFL+NN+T +  T++FRG DYYLP+KSVSILPDCK +++NT  I+AQH+ R F   
Sbjct  374   NLCVAFLTNNDTREAKTIHFRGKDYYLPSKSVSILPDCKTVVYNTAAIVAQHSSRNFVVP  433

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + A   KWEMF+E+IPTI+ L  ++PAPKE+Y+ TK  +DY W+ST + ++ RDLPMRPD
Sbjct  434   QQAKFSKWEMFKETIPTINDLKDRTPAPKELYSFTKDVSDYAWYSTSIKIDARDLPMRPD  493

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + P L + S+GHA++ F+NGE+ G+ HG+NV K  I  +PVNL  G NDIT L   + +P
Sbjct  494   VRPGLHIASLGHALLAFVNGEYIGFEHGSNVEKSHIFRKPVNLTAGDNDITLLAMTVGFP  553

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME+R+AGP++V L  LM+G  DIT N+W   +G  GEK+ ++TEEGA+  KW P 
Sbjct  554   NSGAYMEKRFAGPRAVTLEGLMSGTLDITNNNWGQQVGVNGEKVPVYTEEGAKTVKWVPF  613

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G  +    TWYKT+FD PEGN+P+A+ M  M+KGMVWVNG+SIGRYWVS+ +PLG+PTQ
Sbjct  614   AGTPSP--VTWYKTYFDAPEGNNPVALRMMSMAKGMVWVNGQSIGRYWVSYNSPLGRPTQ  671

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKPK+NLLVVFEE GG+P+ I +++VNRDTICS + E +PP V  WERKG+
Sbjct  672   EEYHIPRAFLKPKSNLLVVFEETGGNPEKIDILVVNRDTICSVITEYHPPSVNSWERKGN  731

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSC-SFPNAIKIVEKAC  1615
             E RA  + ++    LTCPD KV+KK+EF  +G  +G CG F  G C S   AIK+VE  C
Sbjct  732   ELRALVNPVR-EAELTCPDNKVIKKVEFVGFGEVDGACGAFKPGKCNSNSKAIKLVESLC  790

Query  1616  LGKTECEVPVEKSLFVE-GKDLCPKIVKTLAVQAKC  1720
             LGK EC+VP E+   V+ GKD CP + KTLA+Q  C
Sbjct  791   LGKNECKVPFERERLVDVGKDACPDVSKTLAIQVAC  826



>ref|XP_010028723.1| PREDICTED: beta-galactosidase 13 [Eucalyptus grandis]
Length=770

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/573 (54%), Positives = 418/573 (73%), Gaps = 1/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED++FSV RF++K+GT  NYYMY GG N G T + F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRSAEDLAFSVARFFAKNGTLTNYYMYHGGTNLGRTSAVFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H+AL+LC+K LLWG+  + +++ D E   +E    K
Sbjct  257   YYDEAPLDEYGLQREPKWGHLKDLHKALRLCRKALLWGSPKVQRLSKDLEARYYEIPGTK  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+TL    + FRG +YYLP  S+SILPDCK +++NTQ I++QHN R    S+
Sbjct  317   VCAAFLTNNSTLSAQVVKFRGQEYYLPQHSISILPDCKTVVYNTQRIVSQHNSRNLVKSE  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKWEM  E IP  + +P  +  P E+Y+L K TTDY WF+T + +  RDLPMR +I
Sbjct  377   KANKLKWEMSLEIIPDTNRVPVNAKIPAELYSLLKDTTDYAWFTTSLDLGVRDLPMRKNI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL V S+GHAM+ F+NGEF G  HG+++ K F+L QP++LKPG N I+ L S +  P+
Sbjct  437   KPVLRVASLGHAMLAFVNGEFIGSAHGSHIDKSFVLQQPIDLKPGVNHISLLGSTVGLPD  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+ V +L L TG  D+T N W + +G  GEK++++T+ G+ +A+W   T
Sbjct  497   SGAYMEHRYAGPRLVTILGLNTGTLDLTLNGWGHQVGLDGEKVRVYTQSGSHRAQWTEAT  556

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  TWYKT+FD PEG+ P+A+++ +M+KGMVWVNGKSIGRYW ++L+PLGQP+Q+
Sbjct  557   KGVG-RALTWYKTYFDAPEGDQPVAIHLPQMTKGMVWVNGKSIGRYWYTYLSPLGQPSQS  615

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP +NLLVV +E GG+P+SI+++ V+RDTICS + EN+PP VK W RK   
Sbjct  616   EYHIPRSFIKPTDNLLVVLDEDGGNPESIEILNVDRDTICSYITENHPPSVKSWARKNSH  675

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F    D++K   HL CP+ K +  IEFAS+G+P G+CGNF  G+C+ P +  IVEK CLG
Sbjct  676   FITVLDEVKTAAHLKCPNHKKIVAIEFASFGDPYGICGNFKYGNCTSPISKDIVEKHCLG  735

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C VP+E+ L  +G D CP I+KTLA+QAKC
Sbjct  736   KTSCAVPIERGLLDKGNDGCPSIMKTLAIQAKC  768



>gb|KCW55522.1| hypothetical protein EUGRSUZ_I01412 [Eucalyptus grandis]
Length=830

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/573 (54%), Positives = 418/573 (73%), Gaps = 1/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED++FSV RF++K+GT  NYYMY GG N G T + F +T 
Sbjct  257   TENWTAQYRVFGDPPSQRSAEDLAFSVARFFAKNGTLTNYYMYHGGTNLGRTSAVFTTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H+AL+LC+K LLWG+  + +++ D E   +E    K
Sbjct  317   YYDEAPLDEYGLQREPKWGHLKDLHKALRLCRKALLWGSPKVQRLSKDLEARYYEIPGTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+TL    + FRG +YYLP  S+SILPDCK +++NTQ I++QHN R    S+
Sbjct  377   VCAAFLTNNSTLSAQVVKFRGQEYYLPQHSISILPDCKTVVYNTQRIVSQHNSRNLVKSE  436

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKWEM  E IP  + +P  +  P E+Y+L K TTDY WF+T + +  RDLPMR +I
Sbjct  437   KANKLKWEMSLEIIPDTNRVPVNAKIPAELYSLLKDTTDYAWFTTSLDLGVRDLPMRKNI  496

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL V S+GHAM+ F+NGEF G  HG+++ K F+L QP++LKPG N I+ L S +  P+
Sbjct  497   KPVLRVASLGHAMLAFVNGEFIGSAHGSHIDKSFVLQQPIDLKPGVNHISLLGSTVGLPD  556

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+ V +L L TG  D+T N W + +G  GEK++++T+ G+ +A+W   T
Sbjct  557   SGAYMEHRYAGPRLVTILGLNTGTLDLTLNGWGHQVGLDGEKVRVYTQSGSHRAQWTEAT  616

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  TWYKT+FD PEG+ P+A+++ +M+KGMVWVNGKSIGRYW ++L+PLGQP+Q+
Sbjct  617   KGVG-RALTWYKTYFDAPEGDQPVAIHLPQMTKGMVWVNGKSIGRYWYTYLSPLGQPSQS  675

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP +NLLVV +E GG+P+SI+++ V+RDTICS + EN+PP VK W RK   
Sbjct  676   EYHIPRSFIKPTDNLLVVLDEDGGNPESIEILNVDRDTICSYITENHPPSVKSWARKNSH  735

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F    D++K   HL CP+ K +  IEFAS+G+P G+CGNF  G+C+ P +  IVEK CLG
Sbjct  736   FITVLDEVKTAAHLKCPNHKKIVAIEFASFGDPYGICGNFKYGNCTSPISKDIVEKHCLG  795

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C VP+E+ L  +G D CP I+KTLA+QAKC
Sbjct  796   KTSCAVPIERGLLDKGNDGCPSIMKTLAIQAKC  828



>ref|XP_006590856.1| PREDICTED: beta-galactosidase 13-like isoform X1 [Glycine max]
 gb|KHN39877.1| Beta-galactosidase 13 [Glycine soja]
Length=842

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/573 (54%), Positives = 408/573 (71%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  271   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFTTTR  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD HRAL LCK+ L  G + + K++  HE+  FE     
Sbjct  331   YYDEAPLDEYGMQREPKWSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSN  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAF++NN+T  PTT++FRGTDYY+P +S+SILPDCK ++FNTQ I +QH+ R F  S 
Sbjct  391   LCAAFITNNHTKVPTTISFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSM  450

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A + KWE++ E+IPT   +P     P E+Y+L K T+DY W++T V +   DLP + DI
Sbjct  451   AANDHKWEVYSETIPTTKQIPTHEKNPIELYSLLKDTSDYAWYTTSVELRPEDLPKKNDI  510

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
               +L + S+GH+++ F+NGEF G NHG++  K F   +PV LK G N I  L S +  P+
Sbjct  511   PTILRIMSLGHSLLAFVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPD  570

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGPKS+ +L L +G  D+T N W + +G +GEKL +FTEEG++K +W    
Sbjct  571   SGAYMEHRFAGPKSIFILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAK  630

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       +WYKT+F  PEG DP+A+ M  M KGMVW+NGKSIGR+W+S+L+PLGQPTQ+
Sbjct  631   GPGPA--VSWYKTNFATPEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQS  688

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +  PK+NLLVVFEE   +P+ ++++ VNRDTICS V EN+PP+VK W  K ++
Sbjct  689   EYHIPRTYFNPKDNLLVVFEEEIANPEKVEILTVNRDTICSFVTENHPPNVKSWAIKSEK  748

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+A  +DL P   L CP  + +K +EFAS+G+P G CG F  G C+ P   +IVEK CLG
Sbjct  749   FQAVVNDLVPSASLKCPHQRTIKAVEFASFGDPAGACGAFALGKCNAPAIKQIVEKQCLG  808

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C VP++K  F +G+D CP + K LA+Q +C
Sbjct  809   KASCLVPIDKDAFTKGQDACPNVTKALAIQVRC  841



>ref|XP_006590857.1| PREDICTED: beta-galactosidase 13-like isoform X2 [Glycine max]
Length=814

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/573 (54%), Positives = 408/573 (71%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  243   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFTTTR  302

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD HRAL LCK+ L  G + + K++  HE+  FE     
Sbjct  303   YYDEAPLDEYGMQREPKWSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSN  362

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAF++NN+T  PTT++FRGTDYY+P +S+SILPDCK ++FNTQ I +QH+ R F  S 
Sbjct  363   LCAAFITNNHTKVPTTISFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSM  422

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A + KWE++ E+IPT   +P     P E+Y+L K T+DY W++T V +   DLP + DI
Sbjct  423   AANDHKWEVYSETIPTTKQIPTHEKNPIELYSLLKDTSDYAWYTTSVELRPEDLPKKNDI  482

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
               +L + S+GH+++ F+NGEF G NHG++  K F   +PV LK G N I  L S +  P+
Sbjct  483   PTILRIMSLGHSLLAFVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPD  542

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGPKS+ +L L +G  D+T N W + +G +GEKL +FTEEG++K +W    
Sbjct  543   SGAYMEHRFAGPKSIFILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAK  602

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       +WYKT+F  PEG DP+A+ M  M KGMVW+NGKSIGR+W+S+L+PLGQPTQ+
Sbjct  603   GPGPA--VSWYKTNFATPEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQS  660

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +  PK+NLLVVFEE   +P+ ++++ VNRDTICS V EN+PP+VK W  K ++
Sbjct  661   EYHIPRTYFNPKDNLLVVFEEEIANPEKVEILTVNRDTICSFVTENHPPNVKSWAIKSEK  720

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+A  +DL P   L CP  + +K +EFAS+G+P G CG F  G C+ P   +IVEK CLG
Sbjct  721   FQAVVNDLVPSASLKCPHQRTIKAVEFASFGDPAGACGAFALGKCNAPAIKQIVEKQCLG  780

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C VP++K  F +G+D CP + K LA+Q +C
Sbjct  781   KASCLVPIDKDAFTKGQDACPNVTKALAIQVRC  813



>ref|XP_002278545.1| PREDICTED: beta-galactosidase 13 [Vitis vinifera]
 emb|CBI37877.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/577 (54%), Positives = 408/577 (71%), Gaps = 3/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AED++FSV RF SK+GT  NYYMY GG NFG TGSSFV+T 
Sbjct  258   TENWTAQYRVFGDPPSQRAAEDLAFSVARFISKNGTLANYYMYHGGTNFGRTGSSFVTTR  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H AL+LCKK L  G+  + K+  D E+  +E     
Sbjct  318   YYDEAPLDEYGLQREPKWGHLKDLHSALRLCKKALFTGSPGVEKLGKDKEVRFYEKPGTH  377

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN++ +  TL FRG +Y+LP  S+SILPDCK +++NTQ ++AQHN R F  SK
Sbjct  378   ICAAFLTNNHSREAATLTFRGEEYFLPPHSISILPDCKTVVYNTQRVVAQHNARNFVKSK  437

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  NLKWEM QE IP +  +   + +P E+Y   K  +DY WF T + ++  DLPM+ D
Sbjct  438   IANKNLKWEMSQEPIPVMTDMKILTKSPMELYNFLKDRSDYAWFVTSIELSNYDLPMKKD  497

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL + ++GHAM+ F+NG F G  HG+NV K F+  +PV  K GTN I  LC  +  P
Sbjct  498   IIPVLQISNLGHAMLAFVNGNFIGSAHGSNVEKNFVFRKPVKFKAGTNYIALLCMTVGLP  557

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSGA+ME RYAG  SV +L L TG  DIT N W   +G  GE +K +T+ G+ + +W   
Sbjct  558   NSGAYMEHRYAGIHSVQILGLNTGTLDITNNGWGQQVGVNGEHVKAYTQGGSHRVQWTAA  617

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYKT+FD+PEGNDP+ + M  M+KGM WVNGK+IGRYW+S+L+PL +P+Q
Sbjct  618   KGKGPA--MTWYKTYFDMPEGNDPVILRMTSMAKGMAWVNGKNIGRYWLSYLSPLEKPSQ  675

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYH+PR WLKP +NLLV+FEE GG+P+ I+V LVNRDTICS V E +PP VK W+R   
Sbjct  676   SEYHVPRAWLKPSDNLLVIFEETGGNPEEIEVELVNRDTICSIVTEYHPPHVKSWQRHDS  735

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + RA  D++KP+ HL CP+ KV+ K++FAS+GNP G CG+F  G+C+ PN+ K+VE+ C+
Sbjct  736   KIRAVVDEVKPKGHLKCPNYKVIVKVDFASFGNPLGACGDFEMGNCTAPNSKKVVEQHCM  795

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             GKT CE+P+E  +F      C  I KTLAVQ +C R+
Sbjct  796   GKTTCEIPMEAGIFDGNSGACSDITKTLAVQVRCGRK  832



>gb|KHN25472.1| Beta-galactosidase 13 [Glycine soja]
Length=854

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/573 (53%), Positives = 410/573 (72%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT QYRVFGDPP +RSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  282   TENWTVQYRVFGDPPSRRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFTTTQ  341

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LCKK L  G + + K++  HE   FE     
Sbjct  342   YYDEAPLDEYGMQREPKWSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSD  401

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+TL P T+ FRGTDYY+P +S+SILPDCK ++FNTQ I +QHN R F  S 
Sbjct  402   LCAAFLTNNHTLTPATIKFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSM  461

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A N KWE++ E+IPT   +P     P E+Y+L K T+DY W++T V +   DLP + DI
Sbjct  462   AANNHKWEVYSENIPTTKQIPTNEKIPTELYSLLKDTSDYAWYTTSVELGPEDLPKKNDI  521

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH+++ F+NGEF G NHG++  K F   +PV LK G N I  L   +  P+
Sbjct  522   SPVLRIMSLGHSLVAFVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPD  581

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGPKS+ +L L +G  D+  N W + +G +GE+L +FTEEG++K +W    
Sbjct  582   SGAYMEHRFAGPKSIFILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAK  641

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G+      +WYKT+F+ PEG DP+A+ M  M KGM+W+NGKSIGR+W+S+L+PLG PTQ+
Sbjct  642   GSGPA--LSWYKTNFETPEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQS  699

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +  PK+NL+VVFEE   +P+ ++++ V+RDTICS + EN+PP+VK W  K ++
Sbjct  700   EYHIPRAFFNPKDNLIVVFEEEIANPEKVEILTVDRDTICSFITENHPPNVKSWAVKSEK  759

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+A +++L P   L CP+ + +K +EFAS+G+P GVCG +  G C+ P+  +IVEK CLG
Sbjct  760   FQALSNNLVPTATLKCPNRRTIKAVEFASFGDPAGVCGAYTLGKCNAPSTKQIVEKHCLG  819

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C VP++K  F +G+D C  +VKTLA+Q KC
Sbjct  820   KQSCNVPIDKDAFTKGQDACRNMVKTLAIQVKC  852



>ref|XP_002306183.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
 gb|EEE86694.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
Length=838

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/578 (54%), Positives = 407/578 (70%), Gaps = 5/578 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED +FSV R++SK+G+ VNYYMY GG NF  T +SFV+T 
Sbjct  257   TENWTAQFRVFGDPPSQRSAEDTAFSVARWFSKNGSLVNYYMYHGGTNFDRTAASFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKK LLWGT N+ +++ D E   FE     
Sbjct  317   YYDEAPLDEYGLQREPKWGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFEQPRTN  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
              CAAFL+NNNT  P T+ FRG  YYLPAKS+SILPDCK +++NT  +++QHN R F  S 
Sbjct  377   DCAAFLANNNTKDPETVTFRGKKYYLPAKSISILPDCKTVVYNTMTVVSQHNSRNFVKSR  436

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K  G L+W+MF E+IP+   L   S  P+E+Y LTK  TDY WF+T + +++ DL  R D
Sbjct  437   KTDGKLEWKMFSETIPS--NLLVDSRIPRELYNLTKDKTDYAWFTTTINVDRNDLSARKD  494

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I+PVL V S+GHAM+ FINGEF G  HG+ + K F+L   V LKPG N +T L S++  P
Sbjct  495   INPVLRVASLGHAMVAFINGEFIGSAHGSQIEKSFVLQHSVKLKPGINFVTLLGSLVGLP  554

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME RYAGP+ V +L L TG  D++ N W + +   GE  K+FT+EG  K  W  V
Sbjct  555   DSGAYMEHRYAGPRGVSILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGRKVTWTKV  614

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               N +    TWYKT FD PEG  P+AV M  M KGM+W+NGKSIGRYW+++++PLG+PTQ
Sbjct  615   --NKDGPPVTWYKTRFDAPEGKSPVAVRMTGMKKGMIWINGKSIGRYWMNYISPLGEPTQ  672

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR +LKP NNL+V+ EE G  P+ I+++ VNRDTICS V E +PP+V+ WERK  
Sbjct  673   SEYHIPRSYLKPTNNLMVILEEEGASPEKIEILTVNRDTICSYVTEYHPPNVRSWERKNK  732

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F    DD KP   L CP+ K +  ++FAS+G+P G CGNF  G+C  P + ++VE+ CL
Sbjct  733   KFTPVADDAKPAARLKCPNKKKIVAVQFASFGDPSGTCGNFAVGTCDSPISKQVVEQHCL  792

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQG  1732
             GKT C++P++K LF   KD CP + K LAVQ KC  +G
Sbjct  793   GKTSCDIPMDKGLFNGKKDNCPNLTKNLAVQVKCSNKG  830



>ref|XP_006592069.1| PREDICTED: beta-galactosidase 13-like [Glycine max]
Length=843

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/573 (53%), Positives = 409/573 (71%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT QYRVFGDPP +RSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  271   TENWTVQYRVFGDPPSRRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFTTTQ  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LCKK L  G + + K++  HE   FE     
Sbjct  331   YYDEAPLDEYGMQREPKWSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSD  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+TL P T+ FRGTDYY+P +S+SILPDCK ++FNTQ I +QHN R F  S 
Sbjct  391   LCAAFLTNNHTLTPATIKFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSM  450

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A N KWE++ E+IPT   +P     P E+Y+L K T+DY W++T V +   DLP + DI
Sbjct  451   AANNHKWEVYSENIPTTKQIPTNEKIPTELYSLLKDTSDYAWYTTSVELGPEDLPKKNDI  510

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH+++ F+NGEF G NHG++  K F   +PV LK G N I  L   +  P+
Sbjct  511   SPVLRIMSLGHSLVAFVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPD  570

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGPKS+ +L L +G  D+  N W + +G +GE+L +FTEEG++K +W    
Sbjct  571   SGAYMEHRFAGPKSIFILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAK  630

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G+      +WYKT+F+ PEG DP+A+ M  M KGM+W+NGKSIGR+W+S+L+PLG PTQ+
Sbjct  631   GSGPA--LSWYKTNFETPEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQS  688

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +  PK+NL+VVFEE   +P+ ++++ V+RDTICS + EN+PP+VK W  K ++
Sbjct  689   EYHIPRAFFNPKDNLIVVFEEEIANPEKVEILTVDRDTICSFITENHPPNVKSWAVKSEK  748

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+A +++L P   L CP+ + +K +EFAS+G+P GVCG +  G C+ P+  +IVEK CLG
Sbjct  749   FQALSNNLVPTATLKCPNRRTIKAVEFASFGDPAGVCGAYTLGKCNAPSTKQIVEKHCLG  808

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C VP++K  F +G+D C  +VK LA+Q KC
Sbjct  809   KQSCNVPIDKDAFTKGQDACRNMVKALAIQVKC  841



>ref|XP_011088601.1| PREDICTED: beta-galactosidase 13 [Sesamum indicum]
Length=834

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/574 (55%), Positives = 417/574 (73%), Gaps = 6/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV+GDPP QR+AEDI+F+V RF++K+GT  NYYMY GG NFG T SSFV++ 
Sbjct  257   TENWTAQYRVYGDPPSQRAAEDIAFAVARFFAKNGTLNNYYMYHGGTNFGRTSSSFVTSR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PK+ HLRD HRAL+L KK LL GT  + K+  D EI TFE  D+ 
Sbjct  317   YYDEAPLDEFGLKREPKFGHLRDLHRALRLSKKALLKGTPRVQKLTEDLEIITFEKDDI-  375

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NN+T +  T+ FRG DYYLP+KS+SILPDCK +++NTQ ++AQH+ R F  S 
Sbjct  376   -CAAFLTNNDTREAGTIKFRGVDYYLPSKSISILPDCKTVVYNTQTVVAQHSSRNFVIST  434

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A   KWEMF+E +PT   L  KS +P+E+Y L K T+DY W+ST +  +KRDLPMR DI
Sbjct  435   KAKLGKWEMFKERVPTAHELERKSKSPEELYNLAKDTSDYAWYSTSITFDKRDLPMRSDI  494

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              P+L V S+GHA++VF+N E+ G+ HG+NV K  +  + + L PG N I+ L   +  PN
Sbjct  495   SPILQVASLGHALLVFVNAEYIGFGHGSNVEKSHVFKKSIKLFPGVNHISLLAMTVGLPN  554

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME+R+AGP+++ +  LM G  DIT+N W   +G  GEK++L+TEEG++K KW    
Sbjct  555   SGAYMEKRFAGPRAITIQGLMAGTLDITRNYWGQEVGVLGEKMQLYTEEGSKKGKWSEFN  614

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYKT+FD PEG++P+A+ M  M+KGMVW+NG+SIGRYWVS+L+PLG+PTQ 
Sbjct  615   GTPTP--LTWYKTYFDAPEGSNPVALRMTSMAKGMVWINGQSIGRYWVSYLSPLGKPTQE  672

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYH+PR +LKP NNL+VVFEE GGDP  I++++VNRDTICS V E +PP VK ++ K ++
Sbjct  673   EYHVPRSFLKPTNNLIVVFEETGGDPRKIEILVVNRDTICSVVTEYHPPHVKSFDLKENK  732

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              R+  + +K   HL CPD K+++K+EF S+G  +G CG F+ G C    A K+VEK  LG
Sbjct  733   LRSNINPIKG-AHLACPDKKIIEKVEFVSFGEADGACGAFIAGKCDSKTAHKLVEKXXLG  791

Query  1622  KTECEVPVE-KSLFVEGKDLCPKIVKTLAVQAKC  1720
             KTEC +P + K+L   G D CP I K+LAVQ KC
Sbjct  792   KTECTIPFDRKTLLDSGTDPCPDIEKSLAVQVKC  825



>ref|XP_003607189.1| Beta-galactosidase [Medicago truncatula]
 gb|AES89386.1| beta-galactosidase-like protein [Medicago truncatula]
Length=825

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/573 (53%), Positives = 412/573 (72%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK G+ VNYYMY GG NFG T S+F +T 
Sbjct  254   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKHGSLVNYYMYHGGTNFGRTTSAFTTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD H+A+ LCKK LL G     KI+  HE+  +E  +  
Sbjct  314   YYDEAPLDEFGLQREPKWSHLRDAHKAVNLCKKSLLNGVPTTQKISQYHEVIVYEKKESN  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAF++NN+T    TL+FRG+DY+LP +S+SILPDCK ++FNTQ+I +QH+ R F+ SK
Sbjct  374   LCAAFITNNHTQTAKTLSFRGSDYFLPPRSISILPDCKTVVFNTQNIASQHSSRHFEKSK  433

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
                + KWE+F E IP+   LP+K   P E+Y+L K  TDY W++T V +   D+P + D+
Sbjct  434   TGNDFKWEVFSEPIPSAKELPSKQKLPAELYSLLKDKTDYGWYTTSVELGPEDIPKKSDV  493

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH++  F+NGE+ G  HG++  K F   +PVN K G N I  L +++  P+
Sbjct  494   APVLRILSLGHSLQAFVNGEYIGSKHGSHEEKGFEFQKPVNFKVGVNQIAILANLVGLPD  553

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPK++ +L LM+G  D+T N W + +G QGE   +FTE+G++K +W    
Sbjct  554   SGAYMEHRYAGPKTITILGLMSGTIDLTSNGWGHQVGLQGENDSIFTEKGSKKVEWKDGK  613

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  +T   +WYKT+FD PEG +P+A+ ME M+KGM+WVNG+SIGR+W+S+L+PLG+PTQ+
Sbjct  614   GKGST--ISWYKTNFDTPEGTNPVAIGMEGMAKGMIWVNGESIGRHWMSYLSPLGKPTQS  671

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKPK+NLLV+FEE    PD I ++ VNRDTICS + EN+PP+++ +  K  +
Sbjct  672   EYHIPRSFLKPKDNLLVIFEEEAISPDKIAILTVNRDTICSFITENHPPNIRSFASKNQK  731

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
                  ++L P   +TCPD K +  +EFAS+G+P G CG+F+ G C+ P++ KIVE+ CLG
Sbjct  732   LERVGENLTPEAFITCPDQKKITAVEFASFGDPSGFCGSFIMGKCNAPSSKKIVEQLCLG  791

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C VP+ K+ F  G D CP +VKTLA+Q KC
Sbjct  792   KPTCSVPMVKATFTGGNDGCPDVVKTLAIQVKC  824



>ref|XP_011046271.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=835

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/573 (54%), Positives = 408/573 (71%), Gaps = 4/573 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED +FSV R++SK+G+ VNYYMY GG NFG T +SFV+T 
Sbjct  257   TENWTAQFRVFGDPPSQRSAEDTAFSVARWFSKNGSLVNYYMYHGGTNFGRTAASFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKK LLWG  N+ K++ D E   +E    K
Sbjct  317   YYDEAPLDEYGLQREPKWGHLKDLHRALNLCKKALLWGNPNVQKLSADVEARFYEQPGTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL++NN+ +  T+ FRG +YYLPA+S+SILPDCK +++NT  +++QHN R F  S+
Sbjct  377   VCAAFLTSNNSKEAETVKFRGQEYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSR  436

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
                 L+W+M+ E+IP    L   S  PKE+Y LTK  TDYVWF+T + +++RD+  R  I
Sbjct  437   KTNKLEWKMYSETIPA--QLQVDSSLPKELYNLTKDKTDYVWFTTTINVDRRDMNERKRI  494

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
             +PVL V S+GHAM+ F+NGEF G  HG+ + K F+L   V+LKPG N +T L +++  P+
Sbjct  495   NPVLRVASLGHAMVAFVNGEFIGSAHGSQIEKSFVLQHSVDLKPGINFVTLLGTLVGLPD  554

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+ V +L L TG  D+T N W + +G  GE  KLFT+EG  K  W  V 
Sbjct  555   SGAYMEHRYAGPRGVSILGLNTGTLDLTSNGWGHQVGLSGETAKLFTKEGGGKVTWTKV-  613

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKTHFD P G  P+AV M  M+KGM+W+NGKSIGRYW+++++PLG+PTQ+
Sbjct  614   -QKAGPPVTWYKTHFDAPGGKSPVAVRMTGMNKGMIWINGKSIGRYWMTYVSPLGEPTQS  672

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKP +NL+V+FEE   +P+ I++  VNRDTICS V E +PP VK WERK ++
Sbjct  673   EYHIPRSYLKPTDNLMVIFEEEEANPEKIEIFTVNRDTICSYVTEYHPPSVKSWERKNNK  732

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F    D+ KP  HL CP+ K +  ++FAS+G+P G CG +  G+C    + ++VE+ CLG
Sbjct  733   FTPVVDNAKPAAHLKCPNQKKIIAVQFASFGDPLGACGGYAVGTCHSRVSKQVVEEHCLG  792

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C++P++K LF   KD CP I KTLAVQ KC
Sbjct  793   KTSCDIPIDKGLFAGKKDDCPGISKTLAVQVKC  825



>ref|XP_002312963.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
 gb|EEE86918.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
Length=835

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/573 (54%), Positives = 409/573 (71%), Gaps = 4/573 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED +FSV R++SK+G+ VNYYMY GG NF  T +SFV+T 
Sbjct  257   TENWTAQFRVFGDPPSQRSAEDTAFSVARWFSKNGSLVNYYMYHGGTNFDRTAASFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKK LLWG  N+ K++ D E   +E    K
Sbjct  317   YYDEAPLDEYGLQREPKWGHLKDLHRALNLCKKALLWGNPNVQKLSADVEARFYEQPGTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL++NN+ +  T+ FRG +YYLPA+S+SILPDCK +++NT  +++QHN R F  S+
Sbjct  377   VCAAFLASNNSKEAETVKFRGQEYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSR  436

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
                 L+W M+ E+IP    L   S  PKE+Y LTK  TDYVWF+T + +++RD+  R  I
Sbjct  437   KTNKLEWNMYSETIPA--QLQVDSSLPKELYNLTKDKTDYVWFTTTINVDRRDMNERKRI  494

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
             +PVL V S+GHAM+ F+NGEF G  HG+ + K F+L   V+LKPG N +T L +++  P+
Sbjct  495   NPVLRVASLGHAMVAFVNGEFIGSAHGSQIEKSFVLQHSVDLKPGINFVTLLGTLVGLPD  554

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+ V +L L TG  D+T N W + +G  GE  KLFT+EG  K  W  V 
Sbjct  555   SGAYMEHRYAGPRGVSILGLNTGTLDLTSNGWGHQVGLSGETAKLFTKEGGGKVTWTKV-  613

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKTHFD PEG  P+AV M  M+KGM+W+NGKSIGRYW+++++PLG+PTQ+
Sbjct  614   -QKAGPPVTWYKTHFDAPEGKSPVAVRMTGMNKGMIWINGKSIGRYWMTYVSPLGEPTQS  672

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +LKP +NL+V+FEE   +P+ I+++ VNRDTICS V E +PP VK WERK ++
Sbjct  673   EYHIPRSYLKPTDNLMVIFEEEEANPEKIEILTVNRDTICSYVTEYHPPSVKSWERKNNK  732

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F    D+ KP  HL CP+ K +  ++FAS+G+P G CG++  G+C    + ++VE+ CLG
Sbjct  733   FTPVVDNAKPAAHLKCPNQKKIIAVQFASFGDPLGTCGDYAVGTCHSLVSKQVVEEHCLG  792

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C++P++K LF   KD CP I KTLAVQ KC
Sbjct  793   KTSCDIPIDKGLFAGKKDDCPGISKTLAVQVKC  825



>ref|XP_009374634.1| PREDICTED: beta-galactosidase 13-like [Pyrus x bretschneideri]
Length=769

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/578 (53%), Positives = 407/578 (70%), Gaps = 10/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK+GT  NYYMY GG NFG T S F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKNGTLTNYYMYHGGTNFGRTSSIFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKWSHL+D H+ALKL +K LLWG   + KI+ D E+  +E     
Sbjct  257   YYDEAPLDEYGLPRDPKWSHLKDLHKALKLSRKALLWGVPGVQKISKDIEVHFYETAATN  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNN      +N+RG DY+LP +S+SILPDCK ++FNTQ +++Q N R F  SK
Sbjct  317   ICAAFLTNNNFQTEAIVNWRGVDYHLPPRSISILPDCKTVVFNTQRVVSQLNSRNFVRSK  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKW  + E +P+   +P  +P P E+Y+L K TTDY W++T++ ++ +DLPM+  I
Sbjct  377   VANNLKWTKYVEPVPSTLQVPVNNPTPLELYSLLKDTTDYAWYTTKLALSPQDLPMKESI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+  F++GE+ G+ HG++  K F+  +PV LK G N I+ L   +  P+
Sbjct  437   RPVLRIASLGHALHAFVDGEYIGFAHGSHDEKSFVFEKPVPLKAGINQISLLAMTIGLPD  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP  V +L L TG  D+T+N W + +G  GEKL++FTEEG+++ +W    
Sbjct  497   SGAYMEHRYAGPNLVAVLGLNTGTLDLTRNGWGHQLGLSGEKLQVFTEEGSKQVQW----  552

Query  1082  GNHNTRRA----TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
               H T+ A    TWYKT+FD PEG+DPIA+ M  M KGM+WVNGKSIGR+W SFL+PLG+
Sbjct  553   --HKTKEAPEGLTWYKTYFDAPEGHDPIAIRMAGMGKGMIWVNGKSIGRHWTSFLSPLGE  610

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             PTQ EYHIPR ++KPK NLLVV EE    P  I+++ VNRDT+CS + E +PP+V  WER
Sbjct  611   PTQAEYHIPRSFIKPKQNLLVVLEEQPAKPKPIEILTVNRDTVCSFITEYHPPNVNSWER  670

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K   F+   D +K    + CP  K +  +EFAS+G+P G CGNF+ G C+ P + ++VE+
Sbjct  671   KDSVFQPVFDVVKSSADIKCPKNKKVVAVEFASFGDPAGTCGNFVLGKCNSPVSKEVVER  730

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
              CLGKT C VP++++LF    D CP I KTLA+Q KC 
Sbjct  731   HCLGKTICSVPIDRNLFASKTDGCPDIKKTLAIQVKCA  768



>ref|XP_011046693.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=838

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/578 (53%), Positives = 404/578 (70%), Gaps = 5/578 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED +FSV R++SK+G+ VNYYMY GG NF  T +SFV+T 
Sbjct  257   TENWTAQFRVFGDPPSQRSAEDTAFSVARWFSKNGSLVNYYMYHGGTNFDRTAASFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKK LLWGT N+ +++ D E   F+     
Sbjct  317   YYDEAPLDEYGLQREPKWGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFQQPGTN  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
              CAAFL+NNNT  P T+ FRG  YYLPA+S+SILPDCK +++NT  +++QHN R F  S 
Sbjct  377   DCAAFLANNNTKDPETVTFRGKKYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSR  436

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K  G L+W+MF E+IP+   L   S  P+E+Y LTK  TDY WF+T + +++ DL  R D
Sbjct  437   KTDGKLEWKMFSETIPS--NLLVDSRIPRELYNLTKDRTDYAWFTTTINVDRNDLSARKD  494

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I+PVL V S+GHAM+ FINGEF G  HG+ + K F+L     LKPG N +T L S++  P
Sbjct  495   INPVLRVASLGHAMVAFINGEFIGSAHGSQIEKSFVLQHSAKLKPGINFVTLLGSLVGLP  554

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME RYAGP+ V +L L TG  D++ N W + +   GE  K+FT+EG  K  W  V
Sbjct  555   DSGAYMEHRYAGPRGVSILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGSKVTWTKV  614

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               N +    TWYKT FD PEG  P+AV M  M KG +W+NGKSIGRYW+++++PLG+PTQ
Sbjct  615   --NKDGPPVTWYKTRFDAPEGKSPVAVRMTGMKKGTIWINGKSIGRYWMNYISPLGEPTQ  672

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR  LKP NNL+V+ EE    P+ I+++ VNRDTICS V E++PP+V+ WERK  
Sbjct  673   SEYHIPRYSLKPTNNLMVILEEEEASPEKIEILTVNRDTICSYVTEHHPPNVRSWERKNS  732

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F    DD KP   L CP+ K +  ++FAS+G+P G CGNF  G+C  P + ++VE+ CL
Sbjct  733   KFTPVADDAKPAARLKCPNKKKIVTVQFASFGDPSGTCGNFAVGTCDSPISKQVVEQHCL  792

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQG  1732
             GKT C++P++K LF   KD CP + K LAVQ KC  +G
Sbjct  793   GKTICDIPMDKGLFNGKKDNCPNLTKNLAVQVKCSNKG  830



>ref|XP_010066272.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=768

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/573 (53%), Positives = 409/573 (71%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRS EDI+FSV RF++K+G+  NYYMY GG NFG T + F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRSVEDIAFSVARFFAKNGSLANYYMYHGGTNFGRTSAVFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LC+KPLLWG  ++ ++  D E  TFE    K
Sbjct  257   YYDEAPLDEYGLQREPKWSHLRDVHKALSLCRKPLLWGNPSVQRLGADIEALTFEIPGTK  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T       FRG  +YLP  S+SILPDCK +++NTQ I++QHN R F  SK
Sbjct  317   VCAAFLTNNHTKIAQVAEFRGESFYLPPHSISILPDCKTLVYNTQTIVSQHNARNFRRSK  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             V  NLKWEM +E+IP    +P  S  P E Y LTK TTDY WF+T + ++ RDLP R +I
Sbjct  377   VTDNLKWEMSREAIPDTAKVPVDSKIPAEHYKLTKDTTDYAWFTTSIKISPRDLPRRTEI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM VF+NGE+ G  HG+++ K F+  + VNLKPGTN I+ L   +  P+
Sbjct  437   LPVLRIASLGHAMQVFVNGEYIGTAHGSHIEKSFVFQKAVNLKPGTNYISLLGMTIGLPD  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME ++AGP+ V +L L TG  D+T N W + +G  GEK++ +T+ G+ + +W    
Sbjct  497   SGAYMEHKFAGPRLVTILGLNTGTLDLTLNGWGHKVGLDGEKVRAYTQAGSHRVQWKKAN  556

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYK +F  PEG+ P+A+ +  + KGM+WVNGKSIGR+W S+LTPL QP+Q+
Sbjct  557   GVGPA--LTWYKAYFHAPEGDGPLAIRLPNLGKGMIWVNGKSIGRFWNSYLTPLLQPSQS  614

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP +NL+VV +E GG+P SI+++ V+RDTICS ++EN+PP VK W RK   
Sbjct  615   EYHIPRSFIKPSDNLMVVLDEEGGNPQSIEILTVDRDTICSFISENHPPHVKSWARKNSH  674

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              R   D++KP  +L C + K +  IEFAS+G+P+G+CG+F  G C+   + K+VE+ CLG
Sbjct  675   IRPVVDNVKPTANLKCSNHKKIVAIEFASFGDPDGICGSFSLGKCTSSISKKVVEQYCLG  734

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C+VP++++LF +  + CP I+KTLA+QA+C
Sbjct  735   KTSCQVPIDRALFDKNNNGCPDIMKTLAIQARC  767



>gb|KCW64119.1| hypothetical protein EUGRSUZ_G01775 [Eucalyptus grandis]
Length=830

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/573 (53%), Positives = 409/573 (71%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRS EDI+FSV RF++K+G+  NYYMY GG NFG T + F +T 
Sbjct  259   TENWTAQYRVFGDPPSQRSVEDIAFSVARFFAKNGSLANYYMYHGGTNFGRTSAVFTTTR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LC+KPLLWG  ++ ++  D E  TFE    K
Sbjct  319   YYDEAPLDEYGLQREPKWSHLRDVHKALSLCRKPLLWGNPSVQRLGADIEALTFEIPGTK  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T       FRG  +YLP  S+SILPDCK +++NTQ I++QHN R F  SK
Sbjct  379   VCAAFLTNNHTKIAQVAEFRGESFYLPPHSISILPDCKTLVYNTQTIVSQHNARNFRRSK  438

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             V  NLKWEM +E+IP    +P  S  P E Y LTK TTDY WF+T + ++ RDLP R +I
Sbjct  439   VTDNLKWEMSREAIPDTAKVPVDSKIPAEHYKLTKDTTDYAWFTTSIKISPRDLPRRTEI  498

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM VF+NGE+ G  HG+++ K F+  + VNLKPGTN I+ L   +  P+
Sbjct  499   LPVLRIASLGHAMQVFVNGEYIGTAHGSHIEKSFVFQKAVNLKPGTNYISLLGMTIGLPD  558

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME ++AGP+ V +L L TG  D+T N W + +G  GEK++ +T+ G+ + +W    
Sbjct  559   SGAYMEHKFAGPRLVTILGLNTGTLDLTLNGWGHKVGLDGEKVRAYTQAGSHRVQWKKAN  618

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G       TWYK +F  PEG+ P+A+ +  + KGM+WVNGKSIGR+W S+LTPL QP+Q+
Sbjct  619   GVGPA--LTWYKAYFHAPEGDGPLAIRLPNLGKGMIWVNGKSIGRFWNSYLTPLLQPSQS  676

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP +NL+VV +E GG+P SI+++ V+RDTICS ++EN+PP VK W RK   
Sbjct  677   EYHIPRSFIKPSDNLMVVLDEEGGNPQSIEILTVDRDTICSFISENHPPHVKSWARKNSH  736

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              R   D++KP  +L C + K +  IEFAS+G+P+G+CG+F  G C+   + K+VE+ CLG
Sbjct  737   IRPVVDNVKPTANLKCSNHKKIVAIEFASFGDPDGICGSFSLGKCTSSISKKVVEQYCLG  796

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KT C+VP++++LF +  + CP I+KTLA+QA+C
Sbjct  797   KTSCQVPIDRALFDKNNNGCPDIMKTLAIQARC  829



>ref|XP_007041847.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
 gb|EOX97678.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
Length=843

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/575 (52%), Positives = 411/575 (71%), Gaps = 6/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+G+ VNYYMY GG N+G T ++F +T 
Sbjct  271   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGSLVNYYMYHGGTNYGRTSAAFTTTR  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKW HL+D H+AL LCKK LLWG+  + K+  D E+ T++     
Sbjct  331   YYDEAPLDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTS  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+T    T +FRG  Y LPA+S+SILPDCK +++NTQ I AQHN R F  S 
Sbjct  391   LCAAFLANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSA  450

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  W+M++E +PT   L + +  P E+Y LTK TTDY W++T + +  RDLPM+ +
Sbjct  451   TANKNFNWQMYKEYVPT--QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKE  508

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GH ++ F+NGE+ G+ HG+ V K F+  +PV LK G N IT L +++  P
Sbjct  509   IFPVLRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLP  568

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AGP+S+ +L L TG  D++ N W + +G  GEK K++TE+G+ K +W  +
Sbjct  569   DSGAYMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKL  628

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             +    +   TWYK +FD PEGN+P+A+ M  M KGMVW+NG++IGRYW+S+L+PL QP+Q
Sbjct  629   S---ESPALTWYKGYFDTPEGNNPVAIRMTGMGKGMVWINGQNIGRYWMSYLSPLKQPSQ  685

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EY IPR +LKP  NL+V+ EE  G+P  ++++LVNRDTICS V E +PP V+++E KG 
Sbjct  686   SEYQIPRSFLKPTQNLIVILEEQEGNPKDVEILLVNRDTICSYVTEYHPPSVRLFESKGG  745

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               RA  DDLKP+  LTCP+ K +  +EFAS+G+P G CG++  G+C+FP + K+ EK CL
Sbjct  746   SLRAKVDDLKPKAELTCPNHKKIVAVEFASFGDPFGACGSYSLGNCTFPVSKKVAEKFCL  805

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             GKT C++P++   F +  D CP + K LAVQ KC 
Sbjct  806   GKTSCQIPLDAEDFDKQNDACPHMKKALAVQVKCA  840



>ref|XP_010090335.1| Beta-galactosidase 11 [Morus notabilis]
 gb|EXB39305.1| Beta-galactosidase 11 [Morus notabilis]
Length=848

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/584 (53%), Positives = 402/584 (69%), Gaps = 12/584 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AEDI++SV RF+SK+GT  NYYMY GG NFG T + F +T 
Sbjct  263   TENWTAQYRVFGDPPSQRAAEDIAYSVARFFSKNGTLANYYMYHGGTNFGRTSAVFTTTR  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD HRAL LCKK LLWGT    K+    E+  +E     
Sbjct  323   YYDEAPLDEYGLQREPKWSHLRDLHRALNLCKKALLWGTPGGQKLGKHTEVRMYEKPGTN  382

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNNN+    T+ FRG+ YYLP +S+SILPDCKN+++NTQ I++QHN R +  SK
Sbjct  383   ICAAFLSNNNSKVAHTVKFRGSAYYLPPRSISILPDCKNVVYNTQTIVSQHNARNYVRSK  442

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA  LKW+M  E IP++  +P  +  P E+Y+L K TTDY W++T + +++RDLPMRPDI
Sbjct  443   VASTLKWKMSPEQIPSVHQVPVNNRIPHELYSLLKDTTDYAWYTTSIDLSQRDLPMRPDI  502

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+  F+NGE+ G  HG++  K F+    + LKPGTN I  L   +  P+
Sbjct  503   LPVLRISSLGHALHAFVNGEYVGSGHGSHEEKSFVFQHAIVLKPGTNHIAILGMTVGLPD  562

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGP++V +L L TG  D+T N W   +G  GEK  +FTE+G++K +W  V 
Sbjct  563   SGAYMEHRFAGPRAVTILGLNTGTIDLTPNGWGNQVGLTGEKNHVFTEDGSKKVQWSKV-  621

Query  1082  GNHNTRRATWYK----------THFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF  1231
                     TWYK          T FD PEG DP+A+ M  M KGM+WVNG++IGRYW+S+
Sbjct  622   -KRQGPALTWYKEKFIQLFFEQTRFDAPEGRDPVAIRMNGMGKGMIWVNGQNIGRYWMSY  680

Query  1232  LTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPD  1411
             L+PLG+P+Q EYHIPR +LKP  NLLVV EE    P  I+++ VNRDTICS + E  PP 
Sbjct  681   LSPLGKPSQEEYHIPRSFLKPTQNLLVVLEEEKASPKGIEILKVNRDTICSYITEFSPPH  740

Query  1412  VKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNA  1591
             VK W R+    RA  D L+P  HL CP+ K +  ++FASYG+P GVCGNF+ G+C+ P+ 
Sbjct  741   VKSWAREESHIRAVVDILQPAAHLKCPNHKKIASVDFASYGDPAGVCGNFVLGTCNSPST  800

Query  1592  IKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
               IVE+ CLGK  C VPV+K LF +  D CP + KTLA+Q KC 
Sbjct  801   KGIVEQHCLGKPTCVVPVKKELFDKNGDACPNVNKTLAIQVKCA  844



>ref|XP_007131709.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
 gb|ESW03703.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
Length=842

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/573 (52%), Positives = 402/573 (70%), Gaps = 2/573 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  270   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFSTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKWSHLRD H+AL LC+K L  G + + K+   HEI  +E     
Sbjct  330   YYDEAPLDEFGLQRNPKWSHLRDVHKALNLCRKALFGGQSVITKLTHHHEIIVYEKPGSD  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAF++NN+T  P  + FRG+ Y+LP +S+SILPDCK ++FNTQH+ ++HN R F  +K
Sbjct  390   LCAAFITNNHTKTPIDIKFRGSTYHLPPRSISILPDCKTVVFNTQHVASEHNSRNFRKTK  449

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              + NLKWE+F E+IP    +P     P E+Y+L +  TDY W++T V +   DLP + +I
Sbjct  450   NSNNLKWEVFTEAIPNAKDIPVVLNVPTELYSLLRDVTDYAWYTTSVELGPGDLPRKDEI  509

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+  FINGE+ G NHG +  K F   +PV  K G N I+ L   +  P+
Sbjct  510   SPVLRIMSLGHALHAFINGEYIGTNHGTHEEKGFEFQKPVTFKVGVNYISILACTVGLPD  569

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+L+L L +G  D+T N W    G +GE+L +FTE+G++K +W  V 
Sbjct  570   SGAYMEHRYAGPKSILILGLNSGKIDLTSNGWGAKAGIRGEELAIFTEQGSKKVEWKEVK  629

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  +    +WYKT+F  P+G DP+A+ M  M KGM+W+NGKSIGR+W+SFL+PLG PTQ 
Sbjct  630   GTGSV--LSWYKTNFATPDGRDPVAIRMTGMGKGMIWINGKSIGRHWMSFLSPLGTPTQL  687

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +L PK+NLLV+FEE   +P+ I++  V+RDT+CS + EN PP++  W  K  +
Sbjct  688   EYHIPRIYLNPKDNLLVIFEEERANPEKIEIETVDRDTVCSFITENQPPNINSWACKAGK  747

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F +  D L P   +TCP  K +K +EFAS+G+P G+CG F+ G C  P   +IVE+ CLG
Sbjct  748   FLSVVDKLAPAATITCPTYKTIKAVEFASFGDPTGICGAFVMGKCDAPATKQIVEQHCLG  807

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K  C +PV+ + F++GKD CP ++K+LAVQAKC
Sbjct  808   KQSCTIPVDAATFIKGKDACPDVIKSLAVQAKC  840



>ref|XP_007221604.1| hypothetical protein PRUPE_ppa026900mg [Prunus persica]
 gb|EMJ22803.1| hypothetical protein PRUPE_ppa026900mg [Prunus persica]
Length=837

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/575 (53%), Positives = 405/575 (70%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR  EDI+F+V RF+SK G+  NYYMY GG NFG T + F +T 
Sbjct  263   TENWTAQYRVFGDPPSQRPVEDIAFAVARFFSKKGSLTNYYMYHGGTNFGRTSAIFTTTR  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKWSHLRD H+AL+L +K +LWG   + K++ D E+  +E     
Sbjct  323   YYDEAPLDEYGLPRDPKWSHLRDLHKALRLSRKSMLWGVPGVQKMSADTEVYFYEMPATD  382

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNN     T+++RG DYYLP  SVSILPDCK ++FNTQ I+AQHN R F  S 
Sbjct  383   ICAAFLTNNNLTTEATVSWRGQDYYLPPHSVSILPDCKTIVFNTQTIVAQHNSRNFVRST  442

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA N KW  + E IP+   +P  +P P E+YTL K T+DY W++T + +N +DLP +  I
Sbjct  443   VANNHKWMKYAEPIPSTLQVPVNNPTPLELYTLLKDTSDYAWYTTSLALNPQDLPRKESI  502

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+ +F+NGE+ G+ HG++  K F+L +PV+ K G N IT L   L  P+
Sbjct  503   QPVLRIASLGHALHLFVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  562

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
              GA+ME RYAGP  V++L L TG  DITKN W + +G  GEKL++FTEEG+++ +W    
Sbjct  563   GGAYMEHRYAGPNLVIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  622

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  + +  TWYKT+FD PEGN+P+A+ M  M KGM+WVNGKSIGR+W+SFL+PLG+PTQ+
Sbjct  623   G--SAQGLTWYKTYFDAPEGNNPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGEPTQS  680

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  NLLVV EE  G P  I+++ VNRDTICS + E +PP+VK W R+   
Sbjct  681   EYHIPRSFIKPTQNLLVVLEEQPGKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSV  740

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGN-PEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             FR   D ++    + CPD K +  +EFAS+G+ P G CG+++ G C+ P + ++VE+ CL
Sbjct  741   FRPVLDVIRSSADIKCPDNKKVVAVEFASFGDPPAGSCGSYVLGKCNSPVSKEVVEQHCL  800

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             GK+ C VP++++LF +   D CP I KTLA Q KC
Sbjct  801   GKSSCSVPIDRNLFFKNTTDGCPGIKKTLAFQVKC  835



>ref|XP_008447961.1| PREDICTED: beta-galactosidase 13-like [Cucumis melo]
Length=828

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/574 (53%), Positives = 402/574 (70%), Gaps = 7/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AEDI+FSV RF+SK+G+ VNYYMY GG NFG T + F +T 
Sbjct  259   TENWTAQYRVFGDPPSQRAAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSAVFTTTR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKW HLRD H+AL LCKKPLLWGT     +    E   +E     
Sbjct  319   YYDEAPLDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGTQVMGKGLEARFYEKPGTN  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T    T+NFRG +Y LP +S+SILPDCK ++FNT+ I++QHN R F PSK
Sbjct  379   ICAAFLANNDTKNAQTINFRGREYLLPPRSISILPDCKTVVFNTETIVSQHNARNFVPSK  438

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKW+M  E+IPT+  +P  +  P E+Y+L K TTDY W++T + + K D+  RPDI
Sbjct  439   VANNLKWKMSPETIPTVQQVPVNNKIPLELYSLLKDTTDYGWYTTSIELEKEDVSKRPDI  498

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA++VF+NGE+ G  HG++  K F+    V  K G NDI  L  ++  P+
Sbjct  499   LPVLRIASLGHAILVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNDIALLGVLVGLPD  558

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGP+SV +L L TG  DI+KN W + +G QGEK++++T+ G+ +  W  + 
Sbjct  559   SGAYMEHRFAGPRSVTILGLNTGTLDISKNGWGHQVGLQGEKVRVYTQGGSHRVDWSEI-  617

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKT+FD PEGNDP+AV M  M KG +WVNGKSIGRYW+S+L+PL  PTQ+
Sbjct  618   -KEEKSALTWYKTYFDAPEGNDPVAVRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLPTQS  676

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  NLLV+ EE    P+ +++++VNRDTICS + + +PP+VK WERK  +
Sbjct  677   EYHIPRSFIKPSENLLVILEEENFTPEKVEILVVNRDTICSFITQYHPPNVKSWERKDKQ  736

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSC-SFPNAIKIVEKACL  1618
             FRA  DD+K   HL CP  K M  IEFAS+G+P GVCGN+  G C S     K+VE+ CL
Sbjct  737   FRAVVDDVKTGAHLRCPINKKMATIEFASFGDPSGVCGNYEHGKCHSSSETKKLVEQHCL  796

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C VP++   F   K+ C    KTLA+QAKC
Sbjct  797   GKENCSVPMDA--FDNFKNECES--KTLAIQAKC  826



>ref|XP_004144843.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
 ref|XP_004162905.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
Length=766

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/574 (53%), Positives = 402/574 (70%), Gaps = 7/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AEDI+FSV RF+SK+G+ VNYYMY GG NFG T + F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRAAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSAVFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKW HLRD H+AL LCKKPLLWGT  +  I    E   +E     
Sbjct  257   YYDEAPLDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGIQVIGKGLEARFYEKPGTN  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T    T+NFRG ++ LP +S+SILPDCK ++FNT+ I++QHN R F PSK
Sbjct  317   ICAAFLANNDTKSAQTINFRGREFLLPPRSISILPDCKTVVFNTETIVSQHNARNFIPSK  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKW+M  ESIPT++ +P  +  P E+Y+L K TTDY W++T + ++K D+  RPDI
Sbjct  377   NANKLKWKMSPESIPTVEQVPVNNKIPLELYSLLKDTTDYGWYTTSIELDKEDVSKRPDI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM+VF+NGE+ G  HG++  K F+    V  K G N+I  L  ++  P+
Sbjct  437   LPVLRIASLGHAMLVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNNIALLGILVGLPD  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGP+S+ +L L TG  DI+KN W + +  QGEK+K+FT+ G+ +  W  + 
Sbjct  497   SGAYMEHRFAGPRSITILGLNTGTLDISKNGWGHQVALQGEKVKVFTQGGSHRVDWSEI-  555

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKT+FD PEGNDP+A+ M  M KG +WVNGKSIGRYW+S+L+PL   TQ+
Sbjct  556   -KEEKSALTWYKTYFDAPEGNDPVAIRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLSTQS  614

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  NLLV+ EE    P+ ++++LVNRDTICS + + +PP+VK WERK  +
Sbjct  615   EYHIPRSFIKPSENLLVILEEENVTPEKVEILLVNRDTICSFITQYHPPNVKSWERKDKQ  674

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSC-SFPNAIKIVEKACL  1618
             FRA  DD+K   HL CP  K +  IEFAS+G+P GVCGNF  G C S  +  K+VE+ CL
Sbjct  675   FRAVVDDVKTGAHLRCPHDKKITNIEFASFGDPSGVCGNFEHGKCHSSSDTKKLVEQHCL  734

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C VP++   F   K+ C    KTLA+QAKC
Sbjct  735   GKENCSVPMDA--FDNFKNECDS--KTLAIQAKC  764



>gb|KGN43246.1| hypothetical protein Csa_7G011860 [Cucumis sativus]
Length=828

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/574 (53%), Positives = 402/574 (70%), Gaps = 7/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AEDI+FSV RF+SK+G+ VNYYMY GG NFG T + F +T 
Sbjct  259   TENWTAQYRVFGDPPSQRAAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSAVFTTTR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKW HLRD H+AL LCKKPLLWGT  +  I    E   +E     
Sbjct  319   YYDEAPLDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGIQVIGKGLEARFYEKPGTN  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN+T    T+NFRG ++ LP +S+SILPDCK ++FNT+ I++QHN R F PSK
Sbjct  379   ICAAFLANNDTKSAQTINFRGREFLLPPRSISILPDCKTVVFNTETIVSQHNARNFIPSK  438

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  LKW+M  ESIPT++ +P  +  P E+Y+L K TTDY W++T + ++K D+  RPDI
Sbjct  439   NANKLKWKMSPESIPTVEQVPVNNKIPLELYSLLKDTTDYGWYTTSIELDKEDVSKRPDI  498

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM+VF+NGE+ G  HG++  K F+    V  K G N+I  L  ++  P+
Sbjct  499   LPVLRIASLGHAMLVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNNIALLGILVGLPD  558

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME R+AGP+S+ +L L TG  DI+KN W + +  QGEK+K+FT+ G+ +  W  + 
Sbjct  559   SGAYMEHRFAGPRSITILGLNTGTLDISKNGWGHQVALQGEKVKVFTQGGSHRVDWSEI-  617

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                     TWYKT+FD PEGNDP+A+ M  M KG +WVNGKSIGRYW+S+L+PL   TQ+
Sbjct  618   -KEEKSALTWYKTYFDAPEGNDPVAIRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLSTQS  676

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  NLLV+ EE    P+ ++++LVNRDTICS + + +PP+VK WERK  +
Sbjct  677   EYHIPRSFIKPSENLLVILEEENVTPEKVEILLVNRDTICSFITQYHPPNVKSWERKDKQ  736

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSC-SFPNAIKIVEKACL  1618
             FRA  DD+K   HL CP  K +  IEFAS+G+P GVCGNF  G C S  +  K+VE+ CL
Sbjct  737   FRAVVDDVKTGAHLRCPHDKKITNIEFASFGDPSGVCGNFEHGKCHSSSDTKKLVEQHCL  796

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C VP++   F   K+ C    KTLA+QAKC
Sbjct  797   GKENCSVPMDA--FDNFKNECDS--KTLAIQAKC  826



>ref|XP_008224549.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=871

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/578 (52%), Positives = 406/578 (70%), Gaps = 4/578 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR  EDI+F+V RF+SK G+  NYYMY GG NFG T + F +T 
Sbjct  259   TENWTAQYRVFGDPPSQRPVEDIAFAVARFFSKKGSLTNYYMYHGGTNFGRTSAIFTTTR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKWSHL+D H+AL+L +K +LWG   + K++ D E+  +E     
Sbjct  319   YYDEAPLDEYGLPRDPKWSHLKDLHKALRLSRKAMLWGVPGVQKMSADTEVYFYEMPATD  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNN     T+++RG DYYLP  SVSILPDCK ++FNTQ I+AQHN R +  S 
Sbjct  379   ICAAFLTNNNLTTEATVSWRGQDYYLPPHSVSILPDCKTIVFNTQTIVAQHNSRNYVRST  438

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKW    E IPT   +P  +  P E+YTL K ++DY W++T + +N +DLP +  I
Sbjct  439   VANNLKWMKNAEPIPTTLQVPVNNSTPLELYTLLKDSSDYAWYTTSLALNPQDLPRKASI  498

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+ +F+NGE+ G+ HG++  K F+L +PV+ K G N IT L   L  P+
Sbjct  499   QPVLRIASLGHALHLFVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  558

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
              GA+ME RYAGP  +++L L TG  DITKN W + +G  GEKL++FTEEG+++ +W    
Sbjct  559   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  618

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  + +  TWYKT+FD PEGN+P+A+ M  M KGM+WVNGKSIGR+W+SFL+PLG+PTQ+
Sbjct  619   G--SAQGLTWYKTYFDAPEGNNPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGEPTQS  676

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  NLLVV EE    P  I+++ VNRDTICS + E +PP+VK W R+   
Sbjct  677   EYHIPRSFIKPTQNLLVVLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSV  736

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGN-PEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             FR   D ++    + CPD K +  +EFAS+GN P G+CG+++ G C+ P + ++VE+ CL
Sbjct  737   FRPVLDVIRSSADIKCPDNKKVVAVEFASFGNPPAGLCGSYVLGKCNSPVSKEVVEQHCL  796

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQ  1729
             GK+ C VP++++LF +   D CP I KTLA Q +C +Q
Sbjct  797   GKSSCSVPIDRNLFFKNTTDGCPGIKKTLAFQVRCDKQ  834



>ref|XP_007224244.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
 gb|EMJ25443.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
Length=804

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/576 (51%), Positives = 407/576 (71%), Gaps = 4/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR  +DI+F+V RF+SK G+  NYYMY GG NFG T + F +T 
Sbjct  230   TENWTAQYRVFGDPPSQRPVDDIAFAVARFFSKKGSLTNYYMYHGGTNFGRTSAIFTTTR  289

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKWSHL+D H+AL+L +K LLWG   + K++ + E+  +E     
Sbjct  290   YYDEAPLDEYGLPRDPKWSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATN  349

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNN     T+++RG DYYLP  S+SILPDCK ++FNTQ I+AQHN R F  S 
Sbjct  350   ICAAFLTNNNLTTEATVSWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVQST  409

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKW+ + E IP+   +P  +P P E+YTL K T+DY W++T + +N +DLP +  I
Sbjct  410   VANNLKWKKYAEPIPSTLQVPVNNPTPLELYTLLKDTSDYAWYTTSLALNPQDLPRKASI  469

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+ +F+NG++ G+ HG++  K F+L +PV+ K G N IT L   L  P+
Sbjct  470   QPVLRIASLGHALHLFVNGKYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  529

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
              GA+ME RYAGP  +++L L TG  DITKN W + +G  GEKL++FTEEG+++ +W    
Sbjct  530   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  589

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  + +  TWYKT+FD PEGN+P+A+ M  M KGM+WVNG+SIGR+W+SFL+PLG+PTQ+
Sbjct  590   G--SAQGLTWYKTYFDAPEGNNPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQS  647

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N+LVV EE    P  I+++ VNRDTICS + E +PP+VK W R+   
Sbjct  648   EYHIPRSFIKPTQNILVVLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSV  707

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGN-PEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             FR   D ++    + CP+ K +  +EFAS+G+ P G CG+++ G C+ P + ++VE+ CL
Sbjct  708   FRPVLDVIRSSADIKCPNKKKVVAVEFASFGDPPAGYCGSYVLGKCNSPVSKEVVEQHCL  767

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCV  1723
             GK+ C VP+ ++LF++   D CP I KTLA+Q KC 
Sbjct  768   GKSSCSVPINRNLFLKNITDGCPGIKKTLAIQVKCA  803



>ref|XP_008224548.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=826

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/576 (51%), Positives = 406/576 (70%), Gaps = 4/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR  +DI+F+V RF+SK G+  NYYMY GG NFG T + F +T 
Sbjct  252   TENWTAQYRVFGDPPSQRPVDDIAFAVARFFSKKGSLTNYYMYHGGTNFGRTSAIFTTTR  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKWSHL+D H+AL+L +K LLWG   + K++ + E+  +E     
Sbjct  312   YYDEAPLDEYGLRRDPKWSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATN  371

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNN     T+++RG DYYLP  S+SILPDCK ++FNTQ I+AQHN R F  S 
Sbjct  372   ICAAFLTNNNLTTEATVSWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVRST  431

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKW+ + E IPT   +P  +P P E+YTL K ++DY W++T + +N +DLP +  I
Sbjct  432   VANNLKWKKYAEPIPTSLQVPVNNPTPLELYTLLKDSSDYAWYTTSLALNPQDLPRKASI  491

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHA+ +F+NGE+ G+ HG++  K F+L +PV+ K G N IT L   L  P+
Sbjct  492   QPVLRIASLGHALHLFVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  551

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
              GA+ME RYAGP  +++L L TG  DITKN W + +G  GEKL++FTEEG+++ +W    
Sbjct  552   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  611

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  + +  TWYKT+FD PEGN P+A+ M  M KGM+WVNG+SIGR+W+SFL+PLG+PTQ+
Sbjct  612   G--SAQGLTWYKTYFDAPEGNKPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQS  669

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N LVV EE    P  I+++ VNRDTICS + E +PP+VK W R+   
Sbjct  670   EYHIPRSFIKPTQNTLVVLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSV  729

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGN-PEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             FR  +D ++    + CP+ + +  +EFAS+G+ P G CG+++ G C+ P + ++VE+ CL
Sbjct  730   FRPVSDVIRSSADIKCPNKRKVVAVEFASFGDPPAGYCGSYVLGKCNSPVSKEVVEQHCL  789

Query  1619  GKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCV  1723
             GK+ C VP+ ++LF++   D CP I KTLA+Q KC 
Sbjct  790   GKSSCSVPINRNLFLKNITDGCPDIKKTLAIQVKCA  825



>ref|XP_010266335.1| PREDICTED: beta-galactosidase 13-like [Nelumbo nucifera]
Length=831

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/584 (53%), Positives = 407/584 (70%), Gaps = 9/584 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AED++F+V RF+SK GT  NYYMY GG N+G T + FV+T 
Sbjct  253   TENWTAQYRVFGDPPSQRAAEDLAFAVARFFSKKGTLNNYYMYHGGTNYGRTSADFVTTR  312

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  +DPKW HLRD H AL+LCKK LLWGT ++ K+    E   FEN++ K
Sbjct  313   YYDEAPLDEYGLQKDPKWGHLRDLHAALRLCKKALLWGTPSVQKLENGVEARIFENSESK  372

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL NNNT +P T  FRG +YY P +S+SILPDCK ++FNTQ++++QHN R++  SK
Sbjct  373   VCAAFLCNNNTREPATAKFRGKEYYFPPRSISILPDCKTVVFNTQNVVSQHNSRSYKISK  432

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  NL+WEM+ E IP ID  P K   P E+   TK  +DY+W++T++ + + DLP R D
Sbjct  433   RANKNLEWEMYHEKIPIIDESPVKYKNPLELMNQTKDRSDYLWYTTKIQLTRDDLPFRRD  492

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             IHPVL V + GH M  F NGE+ G  HG+++ K F   +PV LKPGTN I  L   + +P
Sbjct  493   IHPVLQVSNFGHVMHTFANGEYVGSGHGSHIEKSFTFQKPVPLKPGTNHIQLLGMTVGFP  552

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++  R AG   V +  L TG  D++ N W + +G  GEK ++FT EG EK  W   
Sbjct  553   DSGAYLNIRLAGVHRVAVQGLNTGTLDLSANGWGHQVGVDGEKNEIFTPEGTEKVSWKEA  612

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G  +    TWYKT+FD PEG++P+A+N+  M KGMVWVNGKSIGRYWV + +PLG+PTQ
Sbjct  613   KGGGHA--LTWYKTYFDAPEGDNPVALNLTSMGKGMVWVNGKSIGRYWVDYKSPLGKPTQ  670

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYH+PR +LKP  NLLVV EE GG+P+ IK++ VNRDTICS + E++  +V+ W+R+  
Sbjct  671   SEYHVPRVFLKPSGNLLVVLEEMGGNPEEIKILTVNRDTICSIITEHHSANVQSWQRENG  730

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGN-PEGVCGNFMTGSC-SFPNAIKIVEKA  1612
             + RA   D  P+ HL CP+ KV+  ++FA++GN P G CG F  G+C S   A K+VE+ 
Sbjct  731   KIRAVVGDTNPKAHLKCPNHKVIVNVDFATFGNVPTGACGAFTPGNCTSSSEAKKVVEQY  790

Query  1613  CLGKTECEVPVEKSLFVEGK-DLCPKIVKTLAVQAKCVRQGKED  1741
             CLGKT C++PV++  F  GK D CP I K+LAVQ  C   GK+D
Sbjct  791   CLGKTTCDIPVDQKTFGGGKGDECPGI-KSLAVQVHCA--GKDD  831



>gb|KDP29648.1| hypothetical protein JCGZ_18810 [Jatropha curcas]
Length=774

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/577 (53%), Positives = 399/577 (69%), Gaps = 5/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTA YR FGDPP +R+ ED++FSV R++SK+GT  NYYMY GG NFG + SSF++T 
Sbjct  202   TENWTAHYRAFGDPPSRRAVEDLAFSVARWFSKNGTLANYYMYHGGTNFGRSSSSFITTR  261

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H A++L KK LLWGT     +  + E   +E     
Sbjct  262   YYDEAPLDEYGLQREPKWGHLRDLHSAIRLSKKALLWGTPTTQSLGNNLEARIYEKPGTD  321

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNN+T  P T+ FRG +YYLPA S+SILPDCK M++NT  I++QHN R+F  S+
Sbjct  322   MCAAFLSNNDTKLPMTVKFRGQNYYLPALSISILPDCKTMVYNTMMIVSQHNVRSFVSSE  381

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  N KW+M++E +PT   L   S  P E+Y+LTK TTDY W++T   + KRDLPM  D
Sbjct  382   IANKNFKWKMYKELVPT--QLEETSKKPLELYSLTKDTTDYGWYTTAFELTKRDLPMWKD  439

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               PVL +ES+GHAM+ F+NGEF G  HG+ V K F+L + VNLKPG   IT L SI+  P
Sbjct  440   SLPVLRIESLGHAMLAFVNGEFVGAAHGSKVMKSFVLEKSVNLKPGNITITLLGSIMGLP  499

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME RYAGP  V LL    G  D+T N W + +G  GEK +L+TE+G++K  W  V
Sbjct  500   DSGAYMEHRYAGPIGVSLLGFSKGTVDLTLNGWGHQVGLDGEKNQLYTEDGSKKVTWTEV  559

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                  T   TWYKT+F+ PEG DP+A+NM+ M KG++W+NGKSIGRYW+S+L+PLG PTQ
Sbjct  560   KKQGPT--LTWYKTYFNAPEGRDPVAINMDGMGKGILWINGKSIGRYWMSYLSPLGSPTQ  617

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T+YHIPR +LK  NNL+V+ EE   +P+ I++  VNRDTICS + E+ P  VK W RK  
Sbjct  618   TQYHIPRAYLKSTNNLMVILEEEEANPEKIEIFTVNRDTICSYMVEDQPATVKSWTRKRG  677

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +     D++KP   LTCP+ K +  +EFAS+G+PEG CG +  G C+ P +  +VE+ CL
Sbjct  678   KVIPVMDNVKPAAQLTCPNYKQIIAVEFASFGDPEGACGRYSFGKCNSPISKLVVEQLCL  737

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             GK  C +P+++ LF   KD CP I K LAVQ KC R 
Sbjct  738   GKRSCSIPIDRQLFDNKKDDCPGIQKVLAVQVKCGRH  774



>ref|XP_004505828.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=851

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/587 (51%), Positives = 404/587 (69%), Gaps = 16/587 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK+G+ VNYYMY GG NFG T S+F +T 
Sbjct  258   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKNGSLVNYYMYHGGTNFGRTSSAFTTTR  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  RDPKWSHL+D H+AL LCKKPLL G     KI+  HE+  +EN    
Sbjct  318   YYDEAPLDEFGLQRDPKWSHLKDVHKALSLCKKPLLNGEPTTQKISQFHEVIVYENKGSN  377

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAF++NN+T    T+ FRG++YYLP +S+SILPDCK ++FNTQ+I +QHN R F  SK
Sbjct  378   LCAAFITNNHTKMAKTIQFRGSNYYLPPRSISILPDCKTVVFNTQNIASQHNSRNFKQSK  437

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A N KWE+F E IPT   LP     P E+Y++ K TTDY W++T V +   DLP + +I
Sbjct  438   NANNHKWEVFTEPIPTTKELPPSKKVPAELYSMLKDTTDYGWYTTSVELGPEDLPKKNEI  497

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH+++ F+NGE+ G NHG++  K F   +PV+ K G N I  L S++  P+
Sbjct  498   SPVLRIMSLGHSLLAFVNGEYIGSNHGSHEEKGFEFQKPVSFKVGVNQIAILGSLVGLPD  557

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPK++ +L L +G   +T N W + +G  GEK  +FTEEG++K +W  V 
Sbjct  558   SGAYMEHRYAGPKTITILGLNSGTIGLTVNGWGHQVGLYGEKHSIFTEEGSKKVQWKEVK  617

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G  +    +WYKT+F+ PEG  P+A+ ++ M KGM+W+NG+S+GR+W+S+L+PLG+PTQ+
Sbjct  618   G--HGPPLSWYKTNFETPEGKGPVAIKLDGMGKGMIWINGESVGRHWLSYLSPLGKPTQS  675

Query  1262  EYHIPRPWL--KPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             EYHIPR +   K KNNLLV+ EE    P+ + + +VNRDT+CS + EN+PP+V  W  K 
Sbjct  676   EYHIPRSFFNAKSKNNLLVILEEEAASPEKVVIQIVNRDTVCSYITENHPPNVNSWASKD  735

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA-  1612
              +     D+L P+  L CP+ K +  ++FASYG+P G CG F+ G C  P + KIVE+  
Sbjct  736   QKLTPIVDNLGPQASLKCPNHKTIIAVDFASYGDPLGFCGEFIMGKCHAPASKKIVEQVK  795

Query  1613  -----------CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
                        CLGK  C VP+ K+ F  G+D CP ++KTLA+Q +C
Sbjct  796   LLFLYKQKNQHCLGKESCSVPMNKASFTNGQDGCPDVMKTLAIQVQC  842



>ref|XP_008236010.1| PREDICTED: beta-galactosidase 11-like [Prunus mume]
Length=851

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/575 (52%), Positives = 391/575 (68%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK GT  NYYMY GG NFG T + F +T 
Sbjct  279   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSAIFTTTR  338

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKKPL  GT  + ++  + E   +E     
Sbjct  339   YYDEAPLDEYGLQREPKWGHLKDLHRALNLCKKPLFGGTPGVQRLGKETEARFYERPGTD  398

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NN++   TT+N+RG +Y+LP  S+SILPDC+ ++FN+Q I++QHN R F  SK
Sbjct  399   ICVAFLANNHSTIETTVNWRGQEYFLPPHSISILPDCRTVVFNSQQIVSQHNSRNFVRSK  458

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A    WEMF E IPT   +P    +P+E+Y L K  TDY WF++ + +   DLPM+  I
Sbjct  459   AANKFNWEMFSEPIPTTVQIPVNHKSPQELYHLLKDATDYGWFTSSLDLGPYDLPMKESI  518

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM VF+NGE+ G  HG++  K F+  +PV  K G N I+ LC  +  P+
Sbjct  519   RPVLRIPSLGHAMSVFVNGEYVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPD  578

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+++ +L L TG  D+++N W + +G  GE L++FTE+GA+K +W    
Sbjct  579   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLRVFTEKGAQKVQWTKAA  638

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT+F+ PEG DP+A+ M  M KGM+WVNGKSIGR+W+SFL+PLGQPTQ+
Sbjct  639   G--KGRALTWYKTNFEAPEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQS  696

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N L+V EE   DP  I+++ VNRDTIC+   E +PP VK WERKG +
Sbjct  697   EYHIPRAFIKPGQNFLLVLEEQEADPKDIEILTVNRDTICAISTEMHPPHVKSWERKGGD  756

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              +           L CP+ K +  ++FAS+G PEG+CG +  G C  P   K+VE+ CLG
Sbjct  757   LKTIGPVSGASAQLMCPNLKKIVGVDFASFGTPEGMCGAYKPGKCDSPATRKVVEEHCLG  816

Query  1622  KTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKCV  1723
             +T C VPVE  LF +  D CP I +KTLA+Q  C 
Sbjct  817   QTLCTVPVEPKLFFKA-DPCPDIKIKTLAIQVTCA  850



>ref|XP_007201748.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
 gb|EMJ02947.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
Length=857

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 389/575 (68%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK GT  NYYMY GG NFG T + F +T 
Sbjct  285   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSAIFTTTR  344

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D HRAL LCKKPL  GT  + ++  + E   +E     
Sbjct  345   YYDEAPLDEYGLKREPKWGHLKDLHRALSLCKKPLFAGTPGVQRLGKETEARFYERPGTD  404

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NN++   TT+N+RG +Y+LP  S+SILPDCK ++FN+Q I++QHN R F  SK
Sbjct  405   ICVAFLANNHSTIETTVNWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRSK  464

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A    WE F E IPT   +P    +P+E+Y L K  TDY WF++ + +   DLPM+  I
Sbjct  465   AANKFNWERFSEPIPTTVQIPVNQKSPQELYHLLKDATDYGWFTSSLELGPYDLPMKESI  524

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM VF+NGEF G  HG++  K F+  +PV  K G N I+ LC  +  P+
Sbjct  525   RPVLRIPSLGHAMSVFVNGEFVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPD  584

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+++ +L L TG  D+++N W + +G  GE L++FT++GA+K +W    
Sbjct  585   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTKKGAQKVQWTKAA  644

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT+F+ PEG DP+A+ M  M KGM+WVNGKSIGR+W+SFL+PLGQPTQ+
Sbjct  645   G--KGRALTWYKTNFEAPEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQS  702

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +++P  N LVV EE   DP  I+++  NRDTIC+   E +PP VK WERKG E
Sbjct  703   EYHIPRAFIEPGQNFLVVLEEQEADPKDIEILTANRDTICAISTEMHPPHVKSWERKGGE  762

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              +           L CP+ K +  ++FAS+G PEG+CG +  G C  P   K+VE+ CLG
Sbjct  763   LKTVGPVSGASAQLMCPNLKKIVGVDFASFGTPEGMCGAYKPGKCDSPATRKVVEEHCLG  822

Query  1622  KTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKCV  1723
             +T C VPV+  LF +  D CP I +KTLA+Q  C 
Sbjct  823   QTSCTVPVDPKLFFKA-DPCPDINIKTLAIQVTCA  856



>ref|XP_004298189.1| PREDICTED: beta-galactosidase 13-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/574 (51%), Positives = 398/574 (69%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT QYRVFGDP  QR AEDI+FSV RF+SK+G+  NYYMY GG NFG T + F +T 
Sbjct  197   TENWTGQYRVFGDPASQRPAEDIAFSVARFFSKNGSLANYYMYHGGTNFGRTSAIFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFE-NTDL  358
             YYDE P+D YG  RDPKWSHL+D H+AL+LC+KPLLWG   +  +  + E   +E   + 
Sbjct  257   YYDEAPLDEYGLPRDPKWSHLKDLHKALRLCRKPLLWGVPGVQNLGKNIEARFYELKGNS  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              +CAAFL+NNN+     +N+RG DYYLP  S+SILPDCK +++NTQ I++QHN R+F  S
Sbjct  317   SICAAFLANNNSRSEAIVNWRGQDYYLPPHSISILPDCKTVVYNTQTIVSQHNARSFVGS  376

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              +A  ++W    E IP+   +P  +  P E+Y L K  +DY W++T + +N  D+ M+  
Sbjct  377   NLANKMRWMESPEPIPSTKEIPINNRTPLELYGLLKDNSDYAWYTTSLELNSMDMSMKKS  436

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GHAM+VF+NGE+ G  HG++  K F+  + V+ K G N I  L   +  P
Sbjct  437   IQPVLRVGSLGHAMLVFVNGEYVGSGHGSHDEKSFVFEKVVSFKAGVNQIALLAMTVGLP  496

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME RYAGPK +++L L TG  D+T+N W + +G  GEKL+ FT+EG+++ +WG  
Sbjct  497   DSGAYMEHRYAGPKDIVVLGLNTGTLDLTQNGWGHQVGLNGEKLRAFTKEGSKQVQWGET  556

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G    +  TWYKT+FD PEGNDP+A+ M  M KGM+WVNG+SIGR+W+SFL+PLGQPTQ
Sbjct  557   NGP--KKALTWYKTYFDAPEGNDPVAIRMTGMGKGMIWVNGESIGRHWISFLSPLGQPTQ  614

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR ++KP+ NLLVV EE    P SI ++ VNRDTICS + E +PP+VK W R+  
Sbjct  615   SEYHIPRSFIKPRKNLLVVLEEELAKPSSIDIVTVNRDTICSFITEYHPPNVKSWARQNS  674

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
              FR   D ++    L CP+ K +  +EFAS+G+P G CG++  G C+ P + ++VE+ CL
Sbjct  675   VFRPVLDVVRTSAELKCPNYKKVVAVEFASFGDPTGSCGSYTLGKCNSPVSKEVVEQHCL  734

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             G T C VP++++++ +  D CP I KTLA+Q KC
Sbjct  735   GNTSCVVPIDRNVYFKNNDECPDIKKTLAIQVKC  768



>ref|XP_010029662.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=784

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/574 (51%), Positives = 401/574 (70%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+GT  NYYMY+GG NFG T SSFV+T 
Sbjct  197   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGTLANYYMYYGGTNFGRTPSSFVTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H AL+LCKK LLWGT  +  +    E   +E     
Sbjct  257   YYDEAPIDEYGLLREPKWGHLRDLHSALRLCKKALLWGTPTVQNLGEGLEAQVYEKPGTG  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNN+T  P  + F+G +YYLP +S+SIL DCK +++NT  +++QH+ R +  S+
Sbjct  317   ICAAFLSNNSTRLPRQVMFKGIEYYLPQRSISILVDCKTVVYNTGTVVSQHSSRKYHQSE  376

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  NL+WEM++++IPT    P KS +P E+ + TK TTDY+W++T + +   DLP R D
Sbjct  377   IANKNLRWEMWRDNIPTTSDAPIKSKSPLELMSTTKDTTDYLWYATSIKLYPTDLPFRKD  436

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V ++GH M  F+NGE+ G  HG+N+ K F+L +P+ LKPG N+I+ L + +  P
Sbjct  437   IIPVLQVANLGHLMHAFVNGEYIGSGHGSNIEKSFVLQKPIELKPGLNNISLLSATVGLP  496

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AG   V L  L TG  D++ N W++ +G  GEKL ++ + G+ + +W   
Sbjct  497   DSGAYMEHRFAGVHKVTLKGLNTGTLDLSLNGWAHKVGLDGEKLHVYRQGGSHRVQW--T  554

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 + +  TWYK +FD PEGNDP+ + +  MSKGM WVNGKSIGRYW S+L+PL +P+Q
Sbjct  555   KAKKHGQPLTWYKAYFDAPEGNDPVVMQLGTMSKGMAWVNGKSIGRYWSSYLSPLERPSQ  614

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YH+PR +LKP +NLLV+ EE GG+P+ +K++ V+RD +CS + E  P  VK W+  G 
Sbjct  615   DVYHVPRAFLKPTDNLLVLLEEIGGNPEGVKILTVSRDVVCSFIHERDPVTVKSWKTNGG  674

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               R   DD+KPR HL CP+ K + K+EFASYGNP G CG++  G+CS   + K+VE+ CL
Sbjct  675   LIRTVADDMKPRAHLQCPEDKKIVKVEFASYGNPFGACGSYGVGNCSAAKSQKVVEQRCL  734

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             G+++C V VE+  F +   LCP ++K LAVQ +C
Sbjct  735   GRSKCSVKVERKNFDKAGSLCPDVLKMLAVQVRC  768



>ref|XP_010941319.1| PREDICTED: beta-galactosidase 11-like isoform X2 [Elaeis guineensis]
Length=826

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/582 (52%), Positives = 396/582 (68%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+S +G  VNYYMY GG NFG  G+S+V T 
Sbjct  248   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSNNGALVNYYMYHGGTNFGREGASYVMTR  307

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PK+ HLRD H+ALKL +K LLWG  ++  +    E   +E+ D K
Sbjct  308   YYDEAPLDEYGLPKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSK  367

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +C AFL+N N     T+NFRG +Y+LP +S+SILPDCK +IFNTQ + AQHN RTF  + 
Sbjct  368   VCVAFLTNTNPRTDATVNFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAG  427

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +   N KW MFQE IP        S  P E+Y +TK TTDY+W++TR  +   DLPMRPD
Sbjct  428   ETNKNDKWHMFQERIPKFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPD  487

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GHAM  F+NG + G  +G  + K F+  +P+ LK G N I+ L   + +P
Sbjct  488   IRPVLLVSSLGHAMHAFVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFP  547

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             ++GA++E R AG  +  +  L TG  D+++N W + +G +GEKL +FTEEG++K +W   
Sbjct  548   DNGAYLEHRLAGIHTAAIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQW---  604

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             T   N +  TWYK +FD+P GNDP+A++M  M KG+ WVNG  IGRYWVS+L+PLG+P+Q
Sbjct  605   TEAKNDKPVTWYKRYFDMPRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQ  664

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR WLKPK+NLLV+FEE GG P+ I ++ V RD IC+ V E +PP +K + R+ +
Sbjct  665   SVYHIPREWLKPKDNLLVIFEEHGGKPEGILIVTVKRDNICTVVTEFHPPTIKSFSREDN  724

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             E +    D+KPR +L C D KV++ I FAS+GNP G CGNF  G+C  P A  +VEKACL
Sbjct  725   EIKTLVQDVKPRAYLKCDDNKVIRSIAFASFGNPTGACGNFTVGTCHSPQAASVVEKACL  784

Query  1619  GKTECEVPVEKSLFVEGKD-LCPKIVKTLAVQAKCVRQGKED  1741
              K  C +PV    +  G D  CP    TL VQAKC R+ K+D
Sbjct  785   EKNSCVLPVSAQAY--GADPACPGTTSTLVVQAKCARKKKDD  824



>ref|XP_010941318.1| PREDICTED: beta-galactosidase 11-like isoform X1 [Elaeis guineensis]
Length=843

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/582 (52%), Positives = 396/582 (68%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+S +G  VNYYMY GG NFG  G+S+V T 
Sbjct  265   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSNNGALVNYYMYHGGTNFGREGASYVMTR  324

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PK+ HLRD H+ALKL +K LLWG  ++  +    E   +E+ D K
Sbjct  325   YYDEAPLDEYGLPKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSK  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +C AFL+N N     T+NFRG +Y+LP +S+SILPDCK +IFNTQ + AQHN RTF  + 
Sbjct  385   VCVAFLTNTNPRTDATVNFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAG  444

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +   N KW MFQE IP        S  P E+Y +TK TTDY+W++TR  +   DLPMRPD
Sbjct  445   ETNKNDKWHMFQERIPKFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPD  504

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GHAM  F+NG + G  +G  + K F+  +P+ LK G N I+ L   + +P
Sbjct  505   IRPVLLVSSLGHAMHAFVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFP  564

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             ++GA++E R AG  +  +  L TG  D+++N W + +G +GEKL +FTEEG++K +W   
Sbjct  565   DNGAYLEHRLAGIHTAAIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQW---  621

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             T   N +  TWYK +FD+P GNDP+A++M  M KG+ WVNG  IGRYWVS+L+PLG+P+Q
Sbjct  622   TEAKNDKPVTWYKRYFDMPRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQ  681

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR WLKPK+NLLV+FEE GG P+ I ++ V RD IC+ V E +PP +K + R+ +
Sbjct  682   SVYHIPREWLKPKDNLLVIFEEHGGKPEGILIVTVKRDNICTVVTEFHPPTIKSFSREDN  741

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             E +    D+KPR +L C D KV++ I FAS+GNP G CGNF  G+C  P A  +VEKACL
Sbjct  742   EIKTLVQDVKPRAYLKCDDNKVIRSIAFASFGNPTGACGNFTVGTCHSPQAASVVEKACL  801

Query  1619  GKTECEVPVEKSLFVEGKD-LCPKIVKTLAVQAKCVRQGKED  1741
              K  C +PV    +  G D  CP    TL VQAKC R+ K+D
Sbjct  802   EKNSCVLPVSAQAY--GADPACPGTTSTLVVQAKCARKKKDD  841



>ref|XP_007137346.1| hypothetical protein PHAVU_009G119400g [Phaseolus vulgaris]
 gb|ESW09340.1| hypothetical protein PHAVU_009G119400g [Phaseolus vulgaris]
Length=845

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/575 (51%), Positives = 403/575 (70%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV GDPP QRSAEDI+FSV RF+SK G  VNYYMY GG NFG T S+F +T 
Sbjct  272   TENWTAQYRVHGDPPSQRSAEDIAFSVARFFSKGGNLVNYYMYHGGTNFGRTSSAFTTTR  331

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+A+ LC+K +L G  N+ K+N  HEI TFE     
Sbjct  332   YYDEAPLDEYGLQREPKWSHLRDVHKAVLLCRKAILGGDTNVEKLNEFHEIRTFEKLGTN  391

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAF++NN+T+   T+NFRGT+Y+LP  S+S+LPDCK +++NTQ I++QHN R ++ S 
Sbjct  392   MCAAFITNNHTIDAATINFRGTNYFLPPHSISVLPDCKTVVYNTQSIVSQHNSRNYERSP  451

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             +A N +WEMF E+IPT   +      P E+Y+L K TTDY W++T   ++ +DLP +P +
Sbjct  452   IANNFQWEMFIEAIPTTKKMDTYQKLPAELYSLLKDTTDYAWYTTSFELSPQDLPTKPGV  511

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH+M+ F+NG+  G  HG +  K F   +PV  K GTN I+ L S +  P+
Sbjct  512   IPVLRIMSLGHSMVAFVNGDLVGTAHGTHEEKSFEFQRPVAFKVGTNYISILASTVGLPD  571

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L TG  DI+ N W + +G +GE +K+F+EEG+ KAKW P+ 
Sbjct  572   SGAYMEHRYAGPKSISILDLNTGTIDISNNMWGHRVGLKGEGMKVFSEEGSLKAKWMPLA  631

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  TWY+T F  PEG  P+AV M  M KG++WVNG+SIGR+W++FL+PLG PTQ+
Sbjct  632   P--VPRPLTWYRTRFATPEGTGPVAVRMTGMGKGLIWVNGQSIGRHWMTFLSPLGTPTQS  689

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             E+HIPR +L P++NLLV+FEE   +P  ++V+ VNRDTICS +AEN P +V  W  +   
Sbjct  690   EFHIPRAFLNPQDNLLVIFEEEAMNPGQVEVLNVNRDTICSFIAENEPANVNSWVSRRGN  749

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F     ++ P+  L C   K +  +EFAS+GNP G CG+++ GSC+     +IVE+ CLG
Sbjct  750   FHPIVSNIGPQAALECNPGKKITAVEFASFGNPSGYCGDYVLGSCNVAATKQIVEQQCLG  809

Query  1622  KTECEVPVEKSLFVE-GKDLCPKI-VKTLAVQAKC  1720
             K  C V +++++  + G D CP+I VKTLA+QA+C
Sbjct  810   KETCTVALDRAVLNQNGADPCPEILVKTLAIQARC  844



>ref|XP_004500729.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=843

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/574 (51%), Positives = 402/574 (70%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDP  +RSAEDI+FSV RF+SK+G  VNYYMY GG NFG T S+F +T 
Sbjct  270   TENWTAQYRVFGDPISKRSAEDIAFSVARFFSKNGNLVNYYMYHGGTNFGRTSSAFTTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+A+ LC+K +L G  ++ K+N  HE+ TFE  +  
Sbjct  330   YYDEAPLDEYGLEREPKWSHLRDAHKAMLLCRKAILGGVPSVQKLNAYHEVRTFEKPESN  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAF++NN++ +  T++FRG++Y+LPA S+S+LPDCK +++NTQ I++QHN R F  S 
Sbjct  390   ICAAFITNNHSTEAATISFRGSNYFLPAHSISVLPDCKTVVYNTQSIVSQHNARNFVKSA  449

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA N KWE++ E+IP   TL      P E+Y L K  +DY W++T   ++ +DLP +  +
Sbjct  450   VANNHKWEVYSEAIPNTMTLQPNQKVPAELYLLLKDRSDYAWYTTSFELSPQDLPTKNGV  509

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH++  F+NG++ G  HG +  K F   QP N K GTN +T L S +  P+
Sbjct  510   APVLRIMSLGHSLAAFVNGQYIGTGHGTHEEKSFEFEQPANFKVGTNYVTILASTVGLPD  569

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L TG  D+TKN W + +G +GE L++F+EEG++K  W PV 
Sbjct  570   SGAYMEHRYAGPKSISILGLNTGTIDLTKNGWGHQVGLKGEGLEIFSEEGSKKVTWTPVN  629

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G   TR  +W+KT F  PEG  P+A+ M  M KG+V+VNG+SIGR+W++FL+PLG PTQ+
Sbjct  630   G--PTRALSWFKTRFATPEGRGPVAIRMTGMGKGIVYVNGQSIGRHWMTFLSPLGHPTQS  687

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +L  K+NLLV+ EE    P+ I+++ V+RDTICS++ E+ P +V  W  +  +
Sbjct  688   EYHIPRSYLNQKDNLLVILEEEKASPEKIEILNVDRDTICSNILESDPANVNSWVSRHGQ  747

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F A   ++ P+  L CP  K +  IEFAS+GNP G+CGNF  G+C+     ++VEK CLG
Sbjct  748   FHAVIKNVTPQASLKCPSGKRIVAIEFASFGNPSGLCGNFTFGNCNAAATKRVVEKECLG  807

Query  1622  KTECEVPVEKSLFVEGK-DLCPKIVKTLAVQAKC  1720
             K EC V V ++ F   K D CP +VK LA+QAKC
Sbjct  808   KEECLVAVNRASFNRKKGDACPDLVKRLAIQAKC  841



>gb|AES74289.2| glycoside hydrolase family 35 protein [Medicago truncatula]
Length=828

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/573 (53%), Positives = 398/573 (69%), Gaps = 7/573 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDP  QRSAEDI+FSV RF+SK+G  VNYYMY GG NFG T S+F +T 
Sbjct  261   TENWTAQYRVFGDPVSQRSAEDIAFSVARFFSKNGNLVNYYMYHGGTNFGRTTSAFTTTR  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R PKWSHLRD H+AL LC+K +L G   + K+N  HE+  FE     
Sbjct  321   YYDEAPLDEYGMERQPKWSHLRDAHKALLLCRKAILGGVPTVQKLNDYHEVRIFEKPGTS  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C+AF++NN+T +  T++FRG++Y+LPA S+S+LPDCK +++NTQ+I++QHN R F  S 
Sbjct  381   TCSAFITNNHTNQAATISFRGSNYFLPAHSISVLPDCKTVVYNTQNIVSQHNKRNFVKSA  440

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             VA NLKWE+F E+IP+   L +    P E+YTL K TTDY W++T   +   DLP +  I
Sbjct  441   VANNLKWELFLEAIPSSKKLESNQKIPLELYTLLKDTTDYGWYTTSFELGPEDLPKKSAI  500

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
                L + S+GH +  F+NG++ G +HG +  K F   QP N K GTN I+ L + +  P+
Sbjct  501   ---LRIMSLGHTLSAFVNGQYIGTDHGTHEEKSFEFEQPANFKVGTNYISILATTVGLPD  557

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L  G  ++TKN W + +G +GE+LK+FTEEG++K +W PVT
Sbjct  558   SGAYMEHRYAGPKSISILGLNKGKLELTKNGWGHRVGLRGEQLKVFTEEGSKKVQWDPVT  617

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G   TR  +W KT F  PEG  P+A+ M  M KGM+WVNGKSIGR+W+SFL+PLGQP+Q 
Sbjct  618   G--ETRALSWLKTRFATPEGRGPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGQPSQE  675

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +L  K+NLLVV EE  G P+ I++M+V+RDTICS + EN P +V  W  K  E
Sbjct  676   EYHIPRDYLNAKDNLLVVLEEEKGSPEKIEIMIVDRDTICSYITENSPANVNSWGSKNGE  735

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             FR+   +  P+  L CP  K +  +EFAS+GNP G CG+F  G+C+   A  +VEKACLG
Sbjct  736   FRSVGKNSGPQASLKCPSGKKIVAVEFASFGNPSGYCGDFALGNCNGGAAKGVVEKACLG  795

Query  1622  KTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K EC V V ++ F  G+  C   V TLA+QAKC
Sbjct  796   KEECLVEVNRANF-NGQG-CAGSVNTLAIQAKC  826



>ref|XP_007137348.1| hypothetical protein PHAVU_009G119600g [Phaseolus vulgaris]
 gb|ESW09342.1| hypothetical protein PHAVU_009G119600g [Phaseolus vulgaris]
Length=843

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/575 (51%), Positives = 403/575 (70%), Gaps = 4/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV GDPP QRSAEDI+FSV RF+SK G  VNYYMY GG NFG T S+F +T 
Sbjct  270   TENWTAQYRVHGDPPSQRSAEDIAFSVARFFSKGGNLVNYYMYHGGTNFGRTSSAFTTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+A+ LC+K +L G  N+ K+N  HEI TFE     
Sbjct  330   YYDEAPLDEYGLQREPKWSHLRDVHKAVLLCRKAILGGDTNVEKLNQFHEIRTFEKLGTN  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAF++NN+T+   T+NFRGT+Y+LP  S+S+LPDCK +++NTQ I++QHN R ++ S 
Sbjct  390   MCAAFITNNHTIDAATINFRGTNYFLPPHSISVLPDCKTVVYNTQSIVSQHNSRNYERSP  449

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
             +A N +WEMF E+IPT   +      P E+Y+L K TTDY W++T   ++ +DLP +P +
Sbjct  450   IANNFQWEMFIEAIPTTKKMDTYQNLPAELYSLLKDTTDYAWYTTSFELSPQDLPTKPGV  509

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GH+M+ F+NG+  G  HG +  K F   +PV  K GTN I+ L S +  P+
Sbjct  510   IPVLRIMSLGHSMVAFVNGDLVGTAHGTHEEKSFEFQRPVAFKVGTNYISILASTVGLPD  569

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L +G  D++ N W + +G +GE +K+F+EEG+ +AKW P+ 
Sbjct  570   SGAYMEHRYAGPKSISILDLNSGTIDVSDNMWGHRVGLKGEGMKVFSEEGSLRAKWMPLA  629

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  TWY+T F  PEG  P+A+ M  M KG++WVNG+SIGR+W++FL+PLG PTQ+
Sbjct  630   P--VPRPLTWYRTRFATPEGTGPVAIRMTGMGKGLIWVNGQSIGRHWMTFLSPLGTPTQS  687

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             E+HIPR +L P++NLLV+FEE   +P  ++V+ VNRDTICS +AEN P +V  W  +   
Sbjct  688   EFHIPRAFLNPQDNLLVIFEEEAMNPGQVEVLNVNRDTICSFIAENDPANVNSWVSRRGN  747

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F     ++ P+  L C   K +  IEFAS+GNP G CG+F+ GSC+     +IVE+ CLG
Sbjct  748   FHPIVSNIGPQAALECIPGKKITAIEFASFGNPSGYCGDFVLGSCNAAATKQIVEQQCLG  807

Query  1622  KTECEVPVEKSLFVE-GKDLCPKI-VKTLAVQAKC  1720
             K  C V +++++  + G D CP+I VKTLA+QA+C
Sbjct  808   KETCTVALDRAMLNQNGADPCPEILVKTLAIQARC  842



>gb|KHN33673.1| Beta-galactosidase 13 [Glycine soja]
Length=833

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/575 (50%), Positives = 394/575 (69%), Gaps = 3/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV GDPP QRSAEDI+FSV RF+SK+G  VNYYMY GG NFG T S F +T 
Sbjct  261   TENWTAQYRVHGDPPSQRSAEDIAFSVARFFSKNGNLVNYYMYHGGTNFGRTSSVFSTTR  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LC++ +L G  ++ K+N  HE+ TFE     
Sbjct  321   YYDEAPLDEYGLPREPKWSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTN  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAF++NN+T++P T+NFRGT+Y+LP  S+SILPDCK ++FNTQ I++QHN R ++ S 
Sbjct  381   MCAAFITNNHTMEPATINFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSP  440

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A N  WEMF E+IPT   +P   P P E+Y+L K TTDY W++T   +++ D+ M+P +
Sbjct  441   AANNFHWEMFNEAIPTAKKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGV  500

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL V S+GH+M+ F+NG+  G  HG +  K F    PV L+ GTN I+ L S +  P+
Sbjct  501   LPVLRVMSLGHSMVAFVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPD  560

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L  G  D+T+N W + +G +GE  K+F+EEG+   KW P+ 
Sbjct  561   SGAYMEHRYAGPKSINILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLG  620

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  +WY+T F  PEG  P+A+ M  M+KGMVWVNG +IGRYW+S+L+PLG+PTQ+
Sbjct  621   A--VPRALSWYRTRFGTPEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQS  678

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +L P++NLLV+FEE    P  ++++ VNRDTICS V E  P +V  W  +   
Sbjct  679   EYHIPRSFLNPQDNLLVIFEEEARVPAQVEILNVNRDTICSVVGERDPANVNSWVSRRGN  738

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F      +     + C   K +  +EFAS+GNP G CG+F  GSC+   + +IVE+ CLG
Sbjct  739   FHPVVKSVGAAASMACATGKRIVAVEFASFGNPSGYCGDFAMGSCNAAASKQIVERECLG  798

Query  1622  KTECEVPVEKSLF-VEGKDLCPKIVKTLAVQAKCV  1723
             +  C + +++++F   G D CP +VK LAVQ +C 
Sbjct  799   QEACTLALDRAVFNNNGVDACPDLVKQLAVQVRCA  833



>ref|XP_003523495.1| PREDICTED: beta-galactosidase 13 [Glycine max]
Length=844

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/575 (50%), Positives = 394/575 (69%), Gaps = 3/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV GDPP QRSAEDI+FSV RF+SK+G  VNYYMY GG NFG T S F +T 
Sbjct  272   TENWTAQYRVHGDPPSQRSAEDIAFSVARFFSKNGNLVNYYMYHGGTNFGRTSSVFSTTR  331

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHLRD H+AL LC++ +L G  ++ K+N  HE+ TFE     
Sbjct  332   YYDEAPLDEYGLPREPKWSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTN  391

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAF++NN+T++P T+NFRGT+Y+LP  S+SILPDCK ++FNTQ I++QHN R ++ S 
Sbjct  392   MCAAFITNNHTMEPATINFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSP  451

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A N  WEMF E+IPT   +P   P P E+Y+L K TTDY W++T   +++ D+ M+P +
Sbjct  452   AANNFHWEMFNEAIPTAKKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGV  511

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL V S+GH+M+ F+NG+  G  HG +  K F    PV L+ GTN I+ L S +  P+
Sbjct  512   LPVLRVMSLGHSMVAFVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPD  571

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGPKS+ +L L  G  D+T+N W + +G +GE  K+F+EEG+   KW P+ 
Sbjct  572   SGAYMEHRYAGPKSINILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLG  631

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
                  R  +WY+T F  PEG  P+A+ M  M+KGMVWVNG +IGRYW+S+L+PLG+PTQ+
Sbjct  632   A--VPRALSWYRTRFGTPEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQS  689

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR +L P++NLLV+FEE    P  ++++ VNRDTICS V E  P +V  W  +   
Sbjct  690   EYHIPRSFLNPQDNLLVIFEEEARVPAQVEILNVNRDTICSVVGERDPANVNSWVSRRGN  749

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F      +     + C   K +  +EFAS+GNP G CG+F  GSC+   + +IVE+ CLG
Sbjct  750   FHPVVKSVGAAASMACATGKRIVAVEFASFGNPSGYCGDFAMGSCNAAASKQIVERECLG  809

Query  1622  KTECEVPVEKSLF-VEGKDLCPKIVKTLAVQAKCV  1723
             +  C + +++++F   G D CP +VK LAVQ +C 
Sbjct  810   QEACTLALDRAVFNNNGVDACPDLVKQLAVQVRCA  844



>gb|KCW56611.1| hypothetical protein EUGRSUZ_I02332, partial [Eucalyptus grandis]
Length=823

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/571 (51%), Positives = 399/571 (70%), Gaps = 3/571 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+GT  NYYMY+GG NFG T SSFV+T 
Sbjct  255   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGTLANYYMYYGGTNFGRTPSSFVTTR  314

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H AL+LCKK LLWGT  +  +    E   +E     
Sbjct  315   YYDEAPIDEYGLLREPKWGHLRDLHSALRLCKKALLWGTPTVQNLGEGLEAQVYEKPGTG  374

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNN+T  P  + F+G +YYLP +S+SIL DCK +++NT  +++QH+ R +  S+
Sbjct  375   ICAAFLSNNSTRLPRQVMFKGIEYYLPQRSISILVDCKTVVYNTGTVVSQHSSRKYHQSE  434

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  NL+WEM++++IPT    P KS +P E+ + TK TTDY+W++T + +   DLP R D
Sbjct  435   IANKNLRWEMWRDNIPTTSDAPIKSKSPLELMSTTKDTTDYLWYATSIKLYPTDLPFRKD  494

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V ++GH M  F+NGE+ G  HG+N+ K F+L +P+ LKPG N+I+ L + +  P
Sbjct  495   IIPVLQVANLGHLMHAFVNGEYIGSGHGSNIEKSFVLQKPIELKPGLNNISLLSATVGLP  554

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AG   V L  L TG  D++ N W++ +G  GEKL ++ + G+ + +W   
Sbjct  555   DSGAYMEHRFAGVHKVTLKGLNTGTLDLSLNGWAHKVGLDGEKLHVYRQGGSHRVQW--T  612

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 + +  TWYK +FD PEGNDP+ + +  MSKGM WVNGKSIGRYW S+L+PL +P+Q
Sbjct  613   KAKKHGQPLTWYKAYFDAPEGNDPVVMQLGTMSKGMAWVNGKSIGRYWSSYLSPLERPSQ  672

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YH+PR +LKP +NLLV+ EE GG+P+ +K++ V+RD +CS + E  P  VK W+  G 
Sbjct  673   DVYHVPRAFLKPTDNLLVLLEEIGGNPEGVKILTVSRDVVCSFIHERDPVTVKSWKTNGG  732

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               R   DD+KPR HL CP+ K + K+EFASYGNP G CG++  G+CS   + K+VE+ CL
Sbjct  733   LIRTVADDMKPRAHLQCPEDKKIVKVEFASYGNPFGACGSYGVGNCSAAKSQKVVEQRCL  792

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQ  1711
             G+++C V VE+  F +   LCP ++K LAVQ
Sbjct  793   GRSKCSVKVERKNFDKAGSLCPDVLKMLAVQ  823



>ref|XP_010935389.1| PREDICTED: beta-galactosidase 11-like [Elaeis guineensis]
Length=843

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/582 (52%), Positives = 397/582 (68%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+SK+GT VNYYMY GG NFG  G+S+V T 
Sbjct  265   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSKNGTLVNYYMYHGGTNFGREGASYVMTR  324

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PK+ HLRD H+ALKL +K LLWG  ++  +   +E   +E+ +  
Sbjct  325   YYDEAPLDEYGLLKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGEWYEARLYESPESN  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+N N     T+NFRGTDY+LP +S+SILPDCK ++FNTQ + AQHN RTF    
Sbjct  385   VCVAFLTNTNPRVDGTVNFRGTDYFLPHRSISILPDCKTVVFNTQMVNAQHNARTFRTED  444

Query  542   VA-GNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V   N KW+MFQE IP        +  P ++Y +TK  TDY+W++TR  +   DLPMRPD
Sbjct  445   VTRKNDKWQMFQERIPKFLKKGIVASRPLDLYNMTKDITDYMWYTTRFRLEDVDLPMRPD  504

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GHAM  F+NG + G  HG  + K F+  +P++LK G N I+ L   + +P
Sbjct  505   IRPVLLVSSLGHAMHAFVNGIYIGSGHGAKLEKSFVFQKPMDLKQGVNHISILGMTVGFP  564

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             ++GA++E R AG  +  +  L TG  D++ N W + +G +GEKL ++TEEG++K KW   
Sbjct  565   DNGAYLEHRLAGVHTAAIQGLNTGTLDLSPNKWGHEVGMKGEKLGIYTEEGSKKVKW---  621

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             T   + +  TWYK +FD+P GNDP+A++M  M KG+ WVNG  IGRYWVS+L+PLG+P+Q
Sbjct  622   TEAKSGQPVTWYKRYFDMPSGNDPVALDMTGMGKGLAWVNGNCIGRYWVSYLSPLGKPSQ  681

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YH+PR WLKPK+NLLV+FEE GG+P+ + V+ V RD IC+ V + +PP ++ + R+  
Sbjct  682   SVYHVPRGWLKPKDNLLVIFEESGGNPEGLLVVTVKRDNICTVVTDLHPPTIESFSREDS  741

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             E +    D KP  HLTC   KV++ I FAS+GNP G CGNF  G+C  P    IVEKACL
Sbjct  742   EIKNLVQDGKPSAHLTCDKKKVIRSIAFASFGNPTGACGNFTVGTCHSPQTASIVEKACL  801

Query  1619  GKTECEVPVEKSLFVEGKD-LCPKIVKTLAVQAKCVRQGKED  1741
             GK  C +PV    +  G D  CP    TLAVQAKC RQ KED
Sbjct  802   GKNSCVLPVSAQEY--GADPACPGTTNTLAVQAKCARQKKED  841



>ref|XP_009406477.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/582 (50%), Positives = 389/582 (67%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+GT  NYYMY GG NFG TG++FV T 
Sbjct  196   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGTLTNYYMYHGGTNFGRTGAAFVMTR  255

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PKW HL+D H ALKLC+K LLWGT ++ K +   E   +E  + K
Sbjct  256   YYDEAPLDEYGLQKEPKWGHLKDLHNALKLCRKGLLWGTPSVQKFDAGFEARLYEIPESK  315

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+N N  K   +NFRG +YYLP  S+SILPDCK ++FN+Q + +QHN RTFD +K
Sbjct  316   VCVAFLTNTNAKKDGVMNFRGVEYYLPRHSISILPDCKTVVFNSQQVNSQHNARTFDVAK  375

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N +W+M+ E IPT       +  P E+  +TK TTDY+W++T   ++  DLPMR D
Sbjct  376   AAKENNQWQMYTEQIPTSRDANVSAKGPLELLNMTKDTTDYLWYTTSFKLDDDDLPMRHD  435

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V ++GHAM  F+NG++ G  HG  + K F+  +P++LK G N I  L   +  P
Sbjct  436   IRPVLQVSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLKAGVNQIAILGLTVGLP  495

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R +G  +V++  L  G  D+++N W + +G  GE L +F E+ A   KW   
Sbjct  496   DSGAYLEHRLSGVHTVVIQGLNAGTLDLSQNLWRHQVGLAGENLGIFDEQRANAVKWEEA  555

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               +      TWYK +FD P GNDP+AV+M  M KG VW+NG+SIGR+WVS+L+PLG+ +Q
Sbjct  556   QSD---TAVTWYKRYFDAPSGNDPVAVDMNSMGKGQVWINGESIGRFWVSYLSPLGKASQ  612

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YH+PR +LKPKNNL+VVFEE GG P  I ++ V RD IC+ V+  +P  +  W R+  
Sbjct  613   SIYHVPRSFLKPKNNLMVVFEEHGGKPKDIVILTVKRDNICTFVSAQHPAQIGTWSREDS  672

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + R+   D KP   L C + KV++ I FAS+GNP+G+CGNF  GSC    A  +VEKACL
Sbjct  673   QIRSVVGDAKPEARLKCGEKKVIRSIVFASFGNPDGMCGNFTVGSCHTQQAKSVVEKACL  732

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGKED  1741
             GK  C +PV    +  G D  CP    TLAVQAKC R+ K+D
Sbjct  733   GKESCALPVSAEAY--GADAGCPGTTSTLAVQAKCARKSKKD  772



>ref|XP_009376956.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
 ref|XP_009376964.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
Length=859

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/574 (51%), Positives = 388/574 (68%), Gaps = 4/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK GT  NYYMY GG NFG T + F +T 
Sbjct  287   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSAIFTTTR  346

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKWSHL+D H+AL LCKKPL  G + + ++  + E   +E     
Sbjct  347   YYDEAPLDEYGLQREPKWSHLKDLHKALNLCKKPLFAGASGVLRLGKETEARFYEKPGTD  406

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFL+NN++   T++ +RG +Y+LP  S+SILPDCK ++FN+Q I++QHN R F  SK
Sbjct  407   SCVAFLANNHSKLETSVTWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRSK  466

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  L WEM  E IPT++ +P     P+E+Y   K  TDY WF+T + +   DLPM+  I
Sbjct  467   AANKLNWEMSPEPIPTVEQVPVNQKKPQELYHFLKDATDYGWFTTSLNLGPYDLPMKDSI  526

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PVL + S+GHAM VF+NGE+ G  HG++  K F+  +PV  K G N I+ LC  +  P+
Sbjct  527   RPVLRIPSLGHAMGVFVNGEYIGSEHGSHEEKGFVFERPVTFKQGINHISLLCMTVGLPD  586

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+++ +L L TG  D+++N W + +G  GE L++FTE+GAEK +W    
Sbjct  587   SGAYMEHRYAGPRTINVLGLNTGTLDLSQNGWGHRVGLNGENLQVFTEKGAEKVQWTKAV  646

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT+FD PEG DP+A+ M  M KGM+WVNG SIGR+W+ FL+PLGQPTQT
Sbjct  647   G--KGRGLTWYKTYFDAPEGRDPVAIRMTGMGKGMIWVNGLSIGRHWMCFLSPLGQPTQT  704

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N LVV EE   DP  I+++ VNRDTICS   + +PP VK ++RK  +
Sbjct  705   EYHIPRSFIKPSKNFLVVLEEQDADPKDIEILTVNRDTICSMSTQMHPPHVKAFDRKAGK  764

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
              +           L CP+ K +  +EFAS+G+PEG CG +  G C  P   KIVE+ CLG
Sbjct  765   LKVVAGVPGATAQLKCPNYKKIVAVEFASFGSPEGACGTYAIGKCDAPGTKKIVEEKCLG  824

Query  1622  KTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKC  1720
             +T C VP + +LF +  D CP + +KTLA+Q KC
Sbjct  825   QTTCTVPSDPNLFFK-VDPCPDVKIKTLAIQVKC  857



>ref|XP_008377743.1| PREDICTED: beta-galactosidase 13 [Malus domestica]
Length=860

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/574 (52%), Positives = 386/574 (67%), Gaps = 4/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK GT  NYYMY GG NFG T S F +T 
Sbjct  288   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSSIFTTTR  347

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H+AL LCKK LL G   + K+  + E   +E     
Sbjct  348   YYDEAPLDEYGLQREPKWGHLKDLHKALNLCKKSLLAGAPGVLKLGKETEARFYEKPGTD  407

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NN++   T++ +RG  Y+LP  S+SILPDCK ++FN+Q I++QHN R F  SK
Sbjct  408   ICVAFLANNHSKLETSVTWRGQXYFLPPHSISILPDCKTVVFNSQQIVSQHNTRNFVRSK  467

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  L WEM  E IPT+  +P     P+E+Y L K  TDY WF+T + +   DLPM+  I
Sbjct  468   AAKKLNWEMSPEPIPTVVQVPVNQKKPQELYHLLKDATDYGWFTTSLDLGPYDLPMKDSI  527

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PV+ + S+GHAM VF+NGE+ G  HG++  K F+  +PV  K G N I+ LC  +  P+
Sbjct  528   RPVIRIPSLGHAMGVFVNGEYIGTEHGSHAEKGFVFEKPVTFKQGLNYISLLCMTVGLPD  587

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+++ +L L TG  D+++N W + +G  GE L++FTE+GA+K +W    
Sbjct  588   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTEKGAQKVQWTKAA  647

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT+FD PEG DP+A+ M  M KGMVWVNG SIGR+W+SFL+PLGQPTQ 
Sbjct  648   G--KGRALTWYKTYFDAPEGKDPVAIRMTGMGKGMVWVNGLSIGRHWMSFLSPLGQPTQA  705

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N LVV EE   DP  I+++ VNRDTICS  ++ +PP V  +ERKG +
Sbjct  706   EYHIPRSFIKPGKNFLVVLEEQDADPKDIEILTVNRDTICSMSSQMHPPHVNAFERKGGK  765

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+           L CP+ K +  +EFAS+G PEGVCG +  GSC  P   KIVE+ CLG
Sbjct  766   FQIVAGISAATAQLKCPNYKKIVAVEFASFGTPEGVCGTYAIGSCDAPGTKKIVEEKCLG  825

Query  1622  KTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKC  1720
             KT C VP +  LF +  D CP + +K LA+Q  C
Sbjct  826   KTACTVPSDPGLFFK-VDPCPTVKIKRLAIQVLC  858



>gb|AAS76480.1| beta-galactosidase [Gossypium hirsutum]
Length=843

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/575 (51%), Positives = 400/575 (70%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+G+ VNYYM++GG NFG T +SF +T 
Sbjct  275   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGSMVNYYMHYGGTNFGRTSASFTTTR  334

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDEGP+D +G  R+PKW HL+D HRAL LCK+ L WG     K+  D +   ++     
Sbjct  335   YYDEGPLDEFGLQREPKWGHLKDVHRALSLCKRALFWGFPTTLKLGPDQQAIVWQQPGTS  394

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT     +NFRG D  LPA+S+S+LPDCK ++FNTQ +  QHN R F  S+
Sbjct  395   ACAAFLANNNTRLAQHVNFRGQDIRLPARSISVLPDCKTVVFNTQLVTTQHNSRNFVRSE  454

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  N  WEM +E  P    L  K   P+E++ LTK TTDY W++T +++ +RDLPM+ +
Sbjct  455   IANKNFNWEMCREVPPV--GLGFKFDVPRELFHLTKDTTDYAWYTTSLLLGRRDLPMKKN  512

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL V S+GH +  ++NGE+AG  HG+ V K F+L + V+LK G N I  L  ++  P
Sbjct  513   VRPVLRVASLGHGIHAYVNGEYAGSAHGSKVEKSFVLQRAVSLKEGENHIALLGYLVGLP  572

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME+R+AGP+S+ +L L TG  DI++N W + +G  GEK KLFTEEG++  +W   
Sbjct  573   DSGAYMEKRFAGPRSITILGLNTGTLDISQNGWGHQVGIDGEKKKLFTEEGSKSVQW---  629

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             T        TWYK +FD PEG++P+A+ M  M KGMVWVNG+SIGRYW ++L+PL +PTQ
Sbjct  630   TKPDQGGPLTWYKGYFDAPEGDNPVAIVMTGMGKGMVWVNGRSIGRYWNNYLSPLKKPTQ  689

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYHIPR +LKPK NL+V+ EE GG+P  + ++ VNRDTICS+V+E +PP  +++E K  
Sbjct  690   SEYHIPRAYLKPK-NLIVLLEEEGGNPKDVHIVTVNRDTICSAVSEIHPPSPRLFETKNG  748

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               +A  +DLKPR  L CP  K +  +EFASYG+P G CG +  G+C+ P + ++VEK CL
Sbjct  749   SLQAKVNDLKPRAELKCPGKKQIVAVEFASYGDPFGACGAYFIGNCTAPESKQVVEKYCL  808

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             GK  C++P++   F    D C  + KTLAVQ KC 
Sbjct  809   GKPSCQIPLDSIPFSNQNDACTHLRKTLAVQLKCA  843



>ref|XP_006486854.1| PREDICTED: beta-galactosidase 13-like [Citrus sinensis]
Length=832

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/577 (51%), Positives = 404/577 (70%), Gaps = 8/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RV+GDPP QRS ED++FS  RF S++GT +NYYMY GG NFG T ++FV+T 
Sbjct  257   TENWTAQFRVYGDPPSQRSVEDLAFSTARFISRNGTLINYYMYHGGTNFGRTSANFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R+PKW HL+D HRALKLCKK LLWG  ++ K+  D E   +E     
Sbjct  317   YYDEAPLDEFGLQREPKWGHLKDLHRALKLCKKALLWGYPSVKKLGQDLEAIVYEGHGA-  375

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFLSNN+T    T++FRG +YYLP+KS+SILPDC+ +++NTQ I++QHN R F PS 
Sbjct  376   -CAAFLSNNSTYMEKTISFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPSV  434

Query  542   VAG---NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
             VA    +  WE + ESIPT + L  K+  P E++ LTK TTDY W+S  + + + DLPMR
Sbjct  435   VANKRLSWDWETYTESIPTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPMR  494

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
              +  PVL V S+GHA++ F+NGE+ G  HG+++ K F+  +P+ LK G N I  L S++ 
Sbjct  495   ANASPVLIVASLGHALVAFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVVG  554

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             +P+SGA+ME+R+AGP  V +L L TG  ++TKN W++ +G  GE+ K+FT  G  K KW 
Sbjct  555   FPDSGAYMEKRFAGPHRVEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKWT  614

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
              + G       TW+KTHFD PEGN PIA+ M +M KGM+W+NG+SIGRYW+S+L+PLGQP
Sbjct  615   KIEGKRPA--LTWFKTHFDAPEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQP  672

Query  1253  TQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQ+EYHIPR +LKP  NL+V+  EE    P+ IK ++V+RDTICS +++ +PP V+ W  
Sbjct  673   TQSEYHIPRSYLKPTGNLMVILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWGS  732

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K +    T ++ K    LTCPD KV+  ++FASYG+  G+CG +  G+C+  +  ++VE+
Sbjct  733   KNNVSEYTANNRKASAVLTCPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVER  792

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CLGK  C++P EK L +   D CP + K+LAVQ KC
Sbjct  793   FCLGKHTCQIPFEKELLIRNWDPCPNVKKSLAVQVKC  829



>ref|XP_008347518.1| PREDICTED: beta-galactosidase 13-like [Malus domestica]
Length=769

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/574 (52%), Positives = 386/574 (67%), Gaps = 4/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+SK GT  NYYMY GG NFG T S F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSSIFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H+AL LCKK LL G   + K+  + E   +E     
Sbjct  257   YYDEAPLDEYGLQREPKWGHLKDLHKALNLCKKSLLAGAPGVLKLGKETEARFYEKPGTD  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+NN++   T++ +RG +Y+LP  S+SILPDCK ++FN+Q I++Q N R F  SK
Sbjct  317   ICVAFLANNHSKLETSVTWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQXNTRNFVRSK  376

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  L WEM  E IPT+  +P     P+E+Y L K  TDY WF+T + +   DLPM+  I
Sbjct  377   AAKKLNWEMSPEPIPTVVQVPVNQKKPQELYHLLKDATDYGWFTTSLDLGPYDLPMKDSI  436

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PV+ + S+GHAM VF+NGE+ G  HG++  K F+  +PV  K G N I+ LC  +  P+
Sbjct  437   RPVIRIPSLGHAMGVFVNGEYIGTEHGSHAEKGFVFEKPVTFKQGLNYISLLCMTVGLPD  496

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+++ +L L TG  D+++N W + +G  GE L++FTE+GA+K +W    
Sbjct  497   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTEKGAQKVQWTKAA  556

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT+FD PEG DP+A+ M  M KGMVWVNG SIGR+W+SFL+PLGQPTQ 
Sbjct  557   G--KGRALTWYKTYFDAPEGKDPVAIRMTGMGKGMVWVNGLSIGRHWMSFLSPLGQPTQA  614

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KP  N LVV EE   DP  I+++ VNRDTICS  ++ +PP V  +ERKG +
Sbjct  615   EYHIPRSFIKPGKNFLVVLEEQDADPKDIEILTVNRDTICSMSSQMHPPHVNAFERKGGK  674

Query  1442  FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLG  1621
             F+           L CP+ K +  +EFAS+G PEGVCG +  GSC  P   KIVE+ CLG
Sbjct  675   FQIVAGISAATAQLKCPNYKKIVAVEFASFGTPEGVCGTYAIGSCDAPGTKKIVEEKCLG  734

Query  1622  KTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKC  1720
             KT C VP +  LF +  D CP + +K LA+Q  C
Sbjct  735   KTACTVPSDPGLFFK-VDPCPTVKIKRLAIQVLC  767



>ref|XP_006422606.1| hypothetical protein CICLE_v10030124mg [Citrus clementina]
 gb|ESR35846.1| hypothetical protein CICLE_v10030124mg [Citrus clementina]
Length=832

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/577 (51%), Positives = 404/577 (70%), Gaps = 8/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RV+GDPP QRS ED++FS  RF S++GT +NYYMY GG NFG T ++FV+T 
Sbjct  257   TENWTAQFRVYGDPPSQRSVEDLAFSTARFISRNGTLINYYMYHGGTNFGRTSANFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  RDPKW HL+D HRALKLCKK LLWG  ++ K+  D E   +E     
Sbjct  317   YYDEAPLDEFGLQRDPKWGHLKDLHRALKLCKKALLWGYPSVQKLGQDLEAIVYEGHGA-  375

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFLSNN+T    T++FRG +YYLP+KS+SILPDC+ +++NTQ I++QHN R F PS 
Sbjct  376   -CAAFLSNNSTYMAKTISFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPSV  434

Query  542   VAG---NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
             VA    +  WE + ESIPT + L  K+  P E++ LTK TTDY W+S  + + + DLPMR
Sbjct  435   VANKRLSWDWETYTESIPTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPMR  494

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
              +  PVL V S+GHA++ F+NGE+ G  HG+++ K F+  +P+ LK G N I  L S++ 
Sbjct  495   ANASPVLIVASLGHALVAFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVVG  554

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             +P+SGA+ME+R+AGP  V +L L TG  ++TKN W++ +G  GE+ K+FT  G  K KW 
Sbjct  555   FPDSGAYMEKRFAGPHRVEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKWT  614

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
              + G       TW+KT+FD PEGN PIA+ M +M KGM+W+NG+SIGRYW+S+L+PLGQP
Sbjct  615   KIEGKRPA--LTWFKTYFDAPEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQP  672

Query  1253  TQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQ+EYHIPR +LKP  NL+V+  EE    P+ IK ++V+RDTICS +++ +PP V+ W  
Sbjct  673   TQSEYHIPRSYLKPTGNLMVILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWGS  732

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K +    T ++ K    LTCPD KV+  ++FASYG+  G+CG +  G+C+  +  ++VE+
Sbjct  733   KNNVSEYTANNRKASAVLTCPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVER  792

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CLGK  C++P EK L +   D CP + K+LAVQ KC
Sbjct  793   FCLGKHTCQIPFEKELLIRNWDPCPNVKKSLAVQVKC  829



>ref|XP_003604038.1| Beta-galactosidase [Medicago truncatula]
Length=847

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/592 (51%), Positives = 398/592 (67%), Gaps = 26/592 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDP  QRSAEDI+FSV RF+SK+G  VNYYMY GG NFG T S+F +T 
Sbjct  261   TENWTAQYRVFGDPVSQRSAEDIAFSVARFFSKNGNLVNYYMYHGGTNFGRTTSAFTTTR  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R PKWSHLRD H+AL LC+K +L G   + K+N  HE+  FE     
Sbjct  321   YYDEAPLDEYGMERQPKWSHLRDAHKALLLCRKAILGGVPTVQKLNDYHEVRIFEKPGTS  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQH--------------  499
              C+AF++NN+T +  T++FRG++Y+LPA S+S+LPDCK +++NTQ+              
Sbjct  381   TCSAFITNNHTNQAATISFRGSNYFLPAHSISVLPDCKTVVYNTQNVMNQLVYYKLISSH  440

Query  500   -----ILAQHNHRTFDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYV  664
                  I++QHN R F  S VA NLKWE+F E+IP+   L +    P E+YTL K TTDY 
Sbjct  441   LIIKLIVSQHNKRNFVKSAVANNLKWELFLEAIPSSKKLESNQKIPLELYTLLKDTTDYG  500

Query  665   WFSTRVVMNKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVN  844
             W++T   +   DLP +  I   L + S+GH +  F+NG++ G +HG +  K F   QP N
Sbjct  501   WYTTSFELGPEDLPKKSAI---LRIMSLGHTLSAFVNGQYIGTDHGTHEEKSFEFEQPAN  557

Query  845   LKPGTNDITFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGE  1024
              K GTN I+ L + +  P+SGA+ME RYAGPKS+ +L L  G  ++TKN W + +G +GE
Sbjct  558   FKVGTNYISILATTVGLPDSGAYMEHRYAGPKSISILGLNKGKLELTKNGWGHRVGLRGE  617

Query  1025  KLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGK  1204
             +LK+FTEEG++K +W PVTG   TR  +W KT F  PEG  P+A+ M  M KGM+WVNGK
Sbjct  618   QLKVFTEEGSKKVQWDPVTG--ETRALSWLKTRFATPEGRGPVAIRMTGMGKGMIWVNGK  675

Query  1205  SIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICS  1384
             SIGR+W+SFL+PLGQP+Q EYHIPR +L  K+NLLVV EE  G P+ I++M+V+RDTICS
Sbjct  676   SIGRHWMSFLSPLGQPSQEEYHIPRDYLNAKDNLLVVLEEEKGSPEKIEIMIVDRDTICS  735

Query  1385  SVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFM  1564
              + EN P +V  W  K  EFR+   +  P+  L CP  K +  +EFAS+GNP G CG+F 
Sbjct  736   YITENSPANVNSWGSKNGEFRSVGKNSGPQASLKCPSGKKIVAVEFASFGNPSGYCGDFA  795

Query  1565  TGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              G+C+   A  +VEKACLGK EC V V ++ F  G+  C   V TLA+QAKC
Sbjct  796   LGNCNGGAAKGVVEKACLGKEECLVEVNRANF-NGQG-CAGSVNTLAIQAKC  845



>ref|XP_004292170.1| PREDICTED: beta-galactosidase 13-like [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/574 (52%), Positives = 388/574 (68%), Gaps = 7/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR AEDI+FSV RF+SK G+  NYYMY GG NFG T + F +T 
Sbjct  197   TENWTAQYRVFGDPPSQRPAEDIAFSVARFFSKGGSLTNYYMYHGGTNFGRTSAVFTTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D Y F R+PKWSHL+D H+++ LCKK LL G     ++  D E+  +E    +
Sbjct  257   YYDEAPLDEYAFQREPKWSHLKDLHKSINLCKKTLLTGIPGTQRLGPDTEVRFYEKPGTE  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAF++NN+T    T+N+RG +Y LP  S+S+LPDCK ++FNTQ I++QHN R F  S 
Sbjct  317   -CAAFIANNHTTLEATVNWRGQNYLLPPFSISVLPDCKTVVFNTQQIVSQHNARNFVTS-  374

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
              A  + WEM+ E + T++ +P  +   +E+Y L K  TDY W++T + +   DLPM+  I
Sbjct  375   -AKQMNWEMYLEPVATVEQVPVNNRELQELYGLLKDKTDYAWYTTSIELGPYDLPMKDTI  433

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              PV+ + S+GHAM+VF+N E+AG  HG +  K F+   PV +K GTN I+ LC  +  P+
Sbjct  434   SPVVRIPSLGHAMLVFVNDEYAGSQHGTHAEKGFVFEAPVKMKKGTNHISLLCMTVGLPD  493

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVT  1081
             SGA+ME RYAGP+SV +L L TG  D++ N W +  G  GEKL++FTE+GA+K +W   T
Sbjct  494   SGAYMEHRYAGPRSVTILGLNTGTIDVSANGWGHRAGLNGEKLQVFTEQGAQKVQWTKAT  553

Query  1082  GNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQT  1261
             G    R  TWYKT FD P G DP A+ M  M KGM+WVNG SIGR+W+SFL+PLGQPTQT
Sbjct  554   G--IGRALTWYKTTFDAPPGGDPCAIRMTGMGKGMIWVNGISIGRHWMSFLSPLGQPTQT  611

Query  1262  EYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDE  1441
             EYHIPR ++KPK NLLVV EE   DP  I+++ VNRDTICS + ++YP  VK W+RK   
Sbjct  612   EYHIPRAFIKPK-NLLVVLEEEPSDPKDIEIVTVNRDTICSLIGQDYPGHVKYWDRKAGI  670

Query  1442  FR-ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
              + A    L+    L CPD K + KIEFASYGNP+G CG    G+C+ P + K+VE  CL
Sbjct  671   LQHAPGKSLQATALLNCPDYKKISKIEFASYGNPDGSCGALTMGTCNAPESKKVVEDLCL  730

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C VP++  LF +  D CP   K L +QA C
Sbjct  731   GKMICTVPLDPKLFFKAGDPCPGTKKKLMIQALC  764



>gb|KDO71286.1| hypothetical protein CISIN_1g045037mg [Citrus sinensis]
Length=832

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/574 (50%), Positives = 398/574 (69%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTA+YRVFGDPP +RSAE+++FSV RF+SK+GT  NYYMY+GG N+G  GSSFV+T 
Sbjct  257   TENWTARYRVFGDPPSRRSAENLAFSVARFFSKNGTLANYYMYYGGTNYGRLGSSFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H AL+LCKK LL G  ++     + E   +E    K
Sbjct  317   YYDEAPIDEYGMLREPKWGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFLSNN++  P TL FRG+ YYLP  S+SILPDCK +++NT+ I+AQH+ R +  SK
Sbjct  377   ACVAFLSNNDSRTPATLTFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSK  436

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  +L+WEMF E IPT++    KS +P E +++TK TTDY+W +T + ++   LP+R  
Sbjct  437   AANKDLRWEMFIEDIPTLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREK  496

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL + S+GH M  F+NG + G  HG N    F+  +P+ LKPG N I+ L   +  P
Sbjct  497   VLPVLRIASLGHMMHGFVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLP  556

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG ++ERRYAG ++V +  L TG  D+T + W   +G  GEK +++T+EG+++ KW   
Sbjct  557   DSGVYLERRYAGTRTVAIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKT  616

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYKT+FD PEGNDP+A+ +  MSKGMVWVNGKSIGRYWVSFL+P G+P+Q
Sbjct  617   KGLGGP--LTWYKTYFDAPEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQ  674

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK+NLL +FEE GG+ D ++++ VNR+TICS + E+ P  V   +R+  
Sbjct  675   SVYHIPRAFLKPKDNLLAIFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDI  734

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               +   DD +    L CPD + + ++EFASYGNP G CGN++ G+CS P++ +I+E+ CL
Sbjct  735   VIQKVFDDARRSATLMCPDNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCL  794

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C +P ++++F   + LCP + K LA+Q +C
Sbjct  795   GKNRCAIPFDQNIFDRERKLCPNVPKNLAIQVQC  828



>gb|KDO68060.1| hypothetical protein CISIN_1g035496mg [Citrus sinensis]
Length=833

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/578 (51%), Positives = 403/578 (70%), Gaps = 9/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RV+GDPP QRS ED++FS  RF S++GT +NYYMY GG NFG T ++FV+T 
Sbjct  257   TENWTAQFRVYGDPPSQRSVEDLAFSTARFISRNGTLINYYMYHGGTNFGRTSANFVTTR  316

Query  182   YYDEGPMDIYG-FNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             YYDE P+D +  F + PKW HL+D HRALKLCKK LLWG  ++ K+  D E   +E    
Sbjct  317   YYDEAPLDEFAVFAKGPKWGHLKDLHRALKLCKKALLWGYPSVQKLGQDLEAIVYEGHGA  376

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSNN+T    T++FRG +YYLP+KS+SILPDC+ +++NTQ I++QHN R F PS
Sbjct  377   --CAAFLSNNSTYMEKTISFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPS  434

Query  539   KVAG---NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
              VA    +  WE + ESIPT + L  K+  P E++ LTK TTDY W+S  + + + DLPM
Sbjct  435   VVANKRLSWDWETYTESIPTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPM  494

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             R +  PVL V S+GHA++ F+NGE+ G  HG+++ K F+  +P+ LK G N I  L S++
Sbjct  495   RANASPVLIVASLGHALVAFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVV  554

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
              +P+SGA+ME+R+AGP  V +L L TG  ++TKN W++ +G  GE+ K+FT  G  K KW
Sbjct  555   GFPDSGAYMEKRFAGPHRVEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKW  614

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
               + G       TW+KT+FD PEGN PIA+ M +M KGM+W+NG+SIGRYW+S+L+PLGQ
Sbjct  615   TKIEGKRPA--LTWFKTYFDAPEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQ  672

Query  1250  PTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             PTQ+EYHIPR +LKP  NL+V+  EE    P+ IK ++V+RDTICS +++ +PP V+ W 
Sbjct  673   PTQSEYHIPRSYLKPTGNLMVILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWG  732

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
              K +    T ++ K    LTCPD KV+  ++FASYG+  G+CG +  G+C+  +  ++VE
Sbjct  733   SKNNVSEYTANNRKASAVLTCPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVE  792

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             + CLGK  C++P EK L +   D CP + K+LAVQ KC
Sbjct  793   RFCLGKHTCQIPFEKELLIRNWDPCPNVKKSLAVQVKC  830



>ref|XP_006467171.1| PREDICTED: beta-galactosidase 13-like [Citrus sinensis]
Length=832

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/574 (50%), Positives = 398/574 (69%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTA+YRVFGDPP +RSA++++FSV RF+SK+GT  NYYMY+GG N+G +GSSFV+T 
Sbjct  257   TENWTARYRVFGDPPSRRSAQNLAFSVARFFSKNGTLANYYMYYGGTNYGRSGSSFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H AL+LCKK LL G  ++     + E   +E    K
Sbjct  317   YYDEAPIDEYGMLREPKWGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFLSNN++  P TL FRG+ YYLP  S+SILPDCK +++NT+ I+AQH+ R +  SK
Sbjct  377   ACVAFLSNNDSRTPATLTFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSK  436

Query  542   VAGN-LKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A   L+WEMF E IPT++    KS +P E +++TK TTDY+W +T + ++   LP+R  
Sbjct  437   AANKALRWEMFIEDIPTLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREK  496

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL + S+GH M  F+NG + G  HG N    F+  +P+ LKPG N I+ L   +  P
Sbjct  497   VLPVLRIASLGHMMHGFVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLP  556

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG ++ERRYAG ++V +  L TG  D+T + W   +G  GEK +++T+EG+++ KW   
Sbjct  557   DSGVYLERRYAGTRTVAIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKT  616

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYKT+FD PEGNDP+A+ +  MSKGMVWVNGKSIGRYWVSFL+P G+P+Q
Sbjct  617   KGLGGP--LTWYKTYFDAPEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQ  674

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK+NLL +FEE GG+ D ++++ VNR+TICS + E+ P  V   +R+  
Sbjct  675   SVYHIPRAFLKPKDNLLAIFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDI  734

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               +   DD +    L CPD + + ++EFASYGNP G CGN++ G+CS P++ +I+E+ CL
Sbjct  735   VIQKVFDDARRSATLMCPDNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCL  794

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C +P ++++F   + LCP + K LA+Q +C
Sbjct  795   GKNRCAIPFDQNIFDRERKLCPNVPKNLAIQVQC  828



>ref|XP_006425408.1| hypothetical protein CICLE_v10026929mg [Citrus clementina]
 gb|ESR38648.1| hypothetical protein CICLE_v10026929mg [Citrus clementina]
Length=832

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/574 (50%), Positives = 399/574 (70%), Gaps = 3/574 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTA+YRVFGDPP +RSA++++FSV RF+SK+GT  NYYMY+GG N+G +GSSFV+T 
Sbjct  257   TENWTARYRVFGDPPSRRSAQNLAFSVARFFSKNGTLANYYMYYGGTNYGRSGSSFVTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD H AL+LCKK LL G  ++     + E   +E    K
Sbjct  317   YYDEAPIDEYGMLREPKWGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTK  376

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFLSNN++  P TL FRG+ YYLP  S+SILPDCK +++NT+ I+AQH+ R +  SK
Sbjct  377   ACVAFLSNNDSRTPATLTFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSK  436

Query  542   VAGN-LKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A   L+WEMF E IPT++    KS +P E +++TK TTDY+W +T + ++   LP+R +
Sbjct  437   AANKALRWEMFIEDIPTLNENLIKSASPLEQWSVTKDTTDYLWHTTGISLDGFHLPLREN  496

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL + S+GH M  F+NG + G  HG N+   F+  +P+ LKPG N I+ L   +  P
Sbjct  497   VLPVLRIASLGHMMHGFVNGHYIGSGHGTNIENSFVFQKPIILKPGINHISLLGVTIGLP  556

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG ++ERRYAG ++V +  L TG  D+T + W   +G  GEK +++T+EG+++ KW   
Sbjct  557   DSGVYLERRYAGTRTVAIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKT  616

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYKT+FD PEGNDP+A+ +  MSKGMVWVNGKSIGRYWVSFL+P G+P+Q
Sbjct  617   KGLGGP--LTWYKTYFDAPEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQ  674

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK+NLL +FEE GG+ D ++++ VNR+TICS + E+ P  V   +R+  
Sbjct  675   SVYHIPRAFLKPKDNLLAIFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDI  734

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
               +   DD +    L CPD + + ++EFASYGNP G CGN++ G+CS P++ +I+E+ CL
Sbjct  735   VIQKVFDDARRSATLMCPDNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCL  794

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C +P ++++F   K LC  + K LA+Q +C
Sbjct  795   GKNRCAIPFDQNIFDREKKLCLNVPKNLAIQVQC  828



>gb|KHG26973.1| Beta-galactosidase 13 -like protein [Gossypium arboreum]
Length=819

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/578 (50%), Positives = 399/578 (69%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED++FS++RF SK+GT VNYYMY GG NFG T SS+ +T 
Sbjct  247   TENWTAQFRVFGDPPSQRSAEDLAFSIIRFCSKNGTLVNYYMYHGGTNFGRTSSSYTTTR  306

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R PKW HL+D HRA+ LCK+ L  G+  + K+  D E   +E     
Sbjct  307   YYDEAPLDEFGLIRQPKWGHLKDAHRAVNLCKRALFSGSPFVQKLGPDQEARVWEQPGTS  366

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC+AFL+NN+T KP  L FRG DY LP +S+SILPDCK  +FN+Q I   HN R F  S 
Sbjct  367   LCSAFLTNNDTKKPQALRFRGQDYQLPPRSISILPDCKTEVFNSQMITTHHNSRNFVRSV  426

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  WEM++E +P  D    K   P+E+Y LTK T+DY W+ T++ + +RDLPM+ +
Sbjct  427   AANKNFNWEMYREVVP--DDPGNKLNEPRELYELTKDTSDYAWYITKLDLGRRDLPMKNE  484

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GH +  ++NG++ G  HG+ V K F+  +PV  + G+N I  L  ++  P
Sbjct  485   ILPVLRVASLGHGLHCYVNGKYIGTAHGSKVEKSFVFQKPVEFQAGSNQIALLGFLVGLP  544

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW---  1069
             +SGA+ME+RYAGP+S+ +L L TG  DIT N+WS+ +G  GEK +++T+ G  K +W   
Sbjct  545   DSGAYMEKRYAGPRSITILGLNTGTLDITLNTWSHQVGLDGEKNQIYTQNGFPKVQWVKG  604

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
             GP  G       TWYK +FD PEG++P+AV M  M KGMV++NG++IGRYW+S+L+PL +
Sbjct  605   GPSEG------VTWYKGYFDAPEGDNPVAVKMTGMGKGMVYINGRNIGRYWMSYLSPLKR  658

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             PTQ+EYHIPR +L+P  NL+V+ E+  GDP  I+++LV+RDTIC  + E + P V+++E 
Sbjct  659   PTQSEYHIPRSYLQPTMNLIVIVEDEKGDPKDIEIVLVDRDTICGFITEKHLPSVRLFEG  718

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             KG +  A   DLKPR+ LTCP  K +  +EFAS+G+P G CG+++ G+C+ P A ++VEK
Sbjct  719   KGGKLVALEKDLKPRVELTCPSQKQIVSVEFASFGDPFGACGHYVEGNCTSPVAKQVVEK  778

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
              CLGK  C +P++        + CP++ KTLA+QAKC 
Sbjct  779   FCLGKPSCNIPLDTPDLHNKNEACPEMKKTLAIQAKCA  816



>ref|XP_008811843.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like [Phoenix 
dactylifera]
Length=867

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/606 (49%), Positives = 397/606 (66%), Gaps = 31/606 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+SK+GT VNYYMY GG NFG  G+S+V T 
Sbjct  265   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSKNGTLVNYYMYHGGTNFGREGASYVMTR  324

Query  182   YYDEGPMDIYGF------------------------NRDPKWSHLRDTHRALKLCKKPLL  289
             YYDE P+D YGF                         ++PK+ HLR+ H+AL+L +K LL
Sbjct  325   YYDEAPLDEYGFFFILNVYRLXDTQLFLMRCVHPGLPKEPKFGHLRELHQALRLSRKGLL  384

Query  290   WGTANLNKINGDHEITTFENTDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPD  469
             WG  ++  +   +E T FE+ + K+C AFL+N N     T+NFRG +Y+LP +S+SILPD
Sbjct  385   WGVPSVQPLGPGYEATLFESPESKICVAFLTNTNPRVDGTVNFRGVNYFLPHRSISILPD  444

Query  470   CKNMIFNTQHILAQHNHRTFDPSKVAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTK  646
             CK ++FNTQ +  QHN RTF+ + V G N KW MFQE IP        +  P E+Y +TK
Sbjct  445   CKTVVFNTQRVNGQHNARTFNTADVTGKNDKWYMFQERIPKFRDSGIVASKPLELYNMTK  504

Query  647   HTTDYVWFSTRVVMNKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFI  826
               TDY+W++TR  +   DLPMR DI PVL V S+GHAM  F+NG + G  +G  + K F+
Sbjct  505   DVTDYMWYTTRFRLEDEDLPMRHDIRPVLLVSSLGHAMHAFVNGIYIGSGNGAKLEKSFV  564

Query  827   LLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYS  1006
               +P+ LK G N I+ L     +P++GA++E R AG  +  +  L  G  D++ N W + 
Sbjct  565   FQKPMELKQGVNHISILGLTTGFPDNGAYLEHRLAGIHTAAVQGLNIGTLDLSGNKWGHE  624

Query  1007  IGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGM  1186
             +G +GEKL ++TEEG++K KW   T   + +  TWYK +FD+P GNDP+A++M  M KG+
Sbjct  625   VGMKGEKLGIYTEEGSKKVKW---TEAKSGQPVTWYKRYFDMPRGNDPVALDMTGMGKGL  681

Query  1187  VWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
              WVNG  IGRYWVS+L+PLG+P+Q+ YH+PR WLKPK+NLLV+FEE GG+P+ + ++ V 
Sbjct  682   AWVNGNCIGRYWVSYLSPLGKPSQSVYHVPRGWLKPKDNLLVIFEEHGGNPEGLLIVTVK  741

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
             RD IC+ V E +PP ++ + R+ +E +    D KPR HL C + KV++ I FAS+GNP G
Sbjct  742   RDNICTVVTELHPPAIESFSREDNEIKTLVQDTKPRAHLKCDNRKVIRSIAFASFGNPTG  801

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKD-LCPKIVKTLAVQAKCV  1723
              CGNF  G+C       IVEKACLGK  C +PV    +  G D  CP    TLAVQAKC 
Sbjct  802   ACGNFTVGTCHSLQTASIVEKACLGKNSCVLPVSAQEY--GADPACPGTTNTLAVQAKCA  859

Query  1724  RQGKED  1741
             RQ K+D
Sbjct  860   RQKKDD  865



>ref|XP_009386767.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=769

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/576 (49%), Positives = 389/576 (68%), Gaps = 7/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+SK+GT  NYYMY GG NFG TG++F+ T 
Sbjct  196   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSKNGTLTNYYMYHGGTNFGRTGAAFMMTR  255

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PKW HLRD H ALKLC+K LLWGT ++   +   E   +E  +  
Sbjct  256   YYDEAPLDEYGMEKEPKWGHLRDLHHALKLCRKGLLWGTPSVQAFDKGFEARLYEIPESH  315

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+N N  +  T++FRG +YYLP +S+SILPDCK ++FN+Q + AQHN RTFD +K
Sbjct  316   VCVAFLTNTNRKEDGTVSFRGEEYYLPRRSISILPDCKTVVFNSQRVNAQHNARTFDVAK  375

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              +    +W+M  + IPT+      S  P E+  LTK TTDY+W++T   ++  DLP R D
Sbjct  376   ESSMKNQWQMTSDLIPTLRHASVISKGPLELMNLTKDTTDYLWYTTSFKLDADDLPRRQD  435

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V ++GHAM  F+NG++ G  HG  + K F+  +P++L  GTN I  L   +  P
Sbjct  436   IRPVLQVSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLNAGTNHIAILGLTVGLP  495

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R AG  +V++  L  G  D++ + W + +G  GE L +F+E+G    KW   
Sbjct  496   DSGAYLEHRLAGVHTVVIQGLNAGTLDLSHSVWGHQVGLTGETLGIFSEKGVNAVKWEEA  555

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               +       WYK +FD P G+DP+A+ M  M KG+VW+NG+SIGRYW+S+L PLG+ +Q
Sbjct  556   KSD---TPVMWYKRYFDAPSGHDPVALEMNSMGKGLVWINGESIGRYWISYLNPLGKASQ  612

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YH+PR +LKPK+NL+VVFEE GG P+ I++M V RD IC+ V++ +P  V+ W R+  
Sbjct  613   SVYHVPRSFLKPKDNLMVVFEEHGGKPEDIQIMTVKRDDICTVVSDLHPAHVRSWSRENS  672

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + R+  DD KP   L C   KV++ I+FAS+GNP G+CGNF TGSC  P A  + EKACL
Sbjct  673   KIRSVDDDAKPEARLKCTGKKVIQSIDFASFGNPGGMCGNFTTGSCHTPQAKAVAEKACL  732

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCV  1723
             GK  C +PV    +  G D+ CP+ + TLAVQAKCV
Sbjct  733   GKESCVLPVAPEAY--GADVGCPETMATLAVQAKCV  766



>ref|XP_009419064.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/582 (49%), Positives = 393/582 (68%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI++SV RF+SK+GT VNYYMY GG NFG TG++FV T 
Sbjct  196   TENWTAQYRVFGDPPSQRSAEDIAYSVARFFSKNGTLVNYYMYHGGTNFGRTGAAFVMTR  255

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  ++PKW HLRD H ALKLC K LL G+ ++       E   +E  +  
Sbjct  256   YYDEAPLDEYGLPKEPKWGHLRDLHYALKLCSKALLKGSPSVQSFGSGFEARLYEIPEDN  315

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFL+N N  +  T+ FRGT+Y+LP +S+SILPDCK +++N Q + +QHN RTF+P+K
Sbjct  316   VCVAFLTNTNARRDGTVKFRGTEYFLPRRSISILPDCKTVVYNNQMVNSQHNARTFNPAK  375

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
               + N KW+M+ E  P++     K+  P+E+  +TK TTDY+W++T   + K DL MR D
Sbjct  376   EDSKNNKWQMYVEQPPSVRDTSIKAKGPQELVNMTKDTTDYLWYATSFNLEKDDLSMRHD  435

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V  +GHAM  F+NG++ G  HG  + K F+  +P++L+ GTND+  L   +  P
Sbjct  436   IRPVLQVSHLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLQAGTNDVAILGMTVGLP  495

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R +G  +V++  L  G+ D+++N W + +  +GE+  ++ E+  +  KW   
Sbjct  496   DSGAYLEHRLSGVHTVVVQGLNAGSLDLSQNVWGHKVAMEGERKAIYDEKKVDSFKWEDP  555

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               +      TWYK +FD P G DP+AV+++ M KG VWVNG+SIGRYWVS+L+PLG+P+Q
Sbjct  556   KSDSPI---TWYKRYFDAPNGKDPVAVDLKSMGKGQVWVNGESIGRYWVSYLSPLGKPSQ  612

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YH+PR +LK K+NL+VVFEE GG P+ I +M V RD ICS V+E+ PP V+ W  K  
Sbjct  613   SIYHVPRSFLKSKDNLMVVFEERGGKPEDILIMTVKRDNICSFVSESNPPQVRSWAIKNS  672

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + ++  +DLKP   LTC   KV++ I FAS+GNP GVCGNF  GSC    A  +VE+ACL
Sbjct  673   QIQSVVNDLKPDATLTCTGDKVIRSIVFASFGNPSGVCGNFTVGSCHARQAKSVVEQACL  732

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGKED  1741
             GK  C +PV  + +  G D  C     TLAVQAKC R  ++D
Sbjct  733   GKASCVLPVSAATY--GADAGCEGTTATLAVQAKCARASQKD  772



>emb|CAC13966.1| putative beta-galactosidase [Nicotiana tabacum]
Length=715

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 356/461 (77%), Gaps = 8/461 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYR FGDPP QR+AEDI+FSV RF++K+GT  NYYMY+GG N+G TGSSFV+T 
Sbjct  254   TENWTAQYRTFGDPPSQRAAEDIAFSVARFFAKNGTLTNYYMYYGGTNYGRTGSSFVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFEN--TD  355
             YYDE P+D +G  R+PKWSHLRD HRAL+L ++ LLWGT ++ KIN   EIT +E   TD
Sbjct  314   YYDEAPLDEFGLYREPKWSHLRDLHRALRLSRRALLWGTPSVQKINQHLEITVYEKPGTD  373

Query  356   LKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP  535
                CAAFL+NN+T  P T+ FRG +YYLP KSVSILPDCK +  NTQ I++QHN R F P
Sbjct  374   ---CAAFLTNNHTTLPATIKFRGREYYLPEKSVSILPDCKLLSTNTQTIVSQHNSRNFLP  430

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             S+ A NLKWEM+QE +PTI  L  K+  P E+Y+LTK T+DY W+ST +  ++ DLPMRP
Sbjct  431   SEKAKNLKWEMYQEKVPTISDLSLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRP  490

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI PVL + SMGHA+  F+NGEF G+ HGNN+ K F+  +PV LKPGTN I+ L   + +
Sbjct  491   DILPVLQIASMGHALSAFVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGF  550

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             PNSGA+ME+R+AGP+ + +  LM G  DIT+N+W + +G  GEK +LFTEEGA+K KW P
Sbjct  551   PNSGAYMEKRFAGPRGITVQGLMAGTLDITQNNWGHEVGVFGEKEQLFTEEGAKKVKWTP  610

Query  1076  VTGNHNTRRA-TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
             V G   T+ A TWYKT+FD PEGN+P+A+ M+KM KGM+WVNG S+GRYW SFL+PLGQP
Sbjct  611   VNG--PTKGAVTWYKTYFDAPEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQP  668

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDT  1375
             TQ EYHIPR +LKP NNLLV+FEE GG P++I+V +VNRDT
Sbjct  669   TQFEYHIPRAFLKPTNNLLVIFEETGGHPETIEVQIVNRDT  709



>ref|XP_006826593.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
 gb|ERM93830.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
Length=850

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/576 (51%), Positives = 387/576 (67%), Gaps = 6/576 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRV GDPP QR AED++F+V R++SK GT VNYYMY GG NFG T SSFV+T 
Sbjct  270   TENWTAQYRVLGDPPSQRPAEDLAFAVARWFSKHGTLVNYYMYHGGTNFGRTTSSFVTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD HRALKL +K LLWGT +   +    E   ++N++  
Sbjct  330   YYDEAPLDEYGLVREPKWGHLRDLHRALKLSRKALLWGTHSNYSLGHQLEARVYQNSEKN  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C+AFL+NNNT +  T+ F+   YYLP +S+SILPDCK ++FNT+ + AQHN RTF   K
Sbjct  390   VCSAFLANNNTREAATIYFQNVPYYLPPRSISILPDCKTVVFNTKKVNAQHNARTFHHVK  449

Query  542   -VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
               +  ++W+MF++SIP  +  P ++    E Y  TK TTD++W++T + +   DLP+   
Sbjct  450   DFSKGMRWKMFKDSIPNTEDTPVQNSLLLEHYNATKDTTDFLWYTTNIDVGSNDLPLLNS  509

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I P+L V S GHA+  F+N  + G +HG++V   F L +P+ LKPG N I+ L     +P
Sbjct  510   IKPILQVASWGHAVHGFVNDLYVGSSHGDHVQSPFSLNKPITLKPGKNKISLLSMTTGFP  569

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             NSG +ME + AG   VL+  LMTG QD+  N W + +G  GEKL+++    ++K KW   
Sbjct  570   NSGGYMEHKIAGVSKVLIQGLMTGTQDLINNIWGHQVGLLGEKLEVYNPRSSKKVKWVDA  629

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G H+     WYK HFD P G+DP+A++M  M KG +WVNG+SIGRYWVS+LTPLG P+Q
Sbjct  630   KG-HDHEPLIWYKRHFDAPAGSDPVALDMSSMGKGEIWVNGQSIGRYWVSYLTPLGLPSQ  688

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK NLLV+ EE GG+P  I +  V RD IC  V+EN+PP VK +ER   
Sbjct  689   SVYHIPRSFLKPKRNLLVILEETGGNPRRITLENVRRDIICGFVSENHPPKVKDFERSDS  748

Query  1439  EFRATT--DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
             + +A     +L+P ++L CP   V++ I+FAS+GNP G+C  F TG+C    A  IVEKA
Sbjct  749   QIKALVHESELQPMLNLHCPSDNVIQTIDFASFGNPIGICSAFATGTCHSAVAKDIVEKA  808

Query  1613  CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             CLGK  C V    S F  G DLCP  +KTLAVQA+C
Sbjct  809   CLGKESCVVSALPSNF--GTDLCPGTIKTLAVQARC  842



>ref|XP_008811847.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like [Phoenix 
dactylifera]
Length=905

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/579 (49%), Positives = 385/579 (66%), Gaps = 9/579 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWTAQYRVFGDPP QR+AED++++V RF+S K+GT VNYYMY GG NFG  GS+FV T
Sbjct  322   TENWTAQYRVFGDPPSQRAAEDLAYAVTRFFSAKNGTLVNYYMYHGGTNFGREGSAFVMT  381

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYDE P+D YG  ++PK+ HLRD H AL+LC+K L +G  +   +   +E+  +E  + 
Sbjct  382   RYYDEAPLDEYGLYKEPKFGHLRDVHHALRLCRKALFYGNPSTQNLGKGYEVVIYEKPER  441

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K+CAAFL+N N     T+NFRG +Y LP +S+SILPDCK ++FN+Q  +AQHN RTF  +
Sbjct  442   KVCAAFLTNTNPRIDGTVNFRGVEYSLPRRSISILPDCKTVVFNSQRTMAQHNARTFHTA  501

Query  539   K-VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             K      KW M+QE IP        S  P E+  +TK TTDY+W++T   ++  DLPMR 
Sbjct  502   KETTEKNKWWMYQEYIPKFRDTKVTSRQPLELMNMTKDTTDYLWYTTSFKLDSEDLPMRH  561

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI PVL V S+GHA+  F+NG + G  HG++V K F+  +P++L  G N IT L   +  
Sbjct  562   DIRPVLQVSSLGHAIHAFVNGFYIGTGHGSHVEKSFVFTKPMDLNRGYNHITILGLTIGL  621

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             PNSGA++E R AG  +V +  L  G  D++ N W + +G  GE+L +FTEEG +  +W  
Sbjct  622   PNSGAYLEHRLAGVHTVGIQGLNAGTLDLSNNRWGHRVGLDGERLGIFTEEGLKNVQW--  679

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              T   +   ATWYK +FD P GNDP+++NM  M KG  WVNG+ IGRYWVS+L P G+P+
Sbjct  680   -TEAKSDTPATWYKRYFDAPRGNDPVSLNMTSMGKGRAWVNGECIGRYWVSYLDPYGKPS  738

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q+ YH+PR WLKPK+NLLV+FEE GG P+ I +M   RD IC+ V+E++PP  + ++ KG
Sbjct  739   QSTYHVPRSWLKPKDNLLVLFEEQGGKPEDIIIMTAKRDNICAFVSEDHPPSARSFQMKG  798

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
             +E + T +D KP+ HL C   KV++ I FAS+GNP G CGN+  GSC  P    I+EK C
Sbjct  799   NELQ-TIEDAKPKAHLKCDSKKVIQAIVFASFGNPTGPCGNYTIGSCHAPQTWSIIEKEC  857

Query  1616  LGKTECEVPVEKSLFVEGKD-LCPKIVKTLAVQAKCVRQ  1729
             LGK+ C +PV    +  G D  CP    TL VQ KC ++
Sbjct  858   LGKSSCVLPVSAQAY--GADPKCPGTTNTLTVQVKCAKK  894



>ref|XP_010548094.1| PREDICTED: beta-galactosidase 11 [Tarenaya hassleriana]
Length=838

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/583 (51%), Positives = 390/583 (67%), Gaps = 13/583 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  263   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKK LLWG     K + D EI  +E    K
Sbjct  323   YYDDAPLDEYGLEREPKYGHLKQLHNALNLCKKALLWGQPRSMKPDQDTEIRYYEQPGTK  382

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT     +NF+G +Y +P +S+SILPDCK +++NT  IL+QH  R F  SK
Sbjct  383   ACAAFLANNNTESAVAVNFKGRNYIVPPRSISILPDCKTVVYNTAQILSQHTSRNFIKSK  442

Query  542   VAGNLKWE--MFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              A N K+E  +F ES+P    L   S  P E+Y L K  TDY W++T   + K +L  + 
Sbjct  443   KA-NKKFEFNVFSESVP--KGLDGDSYIPVELYGLAKDKTDYAWYTTSFKVGKNELLNK-  498

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L + S+GHA+ V+ING++ G  HG++  K F+  + VNLK G N +  L  +  Y
Sbjct  499   --KPTLRIASLGHALHVWINGKYIGNAHGSHEEKSFVFQKAVNLKEGVNHLAMLGVLTGY  556

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITK-NSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG++ME RY GP+ V LL L +G  D+T+ N W   +G +GEKL + TEEG +K KW 
Sbjct  557   PDSGSYMEHRYTGPRGVSLLGLRSGTVDLTEHNKWGNKVGMEGEKLGIHTEEGLKKVKWQ  616

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
                G  N+   TWY+T+FD PE  + +A+ M+ M KG++WVNGK +GRYW+SFL+P G+P
Sbjct  617   KFDG--NSPGMTWYQTYFDAPESQNSVAIRMKGMGKGLIWVNGKGVGRYWMSFLSPQGEP  674

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQTEYHIPR +LKPK NLLV+FEE     P+SI  ++VNRD +CS V E+Y P V+ W R
Sbjct  675   TQTEYHIPRSFLKPKQNLLVIFEEEPDVKPESIDFVIVNRDKVCSYVGEDYSPSVRHWTR  734

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K DE +A  + +     L C   K +  +EFAS+GNP G CGNF  GSC+ P + +++EK
Sbjct  735   KKDELQAINNGVHLTASLKCSGTKKITAVEFASFGNPTGTCGNFTLGSCNAPISKQVIEK  794

Query  1610  ACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
              CLGK ECE+PV K  F +G KD CPK+VKTLAVQ KC R  K
Sbjct  795   YCLGKAECEIPVNKGEFQQGRKDSCPKVVKTLAVQVKCGRDKK  837



>gb|KFK30461.1| hypothetical protein AALP_AA7G264100 [Arabis alpina]
Length=892

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 404/578 (70%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  R+AEDI+FSV RF+SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  268   TENWTTQFRVFGDPPTHRTAEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  327

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  HRAL LCKK LLWG     K+  D E+  +E    K
Sbjct  328   YYDDAPLDEYGMEKEPKYGHLKHLHRALALCKKALLWGHPRAQKLGPDTEVRYYEQPGTK  387

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL+NNNT +  T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R ++ S 
Sbjct  388   VCAAFLANNNTRESNTVKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNYEKSE  447

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+E + E++P+   L   S  P+E+Y LTK  TDY W++T + +++ DLP +  
Sbjct  448   KTSKGLKFETYSENVPS--KLDGDSLIPQELYYLTKDKTDYAWYTTSIKIDEDDLPDQKK  505

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L + S+GHA+IV++NGE+ G  HG++  K F+  + +NLK G N I+ L  +   P
Sbjct  506   VKTMLKIASLGHAVIVYVNGEYQGNEHGSHEMKSFVFNKQLNLKIGENHISLLGVLTGLP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITK-NSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME+RYAGP+SV L+ L +G QD+T+ N W +  G +GEK +++TEEG++K KW  
Sbjct  566   DSGSYMEKRYAGPRSVSLIGLKSGLQDLTEHNEWGHLAGLEGEKKEIYTEEGSKKVKW--  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG+ +GRYW+SFL+PLG+PT
Sbjct  624   -EKDGERKPLTWYKTYFETPEGENTVAIRMKGMGKGLIWVNGQGVGRYWMSFLSPLGEPT  682

Query  1256  QTEYHIPRPWL--KPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             Q+EYHIPR ++  K K N+LV+ EE  G  P++I  +LVNRD ICS V E+YP  VK W+
Sbjct  683   QSEYHIPRSFMNEKKKKNMLVILEEEPGVKPEAIDFVLVNRDRICSYVGEDYPASVKSWK  742

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  +   D++ +  + CP  K +  +EFAS+G+P G CGNF  G CS P + ++VE
Sbjct  743   REGTKIVSRIKDMRLKATMRCPPEKQIVAVEFASFGDPTGTCGNFTMGKCSAPKSKEVVE  802

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLGK+ C + VE+  F  G   C +IVKTLAVQ KC
Sbjct  803   KTCLGKSHCSIIVERDTF--GDKGCSEIVKTLAVQVKC  838



>ref|XP_010431800.1| PREDICTED: beta-galactosidase 14 [Camelina sativa]
Length=913

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/579 (50%), Positives = 399/579 (69%), Gaps = 13/579 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  R+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  283   TENWTTQFRVFGDPPTHRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  342

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YGF ++PK+ HLR  HRAL+LCKK L WG   + K+  D E+   E    K
Sbjct  343   YYDDAPLDEYGFEKEPKYGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTK  402

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNNNT +  T+ F G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S+
Sbjct  403   VCAAFLSNNNTRETNTIKFNGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  462

Query  542   --VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                +  LK+EMF E+IP+   L   S  P E+Y LTK  TDY W++T + + + DLP + 
Sbjct  463   KTTSEGLKFEMFHENIPS--RLGGDSLIPGELYYLTKDKTDYAWYTTSIKIEEDDLPNKK  520

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 +L V S+GHA+IV++NGE+AG  HG++  K F+  +PVNLK G N I+ L  +   
Sbjct  521   GSKTILRVASLGHALIVYVNGEYAGNAHGSHEMKSFVFEKPVNLKTGDNHISILGVLTGL  580

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG++ME RYAGP++V ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K +W 
Sbjct  581   PDSGSYMEHRYAGPRAVSIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVQW-  639

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
                 +   +   WYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+P
Sbjct  640   --EKDGERKPLIWYKTYFETPEGENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEP  697

Query  1253  TQTEYHIPRPWLKP--KNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIW  1423
             TQTEYHIPR ++K   K N+LV+ EE  G   D+I  +LVNRDTICS V E+YP  VK W
Sbjct  698   TQTEYHIPRSFMKEKKKKNMLVILEEEPGVKLDAIDFVLVNRDTICSYVREDYPVSVKSW  757

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
             +R+G +  + + D+K +  + CP  K M  +EFAS+G+P G CGNF  G CS   + ++V
Sbjct  758   KREGPKIVSRSKDMKLKAVMKCPPEKQMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVV  817

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EK CLGK  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  818   EKTCLGKNRCSIVVARETF--GDKGCPEIVKTLAVQVKC  854



>ref|XP_010530895.1| PREDICTED: beta-galactosidase 11-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010530896.1| PREDICTED: beta-galactosidase 11-like isoform X2 [Tarenaya hassleriana]
Length=836

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/577 (50%), Positives = 386/577 (67%), Gaps = 11/577 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  261   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  321   YYDDAPLDEFGLEKEPKYGHLKHLHNALNLCKKPLLWGQPRSEKPGPDTEIRYYEQPGTK  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT     +NF+G +Y +P +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  381   SCAAFLANNNTEVSVAVNFKGRNYIIPPRSISILPDCKTIVYNTAQIVSQHTSRNFVRSK  440

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                   ++ +F ES+P    L   S  P E+Y L K  TDY W++T   + K+DL  +  
Sbjct  441   KTNKKFEFSVFSESVP--KGLDGDSYIPVELYGLNKDKTDYAWYTTSFKVEKKDLTEK--  496

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NG++ G  HG++  K F+  +PV+LK G N +  L  +  YP
Sbjct  497   -KPTLRIASLGHALHVWMNGKYIGKAHGSHEEKSFVFQKPVDLKQGVNHLAMLGVLTGYP  555

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITK-NSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ V LL L +G  D+T+ N W   +G +GEKL + TEEG +K KW  
Sbjct  556   DSGSYMEHRYTGPRGVSLLGLNSGTVDLTEHNKWGNKVGMEGEKLGIHTEEGLKKVKWQK  615

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G  N    TWYKT+FD PE  + +A+ M  M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  616   FYG--NAPGLTWYKTYFDAPESQNSVAIRMNGMGKGLIWVNGNGVGRYWMSFLSPLGEPT  673

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             QTEYHIPR +LKP  NLLV+FEE  G  P+SI  ++VNRDT+CS +AE+Y P V+ W RK
Sbjct  674   QTEYHIPRSFLKPTQNLLVIFEEEPGVKPESIDFVIVNRDTVCSYIAEDYAPSVRHWARK  733

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              DE +A T  +     L C  AK +  +EFAS+GNP G CGNF  G+C+ P + +++EKA
Sbjct  734   KDEIQAITKGVHLTASLKCSGAKKIVAVEFASFGNPTGTCGNFTLGTCNAPVSKQVIEKA  793

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             CLGK EC +PV K  F +  KD CPK VKTLAVQ KC
Sbjct  794   CLGKAECVIPVNKGTFQQDKKDPCPKTVKTLAVQVKC  830



>ref|XP_002886073.1| beta-galactosidase 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62332.1| beta-galactosidase 13 [Arabidopsis lyrata subsp. lyrata]
Length=848

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/582 (49%), Positives = 389/582 (67%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RV+GDPP QRS EDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  270   TENWTTQFRVYGDPPAQRSVEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKK LLWG   + K + + EI  +E    K
Sbjct  330   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTK  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  390   VCAAFLANNNTESAEKIKFKGKEYIIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSK  449

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F E++P+   +   S  P E+Y LTK  TDY W++T   ++  DL  +  
Sbjct  450   KANKNFDFKVFTETVPS--KIKGDSYIPVELYGLTKDETDYGWYTTSFKIDDNDLSKKKG  507

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +P++LK G N +T L  +  +P
Sbjct  508   SKPTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPISLKEGENHLTMLGVLTGFP  567

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T +N W   +G +GEKL +  EEG +K KW  
Sbjct  568   DSGSYMEHRYTGPRSVSILGLGSGTLDLTEENKWGNKVGMEGEKLGIHAEEGLKKVKWQK  627

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  628   FSGKEPG--LTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  685

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+ W RK
Sbjct  686   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSHIGENYTPSVRHWTRK  745

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD+     L C   K + ++EFAS+GNP G CGNF  G+C+ P + K+VEK 
Sbjct  746   NDQVQAITDDVHLTASLKCSGTKKISEVEFASFGNPNGTCGNFTLGTCNAPVSKKVVEKY  805

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD CPK+ K LAVQ KC R  K
Sbjct  806   CLGKAECVIPVNKSTFQQDKKDSCPKVEKKLAVQVKCGRDKK  847



>ref|XP_010690373.1| PREDICTED: beta-galactosidase 13-like [Beta vulgaris subsp. vulgaris]
Length=829

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/575 (50%), Positives = 389/575 (68%), Gaps = 8/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGD P QR+AED +F V R++SK+G++ NYYMY+GG N+  T ++F +T 
Sbjct  257   TENWTAQFRVFGDVPSQRAAEDTAFGVARWFSKNGSHTNYYMYYGGTNYERTAAAFSTTR  316

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HLRD HR+L L KK +L G   + K   D E   +  T  K
Sbjct  317   YYDEAPLDEYGLKREPKWGHLRDLHRSLALSKKAILAGRYGVEKFGPDLEARYY--TKGK  374

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LCAAFL NN T    T+ FRG ++ LP KS+SILPDC+ ++FNT +I++QH+ R F  S 
Sbjct  375   LCAAFLWNNKTHSSGTVKFRGIEHTLPPKSISILPDCRTVVFNTDYIVSQHSAREFVRSE  434

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K    LKWE   E IPT     A+ P  +E +   +  +DY+W++TR+ ++  DLP+R  
Sbjct  435   KAHKGLKWEKTHEHIPTKFDRYARDP--QEQFHFGEDKSDYLWYTTRIELDNVDLPLRKS  492

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               PVL+ + +GHA+  F+NGEF G  HG +    F    PV LK G N+IT L +++  P
Sbjct  493   FQPVLWEKHLGHAVHAFVNGEFVGTKHGIHRDPGFTFQAPVRLKEGVNNITILSTVVGMP  552

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG+ ME+R+ G K++ LL+L TGN D++ N W + IG +GEKL+ FTEEGA+KAKW P 
Sbjct  553   DSGSNMEKRWTGLKNLGLLSLGTGNLDLSFNGWHHKIGMEGEKLQYFTEEGAKKAKWTPA  612

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYK +FD PEG++P+A+ ME M+KGMVWVNGKSIGRYW SFL+   +P+Q
Sbjct  613   EGAGEL--LTWYKAYFDAPEGDEPLAIRMENMTKGMVWVNGKSIGRYWSSFLSVKKEPSQ  670

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LK K+NLLV+F+E GG+ D++++  VNRD ICS V E+ PP V  W+R   
Sbjct  671   KEYHIPRAFLKAKDNLLVIFDESGGNIDTVQIETVNRDIICSYVGEDMPPSVMSWKRDEG  730

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             EF A  DDL+P+  L CP  KV+ ++EFAS+GNP GVCG F+ G+CS P    IVE+ CL
Sbjct  731   EFLAAIDDLRPKASLECPKNKVISRVEFASFGNPNGVCGYFLLGNCSSPLTQNIVEQHCL  790

Query  1619  GKTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKC  1720
             GK  C +PV++ L  +    C  +  KTLAVQ +C
Sbjct  791   GKERCTIPVDRKLLDKDNKKCAGVSSKTLAVQVRC  825



>gb|AAD24606.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=832

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 388/582 (67%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  254   TENWTTQFRVFGDPPAQRSVEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  313

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  R+PK+ HL+  H AL LCKK LLWG   + K + + EI  +E    K
Sbjct  314   YYDDAPLDEFGLEREPKYGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTK  373

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + FRG +Y +P +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  374   VCAAFLANNNTEAAEKIKFRGKEYLIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSK  433

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F ES+P+   +   S  P E+Y LTK  +DY W++T   ++  DL  +  
Sbjct  434   KANKNFDFKVFTESVPS--KIKGDSFIPVELYGLTKDESDYGWYTTSFKIDDNDLSKKKG  491

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +T L  +  +P
Sbjct  492   GKPNLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVTLKEGENHLTMLGVLTGFP  551

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T +N W   +G +GE+L +  EEG +K KW  
Sbjct  552   DSGSYMEHRYTGPRSVSILGLGSGTLDLTEENKWGNKVGMEGERLGIHAEEGLKKVKWEK  611

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  612   ASGKEPG--MTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  669

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  670   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRK  729

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + K+VEK 
Sbjct  730   NDQVQAITDDVHLTANLKCSGTKKISAVEFASFGNPNGTCGNFTLGSCNAPVSKKVVEKY  789

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD CPK+ K LAVQ KC R  K
Sbjct  790   CLGKAECVIPVNKSTFEQDKKDSCPKVEKKLAVQVKCGRDKK  831



>ref|NP_179264.2| beta-galactosidase 13 [Arabidopsis thaliana]
 sp|Q9SCU9.1|BGA13_ARATH RecName: Full=Beta-galactosidase 13; Short=Lactase 13; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64749.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEC06532.1| beta-galactosidase 13 [Arabidopsis thaliana]
Length=848

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 388/582 (67%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  270   TENWTTQFRVFGDPPAQRSVEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  329

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  R+PK+ HL+  H AL LCKK LLWG   + K + + EI  +E    K
Sbjct  330   YYDDAPLDEFGLEREPKYGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTK  389

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + FRG +Y +P +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  390   VCAAFLANNNTEAAEKIKFRGKEYLIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSK  449

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F ES+P+   +   S  P E+Y LTK  +DY W++T   ++  DL  +  
Sbjct  450   KANKNFDFKVFTESVPS--KIKGDSFIPVELYGLTKDESDYGWYTTSFKIDDNDLSKKKG  507

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +T L  +  +P
Sbjct  508   GKPNLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVTLKEGENHLTMLGVLTGFP  567

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T +N W   +G +GE+L +  EEG +K KW  
Sbjct  568   DSGSYMEHRYTGPRSVSILGLGSGTLDLTEENKWGNKVGMEGERLGIHAEEGLKKVKWEK  627

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  628   ASGKEPG--MTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  685

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  686   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRK  745

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + K+VEK 
Sbjct  746   NDQVQAITDDVHLTANLKCSGTKKISAVEFASFGNPNGTCGNFTLGSCNAPVSKKVVEKY  805

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD CPK+ K LAVQ KC R  K
Sbjct  806   CLGKAECVIPVNKSTFEQDKKDSCPKVEKKLAVQVKCGRDKK  847



>ref|XP_006299920.1| hypothetical protein CARUB_v10016129mg [Capsella rubella]
 gb|EOA32818.1| hypothetical protein CARUB_v10016129mg [Capsella rubella]
Length=849

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/582 (49%), Positives = 393/582 (68%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRSAEDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  272   TENWTTQFRVFGDPPTQRSAEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  331

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG + + K N + EI  +E    K
Sbjct  332   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRVEKPNNETEIRYYEQPGTK  391

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT    T+ F+G +Y +P +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  392   VCAAFLANNNTEAAETIKFKGKEYVIPPRSISILPDCKTVVYNTAEIVSQHTSRNFMKSK  451

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   +   S  P E+Y LTK  TDY W++T   ++  DL  +  
Sbjct  452   KANKKFDFKVFTETVPS--KIKGDSYVPAELYGLTKDETDYAWYTTSFKVDDSDLS-KTK  508

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P + + S+GHA+ V++NGE+ G  HG++  K F+  +PV+LK G N +T L  +  +P
Sbjct  509   GKPTVRIASLGHALHVWLNGEYLGSGHGSHEEKSFVFQKPVSLKEGENHLTMLGVLTGFP  568

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV ++ L +G  D+T +N+W   +G +GEKL +  +EG EK KW  
Sbjct  569   DSGSYMEHRYTGPRSVSIVGLSSGPLDLTEENTWGNKVGMEGEKLGIHAKEGLEKVKWEK  628

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             ++G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  629   LSG--KAPGLTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGQGVGRYWMSFLSPLGQPT  686

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+ W +K
Sbjct  687   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVRHWTKK  746

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD+     L C   K +  +EFAS+GNP G CGNF  GSC+ P + ++VEK 
Sbjct  747   KDQLQAITDDVHLTASLKCSGTKKITTVEFASFGNPNGTCGNFTLGSCNAPVSKQVVEKY  806

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV K+ F +  KD CPK+ K LAVQ KC R  K
Sbjct  807   CLGKAECLIPVNKNTFQQDKKDSCPKVAKKLAVQVKCGRDKK  848



>ref|XP_010446366.1| PREDICTED: beta-galactosidase 14-like [Camelina sativa]
Length=889

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/579 (49%), Positives = 398/579 (69%), Gaps = 13/579 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  R+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  265   TENWTTQFRVFGDPPTHRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  324

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YGF ++PK+ HLR  HRAL+LCKK L WG   + K+  D E+   E    K
Sbjct  325   YYDDAPLDEYGFEKEPKYGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTK  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNNNT +  T+ F G +Y LP++S+SILPDCK +++NT  I+AQH+ R F  S+
Sbjct  385   VCAAFLSNNNTRETNTIKFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  444

Query  542   --VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                +  LK+EMF E+I +   L   S  P E+Y LTK  TDY W++T + +   DLP + 
Sbjct  445   KTTSEGLKFEMFHENIAS--KLGGDSLIPGELYYLTKDKTDYAWYTTSIKIEADDLPDKK  502

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
              +  +L V S+GHA+IV++NGE+AG  HG++  K F+  +P+NLK G N I+ L  +   
Sbjct  503   GLKTILRVASLGHALIVYVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISILGVLTGL  562

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG++ME RYAGP++V ++ L +G +D+T+N+ W +  G +GEK +++TE+G++K +W 
Sbjct  563   PDSGSYMEHRYAGPRAVSIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQW-  621

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
                 +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+P
Sbjct  622   --EKDGERKPLTWYKTYFETPEGENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEP  679

Query  1253  TQTEYHIPRPWLKP--KNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIW  1423
             TQTEYHIPR ++K   K N+LV+ EE  G   ++I  +LVNRDTICS V ENYP  VK W
Sbjct  680   TQTEYHIPRSFMKEKKKKNMLVILEEEPGVKLEAIDFVLVNRDTICSFVGENYPVSVKSW  739

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
             +R+G +  + + D+K +  + CP  K M  +EFAS+G+P G CGNF  G CS   + ++V
Sbjct  740   KREGPKIVSRSKDMKLKAVMKCPPEKQMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVV  799

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EK CLGK  C + V +  F  G   C +IVKTLAVQ KC
Sbjct  800   EKTCLGKNRCSIVVARETF--GGKECSEIVKTLAVQVKC  836



>emb|CAB64750.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=887

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 400/578 (69%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QR+AEDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  267   TENWTTQFRVFGDPPTQRTAEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  + PK+ HL+  HRAL+LCKK L WG      +  D E+  +E    K
Sbjct  327   YYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFLSNNNT    T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  387   VCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSE  446

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+EMF E+IP++  L   S  P E+Y LTK  TDY W++T V +++ D P +  
Sbjct  447   KTSKGLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKG  504

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA+IV++NGE+AG  HG +  K F   +PVN K G N I+ L  +   P
Sbjct  505   LKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLP  564

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME R+AGP+++ ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K KW  
Sbjct  565   DSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKW--  622

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  623   -EKDGERKPLTWYKTYFETPEGVNAVAIRMKGMGKGLIWVNGIGVGRYWMSFLSPLGEPT  681

Query  1256  QTEYHIPRPWLK--PKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QTEYHIPR ++K   K N+LV+ EE  G   +SI  +LVNRDTICS+V E+YP  VK W+
Sbjct  682   QTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWK  741

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  + + D++ +  + CP  K M +++FAS+G+P G CGNF  G CS   + ++VE
Sbjct  742   REGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVE  801

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLG+  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  802   KECLGRNYCSIVVARETF--GDKGCPEIVKTLAVQVKC  837



>gb|KFK30139.1| hypothetical protein AALP_AA7G221900 [Arabis alpina]
Length=843

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/582 (50%), Positives = 389/582 (67%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  266   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K + D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHSALNLCKKPLLWGQPRTEKPSKDTEIRYYEQPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGKDYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  +DY W++T   + K  LP +  
Sbjct  446   KANKKFDFKVFTETLPS--KLEGDSYIPVELYGLTKDKSDYGWYTTSFKVQKNHLP-KKG  502

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 + + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  503   AKTTVRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVTLKAGENHLVMLGVLTGFP  562

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T+NS W   +G +GE+L + TE+G++K KW  
Sbjct  563   DSGSYMEHRYTGPRSVSILGLSSGTLDLTENSKWGNKVGMEGERLGIHTEKGSKKVKWEK  622

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G  +    TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  623   FSGKQSG--LTWYQTYFDAPESVSAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  680

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V ENY P VK W RK
Sbjct  681   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSFVGENYTPSVKHWTRK  740

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + +++EKA
Sbjct  741   QDQVQAITDNVSLTATLKCSGTKKISAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKA  800

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  +VKTLAVQ KC +  K
Sbjct  801   CLGKAECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCGKGKK  842



>gb|KDP29649.1| hypothetical protein JCGZ_18811 [Jatropha curcas]
Length=844

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/572 (49%), Positives = 381/572 (67%), Gaps = 42/572 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGDPP QRSAED +FSV R++SK+G+ VNYYMY GG N   T +SFV+T 
Sbjct  262   TENWTAQFRVFGDPPAQRSAEDAAFSVARWFSKNGSLVNYYMYHGGTNLDRTAASFVTTR  321

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R PK+ HL+D HRAL LCKK L WG+  + K+  D E+  +E    K
Sbjct  322   YYDEAPLDEFGLQRQPKYGHLKDLHRALGLCKKALFWGSPGVEKLGKDQEVRFYEQPAEK  381

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+T + + + FRG ++YLP +S+S+LPDCK ++FN+  +++QHN R F  S 
Sbjct  382   LCAAFLTNNDTREGSFVKFRGKEFYLPPRSISVLPDCKTVVFNSMQVVSQHNSRNFLRSN  441

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  NLKWEM  E+I T   L   S  PKE+Y+LTK TTDY W++T +++N RDL MR D
Sbjct  442   EANKNLKWEMTSETILT--QLKMDSKVPKELYSLTKDTTDYAWYTTVMILNPRDLSMRKD  499

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GHAM+ F+NG+                                       
Sbjct  500   ILPVLRVASLGHAMLAFVNGQL--------------------------------------  521

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AGP+ V +L L TG  D++ N W + +G  G+  K +TEEG +K  W  V
Sbjct  522   DSGAYMEHRFAGPRGVEILGLNTGTLDVSSNGWGHQVGLTGQNEKWYTEEGLKKVTWKEV  581

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                      TWYK +FD PEG  P+A++M  M KGM+W+NG+ IGRYW+S+L+PLGQPTQ
Sbjct  582   PQGKGP-PLTWYKAYFDAPEGCKPVAISMIGMVKGMIWINGQCIGRYWMSYLSPLGQPTQ  640

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYHIPR +LKPKNNL+V+ EE   +P+ I+++LV+RDTICS + E++PP VK W R+ +
Sbjct  641   PEYHIPRSYLKPKNNLVVIMEEEPSNPERIEIVLVDRDTICSFIGESHPPHVKSWARQDN  700

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             +F    DD+KP  HL CP  + +  +EFAS+G+P G CG F+ G+C+  N+ ++VE+ C+
Sbjct  701   KFIPVLDDVKPAAHLKCPADRKIVAVEFASFGDPYGACGGFIAGNCTSANSKQVVEQHCM  760

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQA  1714
             GK  C+VP+E+ LF +  D CP I KTLAVQ 
Sbjct  761   GKASCDVPIERELFDKNNDPCPDIRKTLAVQV  792



>sp|Q9SCU8.2|BGA14_ARATH RecName: Full=Beta-galactosidase 14; Short=Lactase 14; Flags: 
Precursor [Arabidopsis thaliana]
Length=887

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 399/578 (69%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QR+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  267   TENWTTQFRVFGDPPTQRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  + PK+ HL+  HRAL+LCKK L WG      +  D E+  +E    K
Sbjct  327   YYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFLSNNNT    T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  387   VCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSE  446

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+EMF E+IP++  L   S  P E+Y LTK  TDY W++T V +++ D P +  
Sbjct  447   KTSKGLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKG  504

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA+IV++NGE+AG  HG +  K F   +PVN K G N I+ L  +   P
Sbjct  505   LKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLP  564

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME R+AGP+++ ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K KW  
Sbjct  565   DSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKW--  622

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  623   -EKDGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPT  681

Query  1256  QTEYHIPRPWLK--PKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QTEYHIPR ++K   K N+LV+ EE  G   +SI  +LVNRDTICS+V E+YP  VK W+
Sbjct  682   QTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWK  741

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  + + D++ +  + CP  K M +++FAS+G+P G CGNF  G CS   + ++VE
Sbjct  742   REGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVE  801

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLG+  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  802   KECLGRNYCSIVVARETF--GDKGCPEIVKTLAVQVKC  837



>ref|XP_002445734.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
 gb|EES15229.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
Length=844

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/580 (49%), Positives = 377/580 (65%), Gaps = 8/580 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  GT  NYYMY GG NFG T ++FV   
Sbjct  264   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGTMTNYYMYHGGTNFGRTAAAFVMPK  323

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H ALKLCKK LLWG  +  K+    E   FE  + K
Sbjct  324   YYDEAPLDEFGLYKEPKWGHLRDLHLALKLCKKALLWGKPSTEKLGKQLEARVFEIPEQK  383

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT    TL FRG  Y++P  S+SIL DCK ++F TQH+ AQHN RTF    
Sbjct  384   VCVAFLSNHNTKDDVTLTFRGQPYFVPRHSISILADCKTVVFGTQHVNAQHNQRTFHFAD  443

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   N  W+MF +E +P       ++    ++Y LTK  TDYVW+++   +   D+P+R 
Sbjct  444   QTNQNNVWQMFDEEKVPKYKQAKIRTRKAADLYNLTKDKTDYVWYTSSFKLEPDDMPIRR  503

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI  V+ V S GHA + F+N +FAG  HG  + K F L +P+ LK G N +  L S +  
Sbjct  504   DIKTVVEVNSHGHASVAFVNNKFAGCGHGTKMNKAFTLEKPMELKKGVNHVAVLASSMGM  563

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA++E R AG   V +  L  G  D+T N W + +G  GE+ +++TE+G     W P
Sbjct  564   MDSGAYLEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGEQKEIYTEKGMASVTWKP  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                  N +  TWYK HFD+P G DPI ++M  M KGM++VNG+ IGRYW+S+   LG+P+
Sbjct  624   AV---NDKPLTWYKRHFDMPSGEDPIVLDMSTMGKGMMYVNGQGIGRYWMSYKHALGRPS  680

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YHIPR +L+PK+N+LV+FEE  G PD+I ++ V RD IC+ ++E  P  +K WERK 
Sbjct  681   QQLYHIPRSFLRPKDNVLVLFEEEFGRPDAIMILTVKRDNICTYISERNPAHIKSWERKD  740

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
              +  AT DDLK R  LTCP  K+++++ FASYGNP G+CGN+  GSC  P A ++VEK+C
Sbjct  741   SQITATADDLKARATLTCPPKKLIQQVVFASYGNPVGICGNYTIGSCHTPRAKEVVEKSC  800

Query  1616  LGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQG  1732
             LGK  C +PV   ++  G D+ CP    TLAVQAKC ++ 
Sbjct  801   LGKRTCTLPVSADVY--GGDVNCPGTTATLAVQAKCSKRA  838



>ref|XP_010436953.1| PREDICTED: beta-galactosidase 14-like isoform X1 [Camelina sativa]
Length=890

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/579 (49%), Positives = 397/579 (69%), Gaps = 13/579 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  R+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  265   TENWTTQFRVFGDPPTHRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  324

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YGF ++PK+ HLR  HRAL+LCKK L WG   + K+  D E+   E    K
Sbjct  325   YYDDAPLDEYGFEKEPKYGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTK  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFLSNNNT +  T+ F G +Y LP++S+SILPDCK +++NT  I+AQH+ R F  S+
Sbjct  385   VCAAFLSNNNTRETNTIKFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  444

Query  542   --VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                +  LK+EMF E+I +   L   S  P E+Y LTK  TDY W+++ + + + DLP + 
Sbjct  445   KTTSKGLKFEMFHENIAS--KLGGDSLIPGELYFLTKDKTDYAWYTSSIKIEEDDLPDKK  502

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 +L V S+GHA+IV++NGE+AG  HG++  K F+  +P+NLK G N I+ +  +   
Sbjct  503   GSKTILRVASLGHALIVYVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISIMGVLTGL  562

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG++ME RYAGP++V ++ L +G +D+T+N+ W +  G +GEK +++TE+G++K +W 
Sbjct  563   PDSGSYMEHRYAGPRAVSIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQW-  621

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
                 +   +  TWYKT+F+ PE  + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+P
Sbjct  622   --EKDGERKPLTWYKTYFETPEEENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEP  679

Query  1253  TQTEYHIPRPWLKP--KNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIW  1423
             TQTEYHIPR ++K   K N+LV+ EE  G   ++I  +LVNRDTICS V ENYP  VK W
Sbjct  680   TQTEYHIPRSFMKEKKKKNMLVILEEEPGVKLEAIDFVLVNRDTICSYVGENYPVSVKSW  739

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
             +R+G +  + + D+K R  + CP  K M  +EFAS+G+P G CGNF  G CS   + ++V
Sbjct  740   KREGQKIVSRSKDMKLRAVMKCPPEKHMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVV  799

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EK CLGK  C + V +  F  G   C +IVKTLAVQ KC
Sbjct  800   EKTCLGKNRCSIVVARETF--GGKECSEIVKTLAVQVKC  836



>ref|XP_010516330.1| PREDICTED: beta-galactosidase 13 isoform X1 [Camelina sativa]
Length=851

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/577 (48%), Positives = 387/577 (67%), Gaps = 8/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY+GG NFG T + +V+T 
Sbjct  273   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYYGGTNFGRTSAHYVTTR  332

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG   + + + + EI  +E    K
Sbjct  333   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTK  392

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  I++ H  R +  SK
Sbjct  393   VCAAFLANNNTESAENIKFKGKEYVIPPRSISILPDCKIIVYNTAEIVSHHTSRNYMKSK  452

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F E++P+   +   S  P E+Y LTK  TDY W++T   ++  DL  R  
Sbjct  453   KANKNFDFKVFAETVPS--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKRKG  510

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV+LK G N +  L  +  +P
Sbjct  511   GKPTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFP  570

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKN-SWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T+   W   +G +GE+L +  EEG +K KW  
Sbjct  571   DSGSYMEHRYTGPRSVSILGLSSGPFDLTQQFKWGNKVGMEGERLGIHAEEGLKKVKWQK  630

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             ++G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  631   LSGKEPG--LTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  688

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  689   QVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRK  748

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD++    L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK 
Sbjct  749   NDQVQAITDDVQLTAKLKCSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKY  808

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             CLGK +C +PV KS F +  KD CPK+ + LAVQ KC
Sbjct  809   CLGKAQCAIPVNKSTFQQDKKDSCPKVARKLAVQVKC  845



>ref|XP_010235388.1| PREDICTED: beta-galactosidase 11-like [Brachypodium distachyon]
Length=821

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/585 (48%), Positives = 385/585 (66%), Gaps = 13/585 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RFYS  GT VNYYMY GG NFG TG+SFV   
Sbjct  239   TENWTAQYRVFGDPPSQRSAEDIAFAVARFYSVGGTMVNYYMYHGGTNFGRTGASFVMPR  298

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H AL+LCKK +LWG  +   +   +E   FE  + K
Sbjct  299   YYDEAPLDEFGLYKEPKWGHLRDLHHALRLCKKAILWGNPSNQPLGKLYEARLFEIPEQK  358

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +C AFLSN+NT +  T+ FRG  Y++P +SVSIL DCK ++F+TQH+ +QHN RTF  S 
Sbjct  359   ICVAFLSNHNTKEDGTVTFRGQQYFVPRRSVSILADCKTVVFSTQHVNSQHNQRTFHFSD  418

Query  542   --VAGNLKWEMFQES--IPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
               V GN+ WEM+ ES  +PT      ++  P E Y LTK  TDYVW++T   +   DLP 
Sbjct  419   QTVQGNV-WEMYTESDKVPTYKFTNIRTQKPLEAYNLTKDKTDYVWYTTSFKLEAEDLPF  477

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             R DI PVL V S GHAM+ F+NG++ G  HG  + K F + +P+ ++ G N ++ L + L
Sbjct  478   RKDIWPVLEVSSHGHAMVAFVNGKYVGAGHGTKINKAFTMEKPIEVRTGINHVSILSTTL  537

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
                +SG ++E R AG   V +  L TG  D+T N W + +G +GE+    TE+G +  +W
Sbjct  538   GMQDSGVYLEHRQAGIDGVTIQGLNTGTLDLTSNGWGHLVGLEGERRNAHTEKGGDGVQW  597

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
              P   +   R  TWY+  FD+P G+DP+ ++M  M KG+++VNG+ +GRYW S+   LG+
Sbjct  598   VPAVFD---RPLTWYRRRFDIPTGDDPVVIDMSPMGKGVLYVNGEGLGRYWSSYKHALGR  654

Query  1250  PTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             P+Q  YH+PR +LKP  N++ +F EE GG PD I ++ V RD ICS ++E  P  VK WE
Sbjct  655   PSQYLYHVPRCFLKPTGNVMTIFEEEGGGQPDGIMILTVKRDNICSFISEKNPAHVKSWE  714

Query  1427  RKGDEFRATTD-DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
             RK    ++  D DLKP+  L+CP+ K+++++ FASYGNP G+CGN+  G+C  P A +IV
Sbjct  715   RKDSHLKSVADADLKPQAVLSCPEKKLIQQVVFASYGNPLGICGNYTVGNCHAPKAKEIV  774

Query  1604  EKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGK  1735
             EKAC+GK  C + V   ++  G DL CP    TLAVQAKC ++ K
Sbjct  775   EKACVGKKSCVLQVSHEVY--GADLNCPGSTGTLAVQAKCSKRQK  817



>ref|NP_195571.2| beta-galactosidase 14 [Arabidopsis thaliana]
 gb|AEE86951.1| beta-galactosidase 14 [Arabidopsis thaliana]
Length=988

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 399/578 (69%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QR+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  197   TENWTTQFRVFGDPPTQRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  + PK+ HL+  HRAL+LCKK L WG      +  D E+  +E    K
Sbjct  257   YYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTK  316

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFLSNNNT    T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  317   VCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSE  376

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+EMF E+IP++  L   S  P E+Y LTK  TDY W++T V +++ D P +  
Sbjct  377   KTSKGLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKG  434

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA+IV++NGE+AG  HG +  K F   +PVN K G N I+ L  +   P
Sbjct  435   LKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLP  494

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME R+AGP+++ ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K KW  
Sbjct  495   DSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKW--  552

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  553   -EKDGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPT  611

Query  1256  QTEYHIPRPWLK--PKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QTEYHIPR ++K   K N+LV+ EE  G   +SI  +LVNRDTICS+V E+YP  VK W+
Sbjct  612   QTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWK  671

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  + + D++ +  + CP  K M +++FAS+G+P G CGNF  G CS   + ++VE
Sbjct  672   REGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVE  731

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLG+  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  732   KECLGRNYCSIVVARETF--GDKGCPEIVKTLAVQVKC  767



>ref|XP_009101935.1| PREDICTED: beta-galactosidase 14 [Brassica rapa]
Length=886

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/585 (48%), Positives = 398/585 (68%), Gaps = 12/585 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDP   R +EDI+F+V RF+SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  268   TENWTTQFRVFGDPTTNRRSEDIAFAVSRFFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  327

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD  P+D YG  +DPK+ HL+  HRAL+LCKK LLWG     K+  D E+  +E     
Sbjct  328   YYDHAPLDEYGMEKDPKYGHLKHVHRALELCKKALLWGHPRFQKLGPDTEVRYYEQPGTN  387

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL+NNNT +P T+ F+G  + LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  388   VCAAFLANNNTREPNTVKFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  447

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK++M+ E++P+   L   +  P E+Y LTK  TDY W++T + + + DLP +  
Sbjct  448   KSSKGLKFDMYSENVPS--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKG  505

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA IV++NGE+ G  HG++  K F+  +PV LKPG N I+ L  +  +P
Sbjct  506   VKTILRVASLGHAAIVYVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME+R+AGP+   ++ L +G +D+T+N+ W +  G +GEK +++TE+G++K KW  
Sbjct  566   DSGSYMEKRFAGPRGASIIGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                N   +  TWYKT+F+ PEG + +A+ M  M KG++WVNG  IGRYW+SFL+P GQPT
Sbjct  624   -VKNGERKPLTWYKTYFETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPT  682

Query  1256  QTEYHIPRPWLKPKN-NLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             Q+EYHIPR ++K K  N+LV+FEE  G   ++I  +LVNRDTICS V ENYP  VK W+R
Sbjct  683   QSEYHIPRTFMKKKEKNMLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKR  742

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             +G        D++ +  + CP  K +  +EFAS+G+P G CGNF  G CS   + ++VEK
Sbjct  743   QGPNIVPRNKDMRLKSLIKCPPGKQIVSVEFASFGDPTGTCGNFTMGKCSASKSKEVVEK  802

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC-VRQGKED  1741
              CLGK+ C + VE+  F + K  C  IVKTLAVQ KC  +QG E 
Sbjct  803   KCLGKSRCSIVVERETFEDKK--CQDIVKTLAVQVKCEKKQGNEQ  845



>emb|CAB37515.1| galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80523.1| galactosidase like protein [Arabidopsis thaliana]
Length=1036

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/578 (49%), Positives = 399/578 (69%), Gaps = 12/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QR+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  245   TENWTTQFRVFGDPPTQRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  304

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  + PK+ HL+  HRAL+LCKK L WG      +  D E+  +E    K
Sbjct  305   YYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTK  364

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFLSNNNT    T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  365   VCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSE  424

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+EMF E+IP++  L   S  P E+Y LTK  TDY W++T V +++ D P +  
Sbjct  425   KTSKGLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKG  482

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA+IV++NGE+AG  HG +  K F   +PVN K G N I+ L  +   P
Sbjct  483   LKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLP  542

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME R+AGP+++ ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K KW  
Sbjct  543   DSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKW--  600

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  601   -EKDGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPT  659

Query  1256  QTEYHIPRPWLK--PKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QTEYHIPR ++K   K N+LV+ EE  G   +SI  +LVNRDTICS+V E+YP  VK W+
Sbjct  660   QTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWK  719

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  + + D++ +  + CP  K M +++FAS+G+P G CGNF  G CS   + ++VE
Sbjct  720   REGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVE  779

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLG+  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  780   KECLGRNYCSIVVARETF--GDKGCPEIVKTLAVQVKC  815



>ref|XP_006412163.1| hypothetical protein EUTSA_v10024392mg [Eutrema salsugineum]
 gb|ESQ53616.1| hypothetical protein EUTSA_v10024392mg [Eutrema salsugineum]
Length=844

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/582 (49%), Positives = 389/582 (67%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEFGLEKEPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG +Y +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  387   SCAAFLANNNTEAAETIKFRGKEYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSK  446

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   +++  LP +  
Sbjct  447   KANKKFDFQVFTEALPS--KLQGDSYIPVELYGLTKDKTDYGWYTTSFKVHENHLP-KKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  V+ + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   VKSVVRIASLGHALHVWLNGEYIGNGHGSHEEKSFVFQKPVTLKAGENHLIMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T++S W   +G +GE+L + TE+G +K KW  
Sbjct  564   DSGSYMEHRYTGPRSVSILGLTSGTLDLTESSKWGNKVGMEGERLGIHTEKGLKKVKWQK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE  +  A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  624   FSG--KAPGLTWYQTYFDAPESQNAAAIRMSGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V ENY P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + ++VEK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C   VKTLAVQ KC R  K
Sbjct  802   CLGKAECVIPVNKSTFQQDKKDSCKNFVKTLAVQVKCGRGKK  843



>ref|XP_010516339.1| PREDICTED: beta-galactosidase 13 isoform X2 [Camelina sativa]
Length=851

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/577 (48%), Positives = 387/577 (67%), Gaps = 8/577 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY+GG NFG T + +V+T 
Sbjct  273   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYYGGTNFGRTSAHYVTTR  332

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG   + + + + EI  +E    K
Sbjct  333   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTK  392

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  I++ H  R +  SK
Sbjct  393   VCAAFLANNNTESAENIKFKGKEYVIPPRSISILPDCKIIVYNTAEIVSHHTSRNYMKSK  452

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F E++P+   +   S  P E+Y LTK  TDY W++T   ++  DL  +  
Sbjct  453   KANKNFDFKVFAETVPS--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKKKG  510

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV+LK G N +  L  +  +P
Sbjct  511   GKPTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFP  570

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKN-SWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T+   W   +G +GE+L +  EEG +K KW  
Sbjct  571   DSGSYMEHRYTGPRSVSILGLSSGPFDLTQQFKWGNKVGMEGERLGIHAEEGLKKVKWQK  630

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             ++G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  631   LSGKEPG--LTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  688

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  689   QVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRK  748

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD++    L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK 
Sbjct  749   NDQVQAITDDVQLTAKLKCSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKY  808

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKC  1720
             CLGK +C +PV KS F +  KD CPK+ + LAVQ KC
Sbjct  809   CLGKAQCAIPVNKSTFQQDKKDSCPKVARKLAVQVKC  845



>ref|XP_010432357.1| PREDICTED: beta-galactosidase 11-like [Camelina sativa]
Length=844

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/582 (49%), Positives = 386/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEYGLEKEPKFGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  387   SCAAFLANNNTEAAETIKFRGRDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSK  446

Query  542   VAGNLK-WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   +NK DLP +  
Sbjct  447   KANKKSDFKVFTETLPS--KLDGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLP-KKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + V S+GHA+ V++NGE+ G  HG++  K F+  +PV +K G N +  L  +  +P
Sbjct  504   VKTSVRVASLGHALHVWLNGEYLGSGHGSHEEKSFVFQKPVTIKAGENHLIMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ V +L L +G  D+T+NS W   +G +GE+L + TEEG++K KW  
Sbjct  564   DSGSYMEHRYTGPRGVSILGLTSGTLDLTENSKWGNKVGMEGERLGVHTEEGSKKVKWQK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G       TWY+T+FD PE  +  A+ M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  624   FNG--KAPGLTWYQTYFDAPESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK N LV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNHLVIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + ++VEK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK  CE+PV KS F +  KD C  +VK LAVQ KC R  K
Sbjct  802   CLGKAHCEIPVNKSTFEQDKKDSCKNVVKMLAVQVKCGRGKK  843



>emb|CDX72747.1| BnaC07g47690D [Brassica napus]
Length=886

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/584 (48%), Positives = 397/584 (68%), Gaps = 12/584 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDP   R +EDI+F+V RF+SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  268   TENWTTQFRVFGDPTTNRRSEDIAFAVSRFFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  327

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD  P+D YG  +DPK+ HL+  HRAL+LCKK LLWG     K+  D E+  +E     
Sbjct  328   YYDHAPLDEYGMEKDPKYGHLKHVHRALELCKKALLWGHPRFKKLGPDTEVRYYEQPGTN  387

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL+NNNT +P T+ F+G  + LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  388   VCAAFLANNNTREPNTVKFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  447

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK++M+ E++P+   L   +  P E+Y LTK  TDY W++T + + + DLP +  
Sbjct  448   KNSKGLKFDMYSENVPS--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKG  505

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA IV++NGE+ G  HG++  K F+  +PV LKPG N I+ L  +  +P
Sbjct  506   VKTILRVASLGHAAIVYVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME+R+AGP+   +  L +G +D+T+N+ W +  G +GEK +++TE+G++K KW  
Sbjct  566   DSGSYMEKRFAGPRGASIKGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                N   +  TWYKT+F+ PEG + +A+ M  M KG++WVNG  IGRYW+SFL+P GQPT
Sbjct  624   -VKNGERKPLTWYKTYFETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPT  682

Query  1256  QTEYHIPRPWLKPKN-NLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             Q+EYHIPR ++K K  N+LV+FEE  G   ++I  +LVNRDTICS V ENYP  VK W+R
Sbjct  683   QSEYHIPRTFMKKKEKNMLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKR  742

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             +G        D++ +  + CP  K +  IEFAS+G+P G CGNF  G CS   + ++VEK
Sbjct  743   QGPNIVPRNKDMRLKSLIKCPPGKQIVSIEFASFGDPTGTCGNFTMGKCSASKSKEVVEK  802

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC-VRQGKE  1738
              CLGK+ C + VE+  F + K  C  IVKTLAVQ KC  +QG E
Sbjct  803   KCLGKSRCSIVVERETFEDKK--CQDIVKTLAVQVKCEKKQGNE  844



>ref|XP_010690372.1| PREDICTED: beta-galactosidase 14-like [Beta vulgaris subsp. vulgaris]
Length=835

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 393/578 (68%), Gaps = 8/578 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+RVFGD P QRSAED +F+V R++SK+G++ NYYMY GG N+  T ++F +T 
Sbjct  263   TENWTAQFRVFGDVPSQRSAEDTAFAVARWFSKNGSHTNYYMYHGGTNYARTAAAFTTTR  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  R PKW HLRD HRA+ L KK +  G   + K   D E   +E    K
Sbjct  323   YYDEAPLDEFGLIRGPKWGHLRDLHRAITLSKKAIFKGRYGVEKFGPDLEARYYERK--K  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL NNNT    T+ FRG  + LP KS+SILPDCK ++FN+  ++AQH+ R F  S+
Sbjct  381   LCAAFLWNNNTHAKETVKFRGKQFTLPPKSISILPDCKTVVFNSDCMVAQHSSREFVRSE  440

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  NL WE   E+ P+   + ++ P   E +   +  TDY+W+ T V ++  DLP R  
Sbjct  441   IANKNLNWEKTTETFPSKGDVYSRMPL--EQFHTAEDRTDYMWYKTSVELDSVDLPFRKS  498

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + PVL +  +GH++  F+NG + G +HG + A  F    PV LK G N+I+ L + +  P
Sbjct  499   LQPVLQLYHLGHSLQAFVNGHYIGSSHGFHRAPSFTFQSPVKLKEGVNNISILSNTMGMP  558

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG++MERR+ G K + +  L TG  D++ N W ++IG +GEKL+ FTEEGA+KAKW P 
Sbjct  559   DSGSYMERRWTGLKFLEIQGLGTGELDLSSNGWHHTIGLKGEKLQYFTEEGAQKAKWTPA  618

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G  +    TWYK HFD PEG+DPIA+ +E M+KG+VWVNG+SIGRYW SFLT    P+Q
Sbjct  619   KGAGDY--LTWYKAHFDAPEGDDPIAIRLENMTKGVVWVNGRSIGRYWSSFLTIRNAPSQ  676

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             +EYH+PR +LKPK+N LV+F+E GG+ D++++  VNRD ICS ++E+ PP V  W+R   
Sbjct  677   SEYHVPRSYLKPKDNFLVIFDEAGGNIDTVQIETVNRDVICSLISEDMPPSVMSWKRDAH  736

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + RA  ++ K    L CP  KV+ ++EFAS+GNP GVCG F+ G+C+ PN+ KIVE+ CL
Sbjct  737   DIRAVAEEPKTEATLRCPKNKVISRVEFASFGNPYGVCGFFLLGTCNSPNSQKIVEQLCL  796

Query  1619  GKTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKCVRQ  1729
             GK  C +PV++ LF +GK+ CP++ +K LAVQ +C R+
Sbjct  797   GKESCSIPVDRDLFDKGKNNCPELPIKGLAVQLRCSRK  834



>ref|XP_006409401.1| hypothetical protein EUTSA_v10022550mg [Eutrema salsugineum]
 gb|ESQ50854.1| hypothetical protein EUTSA_v10022550mg [Eutrema salsugineum]
Length=846

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/582 (48%), Positives = 391/582 (67%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRSAEDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  269   TENWTTQFRVFGDPPTQRSAEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  ++PK+ HL+  H AL LCKK LLWG +   K   + EI  +E    K
Sbjct  329   YYDDAPLDEFGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPGKETEIRYYEQPGTK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT+ I++ H  R F  SK
Sbjct  389   VCAAFLANNNTESAEKIKFKGKEYVIPPRSISILPDCKTVVYNTKEIVSHHTARNFVKSK  448

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   ++  +L  +  
Sbjct  449   KANKQFDFKVFTETVPS--KLKGDSYVPVELYGLTKDETDYGWYTTNFEIDDNELK-KKG  505

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + P L + S+GHA+ V++NGE+ G  HG++  K F+ L+PV+LK G N +T L  +  +P
Sbjct  506   VKPTLRIASLGHALHVWLNGEYIGNGHGSHEEKSFVFLKPVSLKEGENHLTLLGVLTGFP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T K+ W   +G +GE+L +  E+G +K KW  
Sbjct  566   DSGSYMEHRYTGPRSVSILGLSSGTLDLTEKSKWGNKVGMEGERLGIHAEKGLKKVKWEK  625

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +        TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLG+PT
Sbjct  626   FS--KKAPGLTWYQTYFDAPESQSATAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGKPT  683

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+C+ + E Y P V+ W +K
Sbjct  684   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCTYIGEEYTPSVRHWTKK  743

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A  DD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + +++EK 
Sbjct  744   NDQVQAIGDDVHLTANLKCSGTKKISAVEFASFGNPTGSCGNFTLGSCNAPVSKQVIEKY  803

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS+F +  KD CPK+VKTLAVQ KC R  K
Sbjct  804   CLGKAECVIPVNKSMFQQDKKDSCPKVVKTLAVQVKCGRDKK  845



>ref|XP_004974148.1| PREDICTED: beta-galactosidase 11-like [Setaria italica]
Length=852

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/580 (47%), Positives = 379/580 (65%), Gaps = 9/580 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED++F+V RF+S  GT  NYYMY GG NFG T ++FV   
Sbjct  268   TENWTAQYRVFGDPPSQRSAEDLAFAVARFFSVGGTMTNYYMYHGGTNFGRTAAAFVMPK  327

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H+AL+LCKK LLWGT ++ K+    E   FE  +  
Sbjct  328   YYDEAPLDEFGLYKEPKWGHLRDLHQALRLCKKALLWGTPSVQKLGKQFEARVFELKEQN  387

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT    T+ FRG  Y++P  S+SIL DCK ++F+TQH+ AQHN RTF    
Sbjct  388   VCVAFLSNHNTKDDVTMTFRGQPYFVPRHSISILADCKTVVFSTQHVNAQHNQRTFHFTE  447

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   N  W+MF +E +P       ++   +E+Y LTK  TDYVW+++   +   D+P R 
Sbjct  448   QTVQNNVWQMFDEEKVPKYKQAKIRTRKAQELYNLTKDKTDYVWYTSSFKLEADDMPFRR  507

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D+ PVL V S GHA + F+N  F G  HG  + K F+L +P+NLK G N +  L S L  
Sbjct  508   DVRPVLEVNSHGHASVAFVNNVFVGCGHGTKMNKAFLLQKPMNLKMGVNHVAVLSSTLGM  567

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA++E R AG   V +L L  G  D+T N W + IG  GE+ +++TE+G     W P
Sbjct  568   MDSGAYLEHREAGIDRVQILGLNAGTLDLTNNGWGHIIGLVGEQKEIYTEKGMGSVTWKP  627

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYK HFD+P G DP+ +++  M KGM++VNG+ IGRYW+S+   LG+P+
Sbjct  628   AVKD---KPLTWYKRHFDMPSGEDPVVLDLSPMGKGMMYVNGEGIGRYWISYKHALGRPS  684

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YH+PR +L+ KNN+LV+FEE GG PD+I ++ V RD IC+ ++E  P  +K W+R  
Sbjct  685   QQLYHVPRSFLREKNNVLVLFEEEGGHPDAIMILTVKRDNICTFISEKNPAHIKSWQRTD  744

Query  1436  DEFRAT-TDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              +  A    DLKP+  L+CP  KV++++ FAS+GNP+G+CGN+  GSC  P A ++ EKA
Sbjct  745   SQITAKGGGDLKPKATLSCPLKKVIQQVVFASFGNPQGICGNYTAGSCHTPRAKEVAEKA  804

Query  1613  CLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             CLG+  C +PV   ++  G DL CP    TLAVQ KC ++
Sbjct  805   CLGQRTCTLPVAADVY--GGDLNCPGTTATLAVQVKCSKR  842



>emb|CAN73625.1| hypothetical protein VITISV_026637 [Vitis vinifera]
Length=767

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/577 (49%), Positives = 372/577 (64%), Gaps = 37/577 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QR+AED++FSV RF SK+GT  NYYMY GG NFG TGSSFV+T 
Sbjct  226   TENWTAQYRVFGDPPSQRAAEDLAFSVARFISKNGTLANYYMYHGGTNFGRTGSSFVTTR  285

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  R+PKW HL+D H AL+LCKK L  G+  + K+  D E+  +E     
Sbjct  286   YYDEAPLDEYGLQREPKWGHLKDLHSALRLCKKALFTGSPGVEKLGKDKEVRFYEKPGTH  345

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NN++ +  TL FRG +Y+LP  S+SILPDCK +++NTQ ++AQHN R F  SK
Sbjct  346   ICAAFLTNNHSREAATLTFRGEEYFLPPHSISILPDCKTVVYNTQRVVAQHNARNFVKSK  405

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +A  NLKWEM QE IP +  +   + +P E+Y   K  +DY WF T + ++  DLPM+ D
Sbjct  406   IANKNLKWEMSQEPIPVMTDMKILTKSPMELYXFLKDRSDYAWFVTSIELSNYDLPMKKD  465

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL + ++GHAM+ F+NG F G  HG+NV K F+  +PV  + G N +          
Sbjct  466   IIPVLQISNLGHAMLAFVNGNFIGSAHGSNVEKNFVFRKPVKFQ-GRNKL----------  514

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +  A  +    G  SV +L L TG  DIT N W   +G  GE +K +T+ G+ + +W   
Sbjct  515   HCPAVYDSGTTGIHSVQILGLNTGTLDITNNGWGQQVGVNGEHVKAYTQGGSHRVQWTAA  574

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G       TWYKT+FD+PEGNDP+ + M  M+KG    NG                   
Sbjct  575   KGKGPA--MTWYKTYFDMPEGNDPVILRMTSMAKG----NG-------------------  609

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
              EYH+PR WLKP +NLLV+FEE GG+P+ I+  LVNRDTICS V E +PP VK W+R   
Sbjct  610   LEYHVPRAWLKPSDNLLVIFEETGGNPEEIEXELVNRDTICSIVTEYHPPHVKSWQRHDS  669

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + RA  D++KP+ HL CP+ KV+ K++FAS+GNP G CG+F  G+C+ PN+ K+VE+ C 
Sbjct  670   KIRAVVDEVKPKGHLKCPNYKVIVKVDFASFGNPLGACGDFEMGNCTAPNSKKVVEQHCX  729

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             GKT CE+P+E  +F      C  I KTLAVQ +C R+
Sbjct  730   GKTTCEIPMEAGIFXGNSGACSDITKTLAVQVRCXRK  766



>emb|CDY22419.1| BnaA06g37410D [Brassica napus]
Length=956

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/585 (48%), Positives = 398/585 (68%), Gaps = 12/585 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDP   R +EDI+F+V RF+SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  338   TENWTTQFRVFGDPTTNRRSEDIAFAVSRFFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  397

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD  P+D YG  +DPK+ HL+  HRAL+LCKK LLWG     K+  D E+  +E     
Sbjct  398   YYDHAPLDEYGMEKDPKYGHLKHVHRALELCKKALLWGHPRFQKLGPDTEVRYYEQPGTN  457

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL+NNNT +P T+ F+G  + LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  458   VCAAFLANNNTREPNTVKFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSE  517

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK++M+ E++P+   L   +  P E+Y LTK  TDY W++T + + + DLP +  
Sbjct  518   KSSKGLKFDMYSENVPS--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKG  575

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA IV++NGE+ G  HG++  K F+  +PV LKPG N I+ L  +  +P
Sbjct  576   VKTILRVASLGHAAIVYVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFP  635

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME+R+AGP+   ++ L +G +D+T+N+ W +  G +GEK +++TE+G++K KW  
Sbjct  636   DSGSYMEKRFAGPRGASIIGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--  693

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                N   +  TWYKT+F+ PEG + +A+ M  M KG++WVNG  IGRYW+SFL+P GQPT
Sbjct  694   -VKNGERKPLTWYKTYFETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPT  752

Query  1256  QTEYHIPRPWLKPKN-NLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             Q+EYHIPR ++K K  N+LV+FEE  G   ++I  +LVNRDTICS V ENYP  VK W+R
Sbjct  753   QSEYHIPRTFMKKKEKNMLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKR  812

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             +G        D++ +  + CP  K +  +EFAS+G+P G CGNF  G CS   + ++VEK
Sbjct  813   QGPNIVPRNKDMRLKSLIKCPPGKQIVSVEFASFGDPTGTCGNFTMGKCSASKSKEVVEK  872

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC-VRQGKED  1741
              CLGK+ C + VE+  F + K  C  IVKTLAVQ KC  +QG E 
Sbjct  873   KCLGKSRCSIVVERETFEDKK--CQDIVKTLAVQVKCEKKQGNEQ  915



>emb|CDY70118.1| BnaA07g36410D, partial [Brassica napus]
Length=594

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/582 (47%), Positives = 388/582 (67%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  RS EDI++SV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  17    TENWTTQFRVFGDPPAHRSVEDIAYSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  76

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  R+PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  77    YYDDAPLDEFGLEREPKYGHLKLLHNALNLCKKALLWGHSRTEKPGKDTEIRYYEQPGTK  136

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT    T+ F+G ++ +P +S+SILPDCK ++++T  +++QH  R +  SK
Sbjct  137   VCAAFLANNNTEAAETIKFKGKEHVIPPRSISILPDCKTVVYSTAEVISQHTSRNYVKSK  196

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L  +S  P E+Y LT+  TDY W++T   ++  DL  +  
Sbjct  197   KANKKFDFKVFTETVPS--ELKGESFIPVELYGLTEDVTDYGWYTTNFKIDDNDLKKKGG  254

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
              +  L + S+GHA+ V++NGE+ G  HG++  K F+  + V+LK G N +T L  +  +P
Sbjct  255   KY-TLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKQVSLKEGENHLTMLGVLTGFP  313

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG+++E RY GP+SV +L L +G  D+T KN W   +G +GEKL +  E+G +K KW  
Sbjct  314   DSGSYLEHRYTGPRSVSILGLSSGPLDLTEKNKWGNKVGMEGEKLGIHAEKGLKKVKWQK  373

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T FD PE    +AV M  M KG++WVNG+ +GRYW+SFL+PL  PT
Sbjct  374   FSG--KAPGLTWYQTRFDAPESKSSVAVRMNGMGKGLIWVNGEGVGRYWMSFLSPLKNPT  431

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+ W +K
Sbjct  432   QVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVRHWTKK  491

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A  DD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + +++EK 
Sbjct  492   NDKVQAIADDVFLTANLKCSGTKKIAAVEFASFGNPTGTCGNFTLGSCNAPASKQVIEKY  551

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK+EC++PV KS F +  KD CPK+VK LAVQ KC R  K
Sbjct  552   CLGKSECDIPVNKSTFQQDKKDSCPKVVKMLAVQVKCGRTNK  593



>ref|XP_010447011.1| PREDICTED: beta-galactosidase 11 [Camelina sativa]
Length=844

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 384/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEYGLEKEPKFGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  387   SCAAFLANNNTEAAETIKFRGKDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSK  446

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   +NK DLP +  
Sbjct  447   KANKKFDFKVFTETLPS--KLEGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLP-KKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + V S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   VKTSVRVASLGHALHVWLNGEYLGSGHGSHEEKSFVFQKPVTLKAGENHLIMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ V +L L +G  D+T+ S W   +G +GE+L + TEEG++K KW  
Sbjct  564   DSGSYMEHRYTGPRGVSILGLTSGTLDLTEASKWGNKVGMEGERLGVHTEEGSKKVKWEK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G       TWY+T+FD PE  +  A+ M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  624   FNG--KAPGLTWYQTYFDAPESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK N LV+FEE     P+ +  ++VNRDT+CS V ENY P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNHLVIFEEEPNVKPELMDFVIVNRDTVCSYVGENYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + ++VEK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK  C +PV KS F +  KD C  +VK LAVQ KC R  K
Sbjct  802   CLGKAHCAIPVNKSTFEQDKKDSCKNVVKMLAVQVKCGRGKK  843



>ref|XP_008677698.1| PREDICTED: uncharacterized protein LOC100384558 isoform X1 [Zea 
mays]
 gb|AFW65679.1| hypothetical protein ZEAMMB73_601729 [Zea mays]
Length=846

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/579 (48%), Positives = 373/579 (64%), Gaps = 8/579 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  GT  NYYMY GG NFG T ++FV   
Sbjct  267   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGTMTNYYMYHGGTNFGRTSAAFVMPK  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H ALKLCKK LLWG  +  K+    E   FE  + K
Sbjct  327   YYDEAPLDEFGLYKEPKWGHLRDLHLALKLCKKALLWGKTSTEKLGKQFEARVFEIPEQK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT    TL FRG  Y++P  S+SIL DCK ++F TQH+ AQHN RTF    
Sbjct  387   VCVAFLSNHNTKDDVTLTFRGQSYFVPRHSISILADCKTVVFGTQHVNAQHNQRTFHFAD  446

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   N  W+MF +E +P       +     ++Y LTK  TDYVW+++   +   D+P+R 
Sbjct  447   QTTQNNVWQMFDEEKVPKYKQSKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRR  506

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI  VL V S GHA + F+N +F G  HG  + K F L +P++LK G N +  L S +  
Sbjct  507   DIKTVLEVNSHGHASVAFVNTKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASTMGM  566

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA++E R AG   V +  L  G  D+T N W + +G  GE+ +++T++G     W P
Sbjct  567   MDSGAYLEHRLAGVDRVQIKGLNAGTLDLTNNGWGHIVGLVGEQKQIYTDKGMGSVTWKP  626

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                  N R  TWYK HFD+P G DPI ++M  M KG+++VNG+ IGRYW+S+   LG+P+
Sbjct  627   AV---NDRPLTWYKRHFDMPSGEDPIVLDMSTMGKGLMFVNGQGIGRYWISYKHALGRPS  683

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YHIPR +L+ K+N+LV+FEE  G PD+I ++ V RD IC+ ++E  P  +K WERK 
Sbjct  684   QQLYHIPRSFLRQKDNVLVLFEEEFGRPDAIMILTVKRDNICTFISERNPAHIKSWERKD  743

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
              +   T  DLKPR  LTC   K+++++ FASYGNP G+CGN+  GSC  P A ++VEKAC
Sbjct  744   SQITVTAADLKPRATLTCSPKKLIQQVVFASYGNPMGICGNYTIGSCHTPRAKELVEKAC  803

Query  1616  LGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             LGK  C +PV   ++  G D+ CP    TLAVQAKC ++
Sbjct  804   LGKRICTLPVSADVY--GGDVNCPGTTATLAVQAKCSKR  840



>ref|XP_002867095.1| beta-galactosidase 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43354.1| beta-galactosidase 11 [Arabidopsis lyrata subsp. lyrata]
Length=844

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/582 (48%), Positives = 384/582 (66%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI++SV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  266   TENWTTQFRVFGDPPTQRSVEDIAYSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHSALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ F+G +Y +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  386   TCAAFLANNNTEAAETIKFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   ++K  LP +  
Sbjct  446   KANKKFDFKVFTETLPS--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + + S+GHA+ +++NGE+ G  HG++  K F+  + V LK G N +  L  +  +P
Sbjct  504   VKTFVRIASLGHALHIWLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLIMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ V +L L +G  D+T++S W   IG +GEKL + TEEG +K +W  
Sbjct  564   DSGSYMEHRYTGPRGVSILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              TG       TWY+ +FD PE  +  A+ M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  624   FTG--KAPGLTWYQAYFDAPESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ +  ++VNRDT+CS V ENY P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELMDFVIVNRDTVCSYVGENYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + +++EK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  + KTLAVQ KC R  K
Sbjct  802   CLGKAECVIPVNKSTFQQDKKDSCKNVAKTLAVQVKCGRGKK  843



>emb|CDX72512.1| BnaC07g45340D [Brassica napus]
Length=844

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/582 (49%), Positives = 379/582 (65%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+GT+VNYYMY GG NFG  G+ +V+T 
Sbjct  266   TENWTTQFRVFGDSPVKRSVEDIAFSVARFFSKNGTHVNYYMYHGGTNFGRNGAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG +Y +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     + +F E +P  + L   S  P E+Y LTK  TDY W++T   +NK  LP +  
Sbjct  446   KANKKFDFNVFTEPLP--NKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 + + S+GHA+  + NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   AKTTVRIASLGHALHAWFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SGA++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TEEG +K KW  
Sbjct  564   DSGAYLEHRYTGPRSVSILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEEGLKKVKWQK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              TG       TWY+T+FD PE     AV M  M KG++WVNG+ +GRYW+SFL PLGQ T
Sbjct  624   FTG--KAPGLTWYQTYFDAPESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQST  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V E+Y P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K + ++EFAS+GNP G CGNF  G+C+ P + +++EK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPVSKQVIEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   CLGKGECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCARDKK  843



>ref|XP_008663872.1| PREDICTED: uncharacterized protein LOC100194296 isoform X1 [Zea 
mays]
 gb|ACL54349.1| unknown [Zea mays]
 tpg|DAA48743.1| TPA: beta-galactosidase [Zea mays]
Length=850

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/580 (47%), Positives = 373/580 (64%), Gaps = 8/580 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  GT  NYYMY GG NFG T ++FV   
Sbjct  269   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGTLANYYMYHGGTNFGRTSAAFVMPK  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H+ALKLCKK LLWGT +  K+    E   FE  + K
Sbjct  329   YYDEAPLDEFGLYKEPKWGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT    T+ FRG  Y++P  S+S+L DC+ ++F TQH+ AQHN RTF    
Sbjct  389   VCVAFLSNHNTKDDATMTFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFAD  448

Query  539   KVAGNLKWEMFQ-ESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             + A N  WEMF  E++P       +     ++Y LTK  TDYVW+++   +   D+P+R 
Sbjct  449   QTAQNNVWEMFDGENVPKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRS  508

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI  VL V S GHA + F+N +F G  HG  + K F L +P++LK G N +  L S +  
Sbjct  509   DIKTVLEVNSHGHASVAFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGM  568

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA+ME R AG   V +  L  G  D+T N W + +G  GE+ +++T++G     W P
Sbjct  569   TDSGAYMEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKP  628

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                  N R  TWYK HFD+P G DP+ ++M  M KGM++VNG+ IGRYW+S+   LG+P+
Sbjct  629   AM---NDRPLTWYKRHFDMPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPS  685

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YH+PR +L+ K+N+LV+FEE  G PD+I ++ V RD IC+ ++E  P  +  WERK 
Sbjct  686   QQLYHVPRSFLRQKDNMLVLFEEEFGRPDAIMILTVKRDNICTFISERNPAHIMSWERKD  745

Query  1436  DEF--RATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
              +   +A  DDL+ R  L CP  K+++++ FASYGNP G+CGN+  GSC  P A ++VEK
Sbjct  746   SQITAKANADDLRARAALACPPKKLIQQVVFASYGNPAGICGNYTVGSCHTPRAKEVVEK  805

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             ACLGK  C +PV   ++  G   C     TLAVQAKC ++
Sbjct  806   ACLGKRVCTLPVAADVY-GGDANCSGTTATLAVQAKCSKR  844



>ref|NP_567973.1| beta-galactosidase 11 [Arabidopsis thaliana]
 sp|Q9SCV1.1|BGA11_ARATH RecName: Full=Beta-galactosidase 11; Short=Lactase 11; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64747.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86446.1| beta-galactosidase 11 [Arabidopsis thaliana]
Length=845

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/582 (48%), Positives = 381/582 (65%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ F+G +Y +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  387   TCAAFLANNNTEAAETIKFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSK  446

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   ++K  LP +  
Sbjct  447   KANKKFDFKVFTETLPS--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKG  504

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + + S+GHA+  ++NGE+ G  HG++  K F+  + V LK G N +  L  +  +P
Sbjct  505   VKTFVRIASLGHALHAWLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLVMLGVLTGFP  564

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ + +L L +G  D+T++S W   IG +GEKL + TEEG +K +W  
Sbjct  565   DSGSYMEHRYTGPRGISILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKK  624

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              TG       TWY+T+FD PE      + M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  625   FTG--KAPGLTWYQTYFDAPESVSAATIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  682

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ +   +VNRDT+CS V ENY P V+ W RK
Sbjct  683   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELMDFAIVNRDTVCSYVGENYTPSVRHWTRK  742

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + +++EK 
Sbjct  743   KDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKH  802

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  +VK LAVQ KC R  K
Sbjct  803   CLGKAECVIPVNKSTFQQDKKDSCKNVVKMLAVQVKCGRGKK  844



>ref|XP_010437540.1| PREDICTED: beta-galactosidase 11-like [Camelina sativa]
Length=844

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/582 (49%), Positives = 383/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEYGLEKEPKFGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  387   SCAAFLANNNTEAAETIKFRGRDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSK  446

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   +NK DLP +  
Sbjct  447   KANKKFDFKVFTETLPS--KLEGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLP-KKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + V S+GHA+ V++N E+ G  HG++  K F+  + V LK G N +  L  +  +P
Sbjct  504   VKTSVRVASLGHALHVWLNREYLGSGHGSHEEKSFVFQKSVTLKAGENHLIMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ V +L L +G  D+T+NS W   +G +GE+L + TEEG++K KW  
Sbjct  564   DSGSYMEHRYTGPRGVSILGLTSGTLDLTENSKWGNKVGMEGERLGVHTEEGSKKVKWEK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G       TWY+T+FD PE  +  A+ M  M KG++WVNG+ +GRYW SFL+PLGQPT
Sbjct  624   FNG--KAPGLTWYQTYFDAPESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPT  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK N LV+FEE     P+ +  ++VNRDT+CS V ENY P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNHLVIFEEEPNVKPELMDFVIVNRDTVCSYVGENYIPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ P + ++VEK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK  C +PV KS F +  KD C  +VK LAVQ KC R  K
Sbjct  802   CLGKAHCAIPVNKSTFEQDKKDSCKNVVKMLAVQVKCGRGKK  843



>emb|CDY40650.1| BnaA03g53130D [Brassica napus]
Length=844

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/582 (49%), Positives = 379/582 (65%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+GT+VNYYMY GG NFG  G+ +V+T 
Sbjct  266   TENWTTQFRVFGDSPVKRSVEDIAFSVARFFSKNGTHVNYYMYHGGTNFGRNGAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG +Y +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E +P    L   S  P E+Y LTK  TDY W++T   +NK  LP +  
Sbjct  446   KANKKFDFKVFTEPLP--HKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 + + S+GHA+  + NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   AKTTVRIASLGHALHAWFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SGA++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TEEG +K KW  
Sbjct  564   DSGAYLEHRYTGPRSVSILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEEGLKKVKWQK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              TG       TWY+T+FD PE     AV M  M KG++WVNG+ +GRYW+SFL PLGQ T
Sbjct  624   FTG--KAPGLTWYQTYFDAPESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQST  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V E+Y P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K + ++EFAS+GNP G CGNF  G+C+ P + ++VEK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPISKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV K+ F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   CLGKGECVIPVNKATFQQDKKDSCKNVVKTLAVQVKCARDKK  843



>ref|XP_009138336.1| PREDICTED: beta-galactosidase 11-like [Brassica rapa]
Length=844

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/582 (49%), Positives = 379/582 (65%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+GT+VNYYMY GG NFG  G+ +V+T 
Sbjct  266   TENWTTQFRVFGDSPVKRSVEDIAFSVARFFSKNGTHVNYYMYHGGTNFGRNGAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG +Y +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E +P    L   S  P E+Y LTK  TDY W++T   +NK  LP +  
Sbjct  446   KANKKFDFKVFTEPLP--HKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 + + S+GHA+  + NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   AKTTVRIASLGHALHAWFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SGA++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TE+G +K KW  
Sbjct  564   DSGAYLEHRYTGPRSVSILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEKGLKKVKWQK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              TG       TWY+T+FD PE     AV M  M KG++WVNG+ +GRYW+SFL PLGQ T
Sbjct  624   FTG--KAPGLTWYQTYFDAPESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQST  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V E+Y P V+ W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TD++     L C   K + ++EFAS+GNP G CGNF  G+C+ P + +++EK 
Sbjct  742   QDQVQAITDNVSLTATLKCSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPVSKQVIEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   CLGKGECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCARDKK  843



>dbj|BAK07425.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=841

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/580 (48%), Positives = 376/580 (65%), Gaps = 10/580 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  G+ VNYYMY GG NFG TG+SFV   
Sbjct  262   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGSMVNYYMYHGGTNFGRTGASFVMPR  321

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H AL+LCKK LL G  +   +   +E   FE  + K
Sbjct  322   YYDEAPLDEFGMYKEPKWGHLRDLHHALRLCKKALLRGNPSTQPLGKLYEARLFEIPEQK  381

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +C AFLSN+NT +  T+ FRG  Y++P +SVSIL DCK ++F+TQH+ AQHN RTF  + 
Sbjct  382   VCVAFLSNHNTKEDGTVTFRGQQYFVPRRSVSILADCKTVVFSTQHVNAQHNQRTFHLTD  441

Query  539   KVAGNLKWEMFQES--IPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
             +   N  WEM+ E   +PT      +S  P E Y +TK  TDY+W++T   +   DLP R
Sbjct  442   QTLQNNVWEMYTEGDKVPTYKFTTDRSEKPLEAYNMTKDKTDYLWYTTSFKLEAEDLPFR  501

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
              DI PVL   S GHAM+ F+NG+  G  HG  + K F L +P+ ++ G N ++ L S L 
Sbjct  502   QDIKPVLEASSHGHAMVAFVNGKLVGAAHGTKMNKAFSLEKPIEVRAGINHVSILSSTLG  561

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
               +SGA++E R AG  SV +  L TG  D++ N W + +G  GE+ +   ++G E  +W 
Sbjct  562   LQDSGAYLEHRQAGVHSVTIQGLNTGTLDLSSNGWGHIVGLDGERKQAHMDKGGE-VQWK  620

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
             P   +      TWY+  FD+P G DP+ +++  M KG+++VNG+ +GRYW S+   LG+P
Sbjct  621   PAVFD---LPLTWYRRRFDMPSGEDPVVIDLNPMGKGILFVNGEGLGRYWSSYKHALGRP  677

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             +Q  YH+PR +LKP  N+L +FEE GG PD+I ++ V RD ICS ++E  P  V+ WERK
Sbjct  678   SQYLYHVPRCFLKPTGNVLTIFEEEGGRPDAIMILTVKRDNICSFISEKNPGHVRSWERK  737

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
               +     DDLKPR  LTCP+ K ++++ FASYGNP G+CGN+  G+C  P A ++VEKA
Sbjct  738   DSQLTVVADDLKPRAVLTCPEKKTIQQVVFASYGNPLGICGNYTVGNCHTPKAKEVVEKA  797

Query  1613  CLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             C+GK  C + V   ++  G DL CP    TLAVQAKC ++
Sbjct  798   CVGKKSCVLAVSHEVY--GGDLNCPGTTATLAVQAKCSKR  835



>ref|XP_009136326.1| PREDICTED: beta-galactosidase 13 [Brassica rapa]
Length=846

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/582 (48%), Positives = 384/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RV+GDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  269   TENWTTQFRVYGDPPVQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  329   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + FRG DY +P +S+SILPDCK ++++T  I++ H  R F  SK
Sbjct  389   VCAAFLANNNTESAEIIKFRGKDYVIPPRSISILPDCKTVVYSTGEIVSHHTARNFMKSK  448

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P    L   S  P E+Y L K  +DY W++T   ++  DL  +  
Sbjct  449   KANKKFDFKVFTETVP--QELKGDSYVPVELYGLAKDESDYGWYTTNFKIDDSDLKKKGG  506

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P + V S+GHA+  ++NGE+ G  HG++  K F+  +P+ LK G N +T L  +  +P
Sbjct  507   -KPTVRVASLGHALHAWLNGEYLGNGHGSHDEKSFVFQKPIALKEGDNHLTMLGVLTGFP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG+++E R+ GP+SV +  L +G  D+T K+ W   +G +GEKL + TE+G +K KW  
Sbjct  566   DSGSYLEHRFTGPRSVSISGLSSGPMDLTEKSKWGNKVGMEGEKLDIHTEKGLKKVKWEK  625

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE   P A+ M  M KG++WVNG+ +GRYW+SFL+PLG+ T
Sbjct  626   FSG--KAPGLTWYQTYFDAPESLSPAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGKST  683

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE    +P+ I  ++VNRDT+CS + E+Y P V+ W RK
Sbjct  684   QIEYHIPRSFLKPKKNLLVIFEEEPNVNPELIDFVIVNRDTVCSYIGEDYTPSVRHWARK  743

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D  +A TDD++   +L C   K +  +EFAS+GNP G CGNF  GSC  P   ++VEK 
Sbjct  744   NDNVQAITDDVQLTANLKCSGTKKISAVEFASFGNPTGSCGNFTRGSCHAPVTKQVVEKY  803

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F E  KD CPK+VKTLAVQ KC R  K
Sbjct  804   CLGKAECVIPVNKSTFQEDKKDSCPKVVKTLAVQVKCGRPKK  845



>ref|XP_009107264.1| PREDICTED: beta-galactosidase 11 [Brassica rapa]
Length=845

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/583 (49%), Positives = 380/583 (65%), Gaps = 9/583 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  266   TENWTTQFRVFGDAPVKRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAGNLKWE--MFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              A   K++  +F E +P    L   S  P E+Y LTK  +DY W++T   +++  LP + 
Sbjct  446   QANKKKFDFKVFTEPLP--KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLPKKK  503

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                  L + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +
Sbjct  504   GAKTNLRIASLGHALHVWLNGEYLGNGHGSHDEKSFVFQKPVTLKAGENHLVMLGVLTGF  563

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG+++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TE+G +K KW 
Sbjct  564   PDSGSYLEHRYTGPRSVSILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWE  623

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
               +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL PLGQ 
Sbjct  624   KFSG--KAPGITWYQTYFDAPESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQS  681

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQ EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V ENY P V  W R
Sbjct  682   TQIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSFVGENYTPSVGHWIR  741

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K DE +A TD++     L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK
Sbjct  742   KQDEVKAITDNVSLTATLKCSGNKKIAAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEK  801

Query  1610  ACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
              CLGK EC +PV KS F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   HCLGKAECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCARDKK  844



>emb|CDX75479.1| BnaA01g02230D [Brassica napus]
Length=845

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/583 (49%), Positives = 380/583 (65%), Gaps = 9/583 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  266   TENWTTQFRVFGDAPVKRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAGNLKWE--MFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              A   K++  +F E +P    L   S  P E+Y LTK  +DY W++T   +++  LP + 
Sbjct  446   QANKKKFDFKVFTEPLP--KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLPKKK  503

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                  L + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +
Sbjct  504   GAKTNLRIASLGHALHVWLNGEYLGNGHGSHDEKSFVFQKPVTLKAGENHLVMLGVLTGF  563

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG+++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TE+G +K KW 
Sbjct  564   PDSGSYLEHRYTGPRSVSILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWE  623

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
               +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL PLGQ 
Sbjct  624   KFSG--KAPGITWYQTYFDAPESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQS  681

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQ EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V ENY P V  W R
Sbjct  682   TQIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVGHWIR  741

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K DE +A TD++     L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK
Sbjct  742   KQDEVKAITDNVSLTATLKCSGNKKITAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEK  801

Query  1610  ACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
              CLGK EC +PV KS F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   HCLGKAECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCARDKK  844



>emb|CAA17766.1| beta-galactosidase-like protein [Arabidopsis thaliana]
 emb|CAB80218.1| beta-galactosidase-like protein [Arabidopsis thaliana]
Length=831

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/592 (47%), Positives = 381/592 (64%), Gaps = 18/592 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI++SV RF+SK+GT+VNYYMY GG NFG T + +V+T 
Sbjct  243   TENWTTQFRVFGDPPTQRSVEDIAYSVARFFSKNGTHVNYYMYHGGTNFGRTSAHYVTTR  302

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  303   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  362

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ F+G +Y +  +S+SILPDCK +++NT  I++QH  R F  SK
Sbjct  363   TCAAFLANNNTEAAETIKFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSK  422

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L   S  P E+Y LTK  TDY W++T   ++K  LP +  
Sbjct  423   KANKKFDFKVFTETLPS--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKG  480

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +   + + S+GHA+  ++NGE+ G  HG++  K F+  + V LK G N +  L  +  +P
Sbjct  481   VKTFVRIASLGHALHAWLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLVMLGVLTGFP  540

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+ + +L L +G  D+T++S W   IG +GEKL + TEEG +K +W  
Sbjct  541   DSGSYMEHRYTGPRGISILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKK  600

Query  1076  VTGNHNTRRATWY----------KTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV  1225
              TG       TWY          +T+FD PE      + M  M KG++WVNG+ +GRYW 
Sbjct  601   FTG--KAPGLTWYQKFSKECETLQTYFDAPESVSAATIRMHGMGKGLIWVNGEGVGRYWQ  658

Query  1226  SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENY  1402
             SFL+PLGQPTQ EYHIPR +LKPK NLLV+FEE     P+ +   +VNRDT+CS V ENY
Sbjct  659   SFLSPLGQPTQIEYHIPRSFLKPKKNLLVIFEEEPNVKPELMDFAIVNRDTVCSYVGENY  718

Query  1403  PPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSF  1582
              P V+ W RK D+ +A TD++     L C   K +  +EFAS+GNP GVCGNF  G+C+ 
Sbjct  719   TPSVRHWTRKKDQVQAITDNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNA  778

Query  1583  PNAIKIVEKACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             P + +++EK CLGK EC +PV KS F +  KD C  +VK LAVQ KC R  K
Sbjct  779   PVSKQVIEKHCLGKAECVIPVNKSTFQQDKKDSCKNVVKMLAVQVKCGRGKK  830



>ref|NP_001154292.1| beta-galactosidase 14 [Arabidopsis thaliana]
 gb|AEE86952.1| beta-galactosidase 14 [Arabidopsis thaliana]
Length=1052

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/578 (48%), Positives = 395/578 (68%), Gaps = 16/578 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QR+ EDI+FSV R++SK+G++VNYYMY GG NFG T + FV+T 
Sbjct  265   TENWTTQFRVFGDPPTQRTVEDIAFSVARYFSKNGSHVNYYMYHGGTNFGRTSAHFVTTR  324

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  + PK+ HL+  HRAL+LCKK L WG      +  D E+  +E    K
Sbjct  325   YYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTK  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFLSNNNT    T+ F+G DY LP++S+SILPDCK +++NT  I+AQH+ R F  S 
Sbjct  385   VCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSE  444

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K +  LK+EMF E+IP++  L   S  P E+Y LTK  TDY      V +++ D P +  
Sbjct  445   KTSKGLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKTDYAC----VKIDEDDFPDQKG  498

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             +  +L V S+GHA+IV++NGE+AG  HG +  K F   +PVN K G N I+ L  +   P
Sbjct  499   LKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLP  558

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME R+AGP+++ ++ L +G +D+T+N+ W +  G +GEK +++TEEG++K KW  
Sbjct  559   DSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKW--  616

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                +   +  TWYKT+F+ PEG + +A+ M+ M KG++WVNG  +GRYW+SFL+PLG+PT
Sbjct  617   -EKDGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPT  675

Query  1256  QTEYHIPRPWLK--PKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             QTEYHIPR ++K   K N+LV+ EE  G   +SI  +LVNRDTICS+V E+YP  VK W+
Sbjct  676   QTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWK  735

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
             R+G +  + + D++ +  + CP  K M +++FAS+G+P G CGNF  G CS   + ++VE
Sbjct  736   REGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVE  795

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             K CLG+  C + V +  F  G   CP+IVKTLAVQ KC
Sbjct  796   KECLGRNYCSIVVARETF--GDKGCPEIVKTLAVQVKC  831



>ref|XP_006285214.1| hypothetical protein CARUB_v10006573mg [Capsella rubella]
 gb|EOA18112.1| hypothetical protein CARUB_v10006573mg [Capsella rubella]
Length=846

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/585 (48%), Positives = 389/585 (66%), Gaps = 10/585 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  267   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  327   YYDDAPLDEYGLEKEPKYGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTK  386

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
              CAAFL+NNNT    T+ F+G +Y +  +S+SILPDCK +++NT  I++QH  R F  S 
Sbjct  387   TCAAFLANNNTEAAETIKFKGREYVIAPRSISILPDCKTVLYNTAQIVSQHTSRNFMKSK  446

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K      +++F E++P+   L   S  P E+Y LTK  +DY W++T   ++K  LP + +
Sbjct  447   KANKKFAFKVFSETLPS--KLEGDSYIPVELYGLTKDRSDYGWYTTSFKVHKNHLP-KKE  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGT-NDITFLCSILSY  895
             +   + + S+GHA+ V++NGE+ G  HG++  K F+  + V LK G+ N +  L  +  +
Sbjct  504   VKTFVRIASLGHALHVWLNGEYLGSGHGSHEEKSFVFQKQVTLKAGSENHLVMLGVLTGF  563

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             P+SG++ME RY GP+SV +L L +G  D+T+ S W   +G +GEKL + TEEG +K KW 
Sbjct  564   PDSGSYMEHRYTGPRSVSILGLTSGTLDLTETSKWGNKVGMEGEKLGIHTEEGLKKVKWQ  623

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
               TG    +  TWY+T+FD PE  +  A+ M  M KG++WVNG+ +GRYW SFL+PLGQP
Sbjct  624   KFTG--KAQGLTWYQTYFDAPESLNAAAIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQP  681

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             TQ EYHIPR +LKPK NLLV+FEE     P+ +  ++VNRDT+CS V ENY P V+ W R
Sbjct  682   TQIEYHIPRSFLKPKKNLLVIFEEEPNVKPELMDFVIVNRDTVCSYVGENYIPSVRHWTR  741

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K D+ +A TD++     L C   + +  +EFAS+GNP GVCGNF  G+C+ P + ++VEK
Sbjct  742   KQDQVQAITDNVTLTATLKCSGTRKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEK  801

Query  1610  ACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGKED  1741
              CLGK +C +PV KS F +  KD C  +VK LAVQ KC R  K++
Sbjct  802   HCLGKAQCAIPVNKSTFEQDKKDSCKDVVKMLAVQVKCGRGKKKN  846



>ref|XP_009121204.1| PREDICTED: beta-galactosidase 13-like [Brassica rapa]
Length=846

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/582 (47%), Positives = 387/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  RS EDI++SV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  269   TENWTTQFRVFGDPPAHRSVEDIAYSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  R+PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  329   YYDDAPLDEFGLEREPKYGHLKLLHNALNLCKKALLWGHSRTEKPGKDTEIRYYEQPGTK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT    T+ F+G ++ +P +S+SILPDCK ++++T  +++QH  R +  SK
Sbjct  389   VCAAFLANNNTEAAETIKFKGKEHVIPPRSISILPDCKTVVYSTAEVISQHTSRNYVKSK  448

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P    L  +S  P E+Y LT+  TDY W++T   ++  DL  +  
Sbjct  449   KANKKFDFKVFTETVP--GELKGESFIPVELYGLTEDVTDYGWYTTNFKIDDNDLKKKGG  506

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L + S+GHA+ V++NGE+ G  HG++  K F+  + V+LK G N +T L  +  +P
Sbjct  507   -KTTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKQVSLKEGENHLTMLGVLTGFP  565

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG+++E RY GP+SV +L L +G  D+T KN W   +G +GEKL +  E+G +K KW  
Sbjct  566   DSGSYLEHRYTGPRSVSILGLSSGPLDLTEKNKWGNKVGMEGEKLGIHAEKGLKKVKWQK  625

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T FD PE  + +A+ M  M KG++WVNG+ +GRYW+SFL+PL  PT
Sbjct  626   FSG--KAPGLTWYQTRFDAPESKNSVAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLKNPT  683

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+ W +K
Sbjct  684   QVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVRHWTKK  743

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A  DD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + +++EK 
Sbjct  744   NDKVQAIADDVFLTANLKCSGTKKIAAVEFASFGNPTGTCGNFTLGSCNAPASKQVIEKY  803

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK+EC++PV KS F +  KD CPK+VK LAVQ KC R  K
Sbjct  804   CLGKSECDIPVNKSTFQQDKKDSCPKVVKMLAVQVKCGRTNK  845



>ref|XP_009396587.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=739

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/539 (50%), Positives = 359/539 (67%), Gaps = 8/539 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+GT VNYYMY GG NFG +GSSF  T 
Sbjct  197   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGTLVNYYMYHGGTNFGRSGSSFAMTR  256

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGD-HEITTFENTDL  358
             YYDE P+D +G +++PK+ HL D H AL+LC K LLWG +++   + D  E T +EN  +
Sbjct  257   YYDEAPLDEFGLHKEPKYGHLSDLHHALRLCSKALLWGVSSVQTFDIDGFEATVYENPGM  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFLSN+N     T+NF+GTDYYLP +S+SILPDCK + FNTQ +++QHN RTF  +
Sbjct  317   KACAAFLSNSNRKIEGTVNFKGTDYYLPRRSISILPDCKTVAFNTQKVISQHNARTFHVA  376

Query  539   KVAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             K +  N +W+M ++ IP       +S +  E++ +TK T+DY+W++T   +   DLP R 
Sbjct  377   KESSMNNQWQMHKDHIPRFRDTRVRSRSTLELFNMTKDTSDYLWYTTSFRLEDDDLPRRH  436

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI PVL V ++GHAM  F+NG  AG  HG N+ K F+  QP+ L  G N +T LC  +  
Sbjct  437   DIRPVLLVSNLGHAMHAFVNGRHAGSGHGTNIEKSFVFHQPIALGAGINHVTILCMTIGL  496

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             PNSG+++E R AG  +V++  L TG  D+++N W + +G  GEKL +F E+G     W  
Sbjct  497   PNSGSYLEHRIAGVHTVVIQGLNTGTLDLSQNGWGHQVGLVGEKLGIFNEKGVNNVNW--  554

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              T   N    TWYK +FD P GNDP+A+++  MSKGMVW+NG+SIGRYWVS+L PL +P+
Sbjct  555   -TQAQNDMPITWYKRYFDAPSGNDPVALDLTSMSKGMVWINGESIGRYWVSYLNPLQKPS  613

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q+ YH+PR  LKPK+NL+VVFEE  G P+ I +M V RD IC+ V+E +P       R+ 
Sbjct  614   QSVYHVPRSLLKPKDNLMVVFEEHRGKPEGIVMMTVKRDNICTFVSELFPGQASSSLRES  673

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              +         P   L C   KV+  I FAS+GNPEG+CGN+  GSC  P    +VEK 
Sbjct  674   SKLGTVE---HPEARLKCTGKKVIHSIAFASFGNPEGLCGNYSRGSCHAPQTKAVVEKV  729



>gb|KFK36758.1| hypothetical protein AALP_AA4G166000 [Arabis alpina]
Length=848

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/582 (48%), Positives = 385/582 (66%), Gaps = 9/582 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  271   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG +   K + D EI  +E    K
Sbjct  331   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPSDDTEIRYYEQPGTK  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  391   VCAAFLANNNTEAAEKIKFKGKEYVIPPRSISILPDCKTVVYNTAEIVSHHTARNFMKSK  450

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P    L  +S  P E+Y LTK  +DY W+ST   ++  DL  +  
Sbjct  451   KANKKFDFKVFTETVP--KELKGESYVPVELYGLTKDESDYGWYSTSFKIDDDDL-KKKG  507

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L + S+GHA+ V++NGE+ G  HG++  K F+  +P++LK G N +T L  +  +P
Sbjct  508   GKTTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPISLKEGENHLTMLGVLTGFP  567

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+S+ +L L +G  D+T K+ W   +G +GEKL +  E+G  + KW  
Sbjct  568   DSGSYMEHRYTGPRSISILGLSSGTLDLTEKSKWGNKVGMEGEKLGIHAEKGLNEVKWQK  627

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPT
Sbjct  628   FSG--KAPGLTWYQTYFDAPESVSATAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPT  685

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + E Y P V+ W RK
Sbjct  686   QVEYHIPRSFLKPKKNLLVIFEEEPNVKPEKIDFVIINRDTVCSYIGEEYTPSVRHWTRK  745

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A +DD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + +++EK 
Sbjct  746   NDQIQAISDDVHLTANLKCSGTKKIAAVEFASFGNPNGTCGNFTLGSCNAPVSKQVIEKY  805

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK  C +PV KS F +  KD CPK+ K LAVQ KC R+ K
Sbjct  806   CLGKAACVIPVNKSTFQQDKKDSCPKVPKKLAVQVKCGREKK  847



>emb|CDX69103.1| BnaC01g03500D [Brassica napus]
Length=844

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/582 (48%), Positives = 378/582 (65%), Gaps = 8/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGD P +RS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  266   TENWTTQFRVFGDAPVKRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  325

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PK+ HL+  H AL LCKKPLLWG     K   D EI  +E    K
Sbjct  326   YYDDAPLDEYGLEREPKYGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTK  385

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL+NNNT    T+ FRG DY +  +S+SILPDCK +++NT  I++ H  R F  SK
Sbjct  386   SCAAFLANNNTEAAETIKFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSK  445

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E +P    L   S  P E+Y LTK  +DY W++T   +++  L  +  
Sbjct  446   QANKKFDFKVFTEPLP--KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLLKKKG  503

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L + S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +  L  +  +P
Sbjct  504   AKTNLRIASLGHALHVWLNGEYLGNGHGSHDEKSFVFQKPVTLKTGENHLVMLGVLTGFP  563

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNS-WSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG+++E RY GP+SV +L L +G  D+T++S W   +G +GE+L + TE+G +K KW  
Sbjct  564   DSGSYLEHRYTGPRSVSILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWEK  623

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL PLGQ T
Sbjct  624   FSG--KAPGITWYQTYFDAPESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQST  681

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS V ENY P V  W RK
Sbjct  682   QIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVGHWIRK  741

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              DE +A TD++     L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK 
Sbjct  742   QDEVKAITDNVSLTATLKCSGNKKIAAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEKH  801

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK EC +PV KS F +  KD C  +VKTLAVQ KC R  K
Sbjct  802   CLGKAECVIPVNKSTFQQDKKDSCKNVVKTLAVQVKCARDKK  843



>ref|XP_010489252.1| PREDICTED: beta-galactosidase 13-like [Camelina sativa]
Length=835

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/581 (47%), Positives = 377/581 (65%), Gaps = 23/581 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  274   TENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  333

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG   + + + + EI  +E    K
Sbjct  334   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTK  393

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  ++   N ++   S 
Sbjct  394   VCAAFLANNNTESAENIKFKGKEYVIPPRSISILPDCKTIVYNTAEVMT--NSKSCSKS-  450

Query  542   VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDI  721
                              + +   S  P E+Y LTK  TDY W++T   ++  DL  R   
Sbjct  451   ---------------IKEKIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKRKGG  495

Query  722   HPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPN  901
              P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV+LK G N +  L  +  +P+
Sbjct  496   KPTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFPD  555

Query  902   SGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             SG++ME RY GP+SV +L L +G  D+T +N W   +G +GE+L +  EEG +K KW  +
Sbjct  556   SGSYMEHRYTGPRSVSILGLSSGPLDLTEQNKWGNKVGMEGERLGIHAEEGLKKVKWQKL  615

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             +G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL+PLGQPTQ
Sbjct  616   SGKEPG--LTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQ  673

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
              EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+ W RK 
Sbjct  674   VEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSFIGENYTPSVRHWTRKN  733

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
             D+ +A TDD++    L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK C
Sbjct  734   DQVQAITDDVQLTAKLKCSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKYC  793

Query  1616  LGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             LGK +C +PV KS F +  KD CPK+ K LAVQ KC R  K
Sbjct  794   LGKAQCAIPVNKSTFQQDKKDSCPKVAKKLAVQVKCGRDKK  834



>emb|CDY31414.1| BnaA07g03490D [Brassica napus]
Length=780

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/587 (47%), Positives = 386/587 (66%), Gaps = 14/587 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP  RS EDI++SV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  193   TENWTTQFRVFGDPPAHRSVEDIAYSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  252

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D +G  R+PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  253   YYDDAPLDEFGLEREPKYGHLKLLHNALNLCKKALLWGHSRTEKPGKDTEIRYYEQPGTK  312

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT    T+ F+G +Y +P +S+SILPDCK ++++T  +++QH  R +  SK
Sbjct  313   VCAAFLANNNTEAAETIKFKGKEYVIPPRSISILPDCKTVVYSTAEVISQHTSRNYVKSK  372

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A     +++F E++P+   L  +S  P E+Y LT+  TDY W++T    +  DL  +  
Sbjct  373   KANKKFDFKLFTETVPS--ELKGESFIPVELYGLTEDVTDYGWYTTNFKTDDNDLKKKGG  430

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L + S+GHA+ V++NGE+ G  HG++  K F+  + V+LK G N +T L  +  +P
Sbjct  431   -KTTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKQVSLKEGENHLTMLGVLTGFP  489

Query  899   -----NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEK  1060
                  +SG+++E RY GP+SV +L L +G  D+T KN W   +G +GEKL +  E+G +K
Sbjct  490   VRNIDDSGSYLEHRYTGPRSVSILGLSSGPLDLTEKNKWGNKVGMEGEKLGIHAEKGLKK  549

Query  1061  AKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTP  1240
              KW   +        TWY+T FD PE    +A+ M  M KG++WVNG+ +GRYW+SFL+P
Sbjct  550   VKWQKFSA--KAPGLTWYQTRFDAPESKSSVAIRMNGMGKGLIWVNGEGVGRYWMSFLSP  607

Query  1241  LGQPTQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVK  1417
             L  PTQ EYHIPR +LKPK NLLV+FEE     P+ I  +++NRDT+CS + ENY P V+
Sbjct  608   LKNPTQVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVR  667

Query  1418  IWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIK  1597
              W +K D+ +A TDD+    +L C   K +  +EFAS+GNP G CGNF  GSC+ P + +
Sbjct  668   HWTKKNDKVQAITDDVFLTANLKCSGTKKIAAVEFASFGNPNGTCGNFTLGSCNAPASKQ  727

Query  1598  IVEKACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             ++EK CLGK+EC++PV KS F +  KD CPK+VK LAVQ KC R  K
Sbjct  728   VIEKYCLGKSECDIPVNKSTFQQDKKDSCPKVVKMLAVQVKCGRTKK  774



>gb|EMS61528.1| Beta-galactosidase 11 [Triticum urartu]
Length=867

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/610 (46%), Positives = 383/610 (63%), Gaps = 38/610 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  G+ VNYYMY GG NFG TG+SFV   
Sbjct  260   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGSMVNYYMYHGGTNFGRTGASFVMPR  319

Query  182   YYDEGPMDIYG----------------------------FNRDPKWSHLRDTHRALKLCK  277
             YYDE P+D +G                              ++PKW HL+D H AL+LCK
Sbjct  320   YYDEAPLDEFGKAETDESSQTLNMLNYVDSWMNVLVGPGMFKEPKWGHLKDLHHALRLCK  379

Query  278   KPLLWGTANLNKINGDHEITTFENTDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVS  457
               LL+GT +   +   +E   FE  + K+C AFLSN+NT +  T+ FRG  Y++P +SVS
Sbjct  380   NALLFGTPSTQPLGKLYEARVFEIPEQKVCVAFLSNHNTKEDGTVTFRGQKYFVPRRSVS  439

Query  458   ILPDCKNMIFNTQHILAQHNHRTFD-PSKVAGNLKWEMFQE--SIPTIDTLPAKSPAPKE  628
             IL DCK ++F+TQ++ AQHN RTF    +   N  WEM+ E   +PT      +S  P E
Sbjct  440   ILGDCKTVVFSTQYVNAQHNQRTFHFTDQTVQNNVWEMYTEGDQVPTYKFSTDRSEKPLE  499

Query  629   MYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNN  808
              Y +TK  TDY+W++T  +++  DLP R DI PVL   S GHAM+ F+N +  G  HG  
Sbjct  500   AYNMTKDKTDYLWYTTSFLLDPEDLPSRLDIKPVLEASSHGHAMVAFVNKKLVGCGHGTK  559

Query  809   VAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITK  988
             + K F L +P+++K G N I+ L S L   +SG+++ERR AG  SV +  L TG  D+T 
Sbjct  560   MNKAFSLEKPIDVKVGINHISILSSTLGLQDSGSYLERRQAGVHSVTIQGLNTGTLDLTS  619

Query  989   NSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNME  1168
             N W + +G  GE+ + FTE+G E  +W P   +   +  TWY+  FD+P G DP+ ++M 
Sbjct  620   NGWGHIVGLDGERKQAFTEKGGE-VQWQPAVFD---KPLTWYRRRFDMPSGEDPVVIDMN  675

Query  1169  KMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
              M KG+++VNG+ +GRYW S+   LG+P+Q  YH+PR +LKP  N+L +FEE GG PD+I
Sbjct  676   PMGKGILFVNGEGLGRYWSSYKHALGRPSQYLYHVPRCFLKPTGNVLTIFEEEGGRPDAI  735

Query  1349  KVMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFAS  1528
              ++ V RD ICS ++E  P  V+ WE K  +     DDLKPR  LTCP+ K+++++ FAS
Sbjct  736   MILTVKRDNICSFISETNPGHVRSWETKDSQLTMVADDLKPRAVLTCPEKKMIQQVVFAS  795

Query  1529  YGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLA  1705
             YGNP G+CGN+  G+C  P A +IVEKAC+GK  C + V   ++  G DL CP    TLA
Sbjct  796   YGNPLGICGNYTFGNCHTPKAKEIVEKACVGKRSCVLAVSHEVY--GGDLNCPGTTATLA  853

Query  1706  VQAKCVRQGK  1735
             VQAKC ++ +
Sbjct  854   VQAKCSKRQR  863



>gb|EMT25927.1| Beta-galactosidase 11 [Aegilops tauschii]
Length=868

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/610 (46%), Positives = 384/610 (63%), Gaps = 38/610 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  G+ VNYYMY GG NFG TG+SFV   
Sbjct  261   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGSMVNYYMYHGGTNFGRTGASFVMPR  320

Query  182   YYDEGPMDIYG----------------------------FNRDPKWSHLRDTHRALKLCK  277
             YYDE P+D +G                              ++PKW HL+D H AL+LCK
Sbjct  321   YYDEAPLDEFGKAETDESSQTLNMLNYVDLWMNGLVGPGMFKEPKWGHLKDLHHALRLCK  380

Query  278   KPLLWGTANLNKINGDHEITTFENTDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVS  457
               LL+GT +   +   +E   FE  + K+C AFLSN+NT +  T+ FRG +Y++P +SVS
Sbjct  381   NALLFGTPSTQPLGKLYEARVFEIPEQKVCVAFLSNHNTKEDGTVTFRGQNYFVPRRSVS  440

Query  458   ILPDCKNMIFNTQHILAQHNHRTFD-PSKVAGNLKWEMFQES--IPTIDTLPAKSPAPKE  628
             IL DCK ++F+TQ++ AQHN RTF    +   N  WEM+ E   +PT      +S  P E
Sbjct  441   ILGDCKTVVFSTQYVNAQHNQRTFHFTDQTVQNNVWEMYTEGDKVPTYKFSTDRSEKPLE  500

Query  629   MYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNN  808
              Y +TK  TDY+W++T  +++  DLP R DI PVL   S GHAM+ F+N +  G  HG  
Sbjct  501   AYNMTKDKTDYLWYTTSFLLDPEDLPSRLDIKPVLEASSHGHAMVAFVNKKLVGCGHGTK  560

Query  809   VAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITK  988
             + K F L +P+ +K G N I+ L S L   +SG+++ERR AG  SV +  L TG  D+T 
Sbjct  561   MNKAFSLEKPIEVKVGINHISILSSTLGLQDSGSYLERRQAGVHSVTIQGLNTGTLDLTS  620

Query  989   NSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNME  1168
             N W + +G +GE+ + FT++G E  +W P   +   +  TWY+  FD+P G DP+ ++M 
Sbjct  621   NGWGHIVGLEGERKQAFTDKGGE-VQWQPAVFD---KPLTWYRRRFDMPTGEDPVVIDMN  676

Query  1169  KMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
              M KG+++VNG+ +GRYW S+   LG+P+Q  YH+PR +LKP  N+L +FEE GG PD+I
Sbjct  677   PMGKGILFVNGEGLGRYWSSYKHALGRPSQYLYHVPRCFLKPTGNVLTIFEEEGGRPDAI  736

Query  1349  KVMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFAS  1528
              ++ V RD ICS ++E  P  V+ WE K  +     DDLKPR  LTCP+ K+++++ FAS
Sbjct  737   MILTVKRDNICSFISETNPGHVRSWETKDSQLTMVADDLKPRAVLTCPEKKMIQQVVFAS  796

Query  1529  YGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLA  1705
             YGNP G+CGN+  G+C  P A +IVEKAC+GK  C + V   ++  G DL CP    TLA
Sbjct  797   YGNPLGICGNYTFGNCHTPKAKEIVEKACVGKRSCVLAVSHEVY--GGDLNCPGTTATLA  854

Query  1706  VQAKCVRQGK  1735
             VQAKC ++ +
Sbjct  855   VQAKCSKRQR  864



>emb|CDX89744.1| BnaC03g46580D [Brassica napus]
Length=1086

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/585 (48%), Positives = 383/585 (65%), Gaps = 12/585 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RV+GDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  506   TENWTTQFRVYGDPPVQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  565

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  566   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTK  625

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF----  529
             +CAAFL+NNNT     + FRG +Y +P +S+SILPDCK ++++T  I++ H  R +    
Sbjct  626   VCAAFLANNNTESAEIIKFRGKEYVIPPRSISILPDCKTVVYSTGEIVSHHTARNYMKSK  685

Query  530   DPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
               +K      +++F E++P    L   S  P E+Y L K  +DY W++T   ++  D   
Sbjct  686   KANKANKKFDFKVFTETVP--QELKGDSYVPVELYGLAKDESDYGWYTTNFKIDDSDFKK  743

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             +    P + V S+GHA+ V++NGE+ G  HG++  K F+  +PV LK G N +T L  + 
Sbjct  744   KGG-KPTVRVASLGHALHVWLNGEYLGNGHGSHDEKSFVFQKPVALKEGDNHLTMLGVLT  802

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
              +P+SG+++E R+ GP+SV +  L +G  D+T K+ W   +G +GEKL + TE+G +K K
Sbjct  803   GFPDSGSYLEHRFTGPRSVSISGLSSGPMDLTEKSKWGNKVGMEGEKLDIHTEKGLKKVK  862

Query  1067  WGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLG  1246
             W   +G       TWY+T+FD PE   P A+ M  M KG++WVNG+ +GRYW+SFL+PLG
Sbjct  863   WEKFSG--KAPGLTWYQTYFDAPESLSPAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLG  920

Query  1247  QPTQTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIW  1423
             Q TQ EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + E + P V+ W
Sbjct  921   QSTQIEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVIVNRDTVCSYIGEEFTPSVRHW  980

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
              RK D  +A TDD++   +L C   K +  +EFAS+GNP+G+CGNF  GSC  P   ++V
Sbjct  981   TRKNDNVQAITDDVQLTANLKCSGTKKISAVEFASFGNPDGICGNFTRGSCHAPVTKQVV  1040

Query  1604  EKACLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             EK CLGK EC +PV KS F E  KD CPK+VKTLAVQ KC R  K
Sbjct  1041  EKYCLGKAECVIPVNKSTFQEDKKDSCPKVVKTLAVQVKCGRPKK  1085



>tpg|DAA40653.1| TPA: hypothetical protein ZEAMMB73_851266 [Zea mays]
Length=580

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/575 (46%), Positives = 365/575 (63%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  4     TENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  63

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  LWG  +   +   +E   FE  + K
Sbjct  64    YYDEAPMDEYGMYKEPKFGHLRDLHNVIRSYQKAFLWGQHSSEILGHGYEAHIFELPEEK  123

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QH+ R+F  S 
Sbjct  124   LCLSFLSNNNTGEDGTVIFRGDKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSD  183

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V + N +WEMF E+IP       ++  P E Y  TK  TDY+W++T   +   DLP R D
Sbjct  184   VTSKNNQWEMFSETIPKYRDTKVRTKEPLEQYNQTKDDTDYLWYTTSFRLESDDLPFRND  243

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  HAM+ F N  F G   GN   K F+  +PV+LK G N +  L S +   
Sbjct  244   IRPVLQVKSSAHAMMGFANDAFVGCARGNKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMK  303

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  304   DSGGELAEVKGGIQECLIQGLNTGTLDLQVNGWGHKAALEGEYKEIYSEKGLGKVQWKPA  363

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N R ATWYK +FD P+G+DP+ ++M  MSKGM++VNG+ +GRYWVS+ T  G P+Q
Sbjct  364   ---ENDRAATWYKRYFDEPDGDDPVVLDMSSMSKGMIFVNGEGVGRYWVSYRTLAGTPSQ  420

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLV+FEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  421   AVYHIPRPFLKSKDNLLVIFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGD  480

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  LTCP  K ++++ FAS+GNP+G+CGNF  G+C  PNA +IVEK CL
Sbjct  481   KIKLIAEDHSRRGTLTCPPEKTIQEVVFASFGNPDGMCGNFTVGTCHTPNAKQIVEKECL  540

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV+ +++  G D+ C     TL VQ +C
Sbjct  541   GKPSCMLPVDHTVY--GADINCQSTTATLGVQVRC  573



>ref|NP_001169479.1| uncharacterized protein LOC100383352 [Zea mays]
 gb|ACN33871.1| unknown [Zea mays]
Length=580

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/575 (45%), Positives = 363/575 (63%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  4     TENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  63

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  LWG  +   +   +E   FE  + K
Sbjct  64    YYDEAPMDEYGMYKEPKFGHLRDLHNVIRSYQKAFLWGQHSSEILGHGYEAHIFELPEEK  123

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QH+ R+F  S 
Sbjct  124   LCLSFLSNNNTGEDGTVIFRGDKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSD  183

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V   N +WEM  E+IP       ++  P E Y  TK  TDY+W++T   +   DLP R D
Sbjct  184   VTSKNNQWEMSSETIPKYRDTKVRTKEPLEQYNQTKDDTDYLWYTTSFRLESDDLPFRND  243

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  HAM+ F N  F G   GN   K F+  +PV+LK G N +  L S +   
Sbjct  244   IRPVLQVKSSAHAMMGFANDAFVGCARGNKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMK  303

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  304   DSGGELAEVKGGIQECLIQGLNTGTLDLQVNGWGHKAALEGEYKEIYSEKGLGKVQWKPA  363

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N R ATWYK +FD P+G+DP+ ++M  MSKGM++VNG+ +GRYWVS+ T  G P+Q
Sbjct  364   ---ENDRAATWYKRYFDEPDGDDPVVLDMSSMSKGMIFVNGEGVGRYWVSYRTLAGTPSQ  420

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLV+FEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  421   AVYHIPRPFLKSKDNLLVIFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGD  480

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  LTCP  K ++++ FAS+GNP+G+CGNF  G+C  PNA +IVEK CL
Sbjct  481   KIKLIAEDHSRRGTLTCPPEKTIQEVVFASFGNPDGMCGNFTVGTCHTPNAKQIVEKECL  540

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV+ +++  G D+ C     TL VQ +C
Sbjct  541   GKPSCMLPVDHTVY--GADINCQSTTATLGVQVRC  573



>ref|XP_006660363.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like, partial 
[Oryza brachyantha]
Length=829

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/578 (46%), Positives = 364/578 (63%), Gaps = 10/578 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+S  GT  NYYMY GG N G TG++FV   
Sbjct  253   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSVGGTMANYYMYHGGTNLGRTGAAFVMPR  312

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HL+D H AL+LCKK LLWG  +   +   +E   FE  + K
Sbjct  313   YYDEAPLDEFGLYKEPKWGHLKDLHHALRLCKKALLWGNPSSQPLGKLYEARVFEIAEKK  372

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT +  T+ FRG  Y++  +SVSIL DCK ++F+TQH+ +QHN RTF    
Sbjct  373   VCVAFLSNHNTKEDGTVTFRGQKYFVARRSVSILADCKTVVFSTQHVNSQHNQRTFHFAD  432

Query  539   KVAGNLKWEMFQES-IPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   N  WEMF E  IP       ++  P E Y LTK  TDY+W++T   +   D+P R 
Sbjct  433   QTVQNNAWEMFAEGKIPRYKQTTIRTQRPLEQYNLTKDKTDYLWYATSFRLEADDMPFRK  492

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI PVL V S GHA+  F+N  F G  HG  + K F +   + LK G N I  L + L  
Sbjct  493   DIRPVLEVSSHGHAVAAFVNDVFVGVGHGTKINKAFTMEVVMELKVGVNHIAILSTTLGM  552

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA++E R AG  +V +  L TG  D+T N W + +   GE+ +++TE+G     W P
Sbjct  553   MDSGAYLEHRQAGVHTVTIQGLNTGTLDLTTNGWGHLVALNGERRQVYTEQGMGTVAWKP  612

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                  + +  TWY+ HFD P G+DP+ +++  M KG ++VNG+S+GRYWVS+   LG+P+
Sbjct  613   ---GKSAQSLTWYRRHFDAPSGDDPVVIDLTPMGKGNLYVNGESLGRYWVSYRHALGKPS  669

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  Y++PR  L+P  N+L++FEE GG PD+I ++ V RD IC+ ++E  P  V+ WERK 
Sbjct  670   QYLYNVPRLLLRPTGNVLMLFEEEGGRPDAIMILTVKRDNICTFISEKNPAHVRTWERKD  729

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
              +  A   D +P+  L+CP  K +++I FASYGNP G+CGN+  GSC  P + ++VEKAC
Sbjct  730   SQLTAVAGDGRPQAVLSCPPKKTIRQIVFASYGNPLGICGNYTFGSCHAPRSKEVVEKAC  789

Query  1616  LGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             +GK  C + V   ++  G    P+      VQAKC ++
Sbjct  790   VGKKTCSLTVAHDVYGGGAQR-PRT----XVQAKCSKR  822



>ref|XP_004959631.1| PREDICTED: beta-galactosidase 12-like [Setaria italica]
Length=838

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/575 (46%), Positives = 367/575 (64%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  262   TENWTAQFRAYGDQLAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  321

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  L G  +  K+   +E  TFE  +  
Sbjct  322   YYDEAPMDEYGMCKEPKFGHLRDLHNVIRSYQKAFLTGEHSSEKLGHGYEAHTFELPEDN  381

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QH+ R+F  S+
Sbjct  382   LCLSFLSNNNTGEDGTVTFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSE  441

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V + N  WEM+ E IP       ++  P E Y  TK  +DY+W++T   +   DLP R D
Sbjct  442   VTSKNKSWEMYSEQIPKFHKTKVRTKEPLEQYNQTKDASDYLWYTTSFRLESDDLPFRGD  501

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  H+M+ F N  F G   G+   K F+  +PV+LK G N IT L S +   
Sbjct  502   IRPVLQVKSTAHSMVGFANDAFVGSGRGSKQVKGFMFEKPVDLKVGVNHITLLSSAMGMK  561

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  562   DSGGELAEVKGGIQECLIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGMGKVQWKPA  621

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N + ATWYK +FD P+G+DP+ ++M  MSKGM++VNG+ IGRYWVS+ T  G P+Q
Sbjct  622   ---QNDQPATWYKRYFDEPDGDDPVVLDMSSMSKGMIYVNGEGIGRYWVSYRTLDGTPSQ  678

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLVVFEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  679   ALYHIPRPFLKSKDNLLVVFEEEMGKPDGILVQTVTRDDICVLLSEHNPAQIKTWDTDGD  738

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L+CP  K ++++ FAS+GNPEG+CGNF  G+C  PNA ++VEK CL
Sbjct  739   KIKLIAEDHSTRGTLSCPPKKTIQEVVFASFGNPEGMCGNFTVGTCHTPNAKQVVEKECL  798

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PVE +L+  G D+ CP    TL VQ +C
Sbjct  799   GKPSCVLPVEHTLY--GADINCPSTTATLGVQVRC  831



>ref|XP_008668408.1| PREDICTED: uncharacterized protein LOC100383352 isoform X1 [Zea 
mays]
Length=837

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/575 (46%), Positives = 365/575 (63%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  LWG  +   +   +E   FE  + K
Sbjct  321   YYDEAPMDEYGMYKEPKFGHLRDLHNVIRSYQKAFLWGQHSSEILGHGYEAHIFELPEEK  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QH+ R+F  S 
Sbjct  381   LCLSFLSNNNTGEDGTVIFRGDKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSD  440

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V + N +WEMF E+IP       ++  P E Y  TK  TDY+W++T   +   DLP R D
Sbjct  441   VTSKNNQWEMFSETIPKYRDTKVRTKEPLEQYNQTKDDTDYLWYTTSFRLESDDLPFRND  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  HAM+ F N  F G   GN   K F+  +PV+LK G N +  L S +   
Sbjct  501   IRPVLQVKSSAHAMMGFANDAFVGCARGNKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  561   DSGGELAEVKGGIQECLIQGLNTGTLDLQVNGWGHKAALEGEYKEIYSEKGLGKVQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N R ATWYK +FD P+G+DP+ ++M  MSKGM++VNG+ +GRYWVS+ T  G P+Q
Sbjct  621   ---ENDRAATWYKRYFDEPDGDDPVVLDMSSMSKGMIFVNGEGVGRYWVSYRTLAGTPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLV+FEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  678   AVYHIPRPFLKSKDNLLVIFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGD  737

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  LTCP  K ++++ FAS+GNP+G+CGNF  G+C  PNA +IVEK CL
Sbjct  738   KIKLIAEDHSRRGTLTCPPEKTIQEVVFASFGNPDGMCGNFTVGTCHTPNAKQIVEKECL  797

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV+ +++  G D+ C     TL VQ +C
Sbjct  798   GKPSCMLPVDHTVY--GADINCQSTTATLGVQVRC  830



>gb|EEE70132.1| hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
Length=838

 Score =   545 bits (1404),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 258/581 (44%), Positives = 362/581 (62%), Gaps = 7/581 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD   QRSAEDI+++V+RF++K GT VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTAQFRTFGDQLAQRSAEDIAYAVLRFFAKGGTLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  +K   K  LWG  +   +   +E   +E  + K
Sbjct  321   YYDEAPMDEYGMCKEPKFGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDK  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL DCK +++NT+ +  QH+ R+F  + 
Sbjct  381   LCLSFLSNNNTGEDGTVVFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTD  440

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + + N  WEM+ E+IP       ++  P E Y  TK T+DY+W++T   +   DLP R D
Sbjct  441   ETSKNNVWEMYSEAIPKFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRD  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ ++S  HAMI F N  F G   G+   K F+  +P++L+ G N I  L S +   
Sbjct  501   IRPVIQIKSTAHAMIGFANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  ++  L TG  D+  N W +    +GE  +++TE+G  + +W P 
Sbjct  561   DSGGELVEVKGGIQDCVVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAQFQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N    TWYK +FD P+G+DPI V+M  MSKGM++VNG+ IGRYW SF+T  G P+Q
Sbjct  621   ---ENDLPITWYKRYFDEPDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK NLL++FEE  G P  I +  V RD IC  ++E+ P  +K WE  G 
Sbjct  678   SVYHIPRAFLKPKGNLLIIFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGG  737

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  + ++++ FAS+GNPEG CGNF  G+C  P+A  IVEK CL
Sbjct  738   QIKLIAEDTSTRGTLNCPPKRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKECL  797

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGKE  1738
             GK  C +PV  +++  G D+ CP    TLAVQ +C   G +
Sbjct  798   GKESCVLPVVNTVY--GADINCPATTATLAVQVRCKVSGAQ  836



>ref|XP_003576777.1| PREDICTED: beta-galactosidase 12-like [Brachypodium distachyon]
Length=835

 Score =   545 bits (1403),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 259/582 (45%), Positives = 365/582 (63%), Gaps = 7/582 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD    RSAEDI++SV+RF++K GT VNYYMY+GG NFG TG+S+V T 
Sbjct  258   TENWTAQFRAFGDQAAVRSAEDIAYSVLRFFAKGGTLVNYYMYYGGTNFGRTGASYVLTG  317

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG N++PK+ HLRD H+ +K   K  L G  +   +   +E   +E  +  
Sbjct  318   YYDEAPIDEYGLNKEPKFGHLRDLHKLIKSYHKAFLVGKQSFELLGHGYEAHNYELPEEN  377

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AF+SNNNT +  T+ FRG  YY+P++SVSIL DC ++++NT+ +  QH+ R+F  + 
Sbjct  378   LCLAFISNNNTGEDGTVMFRGKKYYIPSRSVSILADCNHVVYNTKRVFVQHSERSFHTAD  437

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +   N  WEM+ E IP       ++  P E Y LTK  +DY+W++T   +   DLP R D
Sbjct  438   ESTKNNVWEMYSEPIPRYKVTSVRTKEPLEQYNLTKDKSDYLWYTTSFRLEADDLPFRRD  497

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ V+S  HAM+ F+N  FAG   G+   K F+  +P++L+ G N +  L S +   
Sbjct  498   IRPVVQVKSSAHAMMGFVNDAFAGSGRGSKKDKGFLFEKPIDLRIGINHLALLSSSMGMK  557

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  ++  L TG  D+  N W + I   GE  +++TE+G    KW P 
Sbjct  558   DSGGELVEVKGGIQDCMIQGLNTGTLDLQGNGWGHKINLDGEDKEIYTEKGMGTVKWKPA  617

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                H     TWY+ +FD P+G+DP+ ++M  MSKGM++VNG+ +GRYW S+ T  G P+Q
Sbjct  618   ENGH---AVTWYRRYFDEPDGDDPVVLDMSSMSKGMIFVNGEGVGRYWTSYKTIAGLPSQ  674

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPRP+LK K NLLVVFEE  G P+ I +  V RD IC  ++E+ P  VK W+  G 
Sbjct  675   SLYHIPRPFLKSKKNLLVVFEEEIGKPEGILIQTVRRDDICFLMSEHNPAQVKTWDADGG  734

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  LTCP  K ++++ FAS+GNPEG CGNF  G+C  PNA + V K CL
Sbjct  735   QIKLIAEDHSSRGILTCPHKKTIEEVVFASFGNPEGACGNFTAGTCHTPNAKEFVAKECL  794

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGKED  1741
             GK  C +P+  +L+  G D+ CP    TLAVQ +C R+GK+D
Sbjct  795   GKKSCVLPLIHTLY--GADINCPTTTATLAVQVRCHRKGKKD  834



>ref|XP_010468659.1| PREDICTED: beta-galactosidase 13-like [Camelina sativa]
Length=827

 Score =   544 bits (1401),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 264/582 (45%), Positives = 366/582 (63%), Gaps = 33/582 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+RVFGDPP QRS                         GG NFG T + +V+T 
Sbjct  274   TENWTTQFRVFGDPPTQRS-------------------------GGTNFGRTSAHYVTTR  308

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG   + + + + EI  +E    K
Sbjct  309   YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTK  368

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             +CAAFL+NNNT     + F+G +Y +P +S+SILPDCK +++NT  I++ H  R +  SK
Sbjct  369   VCAAFLANNNTESAENIKFKGKEYVIPPRSISILPDCKTVVYNTAEIVSHHTARNYMKSK  428

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  +++F E++P+   +   S  P E+Y LTK  TDY W++T   ++  DL     
Sbjct  429   KANKNFDFKVFTETVPS--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKNKG  486

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L + S+GHA+ V++NGE+ G  HG++  K F+  +PV+LK G N ++ L  +  +P
Sbjct  487   GKPTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLSMLGVLTGFP  546

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             +SG++ME RY GP+SV +L L +G  D+T +N W   +G +GE+L +  EEG EK KW  
Sbjct  547   DSGSYMEHRYTGPRSVSILGLSSGPLDLTEQNKWGNKVGMEGERLGIHAEEGLEKVKWQK  606

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             ++G       TWY+T+FD PE     A+ M  M KG++WVNG+ +GRYW+SFL PLGQPT
Sbjct  607   LSGKEPG--LTWYQTYFDAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLPPLGQPT  664

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             Q EYHIPR +LKPK NLLV+FEE     P+ I  ++VNRDT+CS + ENY P V+ W RK
Sbjct  665   QIEYHIPRSFLKPKKNLLVIFEEEANVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRK  724

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              D+ +A TDD++    L C   K +  +EFAS+GNP G CGNF  G+C+ P + ++VEK 
Sbjct  725   NDQVQAITDDVQLTAKLKCSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKY  784

Query  1613  CLGKTECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             CLGK +C +PV KS F +  KD CPK+ K LAVQ KC R  K
Sbjct  785   CLGKAQCAIPVNKSTFQQDKKDSCPKVAKKLAVQVKCGRDKK  826



>ref|XP_010690706.1| PREDICTED: beta-galactosidase 14-like [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   542 bits (1397),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 265/581 (46%), Positives = 377/581 (65%), Gaps = 48/581 (8%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGD P QR+AEDI+FSV R++ K+G++VNYYMY+GG N+G T +SFV+T 
Sbjct  267   TENWTAQYRVFGDAPSQRAAEDIAFSVARWFGKNGSHVNYYMYYGGTNYGRTAASFVTTR  326

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  RDPKW HL+  H+A+ L KKP+L GT  + K   D E   +E  D  
Sbjct  327   YYDEAPIDEFGLVRDPKWGHLKHLHQAILLAKKPILEGTYRIQKNGADFEANFYEKGD--  384

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LCAAFL NN+T +  T+ FRG ++ +P +S+SILPDCK +++NT ++++QH+ R F  S 
Sbjct  385   LCAAFLWNNHTHETKTMRFRGKEHQVPPRSISILPDCKTLVYNTDYMVSQHSAREFVRSE  444

Query  539   KVAGNLKWEMFQESIPTIDTLPAK---SPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
             K   NLKWE   E++P     P K   S  PKE Y  TK  +DY+W+ T + ++  DLP 
Sbjct  445   KAHANLKWEKTTETLPG----PGKGIFSREPKEQYVTTKDQSDYLWYRTSIDLDSSDLPF  500

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             +    PVL V S+GHA++ ++NGE+ G  HG      F     V LK G N+I+ L   +
Sbjct  501   KKSFRPVLQVLSLGHALLAYVNGEYVGTAHGVKREYNFPFSVAVRLKEGLNNISVLGCTV  560

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
               P+SG++MERRY G ++V LL L TGN DI+ N W ++                     
Sbjct  561   GMPDSGSYMERRYTGIRTVELLGLGTGNLDISFNGWHHT---------------------  599

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                              +FD P+G+ P+++ M  M+KGM+W+NG+S+GRYW S+L+ + +
Sbjct  600   ----------------AYFDEPDGDGPLSLRMLNMTKGMMWINGQSLGRYWSSYLSVIEE  643

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             P+Q EYH+PR +LK K+NLLV+F+E GGD +++++  VNRD+ICS + E++P DV  W+R
Sbjct  644   PSQDEYHLPRSFLKSKDNLLVIFDEAGGDINTVQIETVNRDSICSIIDEDWPADVWSWKR  703

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             KG+E     D  + +  L CP  KV+ ++EFAS+GNP GVCG ++ G+C+ PN++KIVE+
Sbjct  704   KGNEIVPEGDTPQVKASLKCPKDKVINRVEFASFGNPIGVCGFYLLGNCTSPNSVKIVEQ  763

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKI-VKTLAVQAKCVRQ  1729
              CLGK  C +PV++ LF + KD C  I  KTLAVQ +C R+
Sbjct  764   NCLGKESCTIPVDRKLFDKDKDPCSNINPKTLAVQLRCGRK  804



>ref|XP_006660050.1| PREDICTED: beta-galactosidase 12-like [Oryza brachyantha]
Length=838

 Score =   541 bits (1395),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 262/577 (45%), Positives = 361/577 (63%), Gaps = 9/577 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD   QRSAEDI+++V+RF++K GT VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTAQFRTFGDQLAQRSAEDIAYAVLRFFAKGGTLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  LWG  +   +   +E   FE  + K
Sbjct  321   YYDEAPMDEYGMCKEPKFGHLRDLHSVIRSYQKAFLWGKQSFEILGHGYEAHNFELPEEK  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AFLSNNNT +  T+ FRG  +Y+P++SVSIL DCK +++NT+ +  QH+ R+F  S 
Sbjct  381   LCLAFLSNNNTGEDGTVVFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTSD  440

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +   N  WEM+ E+IP       ++  P E Y  TK T+DY+W++T   +   DLP R D
Sbjct  441   ESTKNNVWEMYSEAIPKYHKTKLRTKEPMEQYNQTKDTSDYLWYTTSFRLESDDLPFRRD  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ V+S  HAMI F N  F G   G+   K F+  +P++L+ G N I  L S +   
Sbjct  501   IRPVIQVKSTAHAMIGFANDAFVGTGRGSKRDKSFVFEKPMDLRIGVNHIAMLSSSMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  ++  L TG  D+  N W +    +GE  +++TE+G  K +W P 
Sbjct  561   DSGGELVEVKGGIQDCVVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAKFQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N    TWYK +FD P+G+DP+ ++M  MSKGM++VNG+ +GRYW SF T  GQP+Q
Sbjct  621   D---NDLPITWYKRYFDEPDGDDPVVLDMSSMSKGMMFVNGEGLGRYWTSFRTLAGQPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER--K  1432
             + YHIPR +LKPK NLLV+FEE  G P  I V  V RD IC  ++E+ P  +K WE    
Sbjct  678   SVYHIPRAYLKPKGNLLVIFEEELGKPGGILVQTVRRDDICVFISEHNPAQIKTWESDGA  737

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
             G + +   +D   R  L CP  + ++++ FAS+GNPEG CGNF  G+C  P+A  IVEK 
Sbjct  738   GGQIKLIAEDHSTRGTLACPPDRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKE  797

Query  1613  CLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             CLGK  C +PV  +++  G D+ CP    TLAVQA+C
Sbjct  798   CLGKDSCVLPVVHTVY--GADINCPATTATLAVQARC  832



>gb|EEC84965.1| hypothetical protein OsI_32205 [Oryza sativa Indica Group]
Length=807

 Score =   539 bits (1389),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 256/581 (44%), Positives = 361/581 (62%), Gaps = 7/581 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD   QRSAEDI+++V+RF++K GT VNYYMY GG NFG TG+S+V T 
Sbjct  230   TENWTAQFRTFGDQLAQRSAEDIAYAVLRFFAKGGTLVNYYMYHGGTNFGRTGASYVLTG  289

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  +K   K  LWG  +   +   +E   +E  + K
Sbjct  290   YYDEAPMDEYGMCKEPKFGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDK  349

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL DCK +++NT+ +  QH+ R+F  + 
Sbjct  350   LCLSFLSNNNTGEDGTVVFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTD  409

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + + N  WEM+ E+IP       ++  P E Y  TK T+DY+W++T   +   DLP R D
Sbjct  410   ETSKNNVWEMYSEAIPKFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRD  469

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ ++S  HAMI F N  F G   G+   K F+  +P++L+ G N I  L S +   
Sbjct  470   IRPVIQIKSTAHAMIGFANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMK  529

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  ++  L TG  D+  N   +    +GE  +++TE+G  + +W P 
Sbjct  530   DSGGELVEVKGGIQDCVVQGLNTGTLDLQGNGRGHKARLEGEDKEIYTEKGMAQFQWKPA  589

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N    TWYK +FD P+G+DPI V+M  MSKGM++VNG+ IGRYW SF+T  G P+Q
Sbjct  590   ---ENDLPITWYKRYFDEPDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQ  646

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK NLL++FEE  G P  I +  V RD IC  ++E+ P  +K WE  G 
Sbjct  647   SVYHIPRAFLKPKGNLLIIFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGG  706

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  + ++++ FAS+GNPEG CGNF  G+C  P+A  +VEK CL
Sbjct  707   QIKLIAEDTSTRGTLNCPPQRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAVVEKECL  766

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQGKE  1738
             GK  C +PV  +++  G D+ CP    TLAVQ +C   G +
Sbjct  767   GKESCVLPVVNTVY--GADINCPATTATLAVQVRCKVSGAQ  805



>ref|NP_001062440.1| Os08g0549200 [Oryza sativa Japonica Group]
 sp|Q6ZJJ0.1|BGA11_ORYSJ RecName: Full=Beta-galactosidase 11; AltName: Full=Lactase 115; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD08952.1| putative glycosyl hydrolase family 35 (beta-galactosidase) [Oryza 
sativa Japonica Group]
 dbj|BAF24354.1| Os08g0549200 [Oryza sativa Japonica Group]
Length=848

 Score =   540 bits (1391),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 261/586 (45%), Positives = 363/586 (62%), Gaps = 15/586 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+S  GT  NYYMY GG NFG  G++FV   
Sbjct  259   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSVGGTMANYYMYHGGTNFGRNGAAFVMPR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H AL+ CKK LLWG  ++  +   +E   FE  +  
Sbjct  319   YYDEAPLDEFGLYKEPKWGHLRDLHHALRHCKKALLWGNPSVQPLGKLYEARVFEMKEKN  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT +  T+ FRG  Y++  +S+SIL DCK ++F+TQH+ +QHN RTF    
Sbjct  379   VCVAFLSNHNTKEDGTVTFRGQKYFVARRSISILADCKTVVFSTQHVNSQHNQRTFHFAD  438

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   +  WEM+ +E IP       ++  P E Y  TK  TDY+W++T   +   DLP R 
Sbjct  439   QTVQDNVWEMYSEEKIPRYSKTSIRTQRPLEQYNQTKDKTDYLWYTTSFRLETDDLPYRK  498

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             ++ PVL V S GHA++ F+N  F G  HG  + K F + + ++LK G N +  L S L  
Sbjct  499   EVKPVLEVSSHGHAIVAFVNDAFVGCGHGTKINKAFTMEKAMDLKVGVNHVAILSSTLGL  558

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SG+++E R AG  +V +  L TG  D+T N W + +G  GE+ ++ +E+G     W P
Sbjct  559   MDSGSYLEHRMAGVYTVTIRGLNTGTLDLTTNGWGHVVGLDGERRRVHSEQGMGAVAWKP  618

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                N   +  TWY+  FD P G DP+ +++  M KG ++VNG+ +GRYWVS+   LG+P+
Sbjct  619   GKDN---QPLTWYRRRFDPPSGTDPVVIDLTPMGKGFLFVNGEGLGRYWVSYHHALGKPS  675

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVK-IWERK  1432
             Q  YH+PR  L+PK N L+ FEE GG PD+I ++ V RD IC+ + E  P  V+  WE K
Sbjct  676   QYLYHVPRSLLRPKGNTLMFFEEEGGKPDAIMILTVKRDNICTFMTEKNPAHVRWSWESK  735

Query  1433  GDEFR------ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               + +      A    LKP   L+CP  K ++ + FASYGNP G+CGN+  GSC  P   
Sbjct  736   DSQPKAVAGAGAGAGGLKPTAVLSCPTKKTIQSVVFASYGNPLGICGNYTVGSCHAPRTK  795

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             ++VEKAC+G+  C + V   ++  G D+ CP    TLAVQAKC ++
Sbjct  796   EVVEKACIGRKTCSLVVSSEVY--GGDVHCPGTTGTLAVQAKCSKR  839



>dbj|BAK06282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=846

 Score =   540 bits (1390),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 259/575 (45%), Positives = 360/575 (63%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD    RSAEDI++SV+RF++K GT VNYYMY+GG NFG TG+S+V T 
Sbjct  269   TENWTAQFRAFGDQLALRSAEDIAYSVLRFFAKGGTLVNYYMYYGGTNFGRTGASYVLTG  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDEGP+D YG  + PK+ HLRD H  +K   +  L G  +   +   +E   FE  + K
Sbjct  329   YYDEGPVDEYGMPKAPKYGHLRDLHNLIKSYSRAFLEGKQSFELLAHGYEAHNFEIPEEK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AF+SNNNT +  T+NFRG  YY+P++SVSIL DCK++++NT+ +  QH+ R+F  + 
Sbjct  389   LCLAFISNNNTGEDGTVNFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHTAQ  448

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K+A +  WEM+ E IP       ++  P E Y LTK  +DY+W++T   +   DLP R D
Sbjct  449   KLAKSNAWEMYSEPIPRYKLTSIRNKEPMEQYNLTKDDSDYLWYTTSFRLEADDLPFRGD  508

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ V+S  HA++ F+N  FAG   G+   K F+   P+NL+ G N +  L S +   
Sbjct  509   IRPVVQVKSTSHALMGFVNDAFAGNGRGSKKEKGFMFETPINLRIGINHLALLSSSMGMK  568

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +   +  L TG  D+  N W + +  +GE  +++TE+G    KW P 
Sbjct  569   DSGGELVEVKGGIQDCTIQGLNTGTLDLQVNGWGHKVKLEGEVKEIYTEKGMGAVKWVPA  628

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
             T     R  TWYK +FD P+G DP+ ++M  M KGM++VNG+ +GRYW S+ T  G P+Q
Sbjct  629   T---TGRAVTWYKRYFDEPDGEDPVVLDMTSMGKGMIFVNGEGMGRYWPSYRTVGGVPSQ  685

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LKPKNNLLV+FEE  G P+ I +  V RD IC  ++E+ P  +K W++ G 
Sbjct  686   AMYHIPRPFLKPKNNLLVIFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKTWDKDGG  745

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  K ++++ FAS+GNPEG C NF  GSC  PNA  IV K CL
Sbjct  746   QIKVIAEDHSTRGILKCPPKKTIQEVVFASFGNPEGSCANFTAGSCHTPNAKDIVAKECL  805

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV  +++  G D+ CP    TLAVQ +C
Sbjct  806   GKKSCVLPVLHTVY--GADINCPTTTATLAVQVRC  838



>gb|EEE69115.1| hypothetical protein OsJ_28192 [Oryza sativa Japonica Group]
Length=848

 Score =   538 bits (1385),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/586 (44%), Positives = 361/586 (62%), Gaps = 15/586 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+S  GT  NYYMY GG NFG  G++FV   
Sbjct  259   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSVGGTMANYYMYHGGTNFGRNGAAFVMPR  318

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P D +G  ++PKW HLRD H AL+ CKK LLWG  ++  +   +E   FE  +  
Sbjct  319   YYDEAPFDEFGLYKEPKWGHLRDLHHALRHCKKALLWGNPSVQPLGKLYEARVFEMKEKN  378

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT +  T+ FRG  Y++  +S+SIL DCK ++F+TQH+ +QHN RTF    
Sbjct  379   VCVAFLSNHNTKEDGTVTFRGQKYFVARRSISILADCKTVVFSTQHVNSQHNQRTFHFAD  438

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   +  WEM+ +E IP       ++  P E Y  TK  TDY+W++T   +   DLP R 
Sbjct  439   QTVQDNVWEMYSEEKIPRYSKTSIRTQRPLEQYNQTKDKTDYLWYTTSFRLETDDLPYRK  498

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             ++ PVL V S GHA++ F+N  F G  HG  + K F + + ++LK G N +  L S L  
Sbjct  499   EVKPVLEVSSHGHAIVAFVNDAFVGCGHGTKINKAFTMEKAMDLKVGVNHVAILSSTLGL  558

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SG+++E R AG  +V +  L TG  D+T N W + +G  GE+ ++ +E+G     W P
Sbjct  559   MDSGSYLEHRMAGVYTVTIRGLNTGTLDLTTNGWGHVVGLDGERRRVHSEQGMGAVAWKP  618

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                N   +  TWY+  FD P G DP+ +++  M KG ++VNG+ +GRYWVS+   LG+P+
Sbjct  619   GKDN---QPLTWYRRRFDPPSGTDPVVIDLTPMGKGFLFVNGEGLGRYWVSYHHALGKPS  675

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVK-IWERK  1432
             Q  YH+PR  L+PK N L+ FEE GG PD+I ++ V RD IC+ + E  P  V+  WE K
Sbjct  676   QYLYHVPRSLLRPKGNTLMFFEEEGGKPDAIMILTVKRDNICTFMTEKNPAHVRWSWESK  735

Query  1433  GDEFR------ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               + +      A     KP   L+CP  K ++ + FASYGNP G+CGN+  GSC  P   
Sbjct  736   DSQPKAVAGAGAGAGGFKPTAVLSCPTKKTIQSVVFASYGNPLGICGNYTVGSCHAPRTK  795

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             ++VEKAC+G+  C + V   ++  G D+ CP    TLAVQAKC ++
Sbjct  796   EVVEKACIGRKTCSLVVSSEVY--GGDVHCPGTTGTLAVQAKCSKR  839



>sp|Q0IZZ8.2|BGA12_ORYSJ RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=911

 Score =   539 bits (1389),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 260/587 (44%), Positives = 362/587 (62%), Gaps = 17/587 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FGD   QRSAEDI+++V+RF++K GT VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTAQFRTFGDQLAQRSAEDIAYAVLRFFAKGGTLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  +K   K  LWG  +   +   +E   +E  + K
Sbjct  321   YYDEAPMDEYGMCKEPKFGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDK  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL DCK +++NT+ +  QH+ R+F  + 
Sbjct  381   LCLSFLSNNNTGEDGTVVFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTD  440

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + + N  WEM+ E+IP       ++  P E Y  TK T+DY+W++T   +   DLP R D
Sbjct  441   ETSKNNVWEMYSEAIPKFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRD  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ ++S  HAMI F N  F G   G+   K F+  +P++L+ G N I  L S +   
Sbjct  501   IRPVIQIKSTAHAMIGFANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +  ++  L TG  D+  N W +    +GE  +++TE+G  + +W P 
Sbjct  561   DSGGELVEVKGGIQDCVVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAQFQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N    TWYK +FD P+G+DPI V+M  MSKGM++VNG+ IGRYW SF+T  G P+Q
Sbjct  621   ---ENDLPITWYKRYFDEPDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKPK NLL++FEE  G P  I +  V RD IC  ++E+ P  +K WE  G 
Sbjct  678   SVYHIPRAFLKPKGNLLIIFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGG  737

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  + ++++ FAS+GNPEG CGNF  G+C  P+A  IVEK CL
Sbjct  738   QIKLIAEDTSTRGTLNCPPKRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKECL  797

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQ----------AKCVR  1726
             GK  C +PV  +++  G D+ CP    TLAVQ          A CVR
Sbjct  798   GKESCVLPVVNTVY--GADINCPATTATLAVQLLLASHVMRIAICVR  842



>ref|XP_008653570.1| PREDICTED: beta-galactosidase 12-like [Zea mays]
 tpg|DAA64335.1| TPA: hypothetical protein ZEAMMB73_578897 [Zea mays]
Length=837

 Score =   536 bits (1382),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 255/575 (44%), Positives = 361/575 (63%), Gaps = 7/575 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  L G  +   +   +E   FE  +  
Sbjct  321   YYDEAPMDEYGMYKEPKFGHLRDLHNVIRSYQKAFLLGKHSSEILGHGYEAHIFELPEEN  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QHN R++  S+
Sbjct  381   LCLSFLSNNNTGEDGTVIFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHNERSYHTSE  440

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V + N +WEM+ E IP       +   P E +  TK  +DY+W++T   +   DLP R D
Sbjct  441   VTSKNNQWEMYSEKIPKYRDTKVRMKEPLEQFNQTKDASDYLWYTTSFRLESDDLPFRND  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  H+M+ F N  F G   G+   K F+  +PV+LK G N +  L S +   
Sbjct  501   IRPVLQVKSSAHSMMGFANDAFVGCARGSKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +    +G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  561   DSGGELAEVKSGIQECLIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGVGKVQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N R ATWYK +FD P+G+DP+ ++M  M KGM++VNG+ +GRYWVS+ T  G P+Q
Sbjct  621   ---ENGRAATWYKRYFDEPDGDDPVVLDMSSMDKGMIFVNGEGVGRYWVSYRTLAGTPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLVVFEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  678   ALYHIPRPFLKSKDNLLVVFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGD  737

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  K ++++ FAS+GNPEG+CGNF  G+C  PNA +IVEK CL
Sbjct  738   KIKLIAEDHSRRGTLMCPPEKTIQEVVFASFGNPEGMCGNFTVGTCHTPNAKQIVEKECL  797

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV+ +++  G D+ C     TL VQ +C
Sbjct  798   GKPSCMLPVDHTVY--GADINCQSTTATLGVQVRC  830



>emb|CAG30731.1| beta-galactosidase precursor [Triticum monococcum]
Length=839

 Score =   528 bits (1360),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 255/579 (44%), Positives = 358/579 (62%), Gaps = 7/579 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FG+   QRSAEDI++SV+RF++K GT VNYYMY+GG NFG TG+S+V T 
Sbjct  263   TENWTAQFRAFGNDLAQRSAEDIAYSVLRFFAKGGTLVNYYMYYGGTNFGRTGASYVLTG  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDEGP+D YG  + PK+ HLRD H  +K   +  L G  +   +   +E   FE  + K
Sbjct  323   YYDEGPIDEYGMPKAPKYGHLRDLHNVIKSYSRAFLEGKQSFELLGQGYEARNFEIPEEK  382

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AF+SNNNT +  T+ FRG  YY+P++SVSIL DCK++++NT+ +  QH+ R+F  + 
Sbjct  383   LCLAFISNNNTGEDGTVIFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHKAE  442

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   N  WEMF E IP       ++  P E Y  TK  +DY+W++T   +   DLP+R D
Sbjct  443   KATKNNVWEMFSELIPRYKQTTIRNKEPLEQYNQTKDQSDYLWYTTSFRLEADDLPIRGD  502

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ V+S  HAM+ F+N  FAG  HG+   K F    P++L+ G N +  L S +   
Sbjct  503   IRPVIAVKSTAHAMVGFVNDAFAGNGHGSKKEKFFTFETPISLRLGVNHLALLSSSMGMK  562

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +   +  L TG  D+  N W +    +GE  +++TE+G    KW P 
Sbjct  563   DSGGELVELKGGIQDCTIQGLNTGTLDLQINGWGHKAKLEGEVKEIYTEKGMGAVKWVPA  622

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 + +  TWYK +FD P+G+DP+ ++M  M KGM++VNG+ +GRYW S+ TP    +Q
Sbjct  623   V---SGQAVTWYKRYFDEPDGDDPVVLDMTSMCKGMIFVNGEGMGRYWTSYKTPGKVASQ  679

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPR +LK KNNLLVVFEE  G P+ I +  V RD IC  ++E+ P  +K W+  G 
Sbjct  680   AVYHIPRTFLKSKNNLLVVFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKPWDEHGG  739

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  K+++++ FAS+GNP G C NF  G+C  PNA +IVEK CL
Sbjct  740   QIKLIAEDHNTRGFLNCPPKKIIQEVVFASFGNPVGSCANFTVGTCHTPNAKEIVEKECL  799

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQG  1732
             GK  C +PV  + +  G D+ CP    TLAVQ +C ++G
Sbjct  800   GKKGCVLPVLHTFY--GADINCPTTTATLAVQVRCHKKG  836



>emb|CAG30724.1| putative beta-galactosidase precursor [Hordeum vulgare]
Length=833

 Score =   513 bits (1321),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 255/576 (44%), Positives = 355/576 (62%), Gaps = 13/576 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYM-YFGGNNFGMTGSSFVST  178
             TENWTAQ+R FGD    RSAEDI++SV+RF++K GT VNYYM Y+GG NFG TG+S+V T
Sbjct  260   TENWTAQFRAFGDQLALRSAEDIAYSVLRFFAKGGTLVNYYMQYYGGTNFGRTGASYVLT  319

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYDEGP+D     + PK+ HLRD H  +K   +  L G  +   +   +E   FE  + 
Sbjct  320   GYYDEGPVD-ECMPKAPKYGHLRDLHNLIKSYSRAFLEGKQSFELLAHGYEAHNFEIPEE  378

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             KLC AF+SNNNT +  T+NFRG  YY+P++SVSIL DCK++++NT+ +  QH+ R+F  +
Sbjct  379   KLCLAFISNNNTGEDGTVNFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHTA  438

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K+A +  WEM+ E IP       ++  P E Y LTK  +DY+ F     +   DLP R 
Sbjct  439   QKLAKSNAWEMYSEPIPRYKLTSIRNKEPMEQYNLTKDDSDYLCFR----LEADDLPFRG  494

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI PV+ V+S  HA++ F+N  FAG   G+   K F+   P+NL+ G N +  L S +  
Sbjct  495   DIRPVVQVKSTSHALMGFVNDAFAGNGRGSKKEKGFMFETPINLRIGINHLALLSSSMGM  554

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SG  +     G +   +  L TG  D+  N W + +  +GE  +++TE+G    KW P
Sbjct  555   KDSGGELVEVKGGIQDCTIQGLNTGTLDLQVNGWGHKVKLEGEVKEIYTEKGMGAVKWVP  614

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              T     R  TWYK +FD P+G DP+ ++M  M KGM++VNG+ +GRYW S+ T  G P+
Sbjct  615   AT---TGRAVTWYKRYFDEPDGEDPVVLDMTSMGKGMIFVNGEGMGRYWPSYRTVGGVPS  671

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YHIPRP+LKPKNNLLV+FEE  G P+ I +  V RD IC  ++E+ P  +K W++ G
Sbjct  672   QAMYHIPRPFLKPKNNLLVIFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKTWDKDG  731

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
              + +   +D   R  L CP  K ++++ FAS+GNPEG C NF  G+C  PNA  IV K C
Sbjct  732   GQIKLIAEDHSTRGILKCPPKKTIQEVVFASFGNPEGSCANFTAGTCHTPNAKDIVAKEC  791

Query  1616  LGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             LGK  C +PV  +++  G D+ CP    TLAVQ +C
Sbjct  792   LGKKSCVLPVLHTVY--GADINCPTTTATLAVQVRC  825



>tpg|DAA64336.1| TPA: hypothetical protein ZEAMMB73_578897 [Zea mays]
Length=822

 Score =   508 bits (1308),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/575 (43%), Positives = 350/575 (61%), Gaps = 22/575 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT Q+R +GD    RSAEDI+++V+RF++K G+ VNYYMY GG NFG TG+S+V T 
Sbjct  261   TENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTG  320

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE PMD YG  ++PK+ HLRD H  ++  +K  L G  +   +   +E   FE  +  
Sbjct  321   YYDEAPMDEYGMYKEPKFGHLRDLHNVIRSYQKAFLLGKHSSEILGHGYEAHIFELPEEN  380

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LC +FLSNNNT +  T+ FRG  +Y+P++SVSIL  CKN+++NT+ +  QHN R++  S+
Sbjct  381   LCLSFLSNNNTGEDGTVIFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHNERSYHTSE  440

Query  542   V-AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             V + N +WEM+ E IP       +   P E +  TK  +DY+W++T   +   DLP R D
Sbjct  441   VTSKNNQWEMYSEKIPKYRDTKVRMKEPLEQFNQTKDASDYLWYTTSFRLESDDLPFRND  500

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V+S  H+M+ F N  F G   G+   K F+  +PV+LK G N +  L S +   
Sbjct  501   IRPVLQVKSSAHSMMGFANDAFVGCARGSKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMK  560

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +    +G +  L+  L TG  D+  N W +    +GE  ++++E+G  K +W P 
Sbjct  561   DSGGELAEVKSGIQECLIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGVGKVQWKPA  620

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 N R ATWYK +FD P+G+DP+ ++M  M KGM++VNG+ +GRYWVS+ T  G P+Q
Sbjct  621   ---ENGRAATWYKRYFDEPDGDDPVVLDMSSMDKGMIFVNGEGVGRYWVSYRTLAGTPSQ  677

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
               YHIPRP+LK K+NLLVVFEE  G PD I V  V RD IC  ++E+ P  +K W+  GD
Sbjct  678   ALYHIPRPFLKSKDNLLVVFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGD  737

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
             + +   +D   R  L CP  K ++++ FAS+GNPEG+CGNF                 CL
Sbjct  738   KIKLIAEDHSRRGTLMCPPEKTIQEVVFASFGNPEGMCGNFT---------------ECL  782

Query  1619  GKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKC  1720
             GK  C +PV+ +++  G D+ C     TL VQ +C
Sbjct  783   GKPSCMLPVDHTVY--GADINCQSTTATLGVQVRC  815



>ref|XP_004489161.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=450

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 211/440 (48%), Positives = 298/440 (68%), Gaps = 4/440 (1%)
 Frame = +2

Query  407   TLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSKVAGNLKWEMFQESIP  586
             T+ FRG++YYLP +S+SILPDCK ++FNTQ+I +QHN R F  SK A N KWE+F E IP
Sbjct  4     TIQFRGSNYYLPPRSISILPDCKTVVFNTQNIASQHNSRNFKQSKNANNHKWEVFTEPIP  63

Query  587   TIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPVLFVESMGHAMIV  766
             T   LP     P E+Y++ K TTDY W++T V +   DLP + +I PVL + S+GH+++ 
Sbjct  64    TTKELPPSKKIPAELYSMLKDTTDYGWYTTSVELGPEDLPKKNEISPVLRIMSLGHSLLA  123

Query  767   FINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKSV  946
             F+NGE+ G NHG++  K F   +PV+ K G N I  L S++  P+SGA+ME RYAGPK++
Sbjct  124   FVNGEYIGPNHGSHEDKGFEFQKPVSFKVGVNQIAILGSLVGLPDSGAYMEHRYAGPKTI  183

Query  947   LLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHF  1126
              +L L +G   +T N W + +   GEK  +FTEEG++K +W  V G  +    +WY T+F
Sbjct  184   TILGLNSGTIGLTLNGWGHQVDLYGEKHSIFTEEGSKKVQWKEVKG--HGPPLSWYNTNF  241

Query  1127  DLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWL--KPKN  1300
             + PEG  P+A+ M+ M KGM+W+NG+S+GR+W+S+L+PLG+PTQ+EYHIPR +   K KN
Sbjct  242   ETPEGKGPVAIKMDGMGKGMIWINGESVGRHWLSYLSPLGKPTQSEYHIPRAFFNAKSKN  301

Query  1301  NLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMH  1480
             NLLV+ EE    P+ + ++ VNRDT+CS + EN+PP+V  W  K  +     D+L P+  
Sbjct  302   NLLVILEEEAASPEKVVILNVNRDTVCSYITENHPPNVNSWASKDQKLTPIVDNLGPQAS  361

Query  1481  LTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLF  1660
             L CP  K +  ++FASYG+P G CG F+ G C  P + KIVE+ CLGK  C VP+ K+ F
Sbjct  362   LKCPHHKTIIAVDFASYGDPLGFCGEFIMGKCHAPASKKIVEQHCLGKESCSVPLNKASF  421

Query  1661  VEGKDLCPKIVKTLAVQAKC  1720
               G D CP ++KTLA+Q +C
Sbjct  422   TNGHDDCPDVMKTLAIQVQC  441



>emb|CDY02241.1| BnaA03g39260D [Brassica napus]
Length=989

 Score =   484 bits (1245),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 330/517 (64%), Gaps = 9/517 (2%)
 Frame = +2

Query  197   PMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLKLCAAF  376
             P+D YG  ++PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K+CAAF
Sbjct  477   PLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTKVCAAF  536

Query  377   LSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSKVAGN-  553
             L+NNNT     + FRG DY +P +S+SILPDCK ++++T  I++ H  R F  SK A   
Sbjct  537   LANNNTESAEIIKFRGKDYVIPPRSISILPDCKTVVYSTGEIVSHHTARNFMKSKKANKK  596

Query  554   LKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPVL  733
               +++F E++P    L   S  P E+Y L K  +DY W++T   ++  DL  +    P +
Sbjct  597   FDFKVFTETVP--QELKGDSYVPVELYGLAKDESDYGWYTTNFKIDDSDLKKKGG-KPTV  653

Query  734   FVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAW  913
              V S+GHA+  ++NGE+ G  HG++  K F+  +P+ LK G N +T L  +  +P+SG++
Sbjct  654   RVASLGHALHAWLNGEYLGNGHGSHDEKSFVFQKPIALKEGDNHLTMLGVLTGFPDSGSY  713

Query  914   MERRYAGPKSVLLLALMTGNQDIT-KNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNH  1090
             +E R+ GP+SV +  L +G  D+T K+ W   +G +GEKL + TE+G +K KW   +G  
Sbjct  714   LEHRFTGPRSVSISGLSSGPMDLTEKSKWGNKVGMEGEKLDIHTEKGLKKVKWEKFSGK-  772

Query  1091  NTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYH  1270
                  TWY+T+FD PE   P A+ M  M KG++WVNG+ +GRYW+SFL+PLG+ TQ EYH
Sbjct  773   -APGLTWYQTYFDAPESLSPAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGKSTQIEYH  831

Query  1271  IPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDEFR  1447
             IPR +LKPK NLLV+FEE    +P+ I  ++VNRDT+CS + E+Y P V+ W RK D  +
Sbjct  832   IPRSFLKPKKNLLVIFEEEPNVNPELIDFVIVNRDTVCSYIGEDYTPSVRHWARKNDNVQ  891

Query  1448  ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKT  1627
             A TDD++   +L C   K +  +EFAS+GNP G CGNF  GSC  P   ++VEK CLGK 
Sbjct  892   AITDDVQLTANLKCSGTKKISAVEFASFGNPTGSCGNFTRGSCHAPVTKQVVEKYCLGKA  951

Query  1628  ECEVPVEKSLFVEG-KDLCPKIVKTLAVQAKCVRQGK  1735
             EC +PV KS F E  KD CPK+VKTLAVQ KC R  K
Sbjct  952   ECVIPVNKSTFQEDKKDSCPKVVKTLAVQVKCGRPKK  988


 Score =   219 bits (558),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 143/219 (65%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
            TENWT Q+RV+GDPP QRS EDI+FSV RF+SK+G++VNYYMY GG NFG T + +V+T 
Sbjct  269  TENWTTQFRVYGDPPVQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTR  328

Query  182  YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
            YYD+ P+D YG  ++PK+ HL+  H AL LCKK LLWG +   K   D EI  +E    K
Sbjct  329  YYDDAPLDEYGLEKEPKYGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTK  388

Query  362  LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF----  529
            +CAAFL+NNNT     + FRG +Y +P +S+SILPDCK ++++T  I++ H  R +    
Sbjct  389  VCAAFLANNNTESAEIIKFRGKEYVIPPRSISILPDCKAVVYSTGEIVSHHTARNYMKSK  448

Query  530  DPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTK  646
              +K      +++F E++P    L   S  P + Y L K
Sbjct  449  KANKANKKFDFKVFTETVP--QELKGDSYVPLDEYGLEK  485



>gb|EEC83995.1| hypothetical protein OsI_30162 [Oryza sativa Indica Group]
Length=1078

 Score =   482 bits (1241),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 245/586 (42%), Positives = 338/586 (58%), Gaps = 54/586 (9%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+FSV RF+S  GT  NYYMY GG NFG  G++FV   
Sbjct  528   TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSVGGTMANYYMYHGGTNFGRNGAAFVMPR  587

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H AL+ CKK LLWG  ++  +   +E   FE  +  
Sbjct  588   YYDEAPLDEFGLYKEPKWGHLRDLHHALRHCKKALLWGNPSVQPLGKLYEARVFEMKEKN  647

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT +  T+ FRG  Y++  +S+SIL DCK ++F+TQH+ +QHN RTF    
Sbjct  648   VCVAFLSNHNTKEDGTVTFRGQKYFVARRSISILADCKTVVFSTQHVNSQHNQRTFHFAD  707

Query  539   KVAGNLKWEMF-QESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   +  WEM+ +E IP       ++  P E Y  TK  TDY+W++T   +   DLP R 
Sbjct  708   QTVQDNVWEMYSEEKIPRYSKTSIRTQRPLEQYNQTKDKTDYLWYTTSFRLETDDLPYRK  767

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             ++ PVL                  G   G    + F + + ++LK G N +  L S L  
Sbjct  768   EVKPVL-----------------EGAGTGRRSTRSFTMEKAMDLKVGVNHVAILSSTLGL  810

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SG+++E R AG  +V +  L TG  D+T N W +  G   + L               
Sbjct  811   MDSGSYLEHRMAGVYTVTIRGLNTGTLDLTTNGWGHVPGKDNQPL---------------  855

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                       TWY+  FD P G DP+ +++  M KG ++VNG+ +GRYWVS+   LG+P+
Sbjct  856   ----------TWYRRRFDPPSGTDPVVIDLTPMGKGFLFVNGEGLGRYWVSYHHALGKPS  905

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVK-IWERK  1432
             Q  YH+PR  L+PK N L+ FEE GG PD+I ++ V RD IC+ + E  P  V+  WE K
Sbjct  906   QYLYHVPRSLLRPKGNTLMFFEEEGGKPDAIMILTVKRDNICTFMTEKNPAHVRWSWESK  965

Query  1433  GDEFR------ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               + +      A    LKP   L+CP  K ++ + FASYGNP G+CGN+  GSC  P   
Sbjct  966   DSQPKAVAGAGAGAGGLKPTAVLSCPTKKTIQSVVFASYGNPLGICGNYTVGSCHAPRTK  1025

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQ  1729
             ++VEKAC+G+  C + V   ++  G D+ CP    TLAVQAKC ++
Sbjct  1026  EVVEKACIGRKTCSLVVSSEVY--GGDVHCPGTTGTLAVQAKCSKR  1069


 Score =   147 bits (372),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 99/201 (49%), Gaps = 64/201 (32%)
 Frame = +2

Query  2    TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYM------------------  127
            TENWTAQYRVFGDPP QRSAEDI+FSV RF+S  GT  NYYM                  
Sbjct  260  TENWTAQYRVFGDPPSQRSAEDIAFSVARFFSVGGTMANYYMVVLNSNSNLFLTKKRDEI  319

Query  128  ----------------YFGGNNFGMTGSSFVSTAYYDEGPMDIYGFNRDPKWSHLRDTHR  259
                            Y GG NFG  G++FV   YYDE P+D +G  ++PKW HLRD H 
Sbjct  320  SDRTDTGGFTCVNNQQYHGGTNFGRNGAAFVMPRYYDEAPLDEFGLYKEPKWGHLRDLHH  379

Query  260  ALKLCKKPLLWGTANLNKINGDHEITTFENTDLKLCAAFLSNNNTLKPTTLNFRGTDYYL  439
            AL+ CKK LLWG                              N +++P     RG  Y++
Sbjct  380  ALRHCKKALLWG------------------------------NPSVQPLGKLTRGQKYFV  409

Query  440  PAKSVSILPDCKNMIFNTQHI  502
              +S+SIL DCK + +  Q +
Sbjct  410  ARRSISILADCKTVKYMKQFV  430



>ref|XP_006434247.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
 gb|ESR47487.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
Length=802

 Score =   473 bits (1218),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 245/578 (42%), Positives = 343/578 (59%), Gaps = 23/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TE+WT+ Y+V+G  P  RSA+DI+F V  F +K+G+YVNYYMY GG NFG T ++F+ T 
Sbjct  242   TEDWTSFYQVWGGKPYIRSAQDIAFHVALFIAKNGSYVNYYMYHGGTNFGRTAAAFMITG  301

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PKW HL++ H A+KLC +PLL GT N+  +    E   FE T   
Sbjct  302   YYDQAPLDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVIPLGQLQEAYVFEETS-G  360

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL NN+  K  T+ FR   Y LP KS+SILPDCK + FNT+ +  Q+N R+   + 
Sbjct  361   VCAAFLVNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNL  420

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   + KWE ++E+IP  D    ++    +  +  K  +DY+W++ R   N  +     D
Sbjct  421   KFDSDEKWEEYREAIPNFDNTLLRAEGLLDQISAAKDASDYLWYTFRFHYNSSNAQAPLD  480

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                   V+S GH +  F+NGE+ G  HG++    F L   V+L+ GT+D   L   +  P
Sbjct  481   ------VQSHGHILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTSDGALLSVTVGLP  534

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ER+ AG   V +      ++  T  SW Y +G  GEKL++++  G  K  W  +
Sbjct  535   DSGAFLERKVAGVHRVRVQ-----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSI  589

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                  TR+ TWYKT F  P GNDPIA+N++ M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  590   RS--PTRQLTWYKTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQ  647

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T+YH+PR +LKP  NLLV+ EE  G+P  I V  +    +C  V  ++ P +  W R   
Sbjct  648   TQYHVPRAFLKPTGNLLVLLEEENGNPLGITVDTIAITKVCGHVTNSHLPPLSSWLRHRQ  707

Query  1439  EFRATTD----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
               R  TD      KP + L+CP  K + KI FAS+GNP+G C  +  GSC   ++  +VE
Sbjct  708   --RGDTDIKKFGKKPTVQLSCPLGKKISKIVFASFGNPDGDCERYAGGSCHSSHSQGVVE  765

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             +AC+GK+ C +P+    F  G D CP I K L V A+C
Sbjct  766   RACIGKSRCSIPLLSRYF--GGDPCPGIHKALLVDAQC  801



>ref|XP_007019136.1| Beta-galactosidase isoform 1 [Theobroma cacao]
 gb|EOY16361.1| Beta-galactosidase isoform 1 [Theobroma cacao]
Length=817

 Score =   473 bits (1216),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 247/577 (43%), Positives = 341/577 (59%), Gaps = 15/577 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+V+GD    RSAEDI+F V  F +K G+YVNYYMY GG NFG   ++++ T 
Sbjct  251   TENWTSFYQVYGDDVDIRSAEDIAFHVALFIAKKGSYVNYYMYHGGTNFGRNAAAYMLTG  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC KPL+ G      +    +   +    + 
Sbjct  311   YYDQAPLDEYGLFRQPKWGHLKELHAAIKLCSKPLISGVYTTMALGRSQQAFVYRGNSVD  370

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL NN+T K   + F  + Y LP KS+SILPDCK   FNT  +  Q+N R  +  +
Sbjct  371   -CAAFLVNNDTRKNVGVTFLNSFYELPPKSISILPDCKTEAFNTAKVSTQYNTRAVETRQ  429

Query  542   VAGNL-KWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                ++ KWE F+E+IPT +    ++    E    TK T+DY+W++ R    + D     D
Sbjct  430   KLDSIEKWEEFKEAIPTFEKTSLRANILLEHMNTTKDTSDYLWYTFRF---QNDFS---D  483

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                VL V S  H +  F+NG   G+ HG+   K   L + V L  GTN I+ L  ++  P
Sbjct  484   AQYVLNVTSSAHVLHAFVNGASVGFTHGSYKTKTPNLERKVTLSNGTNHISLLSGMVGLP  543

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ERR AG   V++       +D T  SW Y +G  GEKL+++T+ G+ K +W   
Sbjct  544   DSGAYLERRVAGVSRVIIKGEHE-IKDFTSYSWGYQVGLLGEKLQVYTDFGSSKIQWN-T  601

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G+   R  TWYKT FD P G DP+A+N+E M KG  WVNG+SIGRYWVSFLTP G P+Q
Sbjct  602   YGSSTHRTLTWYKTLFDAPVGKDPVALNLESMGKGEAWVNGQSIGRYWVSFLTPKGSPSQ  661

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE---R  1429
             T Y++PR +LKP NNLLV+ EE  G P  I V  ++   +C  V++++ P V  W    +
Sbjct  662   TWYNVPRSFLKPTNNLLVILEEQNGYPLGISVDTISITKVCGHVSDSHLPPVISWRGQNK  721

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
               ++        +P++ L CP  + +  I F+SYGNP G CG++  GSC   N++ IVE+
Sbjct  722   TEEKNHEKHHGRRPKVQLRCPPGRNISSILFSSYGNPSGDCGSYAIGSCHSSNSLAIVEE  781

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             ACLGK  C +PV    F  G D CP I KTL V A+C
Sbjct  782   ACLGKRICSIPVWSQKF--GDDPCPGIQKTLLVDAQC  816



>ref|XP_009376872.1| PREDICTED: beta-galactosidase 16 [Pyrus x bretschneideri]
Length=757

 Score =   467 bits (1201),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 243/579 (42%), Positives = 352/579 (61%), Gaps = 25/579 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+QY+V+GD P  RSAEDI++ V  F +K  G+YVNYYMY GG NFG + S+FV T
Sbjct  197   TENWTSQYQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVIT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG  R PKW HL++ H A+KL    LL G      +    +   F+    
Sbjct  257   SYYDEAPLDEYGSVRQPKWGHLKELHAAVKLASNSLLSGDQTNVSLGELQDAYVFQVKSG  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL N    K  ++ F+ + Y LP KS+SILPDCK + FNT  + AQ + R++  +
Sbjct  317   E-CAAFLVNKGP-KDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVT  374

Query  539   -KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
              K     +WE ++E+IP  D T+   +  P++++T TK  +DY+W++  +  +  +    
Sbjct  375   QKFDSTERWEEYKEAIPNFDNTVSRANTLPEQLFT-TKDESDYLWYTISLKQDSNN----  429

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
                   L V+S GH +   +NG F G  HG +  + F L Q V L  G N ++FL +++ 
Sbjct  430   ---ESKLVVQSRGHVLHALVNGVFVGSAHGRHRNESFSLEQTVTLNKGVNSLSFLSAMVG  486

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
              P+SGA++ERR  G + VL+       +D++KNSW Y +G  GEKL+++T+ G+ K +W 
Sbjct  487   LPDSGAYLERRVGGLRKVLI-----QERDLSKNSWGYQVGLSGEKLEIYTDAGSSKVQWN  541

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
              + G+   +R  W+KTHFD P GNDPIA+N+  M KG  +VNG+SIGRYWVSF TP G+P
Sbjct  542   KL-GSTANQRLKWFKTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVSFQTPEGKP  600

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             +QT YH+PR +LKP +NLLV+ EE  GDP  + +  ++   +C  V+E + P V  W   
Sbjct  601   SQTWYHVPRAFLKPTSNLLVLLEEENGDPLKVSLDKISVAQVCGHVSETHLPPVVKWLGL  660

Query  1433  GDEFRATT---DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
                 +  T    D +P++ L+CP  + + K+ FAS+GNP G C N+ TGSC    +  IV
Sbjct  661   KTHNQNNTRKYRDRRPKVQLSCPPKRNISKVLFASFGNPSGDCQNYSTGSCHSSISTAIV  720

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             E+ C+GK  C + + K+ F    D CP I KTL V A+C
Sbjct  721   EQVCIGKRRCSILLSKNRF---GDPCPGISKTLLVDAQC  756



>ref|XP_006472815.1| PREDICTED: beta-galactosidase 16-like isoform X1 [Citrus sinensis]
Length=823

 Score =   468 bits (1205),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 244/578 (42%), Positives = 339/578 (59%), Gaps = 23/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TE+WT+ Y+V+G  P  RSA+DI+F V  F +K+G+YVNYYMY GG NFG T ++F+ T 
Sbjct  263   TEDWTSFYQVWGGKPYIRSAQDIAFHVALFIAKNGSYVNYYMYHGGTNFGRTAAAFMITG  322

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PKW HL++ H A+KLC +PLL GT N+  +    E   FE T   
Sbjct  323   YYDQAPLDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFEETS-G  381

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL NN+  K  T+ FR   Y LP KS+SILPDCK + FNT+ +  Q+N R+   + 
Sbjct  382   VCAAFLVNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNL  441

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   + KWE ++E+I   D    ++    +  +  K  +DY W++ R   N  +     D
Sbjct  442   KFDSDEKWEEYREAILNFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQAPLD  501

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                   V+S GH +  F+NGE+ G  HG++    F L   V+L+ GTND   L   +  P
Sbjct  502   ------VQSHGHILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLP  555

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ER+ AG   V +      ++  T  SW Y +G  GEKL++++  G  K  W  +
Sbjct  556   DSGAFLERKVAGVHRVRVQ-----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSI  610

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                  TR+ TWYKT F  P GNDPIA+N++ M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  611   RS--PTRQLTWYKTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQ  668

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T YH+PR +LKP  NLLV+ EE  G+P  I V  +    +C  V  ++ P +  W R   
Sbjct  669   TRYHVPRGFLKPTGNLLVLLEEENGNPLGITVDTIAIRKVCGHVTNSHLPPLSSWLRHRQ  728

Query  1439  EFRATTD----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
               R  TD      KP +  +CP  K + KI FAS+GNP+G C  +  GSC   ++  +VE
Sbjct  729   --RGDTDIKKFGKKPTVQPSCPLGKKISKIVFASFGNPDGDCERYAVGSCHSSHSQGVVE  786

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             +AC+GK+ C +P+    F  G D CP I K L V A+C
Sbjct  787   RACMGKSRCSIPLSSRYF--GGDPCPGIHKALLVDAQC  822



>ref|XP_008338665.1| PREDICTED: beta-galactosidase 16 isoform X2 [Malus domestica]
Length=757

 Score =   464 bits (1193),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 242/578 (42%), Positives = 344/578 (60%), Gaps = 23/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+QY+V+GD P  RSAEDI++ V  F +K  G+YVNYYMY GG NFG + S+FV T
Sbjct  197   TENWTSQYQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVIT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG  R PKW HL++ H A+KL   PLL G  + N   G+ +         
Sbjct  257   SYYDEAPLDEYGSVRQPKWGHLKELHAAVKLASNPLLSG-GHTNVSLGELQDAYVFQVKS  315

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N    K  ++ F+ + Y LP KS+SILPDCK + FNT  + AQ + R++  +
Sbjct  316   GECAAFLVNKGP-KDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVT  374

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K     +WE ++E+IP  D   +++    E    TK  +DY+W++         L    
Sbjct  375   QKFDSTERWEEYKEAIPNFDNXXSRANTLPEQLFTTKDESDYLWYTI-------SLKQDS  427

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             +    L V+S GH +  F+NG F G  HG +  + F L Q V L  G N ++FL +++  
Sbjct  428   NTQSKLXVQSRGHVLHAFVNGVFVGSAHGRHRNEXFSLEQTVILNKGVNSLSFLSAMVGL  487

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR  G + VL+       +D++KNSW Y +G  GEKL+++T+ G  K +W  
Sbjct  488   PDSGAYLERRVGGLRKVLIX-----ERDLSKNSWGYXVGLSGEKLEIYTDAGXSKVEWNK  542

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             + G+   +   W+KTHFD P GNDPIA+N+  M KG  +VNG+SIGRYWV F TP G+P+
Sbjct  543   L-GSSANQPLKWFKTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVLFQTPEGKPS  601

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW---E  1426
             QT YH+PR +LKP  NLLV+ EE  GDP  + +  ++   +C  V+E + P V  W   +
Sbjct  602   QTWYHVPRAFLKPTGNLLVLLEEENGDPLKVSLDKISVAQVCGXVSETHLPPVVKWLGLK  661

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
              +         D +P++ L+CP  + + K+ FAS+GNP G C N+ TGSC    +  IVE
Sbjct  662   TQNQNNTRKNRDRRPKVQLSCPPKRNISKVLFASFGNPSGDCQNYSTGSCHSSISTAIVE  721

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             + C+GK  C + + K+ F    D CP I KTL V A+C
Sbjct  722   QVCIGKRRCSILLSKNRF---GDPCPGISKTLLVDAQC  756



>ref|XP_004171523.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=756

 Score =   463 bits (1191),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 241/576 (42%), Positives = 342/576 (59%), Gaps = 20/576 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+ +G+ P  RSAE+I+F V  F + K+GTYVNYYMY GG NFG + S+F+ T
Sbjct  197   TENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMIT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R+PKW HL++ H A+KLC  PLL GT +   +    E   F+ T+ 
Sbjct  257   GYYDQSPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFK-TES  315

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N   +    L F+   Y LP  S+SILPDCKN+ FNT+ +  QHN R+    
Sbjct  316   NECAAFLVNRGAIDSNVL-FQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAV  374

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +    L+WE F+E IP ID    ++    E    TK  +DY+W++ RV  +       PD
Sbjct  375   QKFDLLEWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDS------PD  428

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L V+S  HA+  F+NG++AG  HG    K F L + + L+ G N+I+ L  ++  P
Sbjct  429   SQQTLEVDSRAHALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLP  488

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R AG + V +       +D ++  W Y +G  GE+ ++F + G+   +W  +
Sbjct  489   DSGAFLETRVAGLRRVGIQG-----EDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRL  543

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              GN +++  TWYKT FD P G+DPIA+N+  M KG VWVNG+ IGRYWVSFLTP G+P+Q
Sbjct  544   -GN-SSQPLTWYKTQFDAPPGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGEPSQ  601

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW--ERK  1432
               Y++PR +LKP +N LV+ EE  G+P  I +  V     C  V+E++ P V  W   +K
Sbjct  602   KWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLITKTCGQVSESHYPLVASWMGAKK  661

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
                 R      +P++ L+CP  K +  I FAS+G P G C ++  G C  PN+  IVE A
Sbjct  662   QKVRRVKNRTRRPKVQLSCPSKKKISNILFASFGTPSGDCQSYAIGLCHSPNSRAIVEHA  721

Query  1613  CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             CLG+ +C +P+    F    D CP + KTL V A+C
Sbjct  722   CLGRAKCSIPISNLNFR--GDPCPHVTKTLLVDAQC  755



>ref|XP_008338663.1| PREDICTED: beta-galactosidase 16 isoform X1 [Malus domestica]
Length=813

 Score =   464 bits (1194),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 242/578 (42%), Positives = 344/578 (60%), Gaps = 23/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+QY+V+GD P  RSAEDI++ V  F +K  G+YVNYYMY GG NFG + S+FV T
Sbjct  253   TENWTSQYQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVIT  312

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG  R PKW HL++ H A+KL   PLL G  + N   G+ +         
Sbjct  313   SYYDEAPLDEYGSVRQPKWGHLKELHAAVKLASNPLLSG-GHTNVSLGELQDAYVFQVKS  371

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N    K  ++ F+ + Y LP KS+SILPDCK + FNT  + AQ + R++  +
Sbjct  372   GECAAFLVNKGP-KDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVT  430

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K     +WE ++E+IP  D   +++    E    TK  +DY+W++         L    
Sbjct  431   QKFDSTERWEEYKEAIPNFDNXXSRANTLPEQLFTTKDESDYLWYTI-------SLKQDS  483

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             +    L V+S GH +  F+NG F G  HG +  + F L Q V L  G N ++FL +++  
Sbjct  484   NTQSKLXVQSRGHVLHAFVNGVFVGSAHGRHRNEXFSLEQTVILNKGVNSLSFLSAMVGL  543

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR  G + VL+       +D++KNSW Y +G  GEKL+++T+ G  K +W  
Sbjct  544   PDSGAYLERRVGGLRKVLIX-----ERDLSKNSWGYXVGLSGEKLEIYTDAGXSKVEWNK  598

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             + G+   +   W+KTHFD P GNDPIA+N+  M KG  +VNG+SIGRYWV F TP G+P+
Sbjct  599   L-GSSANQPLKWFKTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVLFQTPEGKPS  657

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW---E  1426
             QT YH+PR +LKP  NLLV+ EE  GDP  + +  ++   +C  V+E + P V  W   +
Sbjct  658   QTWYHVPRAFLKPTGNLLVLLEEENGDPLKVSLDKISVAQVCGXVSETHLPPVVKWLGLK  717

Query  1427  RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
              +         D +P++ L+CP  + + K+ FAS+GNP G C N+ TGSC    +  IVE
Sbjct  718   TQNQNNTRKNRDRRPKVQLSCPPKRNISKVLFASFGNPSGDCQNYSTGSCHSSISTAIVE  777

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             + C+GK  C + + K+ F    D CP I KTL V A+C
Sbjct  778   QVCIGKRRCSILLSKNRF---GDPCPGISKTLLVDAQC  812



>ref|XP_004149808.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=801

 Score =   464 bits (1193),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 241/576 (42%), Positives = 342/576 (59%), Gaps = 20/576 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+ +G+ P  RSAE+I+F V  F + K+GTYVNYYMY GG NFG + S+F+ T
Sbjct  242   TENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMIT  301

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R+PKW HL++ H A+KLC  PLL GT +   +    E   F+ T+ 
Sbjct  302   GYYDQSPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFK-TES  360

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N   +    L F+   Y LP  S+SILPDCKN+ FNT+ +  QHN R+    
Sbjct  361   NECAAFLVNRGAIDSNVL-FQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAV  419

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +    L+WE F+E IP ID    ++    E    TK  +DY+W++ RV  +       PD
Sbjct  420   QKFDLLEWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDS------PD  473

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L V+S  HA+  F+NG++AG  HG    K F L + + L+ G N+I+ L  ++  P
Sbjct  474   SQQTLEVDSRAHALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLP  533

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R AG + V +       +D ++  W Y +G  GE+ ++F + G+   +W  +
Sbjct  534   DSGAFLETRVAGLRRVGIQG-----EDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRL  588

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              GN +++  TWYKT FD P G+DPIA+N+  M KG VWVNG+ IGRYWVSFLTP G+P+Q
Sbjct  589   -GN-SSQPLTWYKTQFDAPPGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGEPSQ  646

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW--ERK  1432
               Y++PR +LKP +N LV+ EE  G+P  I +  V     C  V+E++ P V  W   +K
Sbjct  647   KWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLITKTCGQVSESHYPLVASWMGAKK  706

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
                 R      +P++ L+CP  K +  I FAS+G P G C ++  G C  PN+  IVE A
Sbjct  707   QKVRRVKNRTRRPKVQLSCPSKKKISNILFASFGTPSGDCQSYAIGLCHSPNSRAIVEHA  766

Query  1613  CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             CLG+ +C +P+    F    D CP + KTL V A+C
Sbjct  767   CLGRAKCSIPISNLNFR--GDPCPHVTKTLLVDAQC  800



>ref|XP_006473025.1| PREDICTED: beta-galactosidase 16-like [Citrus sinensis]
Length=822

 Score =   464 bits (1194),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 340/578 (59%), Gaps = 17/578 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+V+GD    RSAEDI++ V  F  K  G+YVNYYMY GG NFG T S++V T
Sbjct  256   TENWTSFYQVYGDEARIRSAEDIAYHVALFIVKMKGSYVNYYMYHGGTNFGRTASAYVLT  315

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R PKW HL++ H A+KLC KP+L G       +   E   F+ +  
Sbjct  316   GYYDQAPLDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIFQGSSE  375

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP-  535
               CAAFL N +     T+ F    Y LP  S+SILPDCK + FNT  +  Q+  R+ +  
Sbjct  376   --CAAFLVNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTRSMEQR  433

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K+    +WE ++E+IPT D    ++    E    TK  +DY+W++ R    K D     
Sbjct  434   QKLDSVEQWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRF---KHD---PS  487

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             +   VL V S+GH ++ FINGEF G  HG +  K F L + V+L  GTN+++ L  ++  
Sbjct  488   NSESVLKVSSLGHVLLAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGL  547

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR AG ++V +       +D +  SW Y +G  GEKL++FT+ G+    W  
Sbjct  548   PDSGAYLERRVAGLRNVSIQGAKE-LKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSR  606

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G+   +  TWYKT FD P G+DP+A+N+  M KG  WVNG+SIGRYWVSFLTP G P+
Sbjct  607   Y-GSSTHQPLTWYKTVFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPS  665

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q+ YHIPR +LKP  NLLV+ EE  G P  I +  V+  T+C  V++++ P V  W  + 
Sbjct  666   QSWYHIPRSFLKPTGNLLVLLEEENGYPPGISIDTVSVTTLCGHVSDSHLPPVISWRSQN  725

Query  1436  DEFRATTDDL---KPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
                  T   +   +P++ + CP  + + KI FASYGNP G C N+  GSC   N+  IVE
Sbjct  726   QRTLKTHKRIPGRRPKVQIRCPSGRKISKILFASYGNPNGNCENYAIGSCHSSNSRAIVE  785

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KACLGK  C VPV    F    D CP I K L V A+C
Sbjct  786   KACLGKRSCTVPVWTEKFY--GDPCPGIPKALLVDAQC  821



>gb|EMS57945.1| Beta-galactosidase 12 [Triticum urartu]
Length=817

 Score =   464 bits (1194),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 246/633 (39%), Positives = 344/633 (54%), Gaps = 91/633 (14%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FG+   QRSAEDI++SV+RF++K GT VNYYMY+GG NFG TG+S+V T 
Sbjct  217   TENWTAQFRAFGNDLAQRSAEDIAYSVLRFFAKGGTLVNYYMYYGGTNFGRTGASYVLTG  276

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDEGP+D YG  + PK+ HLRD H  +K   +  L G  +   +   +E   FE  + K
Sbjct  277   YYDEGPIDEYGMPKAPKYGHLRDLHNVIKSYSRAFLEGKQSFELLGQGYEARNFEIPEEK  336

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AF+SNNNT +  T+ FRG  YY+P++SVSIL DCK++++NT+ +  QH+ R+F  + 
Sbjct  337   LCLAFISNNNTGEDGTVIFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHKAE  396

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   N  WEMF E IP+                                +   DLP+R D
Sbjct  397   KATKNNVWEMFSELIPSFR------------------------------LEADDLPIRGD  426

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PV+ V+S  HAM+ F+N  FAG  HG+   K F    P++L+ G N +  L S +   
Sbjct  427   IRPVIAVKSTAHAMVGFVNDAFAGNGHGSKKEKFFTFETPISLRLGVNHLALLSSSMGMK  486

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SG  +     G +   +  L TG  D+  N W +    +GE  +++TE+G    KW P 
Sbjct  487   DSGGELVELKGGIQDCTIQGLNTGTLDLQINGWGHKAKLEGEVKEIYTEKGMGAVKWVPA  546

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                 + +  TWYK +FD P+G+DP+ ++M  M KGM++VNG+ +GRYW S+ TP    +Q
Sbjct  547   V---SGQAVTWYKRYFDEPDGDDPVVLDMTSMCKGMIFVNGEGMGRYWTSYKTPGKVASQ  603

Query  1259  ------------------TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICS  1384
                               T YHIPR +LK KNNLLVVFEE  G P+ I +  V RD IC 
Sbjct  604   AVYGSSALLNNPFFLYWPTMYHIPRTFLKSKNNLLVVFEEELGKPEGILIQTVRRDDICV  663

Query  1385  SVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFM  1564
              ++E+ P  +K W+  G + +   +D   R  L CP  K+++++ FAS+GNP G C NF 
Sbjct  664   FISEHNPAQIKPWDEHGGQIKLIAEDHNTRGFLNCPPKKIIQEVVFASFGNPVGSCANFT  723

Query  1565  TGSCSFPNAIKIV------------------------------------EKACLGKTECE  1636
              G+C  PNA +IV                                     K CLGK  C 
Sbjct  724   VGTCHTPNAKEIVAKLILDHILLVPAYGCRLISGVYAQEWLRKTGCVVYAKECLGKKGCV  783

Query  1637  VPVEKSLFVEGKDL-CPKIVKTLAVQAKCVRQG  1732
             +PV  + +  G D+ CP    TLAVQ +C ++G
Sbjct  784   LPVLHTFY--GADINCPTTTATLAVQVRCHKKG  814



>ref|XP_010419240.1| PREDICTED: beta-galactosidase 16 [Camelina sativa]
Length=801

 Score =   463 bits (1191),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 248/587 (42%), Positives = 346/587 (59%), Gaps = 34/587 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  234   TENWTSFYQTYGEEPLIRSAEDIAFQVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  293

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWG---TANLNKINGDHEITTFE-N  349
             YYD+ P+D YG  R PKW HL++ H A+KLC+KPLL G   T +L K+      T F   
Sbjct  294   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISLGKLQ-----TAFVFG  348

Query  350   TDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF  529
                 LCAA L N +  +  T+ FR + Y L  KS+S+LPDCKN+ FNT  + AQ++ RT 
Sbjct  349   KKANLCAALLVNQDECE-ATVQFRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTR  407

Query  530   DP-SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLP  706
             +P  K++ +  WE F E++P+       S +  E    T+ T+DY+W +TR         
Sbjct  408   EPRQKLSSSHMWEEFTENVPSFSETLILSESLLEHMNTTQDTSDYLWQTTRF--------  459

Query  707   MRPD-IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCS  883
              +P+    VL V  +GH +  F+NG+F G  HG   A  F+L + V+L  GTN+I  L  
Sbjct  460   QQPEGAQSVLKVNHLGHVLHGFVNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSV  519

Query  884   ILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAE  1057
             ++  PNSGA +ERR  G +SV    +  G   +  N  SW Y +G QGEK  ++TE GA 
Sbjct  520   MVGLPNSGAHLERRAVGSRSV---KIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAA  576

Query  1058  KAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT  1237
             K +W     +  ++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SIGRYWVSF T
Sbjct  577   KVQWRKYR-DSKSQPLTWYKAAFDTPEGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHT  635

Query  1238  PLGQPTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDV  1414
               G P+Q  YHIPR +LKP +NLLV+  EE  G+P  + +  V+   +C  V+ ++P  V
Sbjct  636   SKGNPSQIWYHIPRSFLKPSSNLLVILEEEREGNPLGVTIDTVSVTEVCGHVSSSHPSPV  695

Query  1415  KIWERKGDEFRATTD-----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCS  1579
                 R G   +         D +P++ L CP+ + + K+ FAS+G P G C ++  GSC 
Sbjct  696   ISQRRTGHNRKKQRHLKHQYDKRPKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSCH  755

Query  1580  FPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              P ++ +++KACL K+ C VPV    F  G D CP  VK+L V A+C
Sbjct  756   SPKSLAVIQKACLNKSRCSVPVWSKTF--GGDSCPHAVKSLLVHAQC  800



>ref|XP_010428819.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=819

 Score =   463 bits (1192),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 247/587 (42%), Positives = 347/587 (59%), Gaps = 34/587 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +GD P  RSAEDI+F V  F +K+G++VNYY Y GG NFG   S FV T+
Sbjct  252   TENWTSFYQTYGDEPLIRSAEDIAFQVALFIAKNGSFVNYYTYHGGTNFGRNASQFVITS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWG---TANLNKINGDHEITTFE-N  349
             YYD+ P+D YG  R PKW HL++ H A+KLC+KPLL G   T +L K+      T F   
Sbjct  312   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISLGKLQ-----TAFVFG  366

Query  350   TDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF  529
                 LCAA L N +  +  T+ FR + Y L  KS+S+L DCKN+ FNT  + AQ++ RT 
Sbjct  367   KKANLCAALLVNQDDCE-ATVQFRNSSYLLSPKSISVLQDCKNVAFNTAKVNAQYSTRTR  425

Query  530   DP-SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLP  706
             +P  K++    WE F E++P+      +S +  E    T+ T+DY+W +TR         
Sbjct  426   EPRQKLSSPHMWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRF--------  477

Query  707   MRPD-IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCS  883
              +P+    VL V  +GH +  F+NG+F G  HG   A  F+L + V+L  GTN+I  L  
Sbjct  478   QQPEGAQSVLKVNHLGHVLHGFVNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSV  537

Query  884   ILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAE  1057
             ++  PNSGA +ERR  G +SV    +  G   +  N  SW Y +G QGEK  ++TE GA 
Sbjct  538   MVGLPNSGAHLERRVVGSRSV---KIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAA  594

Query  1058  KAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT  1237
             K +W     +  ++  TWYK  FD P+G DP+A+N+  M KG  WVNG+SIGRYWVSF T
Sbjct  595   KVQWKKYR-DSKSQPLTWYKASFDTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHT  653

Query  1238  PLGQPTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDV  1414
               G P+Q  YHIPR +LKP +NLLV+  EE  G+P  + +  V+   +C  V+ ++P  V
Sbjct  654   SKGNPSQIWYHIPRSFLKPSSNLLVILEEEREGNPLGVTIDTVSVTEVCGHVSSSHPSPV  713

Query  1415  KIWERKGDEFRATTD-----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCS  1579
                 RKG   +         D +P++ L CP+ + + K+ FAS+G P G C ++  GSC 
Sbjct  714   ISQRRKGHNRKKQRHLKHQYDKRPKVQLQCPNGRKISKVMFASFGTPNGNCWSYSVGSCH  773

Query  1580  FPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              P ++ +++KACL K++C VPV    F  G D CP+ VK+L V A+C
Sbjct  774   SPKSLAVIQKACLNKSKCSVPVWSKTF--GGDSCPQAVKSLLVHAQC  818



>gb|EMT17497.1| Beta-galactosidase 12 [Aegilops tauschii]
Length=798

 Score =   462 bits (1189),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 233/561 (42%), Positives = 322/561 (57%), Gaps = 58/561 (10%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQ+R FG+   QRSAEDI++SV+RF++K GT VNYYMY+GG NFG TG+S+V T 
Sbjct  228   TENWTAQFRAFGNDLAQRSAEDIAYSVLRFFAKGGTLVNYYMYYGGTNFGRTGASYVLTG  287

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDEGP+D YG  + PK+ HLRD H  +K   +  L G  +   +   +E   FE  + K
Sbjct  288   YYDEGPVDEYGMPKAPKYGHLRDLHNVIKSYSRAFLEGKQSFELLGQGYEARNFEIPEEK  347

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             LC AF+SNNNT +  T+NFRG  YY+P++SVSIL DCK++++NT+ +  QH+ R+F  + 
Sbjct  348   LCLAFISNNNTGEDGTVNFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHKAD  407

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   N  WEMF E IP+                                +   DLP+R D
Sbjct  408   KATKNNVWEMFSEVIPSFR------------------------------LEADDLPIRGD  437

Query  719   IHPVLFVESMGHAMIVFINGEF------------------------AGYNHGNNVAKEFI  826
             I PVL V+S  HA++ F+N  F                        AG  HG    K F 
Sbjct  438   IRPVLAVKSSSHALVAFVNDAFAAKSRYQLQALTIVLKRDLITTINAGNGHGTKKEKGFT  497

Query  827   LLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYS  1006
               +P+NL+ G N +  L S +   +SG  +     G +   +  L TG  D+  N W + 
Sbjct  498   FDRPINLRLGVNHLALLSSSMGMKDSGGELVELKGGIQDCTIQGLNTGTLDLQVNGWGHK  557

Query  1007  IGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGM  1186
                +GE+ +++TE+G    KW P T   + +  TWYK +FD P+G+DP+ ++M  M KGM
Sbjct  558   AKLEGEEKEIYTEKGMGAVKWVPAT---SGQAVTWYKRYFDEPDGDDPVVLDMTSMCKGM  614

Query  1187  VWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
             ++VNG+ +GRYW SF+TP    +Q  YHIPRP+LK KNNLLVVFEE  G P+ I +  V 
Sbjct  615   IFVNGEGMGRYWTSFITPGKVASQAVYHIPRPFLKSKNNLLVVFEEELGKPEGILIQTVR  674

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
             RD IC  ++E+ P  +K W+  G + +   +D   R  L CP  K ++++ FAS+GNP G
Sbjct  675   RDDICVFISEHNPAQIKPWDEHGGQIKLIAEDHNTRGFLNCPPKKTIQEVVFASFGNPVG  734

Query  1547  VCGNFMTGSCSFPNAIKIVEK  1609
              CGNF  G+C  PNA  IV K
Sbjct  735   SCGNFTVGTCHVPNAKDIVAK  755



>ref|XP_006434246.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
 gb|ESR47486.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
Length=821

 Score =   461 bits (1187),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 249/578 (43%), Positives = 338/578 (58%), Gaps = 17/578 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+V+GD    RSAEDI++ V  F +K  G+YVNYYMY GG NFG T S++V T
Sbjct  255   TENWTSFYQVYGDEARIRSAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLT  314

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R PKW HL++ H A+KLC KP+L G       +   E   F+ +  
Sbjct  315   GYYDQAPLDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSTLQEAFIFQGSSE  374

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP-  535
               CAAFL N +     T+ F    Y LP  S+SILPDCK + FNT  +  Q+  R+ +  
Sbjct  375   --CAAFLVNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTRSMEQR  432

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K+    +WE ++E+IPT D    ++    E    TK  +DY+W++ R    K D     
Sbjct  433   QKLDSVEQWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRF---KHD---PS  486

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D   VL V S+GH +  FINGEF G  HG +  K F L + V+L  GTN+++ L  ++  
Sbjct  487   DSESVLKVSSLGHVLHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGL  546

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR AG ++V +       +D +  SW Y +G  GEKL++FT+ G+    W  
Sbjct  547   PDSGAYLERRVAGLRNVSIQGAKE-LKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSR  605

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
               G+   +  TWYKT FD P G+DP+A+N+  M KG  WVNG+SIGRYWVSFLTP G P+
Sbjct  606   Y-GSSTHQPLTWYKTVFDAPTGSDPVAINLIPMGKGEAWVNGQSIGRYWVSFLTPQGTPS  664

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q+ YHIPR +LKP  NLLV+ EE  G P  I +  V+   IC  V++++ P V  W  + 
Sbjct  665   QSWYHIPRSFLKPTGNLLVLLEEENGYPPGISIDTVSVTKICGHVSDSHLPPVISWRSQN  724

Query  1436  DEFRATTDDL---KPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
                  T   +   +P++ + CP  + +  I FASYGNP G C N+  GSC   N+  +VE
Sbjct  725   QRTLKTHKKIPGRRPKVQIRCPSGRKISTILFASYGNPNGNCDNYAIGSCHSSNSRAVVE  784

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             KACLGK  C VPV    F    D CP I K L V A+C
Sbjct  785   KACLGKRSCTVPVWTEKFY--GDPCPGIPKALLVDAQC  820



>ref|XP_006390092.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
 gb|ESQ27378.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
Length=818

 Score =   461 bits (1187),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 240/583 (41%), Positives = 348/583 (60%), Gaps = 26/583 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV+++
Sbjct  251   TENWTSFYQTYGEEPLIRSAEDIAFQVALFIAKNGSFVNYYMYHGGTNFGRNASQFVTSS  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTF-ENTDL  358
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G      I        F +N D 
Sbjct  311   YYDQAPLDEYGLLRQPKWGHLKELHAAIKLCERPLLSGLRTAIPIGKLQTAFVFGKNAD-  369

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              LCAA L N +    +T+ F  + Y L   S+S+LPDCKN+ FNT  + AQ+N R  +P 
Sbjct  370   -LCAALLVNQDK-NDSTVQFLDSSYLLSPNSISVLPDCKNVAFNTAKVNAQYNTRRREPR  427

Query  539   K-VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             + ++ +  WE+F E++P+      +S +  E    T+ T+DY+W   ++   ++  P   
Sbjct  428   QNLSSSHMWEVFTETVPSYSETSIRSESLLEHLNTTQDTSDYLW---QIFRFQQSEPAA-  483

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 +L V  +GH +  F+NG   G  HG   A++F+L + V+L  GTN I  L  ++  
Sbjct  484   ---SILKVNHIGHVLHAFVNGRLIGSMHGAFKAQKFLLEKNVSLINGTNSIALLSVMVGL  540

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDI--TKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
             PNSGA +ERR  G +SV    +  G   +   K +W Y +G  GE++ ++T+ GA K KW
Sbjct  541   PNSGAHLERRVGGSRSV---KIWNGKYALYFNKYAWGYQVGLHGEQVHVYTDNGAAKVKW  597

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                  ++N++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SIGRYWVSF T  G 
Sbjct  598   KQYR-DYNSQPLTWYKASFDTPEGKDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGS  656

Query  1250  PTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
             P+Q  YHIPR +LKPK+N LV+F EE  G+P  I +  V+   +C  V+ +YPP V  W+
Sbjct  657   PSQIWYHIPRSFLKPKSNSLVIFEEEREGNPLGITIDTVSVTEVCGHVSNSYPPPVIFWK  716

Query  1427  RKGDE-----FRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNA  1591
             RK  +      R    D++P++ L C + + + K+ FAS+G P G C ++  G C  P +
Sbjct  717   RKSHKRNEHRHRKHRYDMRPKVQLQCSNGRKISKVLFASFGTPNGNCWSYSVGKCHSPKS  776

Query  1592  IKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             + +++KACL K+ C VPV    F  G D CP  VK+L V A+C
Sbjct  777   LAVIQKACLSKSRCSVPVWSKTF--GGDSCPHSVKSLLVHAQC  817



>ref|NP_177866.2| beta-galactosidase 16 [Arabidopsis thaliana]
 sp|Q8GX69.2|BGA16_ARATH RecName: Full=Beta-galactosidase 16; Short=Lactase 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE35975.1| beta-galactosidase 16 [Arabidopsis thaliana]
Length=815

 Score =   461 bits (1185),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 249/582 (43%), Positives = 343/582 (59%), Gaps = 27/582 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  251   TENWTSFYQTYGEEPLIRSAEDIAFHVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G      + G  +          
Sbjct  311   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISL-GKLQTAFVFGKKAN  369

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAA L N +  + +T+ FR + Y L  KSVS+LPDCKN+ FNT  + AQ+N RT    K
Sbjct  370   LCAAILVNQDKCE-STVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRT---RK  425

Query  542   VAGNLK----WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
                NL     WE F E++P+      +S +  E    T+ T+DY+W +TR   ++     
Sbjct  426   ARQNLSSPQMWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSE-----  480

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
                   VL V  +GHA+  F+NG F G  HG   A  F+L + ++L  GTN++  L  ++
Sbjct  481   --GAPSVLKVNHLGHALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMV  538

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEKA  1063
               PNSGA +ERR  G +SV    +  G   +  N  SW Y +G +GEK  ++TE+G+ K 
Sbjct  539   GLPNSGAHLERRVVGSRSV---KIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKV  595

Query  1064  KWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPL  1243
             +W     +  ++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SIGRYWVSF T  
Sbjct  596   QWKQYR-DSKSQPLTWYKASFDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYK  654

Query  1244  GQPTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKI  1420
             G P+Q  YHIPR +LKP +NLLV+  EE  G+P  I +  V+   +C  V+   P  V  
Sbjct  655   GNPSQIWYHIPRSFLKPNSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVIS  714

Query  1421  WERKGDEFRATT--DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               +KG   +  T   D KP++ L CP  + + KI FAS+G P G CG++  GSC  PN++
Sbjct  715   PRKKGLNRKNLTYRYDRKPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSL  774

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              +V+KACL K+ C VPV    F  G D CP  VK+L V+A+C
Sbjct  775   AVVQKACLKKSRCSVPVWSKTF--GGDSCPHTVKSLLVRAQC  814



>ref|XP_002889142.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65401.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   461 bits (1185),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 244/582 (42%), Positives = 343/582 (59%), Gaps = 24/582 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  251   TENWTSFYQTYGEEPLIRSAEDIAFHVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G      + G  +          
Sbjct  311   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISL-GKLQTAFVFGKKAN  369

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAA L N +     T+ FR + Y L  KS+S+LPDCKN+ FNT  + AQ+N RT  P +
Sbjct  370   LCAALLVNQDKCD-CTVQFRNSSYRLSPKSISVLPDCKNVAFNTAKVNAQYNTRTRKPRQ  428

Query  542   -VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              ++    WE F E++P+      +S +  E    T+ T+DY+W +TR   ++        
Sbjct  429   NLSSPHMWEKFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFEQSE-------G  481

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                VL V  +GH +  F+N  F G  HG   A  F+L + ++L  GTN++  L  ++  P
Sbjct  482   APSVLKVNHLGHVLHAFVNERFIGSMHGTFKAHSFLLEKNMSLNNGTNNMALLSVMVGLP  541

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             NSGA +ERR  G +SV    +  G+  +  N  SW Y +G +GEK  ++TE+GA+K +W 
Sbjct  542   NSGAHLERRVVGSRSV---NIWNGSYQLFFNNYSWGYQVGLKGEKYHVYTEDGAKKVQWK  598

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
                 +  ++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SIGRYWVSF T  G P
Sbjct  599   QYR-DSKSQPLTWYKASFDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFYTSKGNP  657

Query  1253  TQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             +Q  YHIPR +LKP +NLLV+  EE  G P  I +  V+   +C  V+  +P  V    +
Sbjct  658   SQIWYHIPRSFLKPNSNLLVILEEEREGYPLGITIDTVSVTEVCGHVSNTHPHPVISPRK  717

Query  1430  KGDEFRATTD-----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
             KG             D KP++ L CP  + + K+ FA++GNP G CG++  GSC  PN++
Sbjct  718   KGHNRNEQRHLKYRYDRKPKVQLQCPTGRKISKVLFATFGNPNGSCGSYSVGSCHSPNSL  777

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              +V+KACL K+ C VPV    F  G DLCP+ VK+L V+A+C
Sbjct  778   AVVQKACLRKSRCSVPVWSKTF--GGDLCPQTVKSLLVRAQC  817



>ref|XP_010471934.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=820

 Score =   460 bits (1183),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 245/583 (42%), Positives = 341/583 (58%), Gaps = 26/583 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +GD P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  253   TENWTSFYQTYGDEPLIRSAEDIAFQVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  312

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC+KPLL G      + G  +          
Sbjct  313   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISL-GKLQTAFVFGKKAN  371

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP-S  538
             LCAA L N +  +  T+ FR + Y L  KS+S+LPDCKN+ FNT  + AQ++ RT +P  
Sbjct  372   LCAALLVNQDECE-ATVQFRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTREPRQ  430

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K++    WE F E++P+      +S +  E    T+ T+DY+W +TR          +P+
Sbjct  431   KLSSPHMWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRF--------QQPE  482

Query  719   -IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 VL V  +GH +  F+NG+F G  HG   A  F+L + V+L  GTN+I  L  ++  
Sbjct  483   GAQSVLKVNHLGHVLHGFVNGKFIGSMHGTYKAHRFLLEKNVSLNNGTNNIALLSVMVGL  542

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEKAKW  1069
             PNSGA +ERR  G +SV    +  G   +  N  SW Y +G QGEK  ++TE GA K +W
Sbjct  543   PNSGAHLERRVVGSRSV---KIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQW  599

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                  +  ++  TWYK  FD P+G DP+A+N+  M KG  WVNG+SIGRYWVSF T  G 
Sbjct  600   KKYR-DSKSQPLTWYKVSFDTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTFKGN  658

Query  1250  PTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDV----  1414
             P+Q  YHIPR +LKP +NLLV+  EE  G P  + +  V+   +C  V+ ++P  V    
Sbjct  659   PSQIWYHIPRSFLKPSSNLLVILEEEREGKPLGVTIDTVSVTEVCGHVSSSHPSPVISQR  718

Query  1415  -KIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNA  1591
              K   RK         D +P++ L CP+ + + K+ FAS+G P G C ++  GS   P +
Sbjct  719   RKSHNRKKHRHLKHQYDRRPKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSRHSPKS  778

Query  1592  IKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             + ++EKACL K+ C VPV    F  G D CP+ VK+L V A+C
Sbjct  779   LAVIEKACLNKSRCSVPVWSKTF--GGDACPQAVKSLLVHAQC  819



>gb|KDO80551.1| hypothetical protein CISIN_1g004533mg [Citrus sinensis]
Length=746

 Score =   456 bits (1174),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 244/598 (41%), Positives = 340/598 (57%), Gaps = 43/598 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TE+WT+ Y+V+G  P  RSA+DI+F V  F +K+G+YVNYYMY GG NFG T ++F+ T 
Sbjct  166   TEDWTSFYQVWGGKPYIRSAQDIAFHVALFIAKNGSYVNYYMYHGGTNFGRTAAAFMITG  225

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R+PKW HL++ H A+KLC +PLL GT N+  +    E   FE T   
Sbjct  226   YYDQAPLDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFEETS-G  284

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS-  538
             +CAAFL NN+  K  T+ FR   Y LP KS+SILPDCK + FNT+ +  Q+N R+   + 
Sbjct  285   VCAAFLVNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNL  344

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K   + KWE ++E+I   D    ++    +  +  K  +DY W++ R   N  +     D
Sbjct  345   KFDSDEKWEEYREAILNFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQAPLD  404

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                   V+S GH +  F+NGE+ G  HG++    F L   V+L+ GTND   L   +  P
Sbjct  405   ------VQSHGHILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLP  458

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ER+ AG   V +      ++  T  SW Y +G  GEKL++++  G  K  W  +
Sbjct  459   DSGAFLERKVAGVHRVRVQ-----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSI  513

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
                  TR+ TWYKT F  P GNDPIA+N++ M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  514   --RSPTRQLTWYKTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQ  571

Query  1259  TE--------------------YHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTI  1378
             T+                    YH+PR +LKP  NLLV+ EE  G+P  I V  +    +
Sbjct  572   TQYAVNTVTSIHFCAIIKATNTYHVPRAFLKPTGNLLVLLEEENGNPLGITVDTIAIRKV  631

Query  1379  CSSVAENYPPDVKIWERKGDEFRATTD----DLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
             C  V  ++ P +  W R     R  TD      KP +  +CP  K + KI FAS+GNP+G
Sbjct  632   CGHVTNSHLPPLSSWLRHRQ--RGDTDIKKFGKKPTVQPSCPLGKKISKIVFASFGNPDG  689

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              C  +  GSC   ++  +VE+AC+GK+ C +P+    F  G D CP I K L V A+C
Sbjct  690   DCERYAVGSCHSSHSQGVVERACIGKSRCSIPLLSRYF--GGDPCPGIHKALLVDAQC  745



>ref|XP_007221984.1| hypothetical protein PRUPE_ppa002839mg [Prunus persica]
 gb|EMJ23183.1| hypothetical protein PRUPE_ppa002839mg [Prunus persica]
Length=628

 Score =   452 bits (1164),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 239/579 (41%), Positives = 341/579 (59%), Gaps = 23/579 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKS-GTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+QY+V+G  P  RSAE+I++ V  F +K+ G+YVNYYMY GG NFG T S+FV T
Sbjct  68    TENWTSQYQVYGGEPYIRSAEEIAYQVALFIAKNRGSYVNYYMYHGGTNFGRTASAFVVT  127

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG  R PKW HL++ H A+KL    LL G      +    +   F+    
Sbjct  128   SYYDEAPLDEYGSIRQPKWGHLKELHAAVKLASSALLSGDQTSISLGQLQDAYVFKVQSG  187

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL N    K  T+ F+ + Y LP KS+SILPDCK + FNT  + AQH  R++  +
Sbjct  188   E-CAAFLVNKGP-KHATVPFQESSYQLPPKSISILPDCKKVAFNTAKVSAQHATRSWQVT  245

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K      WE ++E+IP  +    ++ A  E  ++TK  +DY+W++     +        
Sbjct  246   QKFDTAENWEEYKEAIPNYEKTTLRASALPEQISITKDESDYLWYTFSFQHDS-------  298

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             +    L V+S GH +  F+NG F G  HG +  + F L Q V L  G N I+ L +++  
Sbjct  299   NAQSTLSVKSHGHVLHTFVNGVFTGSAHGRHRNESFSLEQTVTLSKGINYISLLSAMVGL  358

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P++GA++ER+  G     L  +   +QD +K+SW Y +G  GEKL++ ++ G+ K +W  
Sbjct  359   PDNGAYLERKVGG-----LHEVRVEDQDFSKSSWGYQVGLDGEKLQIHSDSGSSKVQWSK  413

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             + GN + +  TWYK  FD   G+D IA+N+  M KG  WVNG+SIGR+WVSF TP G+P+
Sbjct  414   L-GNSDHQPLTWYKILFDAAAGHDSIALNLGSMGKGEAWVNGQSIGRFWVSFQTPKGKPS  472

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             QT Y++PR +LKP  NLLV+ EE  GDP  I +  V+   +C  V+E + P V  W  + 
Sbjct  473   QTWYNVPRSFLKPTGNLLVLLEEENGDPLGISLDKVSITQVCGHVSETHLPPVSKWLVQK  532

Query  1436  DEFRATTD---DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
              + +  T      +P++ L+CP  K + K+ F+S+GNP G C  + TGSC   N+  IVE
Sbjct  533   TQNQNNTKTKLGRRPKIQLSCPPKKSISKVLFSSFGNPSGDCKTYATGSCHSSNSKAIVE  592

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             +ACLGK  C +PV    F    D CP I KTL V A+C 
Sbjct  593   QACLGKRRCSIPVSLQKF---GDPCPSISKTLLVDAQCT  628



>ref|XP_007041849.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
 gb|EOX97680.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
Length=692

 Score =   454 bits (1168),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/397 (52%), Positives = 280/397 (71%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+G+ VNYYMY GG N+G T ++F +T 
Sbjct  271   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGSLVNYYMYHGGTNYGRTSAAFTTTR  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKW HL+D H+AL LCKK LLWG+  + K+  D E+ T++     
Sbjct  331   YYDEAPLDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTS  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+T    T +FRG  Y LPA+S+SILPDCK +++NTQ I AQHN R F  S 
Sbjct  391   LCAAFLANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSA  450

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  W+M++E +PT   L + +  P E+Y LTK TTDY W++T + +  RDLPM+ +
Sbjct  451   TANKNFNWQMYKEYVPT--QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKE  508

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GH ++ F+NGE+ G+ HG+ V K F+  +PV LK G N IT L +++  P
Sbjct  509   IFPVLRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLP  568

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AGP+S+ +L L TG  D++ N W + +G  GEK K++TE+G+ K +W  +
Sbjct  569   DSGAYMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKL  628

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMV  1189
             +    +   TWYK +FD PEGN+P+A+ M  M KGM+
Sbjct  629   S---ESPALTWYKGYFDTPEGNNPVAIRMTGMGKGML  662



>gb|KDO80552.1| hypothetical protein CISIN_1g003612mg [Citrus sinensis]
Length=807

 Score =   456 bits (1172),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 249/577 (43%), Positives = 335/577 (58%), Gaps = 30/577 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+V+GD    RSAEDI++ V  F +K  G+YVNYYMY GG NFG T S++V T
Sbjct  256   TENWTSFYQVYGDEARIRSAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLT  315

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R PKW HL++ H A+KLC KP+L G       +   E   F+ +  
Sbjct  316   GYYDQAPLDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIFQGSSE  375

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N +     T+ F    Y LP  S+SILPDCK + FNT              +
Sbjct  376   --CAAFLVNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNT--------------A  419

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K+    +WE ++E+IPT D    ++    E    TK  +DY+W++ R    K D     D
Sbjct  420   KLDSVEQWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRF---KHD---PSD  473

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                VL V S+GH +  FINGEF G  HG +  K F L + V+L  GTN+++ L  ++  P
Sbjct  474   SESVLKVSSLGHVLHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLP  533

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ERR AG ++V +       +D +  SW Y +G  GEKL++FT+ G+    W   
Sbjct  534   DSGAYLERRVAGLRNVSIQGAKE-LKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSRY  592

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G+   +  TWYKT FD P G+DP+A+N+  M KG  WVNG+SIGRYWVSFLTP G P+Q
Sbjct  593   -GSSTHQPLTWYKTVFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPSQ  651

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             + YHIPR +LKP  NLLV+ EE  G P  I +  V+  T+C  V++++ P V  W  +  
Sbjct  652   SWYHIPRSFLKPTGNLLVLLEEENGYPPGISIDTVSVTTLCGHVSDSHLPPVISWRSQNQ  711

Query  1439  EFRATTDDL---KPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
                 T   +   +P++ + CP  + + KI FASYGNP G C N+  GSC   N+  IVEK
Sbjct  712   RTLKTHKRIPGRRPKVQIRCPSGRKISKILFASYGNPNGNCENYAIGSCHSSNSRAIVEK  771

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             ACLGK  C VPV    F    D CP I K L V A+C
Sbjct  772   ACLGKRSCTVPVWTEKFY--GDPCPGIPKALLVDAQC  806



>ref|XP_009385110.1| PREDICTED: beta-galactosidase 7 [Musa acuminata subsp. malaccensis]
Length=808

 Score =   454 bits (1169),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 234/575 (41%), Positives = 336/575 (58%), Gaps = 24/575 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT +Y+V+G+ P  RSAEDI+F+V  F +K +G++VNYYMY GG NFG + SS+V+T
Sbjct  255   TENWTQRYQVYGEDPRPRSAEDIAFAVALFIAKKNGSFVNYYMYHGGTNFGKSASSYVTT  314

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG    P W HLR+ H  +KLC++ LLWG      +    E   F     
Sbjct  315   SYYDQAPLDEYGLIWLPTWGHLRELHAVIKLCQEALLWGRYTYYSLAKLQEAHLFRTNSG  374

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFL N +      L+F    Y LPAKS+SILPDCK  +FNT  + A++  RT +P 
Sbjct  375   K-CAAFLVNYDKSLVANLHFLDAIYELPAKSISILPDCKKTVFNTAKVSARYGERTAEPV  433

Query  539   K-VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             + +  + +WE   E           +    E  + TK  TDY+W++T    +++D  +  
Sbjct  434   QYLNRSQQWEASAEESNIAGKASLVAKGLLEQMSTTKDVTDYLWYTTSYNHSQQDGQI--  491

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                  L V+S+ H + VF+N E  G  HG N  +  +  +P+ +K G N+I+ L  ++  
Sbjct  492   ----TLHVDSLAHVLHVFVNDELLGTVHGKNHGELPVFDKPIPVKGGQNNISLLSVMVGL  547

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++E+R+AG +   +      ++D+T   W Y +G +GEK+ ++TEEG+++A W P
Sbjct  548   PDSGAYLEKRFAGIQHARIQGTGNLSRDLTHELWRYQVGLRGEKVLIYTEEGSKQAVWNP  607

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             V    N +   WYKT FD P G DP+A+N+  M KG VW+NG+SIGRYW SF  P G+P+
Sbjct  608   VVSFAN-KPLIWYKTRFDAPRGTDPVALNLANMGKGEVWINGESIGRYWASFKAPSGKPS  666

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q+ YH+PR +L P NNLLV+FEE GGDP SI V  ++   +C  VAE+Y P V       
Sbjct  667   QSLYHVPRSFLNPSNNLLVLFEEMGGDPRSITVDTISVARVCGHVAESYYPSV-------  719

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
                   ++   P + L C   + +  I FAS+G P G C +   G C    +  + EKAC
Sbjct  720   -----FSESKHPYVRLGCQRGRSISSIGFASFGTPVGNCKSHAMGGCHSVASRAVAEKAC  774

Query  1616  LGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             LGK +C +PV  S F    D CP I K+L V A+C
Sbjct  775   LGKEKCSIPVTTSRFR--GDPCPGITKSLLVVAEC  807



>ref|XP_010269108.1| PREDICTED: beta-galactosidase 16-like [Nelumbo nucifera]
Length=771

 Score =   451 bits (1161),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 236/578 (41%), Positives = 342/578 (59%), Gaps = 22/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ ++VFG  P  RSAEDI+F V  F + K G+Y+NYYMY GG NFG TGS++V+T
Sbjct  212   TENWTSFFQVFGGKPYIRSAEDIAFHVALFIAAKKGSYINYYMYHGGTNFGRTGSAYVTT  271

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG  R PKW HL++ H A+KLC +PLLWGT     +    E   F+    
Sbjct  272   SYYDQAPLDEYGLVRQPKWGHLKELHSAIKLCTEPLLWGTHTNFSLGNLQEAHIFQGESG  331

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + C+AFL NN+ +    +NF+   Y LP +S+S LPDCKN++FNT+ +  Q++ R+ + S
Sbjct  332   E-CSAFLVNNDAVI-AKVNFQNLSYELPQQSISTLPDCKNVVFNTRKVSTQYSARSTELS  389

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K   + +W+ F+E IP  +     +    +    TK  +DY+W++     N  D     
Sbjct  390   QKFDSSDQWKEFREVIPKFEETSITADMLLDHMDATKDVSDYLWYTFSFQNNSSD-----  444

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 +L V+S+GH +  F+N  + G  HG+       L   ++L  G  D++ L  ++  
Sbjct  445   -DQSLLQVDSLGHVVHAFLNKTYIGSAHGSYKNPGSSLNISISLSNGMTDVSLLSVMVGL  503

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             PNSGA++E R AG + V +  +  G+QD +K  W Y +G  GEK + + EE + + +W  
Sbjct  504   PNSGAYLEHRVAGLRGVKIQGIGNGSQDFSKYQWGYQVGLVGEKFRAYNEESSSEVQWN-  562

Query  1076  VTGNHNTRR--ATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                N  T +   TWYKT FD P G+DP+ +N+  MSKG VWVNG+SIGRYWVSF T  G 
Sbjct  563   ---NLGTYKPPLTWYKTTFDAPAGDDPVVLNLSTMSKGEVWVNGQSIGRYWVSFHTDGGV  619

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             P+Q  YH+PR ++KP  NLLV+ EEFGGDP  I +  V    +C  V+E++ P V  W  
Sbjct  620   PSQALYHVPRSFIKPSGNLLVLLEEFGGDPLHITLDTVTISKVCGHVSESHLPPVASW--  677

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
              G + +  T   +  + + CP  +++ KI FAS+GNP G C ++  GSC   N+  +VEK
Sbjct  678   GGGQHK--THHKRRSVQIECPHGRIISKILFASFGNPSGDCKSYAIGSCHSSNSKAVVEK  735

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             ACLG+  C +P  +S+   G D C    K L V AKC+
Sbjct  736   ACLGRRHCSIP--QSIKAFGGDPCSGTPKALLVDAKCI  771



>ref|XP_002520337.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF42123.1| beta-galactosidase, putative [Ricinus communis]
Length=771

 Score =   451 bits (1160),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 238/574 (41%), Positives = 331/574 (58%), Gaps = 38/574 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+VFG  P  R+AEDI+F V  F +++G+YVNYYMY GG NFG TGS+FV+T+
Sbjct  234   TENWTSFYQVFGGEPYIRTAEDIAFHVALFIARNGSYVNYYMYHGGTNFGRTGSAFVTTS  293

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL+D H  +K C K L+ GT     +    E   F      
Sbjct  294   YYDQAPLDEYGLIRQPKWGHLKDLHAKIKSCSKTLIRGTHQTFPLGRLQEAYVFREKSGD  353

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              C AFL NN+  +  T+ F+   Y LP KS+SILPDCK++ FNT  +  Q+  R+   S+
Sbjct  354   -CVAFLVNNDGRRDVTVRFQNRSYELPHKSISILPDCKSITFNTAKVNTQYATRSATLSQ  412

Query  542   VAGNL-KWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                ++ KWE ++E++ T D+   ++    +  + TK T+DY+W++ R     ++   RP 
Sbjct  413   EFSSVGKWEEYKETVATFDSTSLRAKTLLDHLSTTKDTSDYLWYTFRF----QNHFSRP-  467

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L   S GH +  ++NG +AG  HG++ +  F L   V LK GTN++  L   +  P
Sbjct  468   -QSTLRAYSRGHVLHAYVNGVYAGSAHGSHESTSFTLENSVRLKNGTNNVALLSVTVGLP  526

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ERR AG   V +      N+D T  SW Y +G  GEKL+++T+ G  K  W   
Sbjct  527   DSGAYLERRVAGLHRVRIQ-----NKDFTTYSWGYQVGLLGEKLQIYTDNGLNKVSWNEF  581

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G   T+  TWYKT FD P G+DPIA+N+  M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  582   RG--TTQPLTWYKTQFDAPAGSDPIALNLHSMGKGEAWVNGQSIGRYWVSFSTSKGNPSQ  639

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T YHIP+ ++KP  NLLV+ EE  G P  I V  ++   +C  V+E++            
Sbjct  640   TRYHIPQSFVKPTGNLLVLLEEEKGYPPGITVDSISISKVCGHVSESH------------  687

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
                      K  + L+CP  + + +I F+S+G PEG C  +  G C   N+  IVEKAC+
Sbjct  688   ---------KSVVQLSCPPNRNISRILFSSFGTPEGNCNQYAIGKCHSSNSRAIVEKACI  738

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GKT+C +      F  G D CP I K L V AKC
Sbjct  739   GKTKCIILRSNRFF--GGDPCPGIRKGLLVDAKC  770



>ref|XP_008466742.1| PREDICTED: beta-galactosidase 16 isoform X2 [Cucumis melo]
Length=821

 Score =   452 bits (1163),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 237/577 (41%), Positives = 340/577 (59%), Gaps = 21/577 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+ +G+ P  RSAE+I+F V  F + K+GTYVNYYMY GG NFG + S+F+ T
Sbjct  261   TENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMIT  320

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+GP+D YG  R+PKW HL++ H A+KLC  PLL GT     +    E   F+ T+ 
Sbjct  321   GYYDQGPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFK-TES  379

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF-DP  535
               CAAFL N   +    L F+   Y LP  S+SILPDCKN+ FNT+ +  Q N R+    
Sbjct  380   DECAAFLVNRGAIDTDVL-FQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTV  438

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K   + +WE F+E IP  +    ++    E    TK  +DY+W++ RV  +       P
Sbjct  439   QKFDSSEEWEEFKEPIPNFEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDS------P  492

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D      V+S  HA+  F+NG++AG  HG    K F L+  + L+ G N+I+ L  ++  
Sbjct  493   DSQQTFEVDSRAHALHAFVNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGL  552

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++E R AG + V +       +D ++  W Y +G  GE+ ++F + G+   +W  
Sbjct  553   PDSGAFLETRVAGLRRVGIQG-----EDFSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSR  607

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             +   ++++  TWYKT FD P G+DPIA+N+  M KG  WVNG+ IGRYWVSFLTP G+P+
Sbjct  608   L--GNSSQPLTWYKTRFDAPPGDDPIALNLGSMGKGAAWVNGRGIGRYWVSFLTPKGEPS  665

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW--ER  1429
             Q  Y++PR +LKP +N LV+ EE  G+P  I +  V     C  V+E++ P V  W   +
Sbjct  666   QKWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLITKTCGQVSESHYPLVASWMGAK  725

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
             K     A     +P++ L+CP  K +  I FAS+G P G C ++  G C  PN+  IVE 
Sbjct  726   KQKVRSAKNRTRRPKVQLSCPSKKKISNILFASFGTPSGDCQSYAIGMCHSPNSRPIVEH  785

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             ACLG+ +C +P+  SL  +G D CP + KTL V A+C
Sbjct  786   ACLGRVKCSIPI-SSLNFQG-DPCPHVTKTLLVDAQC  820



>ref|XP_002284529.2| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
 emb|CBI18991.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   451 bits (1160),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 234/577 (41%), Positives = 336/577 (58%), Gaps = 18/577 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y V+G+    R+AED++F V  F +K +G+++NYYMY GG NFG T SS+V T
Sbjct  258   TENWTSVYEVYGEDKRGRAAEDLAFQVALFIAKKNGSFINYYMYHGGTNFGRTSSSYVLT  317

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             AYYD+ P+D YG  R PKW HL++ H  +KLC   LL G      +    E   F+    
Sbjct  318   AYYDQAPLDEYGLIRQPKWGHLKELHAVIKLCSDTLLHGVQYNYSLGQLQEAYLFKRPSG  377

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL NN+  +  T+ F+ T+Y L A S+SILPDCK + FNT  +  Q N R+    
Sbjct  378   Q-CAAFLVNNDKRRNVTVLFQNTNYELAANSISILPDCKKIAFNTAKVSTQFNTRSVQTR  436

Query  539   KVAGNLK-WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                G+ K W  ++E IP+    P K+    E    TK  +DY+W++ R + N  +     
Sbjct  437   ATFGSTKQWSEYREGIPSFGGTPLKASMLLEHMGTTKDASDYLWYTLRFIQNSSN-----  491

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                PVL V+S+ H +  F+NG++    HG++    F L+  V L  G N I+ L  ++  
Sbjct  492   -AQPVLRVDSLAHVLHAFVNGKYIASAHGSHQNGSFSLVNKVPLNSGLNRISLLSVMVGL  550

Query  896   PNSGAWMERRYAGPKSVLLLALMTG--NQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
             P++G ++E + AG + V    +  G  ++D +K+ W Y +G  GEK +++T  G++K +W
Sbjct  551   PDAGPYLEHKVAGIRRV---EIQDGGDSKDFSKHPWGYQVGLMGEKSQIYTSPGSQKVQW  607

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
               + G+H     TWYKT FD P GNDP+ +    M KG  WVNG+SIGRYWVS+LTP G+
Sbjct  608   HGL-GSHGRGPLTWYKTLFDAPPGNDPVVLFFGSMGKGEAWVNGQSIGRYWVSYLTPSGE  666

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             P+QT Y++PR +L PK NLLVV EE  GDP  I +  V+   +C  V +++PP +  W  
Sbjct  667   PSQTWYNVPRAFLNPKGNLLVVQEEESGDPLKISIGTVSVTNVCGHVTDSHPPPIISWTT  726

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
               D   +    + P++ L CP +  + KI FAS+G P G C ++  GSC  PN++ + EK
Sbjct  727   SDDGNESHHGKI-PKVQLRCPPSSNISKITFASFGTPVGGCESYAIGSCHSPNSLAVAEK  785

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             ACLGK  C +P   SL   G D CP   K L V A+C
Sbjct  786   ACLGKNMCSIP--HSLKSFGDDPCPGTPKALLVAAQC  820



>ref|XP_010243519.1| PREDICTED: beta-galactosidase 16 [Nelumbo nucifera]
Length=813

 Score =   451 bits (1159),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 237/575 (41%), Positives = 333/575 (58%), Gaps = 15/575 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+VFG  P  RSAEDI+F V  F + K G+YVNYYMY GG NFG   S++ +T
Sbjct  251   TENWTSFYQVFGGEPYIRSAEDIAFHVALFVAAKKGSYVNYYMYHGGTNFGRVSSAYATT  310

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG  R PKW HL++ H A+KLC + LL GT N   +    E   F+    
Sbjct  311   SYYDQAPLDEYGLTRQPKWGHLKELHAAIKLCSEQLLTGTYNNFSLGQLQEAHVFQGKSG  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHR-TFDP  535
               CAAFL NN+    +T+ F+ + + LP KS+SILPDCKN+IFNT  + +Q++ R T+  
Sbjct  371   G-CAAFLVNNDIRNTSTVYFQNSSFVLPQKSISILPDCKNVIFNTAKVSSQYSARSTWLN  429

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K+  + +W+ F E IP       K     E    TK  +DY+W++     N        
Sbjct  430   QKLESSEQWKEFSEVIPNFSDTSEKETTLLEHMGTTKDASDYLWYTFSFQQNSSAKGN--  487

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                 +L V S+GH +  F+N  +AG  HG++      L   ++L  G N+I+ L  ++  
Sbjct  488   ----MLQVYSLGHVIHAFVNRIYAGSAHGSHENPGSSLNISISLNYGVNNISLLSVMVGL  543

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR AG + V +       QD +K  W Y +G  GEKLK + ++G  K +W  
Sbjct  544   PDSGAYLERRVAGLRRVRIQGTGKWLQDFSKYQWGYQVGLSGEKLKTYGDQGLAKIQWNN  603

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             +T +H  +  TWYKT FD P GNDP+ +N+  M KG  WVNG+SIGRYWVSF      P+
Sbjct  604   LTISHQ-QPLTWYKTTFDAPIGNDPVVLNLSSMGKGEAWVNGQSIGRYWVSFYPDKADPS  662

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             QT YH+PR ++K   NLLV+FEEFGG+P  + +  +    +C  V E++ P V  W  + 
Sbjct  663   QTLYHVPRSFIKNSGNLLVLFEEFGGNPLKVTLETITISKVCGHVLESHLPPVVSWLGRQ  722

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
             ++   T    KP++ L CP  + + KI FAS+GNP G C ++  G C   N+  +VEKAC
Sbjct  723   NQ---THPRRKPKVQLECPHGRTISKILFASFGNPSGDCKSYAFGRCHSSNSRAVVEKAC  779

Query  1616  LGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             LGK  C +P+    F  G D C    K L V A+C
Sbjct  780   LGKRHCSLPLSTKRF--GGDPCSDTPKALLVDAEC  812



>ref|XP_008219605.1| PREDICTED: beta-galactosidase 16 [Prunus mume]
Length=814

 Score =   450 bits (1157),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 238/578 (41%), Positives = 336/578 (58%), Gaps = 23/578 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKS-GTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+QY+V+G  P  RSAE+I++ V  F +K  G+YVNYYMY GG +FG T S FV T
Sbjct  254   TENWTSQYQVYGGEPYIRSAEEIAYQVALFIAKKRGSYVNYYMYHGGTHFGRTASPFVVT  313

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG  R PKW HL++ H A+KL    LL G      +    +   F+    
Sbjct  314   SYYDEAPLDEYGSIRQPKWGHLKELHAAVKLASSALLSGEQTSIPLGQLQDAYVFKVLSG  373

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-P  535
             + CAAFL N      T L F+ + Y LP KS+SILPDCK + FNT  + AQH  R++   
Sbjct  374   E-CAAFLVNKGPKHATVL-FQESSYQLPPKSISILPDCKKVAFNTAKVSAQHATRSWQVA  431

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K      WE ++E+IP  +    ++    E  ++TK  +DY+W++     +        
Sbjct  432   QKFDSAENWEEYKEAIPNFEKTTLRASTLPEQISITKDESDYLWYTFSFQYDS-------  484

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D    L V+S GH +  F+NG F G  HG +  + F L Q V L  G N I+ L +++  
Sbjct  485   DAQSTLSVKSHGHVLHAFVNGVFTGSAHGRHRNESFSLEQTVTLSKGINYISLLSAMVGL  544

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P++GA++ER+  G     L  +   +QD +K+SW Y +G  GEKL++ ++ G  K +W  
Sbjct  545   PDNGAYLERKVGG-----LHEVRVEDQDFSKSSWGYQVGLDGEKLQIHSDSGPSKVQWSK  599

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             + G+ + +  TWYK  FD P G+D IA+N+  M KG  WVNG+SIGR+WVSF TP G+P+
Sbjct  600   L-GSSDHQPLTWYKILFDAPAGHDSIALNLGSMGKGEAWVNGQSIGRFWVSFQTPKGKPS  658

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             QT Y++PR +LKP  NLLV+ EE  GDP  I +  V+   +C  V+E + P V  W  + 
Sbjct  659   QTWYNVPRSFLKPTGNLLVLLEEENGDPLGISLDKVSVTQVCGHVSETHLPPVSKWLVQK  718

Query  1436  DEFRATTD---DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
              + +  T      +P++ L+CP  K + K+ F+S+GNP G C  + TGSC   N+  IVE
Sbjct  719   TQNKNNTKTKLGRRPKIQLSCPPKKSISKVLFSSFGNPSGDCKTYATGSCHSSNSKAIVE  778

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             +ACLGK  C +PV    F    D CP I KTL V A+C
Sbjct  779   QACLGKRRCSIPVSLQKF---GDPCPSISKTLLVDAQC  813



>gb|KGN47702.1| hypothetical protein Csa_6G382900 [Cucumis sativus]
Length=804

 Score =   447 bits (1151),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 241/605 (40%), Positives = 342/605 (57%), Gaps = 49/605 (8%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+ +G+ P  RSAE+I+F V  F + K+GTYVNYYMY GG NFG + S+F+ T
Sbjct  216   TENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMIT  275

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG  R+PKW HL++ H A+KLC  PLL GT +   +    E   F+ T+ 
Sbjct  276   GYYDQSPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFK-TES  334

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL N   +    L F+   Y LP  S+SILPDCKN+ FNT+ +  QHN R+    
Sbjct  335   NECAAFLVNRGAIDSNVL-FQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAV  393

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             +    L+WE F+E IP ID    ++    E    TK  +DY+W++ RV  +       PD
Sbjct  394   QKFDLLEWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDS------PD  447

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                 L V+S  HA+  F+NG++AG  HG    K F L + + L+ G N+I+ L  ++  P
Sbjct  448   SQQTLEVDSRAHALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLP  507

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E R AG + V +       +D ++  W Y +G  GE+ ++F + G+   +W  +
Sbjct  508   DSGAFLETRVAGLRRVGIQG-----EDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRL  562

Query  1079  TGNHNTRRATWYK-----------------------------THFDLPEGNDPIAVNMEK  1171
              GN +++  TWYK                             T FD P G+DPIA+N+  
Sbjct  563   -GN-SSQPLTWYKVLPIINSNYLEFKCSLTDLCHCHSLLIGQTQFDAPPGDDPIALNLGS  620

Query  1172  MSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIK  1351
             M KG VWVNG+ IGRYWVSFLTP G+P+Q  Y++PR +LKP +N LV+ EE  G+P  I 
Sbjct  621   MGKGAVWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKPTDNQLVILEEETGNPVEIS  680

Query  1352  VMLVNRDTICSSVAENYPPDVKIW--ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFA  1525
             +  V     C  V+E++ P V  W   +K    R      +P++ L+CP  K +  I FA
Sbjct  681   LDSVLITKTCGQVSESHYPLVASWMGAKKQKVRRVKNRTRRPKVQLSCPSKKKISNILFA  740

Query  1526  SYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLA  1705
             S+G P G C ++  G C  PN+  IVE ACLG+ +C +P+    F    D CP + KTL 
Sbjct  741   SFGTPSGDCQSYAIGLCHSPNSRAIVEHACLGRAKCSIPISNLNFR--GDPCPHVTKTLL  798

Query  1706  VQAKC  1720
             V A+C
Sbjct  799   VDAQC  803



>ref|XP_002306647.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93643.2| beta-galactosidase family protein [Populus trichocarpa]
Length=788

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 235/574 (41%), Positives = 327/574 (57%), Gaps = 39/574 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TE+WT+ Y+V+G+    RSA+DI+F V  F +K+G+YVNYYMY GG NFG T S+F  T+
Sbjct  252   TEDWTSFYQVYGEETYMRSAQDIAFHVALFIAKTGSYVNYYMYHGGTNFGRTASAFTITS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+K C K LL G      +    +   F+    +
Sbjct  312   YYDQAPLDEYGLIRQPKWGHLKELHAAIKSCSKLLLHGAHKTFSLGPLQQAYVFQGNSGQ  371

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL NN+  +   + F+   Y LP KS+SILPDCK M FNT  + AQ+  R+  P++
Sbjct  372   -CAAFLVNNDGKQEVEVLFQSNSYKLPQKSISILPDCKTMTFNTAKVNAQYTTRSMKPNQ  430

Query  542   VAGNL-KWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                ++ KWE + E IP  D    ++    E  + TK T+DY+W++ R   N       P+
Sbjct  431   KFNSVGKWEEYNEPIPEFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQN------LPN  484

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                V   +S GH +  ++NG  AG+ HG++    F L   V LK GTN +  L + +  P
Sbjct  485   AQSVFNAQSHGHVLHAYVNGVHAGFGHGSHQNTSFSLQTTVRLKNGTNSVALLSATVGLP  544

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ERR AG + V +      N+D T  +W Y +G  GE+L+++TE G+ K KW  +
Sbjct  545   DSGAYLERRVAGLRRVRIQ-----NKDFTTYTWGYQVGLLGERLQIYTENGSNKVKWNKL  599

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               N   R   WYKT FD P GNDP+A+N+  M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  600   GTN---RPLMWYKTLFDAPAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSQGSPSQ  656

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T Y+IPR +LKP  NLLV+ EE  G P  I V  V+   +C   +E++   V+       
Sbjct  657   TWYNIPRAFLKPTGNLLVLLEEEKGYPPGITVDTVSVTKVCGYASESHLSAVQ-------  709

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
                           L+CP  + +  I FAS+G P G C ++  G+C   ++   VEKAC+
Sbjct  710   --------------LSCPLKRNISSIIFASFGTPSGNCESYAIGNCHSSSSKANVEKACI  755

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C +P     F  G D CP I K L V+AKC
Sbjct  756   GKRSCSIPQSNHFF--GGDPCPGIPKVLLVEAKC  787



>ref|XP_006301847.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
 gb|EOA34745.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
Length=821

 Score =   446 bits (1147),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 244/587 (42%), Positives = 338/587 (58%), Gaps = 33/587 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +++G++VNYYMY GG NFG   S FV T+
Sbjct  253   TENWTSFYQTYGEEPLMRSAEDIAFQVALFIARNGSFVNYYMYHGGTNFGRNASQFVITS  312

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWG---TANLNKINGDHEITTFE-N  349
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G   T  L K+     +T F   
Sbjct  313   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTIPLGKL-----LTAFVFG  367

Query  350   TDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTF  529
                 LC+A L N +    +T+ F  + Y L  KS+S+LPDCKN+ FNT  + AQ+N RT 
Sbjct  368   KKANLCSALLVNQDKCD-STVQFHNSSYILSPKSISVLPDCKNVAFNTAKVNAQYNTRTR  426

Query  530   DPSK-VAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLP  706
             +P + ++    WE F E+IP+      +S    E    T+ T+DY+W +TR    +  L 
Sbjct  427   EPRQNLSSPHMWEEFTETIPSFSETSVRSEFFLEHMNTTQDTSDYLWQTTRFHQPEEAL-  485

Query  707   MRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSI  886
                    VL V  +GH +  F+NG F G  HG   A  F+L + V+L  GTN+I  L  +
Sbjct  486   ------SVLKVNHLGHVLHAFVNGRFIGSMHGTFKAHRFLLEKNVSLNNGTNNIALLSVM  539

Query  887   LSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEK  1060
             +  PNSGA +ERR  G +      +  G   +  N  SW Y +G QGEK   +TE GA K
Sbjct  540   VGLPNSGAHLERRVVGTRGA---KIWNGKHTLYFNNYSWGYQVGLQGEKFHAYTENGAAK  596

Query  1061  AKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTP  1240
              +W     +  ++  TWYK  FD PEG D +A+N+  M KG  WVNG+SIGRYWVSF T 
Sbjct  597   VQWKQYR-DSKSQPLTWYKASFDTPEGTDSVALNLGSMGKGEAWVNGQSIGRYWVSFHTY  655

Query  1241  LGQPTQTEYHIPRPWLKP-KNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDV  1414
              G P+Q  YHIPR +LK   +NLLV+  EE  G+P  I +  V+   +CS V+ ++PP V
Sbjct  656   KGNPSQIWYHIPRSFLKRNSSNLLVILEEEREGNPLGITIDTVSVTNVCSHVSSSHPPPV  715

Query  1415  KIWERKGDEFRATTD-----DLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCS  1579
                 RKG             D +P++ L CP+ + + K+ FAS+G P G C ++  GSC 
Sbjct  716   ISQRRKGHNRNKRRHLNHQYDRRPKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSCH  775

Query  1580  FPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              P ++ ++ KACL K++C V V    F  G D CP  VK+L V A+C
Sbjct  776   SPKSLAVIHKACLNKSKCSVSVWSKTF--GVDSCPHAVKSLLVHAQC  820



>ref|XP_011003430.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=788

 Score =   445 bits (1144),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 237/574 (41%), Positives = 326/574 (57%), Gaps = 39/574 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TE+WT+ Y+V+G+    RSA+DI+F V  F +K+G+YVNYYMY GG NFG T S+F  T+
Sbjct  252   TEDWTSFYQVYGEETYMRSAQDIAFHVALFIAKTGSYVNYYMYHGGTNFGRTASAFTITS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+K C K LL G      +    +   F+    +
Sbjct  312   YYDQAPLDEYGLIRQPKWGHLKELHAAIKSCSKLLLHGEHKTFSLGPLQQAYVFQGNSGQ  371

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFL NN+  +   + F+   Y LP KS+SILPDCK M FNT ++ AQ+  R+  P++
Sbjct  372   -CAAFLVNNDGKQEVEVLFQSNSYKLPQKSISILPDCKTMTFNTANVNAQYTTRSMKPNQ  430

Query  542   VAGNL-KWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                ++ KWE + E IP  D    ++    E  + TK T+DY+W++ R   N       P+
Sbjct  431   KFNSVGKWEEYNEPIPEFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQN------LPN  484

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                V   +S GH +  ++NG  AGY HG++    F L   V LK GTN++  L + +  P
Sbjct  485   AQSVFNAQSRGHVLHAYVNGVHAGYGHGSHQNTSFSLQTTVPLKNGTNNVALLSATVGLP  544

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++ERR AG + V +      N+D T   W Y +G  GE+L+++TE G+ K KW   
Sbjct  545   DSGAYLERRVAGLRRVRIQ-----NKDFTTYMWGYQVGLLGERLQIYTENGSNKVKWNKF  599

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
               N   R   WYKT FD P GNDP+A+N+  M KG  WVNG+SIGRYWVSF T  G P+Q
Sbjct  600   GTN---RPLMWYKTLFDAPAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGSPSQ  656

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T Y+IPR +LKP  NLLV+ EE  G P  I V  V+   +C   +E +   V+       
Sbjct  657   TWYNIPRAFLKPTGNLLVLLEEEKGYPPGITVDTVSVTKVCGYASEPHLSAVQ-------  709

Query  1439  EFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACL  1618
                           L+CP  + +  I FAS+G P G C +F  G+C   ++   VEKAC+
Sbjct  710   --------------LSCPPKRNISSIIFASFGTPSGNCESFAIGNCHSSSSKANVEKACI  755

Query  1619  GKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             GK  C +P     F  G D CP I K L V+AKC
Sbjct  756   GKRSCSIPQSNHFF--GGDPCPGIPKVLLVEAKC  787



>ref|XP_011069386.1| PREDICTED: beta-galactosidase 16 [Sesamum indicum]
Length=810

 Score =   445 bits (1145),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 233/575 (41%), Positives = 337/575 (59%), Gaps = 16/575 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT  Y ++G+    RSA+DI++ V  F  K +G+Y+NYYMY GG NFG   SSFV T
Sbjct  249   TENWTHFYDIYGNKTKIRSAQDIAYQVALFIVKMNGSYINYYMYHGGTNFGRMASSFVIT  308

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG  R PKW HL++ H A+KLC   LL+G  +   +    E   +   D 
Sbjct  309   SYYDQAPLDEYGLTRQPKWGHLKELHAAVKLCSDTLLYGQQSNFSLGALQEAYVYSR-DN  367

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL N + +    + F    + LPAKS+SILPDC N+ FNT  +  Q + R+   +
Sbjct  368   RECAAFLFNMDKVNDAEVQFLNRTFQLPAKSISILPDCTNVAFNTAKVSTQMSTRSTQKA  427

Query  539   KVAGNLK-WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                 + + W+ + E+IP  D    +S +  E    TK  +DY+W++T    ++       
Sbjct  428   VGLDSPEIWKEWNEAIPAFDDSLLRSDSLLEQMNTTKDASDYLWYTTSYQQSE-------  480

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D   V+ V S GH +  F+NG   G  HG    + F L   V L  G N+I+ L +++  
Sbjct  481   DSQSVITVNSRGHVLHTFVNGALVGSAHGAFRNQSFTLETTVPLNSGLNNISLLSNMVGL  540

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++ERR AG  +V +       +++T  SW Y +G  GE+L+  TEEG+  A+W  
Sbjct  541   PDSGAFLERRAAGLHTVTIQENQV-VKNLTNYSWGYQVGLLGERLQFHTEEGSSHAQW--  597

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             +  N +++  TWYK+ FD P GNDP+A+N+  M KG  W+NG+SIGRYW+SF TP G P+
Sbjct  598   LNFNSSSQPLTWYKSKFDAPGGNDPVALNLGSMGKGEAWINGESIGRYWISFHTPDGSPS  657

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKG  1435
             Q  YHIPR +LKP +NLLV+FEE  G+P  I V +V+   +C  V+++ PP V  W R+ 
Sbjct  658   QIWYHIPRSFLKPTDNLLVLFEEEIGNPLGISVDIVSISKVCGHVSDSNPPPVVSWRREM  717

Query  1436  DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKAC  1615
                       +P++ L CP  + + KI FAS+G+P G C ++  GSC   N++ +VEKAC
Sbjct  718   PSHN-KHHGRRPKVQLRCPSERNISKILFASFGSPSGDCKSYAVGSCHSTNSMAVVEKAC  776

Query  1616  LGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             LGK  C +P     F  G D CP I K L ++A+C
Sbjct  777   LGKKMCSIPWSNKKF--GGDPCPGIPKRLLIEAEC  809



>emb|CAN64508.1| hypothetical protein VITISV_004610 [Vitis vinifera]
Length=766

 Score =   444 bits (1141),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 229/569 (40%), Positives = 331/569 (58%), Gaps = 18/569 (3%)
 Frame = +2

Query  26    RVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVSTAYYDEGPM  202
             R +G+    R+AED++F V  F +K +G+++NYYMY GG NFG T SS+V TAYYD+ P+
Sbjct  211   RYYGEDKRGRAAEDLAFQVALFIAKKNGSFINYYMYHGGTNFGRTSSSYVLTAYYDQAPL  270

Query  203   DIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLKLCAAFLS  382
             D YG  R PKW HL++ H  +KLC   LL G      +    E   F+    + CAAFL 
Sbjct  271   DEYGLIRQPKWGHLKELHAVIKLCSDTLLXGVQYNYSLGQLQEAYLFKRPSGQ-CAAFLV  329

Query  383   NNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSKVAGNLK-  559
             NN+  +  T+ F+ T+Y L A S+SILPDCK + FNT  +  Q N R+       G+ K 
Sbjct  330   NNDKRRNVTVLFQNTNYELAANSISILPDCKKIAFNTAKVSTQFNTRSVQTRATFGSTKQ  389

Query  560   WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPVLFV  739
             W  ++E IP+    P K+    E    TK  +DY+W++ R + N  +        PVL V
Sbjct  390   WSEYREGIPSFGGTPLKASMLLEHMGTTKDASDYLWYTLRFIHNSSN------AQPVLRV  443

Query  740   ESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAWME  919
             +S+ H ++ F+NG++    HG++    F L+  V L  G N I+ L  ++  P++G ++E
Sbjct  444   DSLAHVLLAFVNGKYIASAHGSHQNGSFSLVNKVPLNSGLNRISLLSVMVGLPDAGPYLE  503

Query  920   RRYAGPKSVLLLALMTG--NQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNHN  1093
              + AG + V    +  G  ++D +K+ W Y +G  GEKL+++T  G++K +W  + G+H 
Sbjct  504   HKVAGIRRV---EIQDGGXSKDFSKHPWGYQVGLMGEKLQIYTSPGSQKVQWYGL-GSHG  559

Query  1094  TRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHI  1273
                 TWYKT FD P GNDP+ +    M KG  WVNG+SIGRYWVS+LTP G+P+QT Y++
Sbjct  560   RGPLTWYKTLFDAPRGNDPVVLFFGSMGKGEAWVNGQSIGRYWVSYLTPSGEPSQTWYNV  619

Query  1274  PRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDEFRAT  1453
             PR +L PK NLLVV EE  GDP  I +  V+   +C  V +++PP +  W    D   + 
Sbjct  620   PRAFLNPKGNLLVVQEEESGDPLKISIGTVSVTNVCGHVTDSHPPPIISWTTSDDGNESH  679

Query  1454  TDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTEC  1633
                + P++ L CP +  + KI FAS+G P G C ++  GSC  PN++ + EKACLGK  C
Sbjct  680   HGKI-PKVQLRCPPSSNISKITFASFGTPVGGCESYAIGSCHSPNSLAVAEKACLGKNXC  738

Query  1634  EVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              +P   SL   G D CP   K L V A+C
Sbjct  739   SIP--HSLKSFGDDPCPGTPKALLVAAQC  765



>ref|XP_010664184.1| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
Length=817

 Score =   444 bits (1143),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 242/579 (42%), Positives = 338/579 (58%), Gaps = 22/579 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y +FG+    R  EDI+F V  F +K +G+++NYYMY GG NFG T S++V T
Sbjct  254   TENWTSSYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGTNFGRTASAYVQT  313

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGT-ANLNKINGDHEITTFENTD  355
             AYYDE P+D YG  + P W HL++ H A+KLC + LL G  +NL+      E   F    
Sbjct  314   AYYDEAPLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGTKLQEAYVFRGQS  373

Query  356   LKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP  535
              K CAAFL NN++    T+ F+ T Y LP KS+SILPDCKN  FNT  I  Q N R+   
Sbjct  374   GK-CAAFLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAKISTQQNTRSIQT  432

Query  536   -SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
              +K     +WE ++ESI   D   +++    E    TK  +DY+W++ R   +  +    
Sbjct  433   VTKFNSTEQWEEYKESILNFDDTSSRANTLLEHMNTTKDASDYLWYTFRYNNDPSNG---  489

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
                  VL   S  HA+  FING   G  HG++    F L   V+ + G N+++ L  ++ 
Sbjct  490   ---QSVLSTNSRAHALHAFINGRHTGSQHGSSSNLSFSLDNTVSFRAGINNVSLLSVMVG  546

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGN-QDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
              P+SGA++ERR AG + V + +   G+ +D T N W Y +G  GEKL+++T+ G++K +W
Sbjct  547   LPDSGAYLERRVAGLRRVRIQS--NGSLKDFTNNPWGYQVGLLGEKLQIYTDVGSQKVQW  604

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                 G+  +   TWYKT FD P GN+P+A+N+  M KG VWVNG+SIGRYWVSFLTP G+
Sbjct  605   SKF-GSSTSGLLTWYKTVFDAPAGNEPVALNLVSMRKGEVWVNGQSIGRYWVSFLTPSGK  663

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDV--KIW  1423
             P+Q  YHIPR +LKP  NLLV+ EE  G P  I +  V+   IC  V+E++ P V  ++ 
Sbjct  664   PSQIWYHIPRSFLKPTGNLLVLLEEETGHPVGISIGKVSIPKICGHVSESHLPPVISRVI  723

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
              +K +         +P++ L CP  + + +I FAS+G P G C ++  GSC   N+   V
Sbjct  724   YKKHENHHGR----RPKVQLRCPSNRNISRILFASFGTPSGDCQSYAVGSCHSSNSRSNV  779

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EKACLGK  C VP+    F  G D CP   K L V  +C
Sbjct  780   EKACLGKGMCSVPLSYKRF--GGDPCPGTPKALLVDVQC  816



>ref|XP_011003960.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=818

 Score =   444 bits (1142),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 235/581 (40%), Positives = 336/581 (58%), Gaps = 24/581 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRF-YSKSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT +YRV+G+    RSAEDI+F V  F  +K+G++VNYYMY GG NFG T S+FV+T
Sbjct  253   TENWTTRYRVYGEDAPIRSAEDIAFHVTLFIVAKNGSFVNYYMYHGGTNFGRTASAFVTT  312

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG    PKW HL++ H A++LC  PLL G   +N   G  +     N   
Sbjct  313   SYYDQAPLDEYGLTTQPKWGHLKELHAAIQLCSTPLLSGV-QVNFYLGPQQQAYIFNAVS  371

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL NN++    ++ FR   Y LP  S+SILPDCKN+ FNT  +  Q+  RT    
Sbjct  372   GECAAFLINNDSRNAASVPFRNASYDLPPMSISILPDCKNVAFNTAKVSTQYTARTMGRG  431

Query  539   KV--AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
             +V  A ++ W+ F E+IP  D+   +S    E    TK ++DY+W++ R+          
Sbjct  432   EVLDAADM-WQEFTEAIPNFDSTSTRSETLLEQMNTTKDSSDYLWYTLRLQHESS-----  485

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
              D   +L V S+GHA+  F+NG+  G   G++    F     V+L  G N+++ L  ++ 
Sbjct  486   -DTQTILDVSSLGHALHAFVNGQAVGSVQGSHKNPRFKFETSVSLSKGINNVSLLSVMVG  544

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
              P+SGA++E R AG ++V++      N D T +SW Y IG QGE  +++TE+G+ + +W 
Sbjct  545   MPDSGAFLENRAAGLRTVMIRDKQD-NNDFTNDSWGYQIGLQGETSQIYTEQGSSQVRWK  603

Query  1073  --PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLG  1246
                V GN      TWYKT  D P G+ P+A+N+  M KG  WVNG+SIGRYW S+ TP G
Sbjct  604   KFSVAGN----PLTWYKTRVDAPPGDVPVALNLASMGKGEAWVNGRSIGRYWPSYRTPNG  659

Query  1247  QPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWE  1426
                QT Y++PR +LKP  NLLV+ EE GG+P  + +  V+   +C  V  ++   V  W 
Sbjct  660   S-AQTWYNVPRSFLKPAGNLLVLQEEKGGNPLQVSLDTVSISQVCGHVTASHLAPVSSWT  718

Query  1427  RKGDEFR--ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGN-FMTGSCSFPNAIK  1597
                  ++  A     +P++ L CP    + +I FASYG P G C N    G+C   N+  
Sbjct  719   EHNQRYKNPAKVSGRRPKVQLACPSKSKISRISFASYGTPLGNCRNSLAVGTCHSQNSKA  778

Query  1598  IVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             +VE+ACLGK +C +PV +  F  G D CP   K+L V A+C
Sbjct  779   VVEEACLGKMKCSIPVSERRF--GGDPCPAKAKSLMVVAEC  817



>ref|XP_008783343.1| PREDICTED: beta-galactosidase 7-like [Phoenix dactylifera]
Length=751

 Score =   442 bits (1136),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/577 (41%), Positives = 339/577 (59%), Gaps = 25/577 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWTA+Y V+G  P  R  ED++FSV  F + K+G++VNYYMY GG NFG + SS+V+T
Sbjct  197   TENWTARYPVYGKEPSMRRVEDLAFSVALFIARKNGSFVNYYMYHGGTNFGKSPSSYVTT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD  P+D YG    P W HLR+ H  +KL  +PLLWGT     +    E   F+    
Sbjct  257   SYYDRAPLDEYGLIWLPTWGHLRELHAVIKLSSEPLLWGTYTNVSLGQLQEAHVFQTNSG  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFL N +     T+ F    Y LP+KS+SILPDCK++ FNT  + AQ+ +R+    
Sbjct  317   K-CAAFLVNFDEHLNATVCFHNATYELPSKSISILPDCKSVAFNTAKVSAQYGNRSARAV  375

Query  539   KVAGNLK-WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             +   N K W  F + +P +      +    E  + TK  TDY+W++        D     
Sbjct  376   QSFDNAKKWMAFLDGVPNVHDASFITKELLEQMSTTKDVTDYLWYTFSYNYKSSDG----  431

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQP-VNLKPGTNDITFLCSILS  892
                  L V+S  H +  F+N EF G  HG++     +  +  ++L+ G N+++ L  ++ 
Sbjct  432   --QQALHVDSRAHVLHAFVNDEFVGSVHGSSDGPRIMTFEKDISLREGQNNLSLLSVMVG  489

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
              P+SGA++E+R+AG + V +    +  Q++T   W Y IG  GEKL+++T++G  K  W 
Sbjct  490   LPDSGAYLEKRFAGLRRVSIHCNGSRPQNLTNWLWGYQIGLLGEKLEIYTQKGLPKVDWK  549

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
              V G+   +  TWYKT F +P G +P+A+++  M KG VW+NG+SIGRYWVSF +P GQP
Sbjct  550   TV-GSSICKPLTWYKTTFHVPLGTNPVALDLSSMGKGEVWINGESIGRYWVSFTSPNGQP  608

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             +QT YH+PR +LKP  NLLV+FEE GGDP  I V  ++   ICS+VAE++ P +   +RK
Sbjct  609   SQTLYHVPRSFLKPFGNLLVLFEELGGDPLGITVNTISVTHICSNVAESFSPSL-FSKRK  667

Query  1433  GDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
                        +P + L C + + +  I+FASYGNP G C N+  G+C    +  ++EKA
Sbjct  668   -----------QPSVQLQCHEGQAIYSIKFASYGNPIGDCENYALGTCHSVLSKAVMEKA  716

Query  1613  CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             C+GK  C +P+  + F  G D CP I K+L V A CV
Sbjct  717   CVGKRRCSIPISATKF--GGDPCPGIAKSLLVVADCV  751



>dbj|BAC43014.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64909.1| At1g77410 [Arabidopsis thaliana]
Length=820

 Score =   444 bits (1141),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 239/562 (43%), Positives = 330/562 (59%), Gaps = 25/562 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G+ P  RSAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  251   TENWTSFYQTYGEEPLIRSAEDIAFHVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G      + G  +          
Sbjct  311   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISL-GKLQTAFVFGKKAN  369

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAA L N +  + +T+ FR + Y L  KSVS+LPDCKN+ FNT  + AQ+N RT    K
Sbjct  370   LCAAILVNQDKCE-STVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRT---RK  425

Query  542   VAGNLK----WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
                NL     WE F E++P+      +S +  E    T+ T+DY+W +TR   ++     
Sbjct  426   ARQNLSSPQMWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSE-----  480

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
                   VL V  +GHA+  F+NG F G  HG   A  F+L + ++L  GTN++  L  ++
Sbjct  481   --GAPSVLKVNHLGHALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMV  538

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEKA  1063
               PNSGA +ERR  G +SV    +  G   +  N  SW Y +G +GEK  ++TE+G+ K 
Sbjct  539   GLPNSGAHLERRVVGSRSV---KIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKV  595

Query  1064  KWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPL  1243
             +W     +  ++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SIGRYWVSF T  
Sbjct  596   QWKQYR-DSKSQPLTWYKASFDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYK  654

Query  1244  GQPTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKI  1420
             G P+Q  YHIPR +LKP +NLLV+  EE  G+P  I +  V+   +C  V+   P  V  
Sbjct  655   GNPSQIWYHIPRSFLKPNSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVIS  714

Query  1421  WERKGDEFRATT--DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               +KG   +  T   D KP++ L CP  + + KI FAS+G P G CG++  GSC  PN++
Sbjct  715   PRKKGLNRKNLTYRYDRKPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSL  774

Query  1595  KIVEKACLGKTECEVPVEKSLF  1660
              +V+KACL K+ C VPV    F
Sbjct  775   AVVQKACLKKSRCSVPVWSKTF  796



>ref|XP_002521778.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF40588.1| beta-galactosidase, putative [Ricinus communis]
Length=828

 Score =   443 bits (1140),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 237/589 (40%), Positives = 328/589 (56%), Gaps = 27/589 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRF-YSKSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT +Y + G+    RS EDI+F V +F  +K G++VNYYMY GG NFG T S+FV T
Sbjct  250   TENWTTRYVITGENIRIRSVEDIAFQVTQFIVAKKGSFVNYYMYHGGTNFGRTASAFVPT  309

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD+ P+D YG  R PKW HL++ H A+KLC  PLL G      +    +   F     
Sbjct  310   SYYDQAPIDEYGLIRQPKWGHLKEMHAAIKLCLTPLLSGGQVTISLGQQQQAFVFTGLSG  369

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL NN+T    ++ FR   Y LP  S+SILPDCK + FNT  +  Q+  R+   S
Sbjct  370   E-CAAFLLNNDTANTASVQFRNASYDLPPNSISILPDCKTVAFNTAKVSTQYTTRSMTRS  428

Query  539   KVA-GNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             K+  G  KW  +QE+I   D    KS A  E  + TK  +DY+W++ R            
Sbjct  429   KLLDGEDKWVQYQEAIVNFDETSVKSEAILEQMSTTKDASDYLWYTFRFQQESS------  482

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D   VL V S+GH +  F+NG+  GY  G++   +F L   V+L  G N+++ L  ++  
Sbjct  483   DTQAVLNVRSLGHVLHAFVNGQAVGYAQGSHKNPQFTLQSTVSLSEGVNNVSLLSVMVGM  542

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA+MERR AG + V +     GN++ T  SW Y +G  GEKL++FT++G+ + +W  
Sbjct  543   PDSGAYMERRAAGLRKVKIQE-KEGNKEFTNYSWGYQVGLLGEKLQIFTDQGSSQVQWAN  601

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
              + N      TWYKT FD P  + P+A+N+  M KG  WVNG+SIGRYW S+    G   
Sbjct  602   FSKNA-LNPLTWYKTLFDAPLEDAPVALNLGSMGKGEAWVNGQSIGRYWPSYRASDGSSQ  660

Query  1256  -------------QTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAE  1396
                             Y++PR +LKPK NLLVV EE GG+P  I V   +   ICS V  
Sbjct  661   IWYAYFNTGAIFRAVRYNVPRSFLKPKGNLLVVLEESGGNPLQISVDTASISKICSHVTA  720

Query  1397  NYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGN-FMTGS  1573
             ++ P V  W ++ +     +   +PR+ L CP    +  I FASYG PEG CG+ +  G 
Sbjct  721   SHLPLVSSWSKRTNTDNNNSLQARPRVKLDCPSNTKISNILFASYGTPEGTCGDAYAVGM  780

Query  1574  CSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             C   ++  IV+KACLG+  C +PV    F  G D C    K+L V A+C
Sbjct  781   CHSSSSEAIVQKACLGQMRCSIPVSSKYF--GGDPCSANEKSLLVVAEC  827



>ref|XP_011027489.1| PREDICTED: beta-galactosidase 16 [Populus euphratica]
Length=816

 Score =   442 bits (1138),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 238/581 (41%), Positives = 332/581 (57%), Gaps = 23/581 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G     RSAEDI+F    F +K G++VNYYMY GG NFG T + +V T+
Sbjct  252   TENWTSVYQTYGKETRSRSAEDIAFHAALFIAKGGSFVNYYMYHGGTNFGRTAAEYVPTS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLL---WGTANLNKINGDHEITTFE-N  349
             YYD+ P+D YG  R PK  HL++ H A+KLC+KPLL   W   +L ++    E   FE N
Sbjct  312   YYDQAPLDEYGLLRQPKHGHLKELHAAIKLCRKPLLSRKWINFSLGQLQ---EAFAFERN  368

Query  350   TDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHR-T  526
             +D   CAAFL N++     T++F+G+ Y LP KS+SILPDCK + FNT  +  Q+  R  
Sbjct  369   SD--NCAAFLVNHDGRSNATVHFKGSSYELPPKSISILPDCKTVAFNTAQVSTQYGTRLA  426

Query  527   FDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLP  706
                 K     +W+ ++E IP+ D    ++    E    TK ++DY+W++ R   N     
Sbjct  427   TRRHKFDSIEQWKEYKEYIPSFDKSSLRADMLLEHMNTTKDSSDYLWYTFRFHQNS----  482

Query  707   MRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSI  886
                D H VL V S+GH +  F+NGEF G  HG++  K FIL + + LK GTN ++ L  +
Sbjct  483   --SDAHSVLTVNSLGHNLHAFVNGEFIGSAHGSHDNKSFILQRILPLKRGTNYVSLLSVM  540

Query  887   LSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
                P++GA++ERR AG + V  +       D T   W Y +G  GE ++L     + KA 
Sbjct  541   TGLPDAGAYLERRVAGLRRV-TIQRQHELHDFTSYLWGYKVGLSGENIQLHRNNASVKAY  599

Query  1067  WGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLG  1246
             W       +++  +WYK+ FD P GNDP+A+N+  M KG  WVNG+SIGRYWVSFL   G
Sbjct  600   WSRYAS--SSQPLSWYKSIFDAPVGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDG  657

Query  1247  QPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW-  1423
              P QT  HIPR +LKP  NLLV+ EE  G+P  I +  ++   +C  V+ ++PP V  W 
Sbjct  658   NPYQTWNHIPRSFLKPSGNLLVILEEERGNPLGISLGTMSITKVCGHVSVSHPPPVISWQ  717

Query  1424  -ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKI  1600
              E + +  R      +P++ L CP  + +  + F+S+G P G C     GSC   N+   
Sbjct  718   GENQINGTRKRKYGRRPKVQLRCPRGRKISSVLFSSFGTPSGDCETHAIGSCHASNSRAT  777

Query  1601  VEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             VEKACLGK  C +PV    F    D CP I K+L V AKC 
Sbjct  778   VEKACLGKERCSIPVSTKNF--KGDPCPGIAKSLMVDAKCA  816



>ref|NP_001132807.1| uncharacterized protein LOC100194296 [Zea mays]
 gb|ACF81804.1| unknown [Zea mays]
Length=467

 Score =   430 bits (1106),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 287/461 (62%), Gaps = 8/461 (2%)
 Frame = +2

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-P  535
             K+C AFLSN+NT    T+ FRG  Y++P  S+S+L DC+ ++F TQH+ AQHN RTF   
Sbjct  5     KVCVAFLSNHNTKDDATMTFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFA  64

Query  536   SKVAGNLKWEMFQ-ESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
              + A N  WEMF  E++P       +     ++Y LTK  TDYVW+++   +   D+P+R
Sbjct  65    DQTAQNNVWEMFDGENVPKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIR  124

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
              DI  VL V S GHA + F+N +F G  HG  + K F L +P++LK G N +  L S + 
Sbjct  125   SDIKTVLEVNSHGHASVAFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMG  184

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
               +SGA+ME R AG   V +  L  G  D+T N W + +G  GE+ +++T++G     W 
Sbjct  185   MTDSGAYMEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWK  244

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQP  1252
             P     N R  TWYK HFD+P G DP+ ++M  M KGM++VNG+ IGRYW+S+   LG+P
Sbjct  245   PAM---NDRPLTWYKRHFDMPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRP  301

Query  1253  TQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERK  1432
             +Q  YH+PR +L+ K+N+LV+FEE  G PD+I ++ V RD IC+ ++E  P  +  WERK
Sbjct  302   SQQLYHVPRSFLRQKDNMLVLFEEEFGRPDAIMILTVKRDNICTFISERNPAHIMSWERK  361

Query  1433  GDEF--RATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVE  1606
               +   +A  DDL+ R  L CP  K+++++ FASYGNP G+CGN+  GSC  P A ++VE
Sbjct  362   DSQITAKANADDLRARAALACPPKKLIQQVVFASYGNPAGICGNYTVGSCHTPRAKEVVE  421

Query  1607  KACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             KACLGK  C +PV   ++  G   C     TLAVQAKC ++
Sbjct  422   KACLGKRVCTLPVAADVY-GGDANCSGTTATLAVQAKCSKR  461



>ref|XP_002302225.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE81498.2| beta-galactosidase family protein [Populus trichocarpa]
Length=816

 Score =   441 bits (1134),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/581 (41%), Positives = 331/581 (57%), Gaps = 23/581 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G     RSAEDI+F    F +K G++VNYYMY GG NFG T + +V T+
Sbjct  252   TENWTSVYQTYGKETRSRSAEDIAFHAALFIAKGGSFVNYYMYHGGTNFGRTAAEYVPTS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLL---WGTANLNKINGDHEITTFE-N  349
             YYD+ P+D YG  R PK  HL++ H A+KLC+KPLL   W   +L ++    E   FE N
Sbjct  312   YYDQAPLDEYGLLRQPKHGHLKELHAAIKLCRKPLLSRKWINFSLGQLQ---EAFAFERN  368

Query  350   TDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHR-T  526
             +D   CAAFL N++     T++F+G+ Y LP KS+SILP CK + FNT  +  Q+  R  
Sbjct  369   SDE--CAAFLVNHDGRSNATVHFKGSSYKLPPKSISILPHCKTVAFNTAQVSTQYGTRLA  426

Query  527   FDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLP  706
                 K     +W+ ++E IP+ D    ++    E    TK ++DY+W++ R   N     
Sbjct  427   TRRHKFDSIEQWKEYKEYIPSFDKSSLRANTLLEHMNTTKDSSDYLWYTFRFHQNS----  482

Query  707   MRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSI  886
                + H VL V S+GH +  F+NGEF G  HG++  K F L + + LK GTN ++ L  +
Sbjct  483   --SNAHSVLTVNSLGHNLHAFVNGEFIGSAHGSHDNKSFTLQRSLPLKRGTNYVSLLSVM  540

Query  887   LSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
                P++GA++ERR AG + V +        D T   W Y +G  GE ++L     + KA 
Sbjct  541   TGLPDAGAYLERRVAGLRRVTI-QRQHELHDFTTYLWGYKVGLSGENIQLHRNNASVKAY  599

Query  1067  WGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLG  1246
             W     +  +R  TWYK+ FD P GNDP+A+N+  M KG  WVNG+SIGRYWVSFL   G
Sbjct  600   WSRYASS--SRPLTWYKSIFDAPAGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDG  657

Query  1247  QPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIW-  1423
              P QT  HIPR +LKP  NLLV+ EE  G+P  I +  ++   +C  V+ ++PP V  W 
Sbjct  658   NPYQTWNHIPRSFLKPSGNLLVILEEERGNPLGISLGTMSITKVCGHVSISHPPPVISWQ  717

Query  1424  -ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKI  1600
              E + +  R      +P++ L CP  + +  + F+S+G P G C  +  GSC   N+   
Sbjct  718   GENQINGTRKRKYGRRPKVQLRCPRGRKISSVLFSSFGTPSGDCEAYAIGSCHASNSRAT  777

Query  1601  VEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             VEKACLGK  C +PV    F    D CP I K+L V AKC 
Sbjct  778   VEKACLGKERCSIPVSSKNF--KGDPCPGIAKSLLVDAKCA  816



>ref|XP_007019138.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY16363.1| Beta-galactosidase [Theobroma cacao]
Length=805

 Score =   441 bits (1133),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 232/576 (40%), Positives = 336/576 (58%), Gaps = 25/576 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+  + +G     RSA DI+F V  F +K+G+YVNYYMY GG NFG T ++++ T+
Sbjct  251   TENWTSFLQRYGQEVFLRSATDIAFHVALFIAKNGSYVNYYMYHGGTNFGRTAAAYIITS  310

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R P W HL++ H A++LC KPLL G           +   F+     
Sbjct  311   YYDQAPLDEYGLIRQPLWGHLKELHAAIRLCTKPLLSGAYETYSSGKLQDAYVFKGKSSG  370

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
              CAAFL N++      + F+   + LP  S+SILPDCKN+ FNT  +  Q+N R+     
Sbjct  371   DCAAFLVNSDNTTNARVRFQNVSFELPPMSISILPDCKNVAFNTAKVSTQYNTRSMTVRH  430

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             K     +WE ++E IPT      ++    +  + TK T+D++W++    ++        D
Sbjct  431   KFDSTGRWEEYKEPIPTFSKTKLRAKNLLDHMSTTKDTSDHLWYTLSFQLDS-------D  483

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
                VL V S  H +  F+NG + GY +G    K F L   V+L  GTN+I+ L  ++ +P
Sbjct  484   AQAVLSVTSDAHVLHSFVNGAYTGYAYGGK--KNFELNNTVHLNNGTNNISLLSVMVGFP  541

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA++E + AG +SV +      N+D+    W Y +G  GE  ++FTE G+ K +W   
Sbjct  542   DSGAYLEHKTAGIQSVTIQ-----NEDLNNYQWGYQVGLSGESSRIFTEHGSNKVQWNRF  596

Query  1079  TGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQ  1258
              G H+  R TWYKT FD P GNDP+A+N+  M KG VWVNG+SIGRYWVS  TP  +P+Q
Sbjct  597   HGIHH--RLTWYKTLFDAPGGNDPLALNLGSMGKGEVWVNGQSIGRYWVSLHTPELRPSQ  654

Query  1259  TEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD  1438
             T Y+IPRP+LKP  NLLV+ EE  GDP  I +  ++   +C  V+E++ P V +  + G 
Sbjct  655   TWYNIPRPFLKPTGNLLVLLEEEYGDPLRITLGSISISKVCGHVSESHLPPV-MQSQSGV  713

Query  1439  EFRATTDDL--KPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKA  1612
              +     DL  +P++ L CP  + + +I FAS+G P G C N+  G+C   ++  IVEKA
Sbjct  714   NY---NKDLARRPKVQLHCPPERNISRILFASFGTPSGDCNNYAIGNCHLSSSRAIVEKA  770

Query  1613  CLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             CLGK +C + +    F  G+D CP I KTL + A+C
Sbjct  771   CLGKKKCSIRLPDQAF--GRDPCPGIPKTLLIDAQC  804



>gb|EYU31765.1| hypothetical protein MIMGU_mgv1a018569mg [Erythranthe guttata]
Length=817

 Score =   438 bits (1126),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 238/579 (41%), Positives = 335/579 (58%), Gaps = 20/579 (3%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT  Y ++G+    RS EDI++ V  F  K +G+++NYYMY GG NFG   S+F+ T
Sbjct  252   TENWTHFYDIYGNITKIRSPEDIAYQVALFIVKMNGSFINYYMYHGGTNFGRNASAFIIT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHE--ITTFENT  352
             +YYD+ P+D YG  R PKW HL++ H A+KLC + LL G  +   +    E  + T EN 
Sbjct  312   SYYDQAPLDEYGLIRQPKWGHLQELHAAVKLCSETLLNGVQSNFSLGVLQEAYVYTRENG  371

Query  353   DLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD  532
             +   CAAFL N +      + FR   Y LP KS+SILPDCK + FNT  +  Q   RT  
Sbjct  372   E---CAAFLLNRDGEHGANIQFRNRTYQLPPKSISILPDCKTVAFNTAKVSTQFGTRTRQ  428

Query  533   PS-KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
             P+ K+     WE + E IP  D    +S    E    TK ++DY+W+       +     
Sbjct  429   PAVKLDKADIWEKWNEIIPVFDNTSIRSNLLLEQMNTTKDSSDYLWYIASYNQTEES---  485

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
                    + V S GH +  F+NG   G  HG    + F +   + L  G NDI+ L  ++
Sbjct  486   ----KSEITVNSRGHLLRAFVNGVQIGSGHGFFRNQGFTVKTTIPLTSGVNDISLLSVMV  541

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
               P+SGA MERR +G +SV +       +++T +SW Y +G  GEKL+L+TEEG  KA W
Sbjct  542   GLPDSGAHMERRASGLQSVSIQENKV-FKNLTISSWGYQVGLLGEKLQLYTEEGTNKAVW  600

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
               +  + +++  TWYK+ FD P G+DP+A+N+  M KG  WVNG+SIGRYW+SFL P G 
Sbjct  601   CDINSS-SSQPLTWYKSKFDAPGGSDPLALNLGSMGKGEAWVNGQSIGRYWISFLNPDGS  659

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             P+Q  YH+PR +LKPK+NLLV+FEE GG+P  I V  V+   +C  + ++ PP +  W+R
Sbjct  660   PSQIWYHVPRSFLKPKDNLLVLFEEEGGNPTGISVDTVSITKVCGHITDSNPPPLISWKR  719

Query  1430  KGDEFRATT--DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
             +      +    + +P++HL CP  K + KI FAS+G+P G C ++  G C   N+  IV
Sbjct  720   ETLSRNKSEIHHERRPKIHLHCPPKKYISKILFASFGSPFGDCESYSLGKCHSTNSTAIV  779

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EKACLGK +C VP     F  G D CP I K L ++A+C
Sbjct  780   EKACLGKKKCSVPWSNKRF--GGDPCPGIRKNLLIEAQC  816



>ref|XP_011069425.1| PREDICTED: beta-galactosidase 14-like, partial [Sesamum indicum]
Length=537

 Score =   427 bits (1099),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 256/341 (75%), Gaps = 1/341 (0%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSS-FVST  178
             TENWTAQYRVFGD P QR+AEDISF+V RF++++GT  NYYMY+GG+NFG T SS FV+T
Sbjct  197   TENWTAQYRVFGDTPSQRAAEDISFAVARFFTRNGTLNNYYMYYGGSNFGRTSSSSFVTT  256

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYDE P+D YG  R+PK+ HLRD HRALKL KKPLL GT  + +I+ D EITT+E    
Sbjct  257   RYYDEAPLDEYGLRREPKFGHLRDLHRALKLSKKPLLRGTPKVERISQDLEITTYEKPSE  316

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
              LC AFL+NN+T +  T++FRG DYYLP+KSVSILPDCK +++NT  I+AQH+ R F   
Sbjct  317   NLCVAFLTNNDTREAKTIHFRGKDYYLPSKSVSILPDCKTVVYNTAAIVAQHSSRNFVVP  376

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
             + A   KWEMF+E+IPTI+ L  ++PAPKE+Y+ TK  +DY W+ST + ++ RDLPMRPD
Sbjct  377   QQAKFSKWEMFKETIPTINDLKDRTPAPKELYSFTKDVSDYAWYSTSIKIDARDLPMRPD  436

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             + P L + S+GHA++ F+NGE+ G+ HG+NV K  I  +PVNL  G NDIT L   + +P
Sbjct  437   VRPGLHIASLGHALLAFVNGEYIGFEHGSNVEKSHIFRKPVNLTAGDNDITLLAMTVGFP  496

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQG  1021
             NSGA+ME+R+AGP++V L  LM+G  DIT N+W   +G  G
Sbjct  497   NSGAYMEKRFAGPRAVTLEGLMSGTLDITNNNWGQQVGVNG  537



>ref|XP_006351205.1| PREDICTED: beta-galactosidase 16-like [Solanum tuberosum]
Length=813

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/581 (38%), Positives = 336/581 (58%), Gaps = 31/581 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+V+G+    RSAE++++ V  F + K+GTY+NYYMY GG NFG + + F+ T
Sbjct  255   TENWTSFYQVYGENAKYRSAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMIT  314

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+ P+D YG    PKW H ++ H A+KLC + +L     ++ +    E   +     
Sbjct  315   GYYDQAPLDEYGLISQPKWGHFKELHAAVKLCSENILSTFPTMHSLGPLQEAYVYGEDSG  374

Query  359   KLCAAFLSN-NNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRT---  526
               C+A L N +++ +  T+ FR   Y LP KS+SIL DCK ++FNT  +  Q N RT   
Sbjct  375   TKCSALLVNTDHSNRNVTVQFRNLTYQLPPKSISILHDCKTVVFNTAKVSTQFNTRTPTT  434

Query  527   ---FDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKR  697
                FD ++     KWE F E IP  D    +S    E    TK  +DY+W++T +     
Sbjct  435   VFKFDRAE-----KWEQFHEIIPRFDATTLRSQTLLEQTNTTKDVSDYLWYTTSLEQESE  489

Query  698   DLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFL  877
             +  ++      L V+S+GH +  F+NG   GY HG      F++   ++L  G N+I+FL
Sbjct  490   EQQVK------LSVKSLGHVLHAFVNGHLVGYGHGQFRKTSFLVESTISLNKGKNEISFL  543

Query  878   CSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAE  1057
              + +  PNSGA++ERR  G  SV++     G ++ T  SW Y +G  GEKL++++ E  +
Sbjct  544   SATIGLPNSGAFLERRSLGVHSVMIQNDNRGLKNFTDFSWGYQVGLLGEKLQIYSSERTK  603

Query  1058  KAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT  1237
                W  +    +  + TWYK+ FD P+G+DP+ +N+  M KG  WVNG+SIGR+W+SF T
Sbjct  604   SVNWSKL--GSSKLQLTWYKSIFDAPKGDDPVTLNLGSMGKGEAWVNGQSIGRFWLSFHT  661

Query  1238  PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVK  1417
             P G P+QT Y++PR +LKPK+N+LV+FEE  G+P  I +  ++   +C  V  + PP + 
Sbjct  662   PQGVPSQTWYNVPRSFLKPKDNVLVLFEEEIGNPLGITIDTISITKVCGHVTNSNPPPLN  721

Query  1418  IWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIK  1597
              W + G         ++P++ L+CP  + + KI FAS+GNP G C ++  G C   N+  
Sbjct  722   SWRKHG--------RIRPKVQLSCPPRRKISKILFASFGNPIGDCDDYDIGLCHSSNSKA  773

Query  1598  IVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             IVEKACLGK++C +      F  G D CP I K+L V  +C
Sbjct  774   IVEKACLGKSKCTIAHSSKKF--GGDPCPGISKSLLVDVQC  812



>ref|XP_008466741.1| PREDICTED: beta-galactosidase 16 isoform X1 [Cucumis melo]
Length=850

 Score =   436 bits (1121),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 239/606 (39%), Positives = 341/606 (56%), Gaps = 50/606 (8%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+ +G+ P  RSAE+I+F V  F + K+GTYVNYYMY GG NFG + S+F+ T
Sbjct  261   TENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMIT  320

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
              YYD+GP+D YG  R+PKW HL++ H A+KLC  PLL GT     +    E   F+ T+ 
Sbjct  321   GYYDQGPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFK-TES  379

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRT-FDP  535
               CAAFL N   +    L F+   Y LP  S+SILPDCKN+ FNT+ +  Q N R+    
Sbjct  380   DECAAFLVNRGAIDTDVL-FQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTV  438

Query  536   SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K   + +WE F+E IP  +    ++    E    TK  +DY+W++ RV  +       P
Sbjct  439   QKFDSSEEWEEFKEPIPNFEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDS------P  492

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             D      V+S  HA+  F+NG++AG  HG    K F L+  + L+ G N+I+ L  ++  
Sbjct  493   DSQQTFEVDSRAHALHAFVNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGL  552

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P+SGA++E R AG + V +       +D ++  W Y +G  GE+ ++F + G+   +W  
Sbjct  553   PDSGAFLETRVAGLRRVGIQG-----EDFSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSR  607

Query  1076  VTGNHNTRRATWYK-----------------------------THFDLPEGNDPIAVNME  1168
             + GN +++  TWYK                             T FD P G+DPIA+N+ 
Sbjct  608   L-GN-SSQPLTWYKVLPIINSNYLEFKCSRTDLCYCHSLLIGQTRFDAPPGDDPIALNLG  665

Query  1169  KMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
              M KG  WVNG+ IGRYWVSFLTP G+P+Q  Y++PR +LKP +N LV+ EE  G+P  I
Sbjct  666   SMGKGAAWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKPTDNQLVILEEETGNPVEI  725

Query  1349  KVMLVNRDTICSSVAENYPPDVKIW--ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEF  1522
              +  V     C  V+E++ P V  W   +K     A     +P++ L+CP  K +  I F
Sbjct  726   SLDSVLITKTCGQVSESHYPLVASWMGAKKQKVRSAKNRTRRPKVQLSCPSKKKISNILF  785

Query  1523  ASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTL  1702
             AS+G P G C ++  G C  PN+  IVE ACLG+ +C +P+  SL  +G D CP + KTL
Sbjct  786   ASFGTPSGDCQSYAIGMCHSPNSRPIVEHACLGRVKCSIPI-SSLNFQG-DPCPHVTKTL  843

Query  1703  AVQAKC  1720
              V A+C
Sbjct  844   LVDAQC  849



>emb|CBI18990.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   433 bits (1113),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 238/579 (41%), Positives = 335/579 (58%), Gaps = 22/579 (4%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSK-SGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y +FG+    R  EDI+F V  F +K +G+++NYYMY GG NFG T S++V T
Sbjct  254   TENWTSSYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGTNFGRTASAYVQT  313

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGT-ANLNKINGDHEITTFENTD  355
             AYYDE P+D YG  + P W HL++ H A+KLC + LL G  +NL+      E   F    
Sbjct  314   AYYDEAPLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGTKLQEAYVFRGQS  373

Query  356   LKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDP  535
              K CAAFL NN++    T+ F+ T Y LP KS+SILPDCKN  FNT     +    +   
Sbjct  374   GK-CAAFLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAKASFRPGLISIQT  432

Query  536   -SKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
              +K     +WE ++ESI   D   +++    E    TK  +DY+W++ R   +  +    
Sbjct  433   VTKFNSTEQWEEYKESILNFDDTSSRANTLLEHMNTTKDASDYLWYTFRYNNDPSNG---  489

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
                  VL   S  HA+  FING   G  HG++    F L   V+ + G N+++ L  ++ 
Sbjct  490   ---QSVLSTNSRAHALHAFINGRHTGSQHGSSSNLSFSLDNTVSFRAGINNVSLLSVMVG  546

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGN-QDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
              P+SGA++ERR AG + V + +   G+ +D T N W Y +G  GEKL+++T+ G++K +W
Sbjct  547   LPDSGAYLERRVAGLRRVRIQS--NGSLKDFTNNPWGYQVGLLGEKLQIYTDVGSQKVQW  604

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                 G+  +   TWYKT FD P GN+P+A+N+  M KG VWVNG+SIGRYWVSFLTP G+
Sbjct  605   SKF-GSSTSGLLTWYKTVFDAPAGNEPVALNLVSMRKGEVWVNGQSIGRYWVSFLTPSGK  663

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDV--KIW  1423
             P+Q  YHIPR +LKP  NLLV+ EE  G P  I +  V+   IC  V+E++ P V  ++ 
Sbjct  664   PSQIWYHIPRSFLKPTGNLLVLLEEETGHPVGISIGKVSIPKICGHVSESHLPPVISRVI  723

Query  1424  ERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIV  1603
              +K +         +P++ L CP  + + +I FAS+G P G C ++  GSC   N+   V
Sbjct  724   YKKHENHHGR----RPKVQLRCPSNRNISRILFASFGTPSGDCQSYAVGSCHSSNSRSNV  779

Query  1604  EKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             EKACLGK  C VP+    F  G D CP   K L V  +C
Sbjct  780   EKACLGKGMCSVPLSYKRF--GGDPCPGTPKALLVDVQC  816



>ref|XP_010312841.1| PREDICTED: beta-galactosidase 16 [Solanum lycopersicum]
Length=814

 Score =   433 bits (1113),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 226/582 (39%), Positives = 341/582 (59%), Gaps = 33/582 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYS-KSGTYVNYYMYFGGNNFGMTGSSFVST  178
             TENWT+ Y+V+G+   +RSAE++++ V  F + K+GTY+NYYMY GG NFG + + F+ T
Sbjct  256   TENWTSFYQVYGENAVKRSAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMIT  315

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYD  P+D YG    PK+ H ++ H A+KLC + +L     ++ +    E+  +     
Sbjct  316   SYYDLAPLDEYGLISQPKYGHFKELHAAIKLCSENILSTFPTMHSLGPLQEVYVYGEDSG  375

Query  359   KLCAAFLSN-NNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRT---  526
               C+A L N +++ K  T+ FR   Y LP KS+SILPDCK ++FNT  +  Q N R+   
Sbjct  376   TKCSALLVNTDHSNKNITVKFRDLTYQLPPKSISILPDCKTVVFNTAKVSTQFNTRSPTT  435

Query  527   ---FDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKR  697
                FD ++     KWE F E IP  D    +S    E    TK  +DY+W++  +     
Sbjct  436   VFKFDRAE-----KWEQFHEIIPQFDATTVRSETLLEQTNTTKDVSDYLWYTASLEQESE  490

Query  698   DLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFL  877
             +  ++      L V+S+GH + VF+NG   GY HG      F++   V+LK G N I+FL
Sbjct  491   EEQVK------LSVKSLGHVLHVFVNGHLVGYGHGQFRKASFLVESTVSLKKGKNQISFL  544

Query  878   CSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAE  1057
              + +  PNSGA++ERR  G  SV++       ++ T  SW Y +G  GEKL++++    +
Sbjct  545   SATVGLPNSGAFLERRSLGVHSVMIQLDNRVLKNFTDFSWGYQVGLLGEKLQIYSSGRTK  604

Query  1058  KAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT  1237
                W  +    + ++ TWYK+ FD P+G+DP+ +N+  M KG VWVNG+SIGR+W+SF T
Sbjct  605   SGNWSRL--GSSKQQLTWYKSIFDAPKGDDPVTLNLGSMGKGEVWVNGQSIGRFWLSFHT  662

Query  1238  PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAE-NYPPDV  1414
             P G P+QT Y++PR +LKPK+N+LV+FEE  G+P  I +  ++   +C+ VA+ N PP +
Sbjct  663   PQGVPSQTWYNVPRSFLKPKDNVLVLFEEEIGNPLGITIDTISITKVCAHVADSNPPPVI  722

Query  1415  KIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               W + G          +P++ L+CP  + + KI FAS+GNP G C ++  G C   N+ 
Sbjct  723   NSWRKHGR---------RPKVQLSCPQGRKISKILFASFGNPIGDCDDYDIGLCHSSNSK  773

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              IVEKACLGK++C +      F  G D CP I K+L V  +C
Sbjct  774   AIVEKACLGKSKCTIAHSSKKF--GGDPCPGISKSLLVDVQC  813



>tpg|DAA48742.1| TPA: hypothetical protein ZEAMMB73_126543 [Zea mays]
Length=706

 Score =   429 bits (1102),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 202/421 (48%), Positives = 270/421 (64%), Gaps = 5/421 (1%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAEDI+F+V RF+S  GT  NYYMY GG NFG T ++FV   
Sbjct  269   TENWTAQYRVFGDPPSQRSAEDIAFAVARFFSVGGTLANYYMYHGGTNFGRTSAAFVMPK  328

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D +G  ++PKW HLRD H+ALKLCKK LLWGT +  K+    E   FE  + K
Sbjct  329   YYDEAPLDEFGLYKEPKWGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQK  388

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD-PS  538
             +C AFLSN+NT    T+ FRG  Y++P  S+S+L DC+ ++F TQH+ AQHN RTF    
Sbjct  389   VCVAFLSNHNTKDDATMTFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFAD  448

Query  539   KVAGNLKWEMFQ-ESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
             + A N  WEMF  E++P       +     ++Y LTK  TDYVW+++   +   D+P+R 
Sbjct  449   QTAQNNVWEMFDGENVPKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRS  508

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             DI  VL V S GHA + F+N +F G  HG  + K F L +P++LK G N +  L S +  
Sbjct  509   DIKTVLEVNSHGHASVAFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGM  568

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
              +SGA+ME R AG   V +  L  G  D+T N W + +G  GE+ +++T++G     W P
Sbjct  569   TDSGAYMEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKP  628

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
                  N R  TWYK HFD+P G DP+ ++M  M KGM++VNG+ IGRYW+S+   LG+P+
Sbjct  629   AM---NDRPLTWYKRHFDMPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPS  685

Query  1256  Q  1258
             Q
Sbjct  686   Q  686



>ref|XP_007041848.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
 gb|EOX97679.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
Length=666

 Score =   424 bits (1089),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 262/374 (70%), Gaps = 6/374 (2%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWTAQYRVFGDPP QRSAED+++SV RF+SK+G+ VNYYMY GG N+G T ++F +T 
Sbjct  271   TENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGSLVNYYMYHGGTNYGRTSAAFTTTR  330

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYDE P+D YG  RDPKW HL+D H+AL LCKK LLWG+  + K+  D E+ T++     
Sbjct  331   YYDEAPLDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTS  390

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAAFL+NN+T    T +FRG  Y LPA+S+SILPDCK +++NTQ I AQHN R F  S 
Sbjct  391   LCAAFLANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSA  450

Query  542   VAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              A  N  W+M++E +PT   L + +  P E+Y LTK TTDY W++T + +  RDLPM+ +
Sbjct  451   TANKNFNWQMYKEYVPT--QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKE  508

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
             I PVL V S+GH ++ F+NGE+ G+ HG+ V K F+  +PV LK G N IT L +++  P
Sbjct  509   IFPVLRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLP  568

Query  899   NSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPV  1078
             +SGA+ME R+AGP+S+ +L L TG  D++ N W + +G  GEK K++TE+G+ K +W  +
Sbjct  569   DSGAYMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKL  628

Query  1079  TGNHNTRRATWYKT  1120
             +    +   TWYK 
Sbjct  629   S---ESPALTWYKV  639



>ref|XP_002310540.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90990.2| beta-galactosidase family protein [Populus trichocarpa]
Length=841

 Score =   429 bits (1103),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 234/605 (39%), Positives = 325/605 (54%), Gaps = 42/605 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG P   R AED++FSV RF+ K G+  NYYMY GG NFG T G  F++T
Sbjct  246   TENWPGWFQTFGAPNPHRPAEDVAFSVARFFQKGGSVQNYYMYHGGTNFGRTAGGPFITT  305

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  E P+D YG  R PKW HL++ H+A+KLC+  LL        +    E   + +   
Sbjct  306   SYDYEAPIDEYGLPRLPKWGHLKELHKAIKLCEHVLLNSKPVNLSLGPSQEADVYADASG  365

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQ--------H  514
               C AFL+N +     T++F+   + LPA SVSILPDCKN+++NT  + +Q         
Sbjct  366   G-CVAFLANIDDKNDKTVDFQNVSFKLPAWSVSILPDCKNVVYNTAKVTSQTALVEMVPD  424

Query  515   NHRTFDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNK  694
             N +  D SK    LKWE+F E                +    TK TTDY+W++T +V+ +
Sbjct  425   NLQQKDGSKA---LKWEVFVEKAGIWGEPDFMKNGFVDHINTTKDTTDYLWYTTSIVVGE  481

Query  695   RDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITF  874
              +  ++   HPVL +ESMGHA+  F+N E  G   GN     F    P++LK G N+I  
Sbjct  482   NEEFLKEGRHPVLLIESMGHALHAFVNQELQGSASGNGSHSPFKFKNPISLKAGNNEIAL  541

Query  875   LCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGA  1054
             L   +  PN+G++ E   AG  SV +     G  D++  +W Y IG QGEKL ++  EG 
Sbjct  542   LSMTVGLPNAGSFYEWVGAGLTSVRIEGFNNGTVDLSHFNWIYKIGLQGEKLGIYKPEGV  601

Query  1055  EKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV---  1225
                 W   +     +  TWYK   D P GN+P+ ++M  M KG+ W+NG+ IGRYW    
Sbjct  602   NSVSWVATSEPPKKQPLTWYKVVLDPPAGNEPVGLDMLHMGKGLAWLNGEEIGRYWPRKS  661

Query  1226  -------------------SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
                                   T  GQPTQ  YH+PR W KP  NLLV+FEE GGDP+ I
Sbjct  662   SVHEKCVTECDYRGKFMPDKCFTGCGQPTQRWYHVPRSWFKPSGNLLVIFEEKGGDPEKI  721

Query  1349  KVMLVNRDTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFA  1525
                     +IC+ +AE+YP  D K  +  G +      + K  +HL CP   V+  ++FA
Sbjct  722   TFSRRKMSSICALIAEDYPSADRKSLQEAGSK----NSNSKASVHLGCPQNAVISAVKFA  777

Query  1526  SYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLA  1705
             S+G P G CG++  G C  PN+I +VEKACL KTEC + + +  F +G  LCP   + LA
Sbjct  778   SFGTPTGKCGSYSEGECHDPNSISVVEKACLNKTECTIELTEENFNKG--LCPDFTRRLA  835

Query  1706  VQAKC  1720
             V+A C
Sbjct  836   VEAVC  840



>ref|XP_004292712.1| PREDICTED: beta-galactosidase 16-like [Fragaria vesca subsp. 
vesca]
Length=813

 Score =   427 bits (1097),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 234/581 (40%), Positives = 330/581 (57%), Gaps = 27/581 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKS-GTYVNYYMYFGGNNFGMTGSSFVST  178
             TE+WT+QY+V+GD P  R AEDI++ V  F +K+ G+YVNYYMY GG NFG T S FV+T
Sbjct  253   TEDWTSQYQVYGDEPYLRRAEDIAYHVALFIAKNKGSYVNYYMYHGGTNFGRTASEFVTT  312

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +YYDE P+D YG   +PK+SHL++ H A+KL   PLL G   +  + G  +         
Sbjct  313   SYYDEAPLDEYGMPNEPKYSHLKELHAAVKLSISPLLAGEQTVVNL-GQSQTAYVYKVKS  371

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL NN + K   + F+ + Y L  KS+SILPDCK++ FNT  + AQH  R++ P+
Sbjct  372   GECAAFLVNNGS-KDAIVQFQNSPYQLYPKSISILPDCKSVAFNTGKVSAQHATRSWTPT  430

Query  539   -KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              K   +  W+ + E IPT D    +     +    T   +DY+W++     +       P
Sbjct  431   QKFDSHQNWQEYNEPIPTYDNTSLRQNIIVDQMRTTNDLSDYLWYTFSFQHDS------P  484

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
             +    L V++ GH +  F+NG   G  HG +    F L   VNL  G N ++ L +++  
Sbjct  485   NPESTLNVQTHGHVLHSFVNGVLVGSGHGVHRNAGFALESKVNLNKGINHVSLLSAMVGL  544

Query  896   PNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             P++GA++ERR  G  SV +       +D +  +W Y +G  GE L+++T+    K +W  
Sbjct  545   PDNGAYLERRDYGLHSVKI-----DGKDFSTYAWGYQVGLSGENLQIYTD--TSKVQWHR  597

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPT  1255
             ++   +    TWYKT FD P GNDP+A+N+  M KG VW+NG+SIGRYWVSF TP G P+
Sbjct  598   LSSTKHP--MTWYKTLFDAPAGNDPVALNLGSMGKGEVWINGQSIGRYWVSFHTPKGTPS  655

Query  1256  QTEYHIPRPWLKPKNNLLVVFEEFGG-DPDSIKVMLVNRDTICSSVAENYPPDVKIW--E  1426
             QT YH+PR +LKP  NLLV+ EE  G DP  I +  ++   +C+ V+E +   V  W  +
Sbjct  656   QTWYHVPRSFLKPTGNLLVLIEEETGVDPVKISLDRISVAKVCALVSETHLHPVSTWMYQ  715

Query  1427  RKGDEFRATTDD--LKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKI  1600
             R       T  +   KP   L CP    + KI +ASYGNP G C  +  GSC   ++  +
Sbjct  716   RTSGNLNNTRQNPGRKPTAKLRCPPNSYISKILYASYGNPSGDCKTYAAGSCHSEDSTAV  775

Query  1601  VEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             V+KACLGK  C V V    F    D CP+I KTL V A+C 
Sbjct  776   VQKACLGKRRCSVSVSSEKF---GDPCPRISKTLLVDAQCA  813



>ref|XP_011022866.1| PREDICTED: beta-galactosidase 10 [Populus euphratica]
Length=841

 Score =   427 bits (1099),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 233/605 (39%), Positives = 326/605 (54%), Gaps = 42/605 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG P   R AED++FSV RF+ K G+  NYYMY GG NFG T G  F++T
Sbjct  246   TENWPGWFQTFGAPNPHRPAEDVAFSVARFFQKGGSVQNYYMYHGGTNFGRTAGGPFITT  305

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  E P+D YG  R PKW HL++ H+A+KLC+  LL  +  +N   G  +     +   
Sbjct  306   SYDYEAPIDEYGLPRLPKWGHLKELHKAIKLCEHVLL-NSKPVNLSLGPSQEAEIYSDAS  364

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQ--------H  514
               C AFL+N +     T+ F+   Y LPA SVSILPDCKN+++NT  + +Q         
Sbjct  365   GGCVAFLANIDDKNDKTVEFQNVSYKLPAWSVSILPDCKNVVYNTAKVTSQTALVEMVPD  424

Query  515   NHRTFDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNK  694
             N +  D SK    LKWE+F E                +    TK TTDY+W++T +V+ +
Sbjct  425   NLQQKDDSKA---LKWEVFMEKAGIWGEPDFMKNGFVDHINTTKDTTDYLWYTTSIVVGE  481

Query  695   RDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITF  874
              +  ++   HPVL +ESMGHA+  F+N E  G   GN     F    P++LK G N+I  
Sbjct  482   NEEFLKEGRHPVLLIESMGHALHAFVNQELQGSASGNGSHSPFKFKNPISLKAGKNEIAL  541

Query  875   LCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGA  1054
             L   +   N+G++ E   AG  SV++     G  D++  +W Y IG QGEKL ++  E  
Sbjct  542   LSMTVGLQNAGSFYEWVGAGLTSVMIKGFNNGTVDLSHFNWIYKIGLQGEKLGIYKPEEV  601

Query  1055  EKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV---  1225
                 W   +     +  TWYK   D P GN+P+ ++M  M KG+ W+NG+ IGRYW    
Sbjct  602   NSVSWVATSEPPKKQPLTWYKVVLDPPAGNEPVGLDMLHMGKGLAWLNGEEIGRYWPRKS  661

Query  1226  -------------------SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
                                   T  GQPTQ  YH+PR W KP  NLLV+FEE GGDP+ I
Sbjct  662   SVHEKCVTECDYRGKFMPDKCFTGCGQPTQRWYHVPRSWFKPSGNLLVIFEEKGGDPEKI  721

Query  1349  KVMLVNRDTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFA  1525
                     +IC+ +AE+YP  D K  +  G +      + +  +HL CP   V+  ++FA
Sbjct  722   TFSRRKMSSICALIAEDYPSADRKSLQETGSK----NSNSRASVHLECPQNAVISAVKFA  777

Query  1526  SYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLA  1705
             S+G P G CG++  G C  PN+I +VEKACL KTEC + + +  F +G  LCP + + LA
Sbjct  778   SFGTPSGKCGSYSEGECHDPNSISVVEKACLNKTECAIELTEENFNKG--LCPDLTRRLA  835

Query  1706  VQAKC  1720
             V+A C
Sbjct  836   VEAVC  840



>gb|KDP44674.1| hypothetical protein JCGZ_19489 [Jatropha curcas]
Length=843

 Score =   425 bits (1092),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 227/605 (38%), Positives = 330/605 (55%), Gaps = 41/605 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG+P   R +EDI++SV  F+ K G+  NYYMY GG NFG T G  F++T
Sbjct  247   TENWPGWFQTFGEPNPHRPSEDIAYSVAHFFQKGGSLQNYYMYHGGTNFGRTSGGPFITT  306

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  E P+D YG  R PKW+HLR+ HRA+KLC+  LL G      +    E   + +   
Sbjct  307   SYDYEAPIDEYGLARLPKWAHLRELHRAIKLCEHALLNGDPINLSLGPSQEADVYADAS-  365

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQ--------H  514
               CAAFL+N +     T+ FR   Y+LPA SVSILPDCKN++ NT  + +Q         
Sbjct  366   GACAAFLANTDDKNDKTVEFRNMSYHLPAWSVSILPDCKNVVLNTAKVNSQTSVVEMVSE  425

Query  515   NHRTFDPSKVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNK  694
             + R  D   +A  LKWE+FQES            +  +    T+ TTDY+W++T +++ +
Sbjct  426   DLRPSDKGLIA--LKWEIFQESAGIWGNSDFVKSSLVDHINTTQDTTDYLWYTTSIIVGE  483

Query  695   RDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITF  874
              +  ++    P+L +ES GHA+  F+N E  G   GN     F   +P++LK G NDI  
Sbjct  484   SEEFLKKGSRPILLIESKGHALHAFVNKELQGSATGNGTHPPFKFKKPISLKSGKNDIAL  543

Query  875   LCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGA  1054
             L   +   N+G++ E   AG  SV +     G  D++++ W+Y IG QGEKL ++  +  
Sbjct  544   LSMTVGLQNAGSFYEWVGAGLTSVKIRGFNNGTIDLSQHHWTYKIGLQGEKLGIYKPDAM  603

Query  1055  EKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYW----  1222
                 W   +     +  TWYK   D P G++PI ++M  M KG+ W+NG+ IGRYW    
Sbjct  604   NSVNWVATSRPPKNQPLTWYKAVVDQPRGDEPIGLDMVHMGKGLAWLNGEEIGRYWPRKS  663

Query  1223  -------------VSFL-----TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSI  1348
                            F+     T  G+PTQ  YH+PR W KP  N+LV+FEE GGDP  I
Sbjct  664   SVHDKCVQECDYRGKFMPGKCRTGCGKPTQRWYHVPRSWFKPSGNILVIFEEKGGDPTKI  723

Query  1349  KVMLVNRDTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFA  1525
                      +C+ VAE+YP  ++ ++++ G+       + K   HL CP   ++  ++FA
Sbjct  724   VFSRRKISGVCALVAEDYPMANLDLYQKAGN----GNFNYKASAHLKCPKNSLISSVKFA  779

Query  1526  SYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLA  1705
             S+G+P G CG++  G C  PN+I +VEK CL K +C + V +  F +G  LCP   K LA
Sbjct  780   SFGSPTGTCGSYSKGECHDPNSISVVEKVCLNKNDCIIEVTEENFTKG--LCPDTTKKLA  837

Query  1706  VQAKC  1720
             V+A C
Sbjct  838   VEAVC  842



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   425 bits (1092),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 228/602 (38%), Positives = 333/602 (55%), Gaps = 40/602 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F+V RF  + G++VNYYMY GG NFG T G  F++T
Sbjct  251   TEAWSGWFTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIAT  310

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+     +  + G+ +      T+ 
Sbjct  311   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSTDPIITSL-GESQQAHVYTTES  369

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN ++     + F    Y LP  SVSILPDC+N++FNT  +  Q +     P+
Sbjct  370   GDCAAFLSNYDSKSSARVMFNNMHYNLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPT  429

Query  539   KVAGNLKWEMFQESIPTIDTLPA-KSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                    WE F E + ++D   A  +P   E   +TK  +DY+W+ T V +   +  +R 
Sbjct  430   NTQ-LFSWESFDEDVYSVDDSSAIMAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRG  488

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ VFING+ +G  +G    + F+    VNL+ G N I  L   +  
Sbjct  489   GELPTLIVQSRGHAVHVFINGQLSGSAYGTREYRRFMYTGKVNLRAGINRIALLSVAIGL  548

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W 
Sbjct  549   PNVGEHFESWSTGILGPVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWM  608

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT---  1237
                +    N +  TW+KTHFD PEG++P+A++ME M KG +W+NG+SIGRYW +F T   
Sbjct  609   QSAIVVQRN-QPLTWHKTHFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFATGNC  667

Query  1238  ----------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLKP  NLLV+FEE GG+P  I ++  + 
Sbjct  668   NDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSV  727

Query  1370  DTICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGN  1537
              ++C+ V+E Y P++K W      K +EF        P++HL C   + +  I+FAS+G 
Sbjct  728   SSVCADVSE-YHPNIKNWHIESYGKSEEFH------PPKVHLHCSPGQTISSIKFASFGT  780

Query  1538  PEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAK  1717
             P G CGN+  G+C  P +  I+EK C+GK  C V V  S F  G+D CPK++K L+V+A 
Sbjct  781   PLGTCGNYEQGACHSPASYAILEKRCIGKPRCTVTVSNSNF--GQDPCPKVLKRLSVEAV  838

Query  1718  CV  1723
             C 
Sbjct  839   CA  840



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   424 bits (1091),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 227/602 (38%), Positives = 333/602 (55%), Gaps = 40/602 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F+V RF  + G++VNYYMY GG NFG T G  F++T
Sbjct  251   TEAWSGWFTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIAT  310

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+     +  + G+ +      T+ 
Sbjct  311   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSTDPIITSL-GESQQAHVYTTES  369

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN ++     + F    Y LP  SVS+LPDC+N++FNT  +  Q +     P+
Sbjct  370   GDCAAFLSNYDSKSSARVMFNNMHYNLPPWSVSVLPDCRNVVFNTAKVGVQTSQMQMLPT  429

Query  539   KVAGNLKWEMFQESIPTIDTLPA-KSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                    WE F E + ++D   A  +P   E   +TK  +DY+W+ T V +   +  +R 
Sbjct  430   NTQ-LFSWESFDEDVYSVDDSSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRG  488

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ VFING+ +G  +G    + F+    VNL+ G N I  L   +  
Sbjct  489   GELPTLIVQSRGHAVHVFINGQLSGSAYGTREYRRFMYTGKVNLRAGINRIALLSVAIGL  548

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W 
Sbjct  549   PNVGEHFESWSTGILGPVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWM  608

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT---  1237
                +    N +  TW+KTHFD PEG++P+A++ME M KG +W+NG+SIGRYW +F T   
Sbjct  609   QSAIVVQRN-QPLTWHKTHFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFATGNC  667

Query  1238  ----------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLKP  NLLV+FEE GG+P  I ++  + 
Sbjct  668   NDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSV  727

Query  1370  DTICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGN  1537
              ++C+ V+E Y P++K W      K +EF        P++HL C   + +  I+FAS+G 
Sbjct  728   SSVCADVSE-YHPNIKNWHIESYGKSEEFH------PPKVHLHCSPGQTISSIKFASFGT  780

Query  1538  PEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAK  1717
             P G CGN+  G+C  P +  I+EK C+GK  C V V  S F  G+D CPK++K L+V+A 
Sbjct  781   PLGTCGNYEQGACHSPASYAILEKRCIGKPRCTVTVSNSNF--GQDPCPKVLKRLSVEAV  838

Query  1718  CV  1723
             C 
Sbjct  839   CA  840



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   424 bits (1090),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 219/595 (37%), Positives = 326/595 (55%), Gaps = 28/595 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE WT  Y  FG P   R  ED++FSV RF  K G ++NYYMY GG NFG T G  F++T
Sbjct  255   TEAWTGWYTEFGGPVPNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIAT  314

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL+D HRA+KLC+  L+ G   + K+    E   F +   
Sbjct  315   SYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKS-  373

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN ++     +++    Y LP  S+SILPDCKN ++NT  + AQ       P 
Sbjct  374   GACAAFLSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPV  433

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              + G   W+ + E     +          E    T+  +DY+W+ T V +N ++  +R  
Sbjct  434   PIHGGFSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSG  493

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
              +P L V+S GHA+ VF+NG+ +G  +G+    +    Q V L+ G+N I  L   +  P
Sbjct  494   KYPTLTVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLP  553

Query  899   NSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             N G   ER  AG    V L  L  G +D+++  WSY +G +GE L L +  G+   +W  
Sbjct  554   NVGPHFERWNAGVLGPVTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAE  613

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF--------  1231
              +     +  TW+KT F  P GN P+A++M  M KG +W+NG+SIGRYW ++        
Sbjct  614   GSLVARKQPLTWFKTTFSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAYKASGTCGG  673

Query  1232  ------------LTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDT  1375
                         L+  G+ +Q  YH+PR WL P  NLLVVFEE+GGDP+ I ++  + D+
Sbjct  674   CNYAGTYGEKKCLSNCGEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGISLVRRDVDS  733

Query  1376  ICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCG  1555
             +C+ + E + P +  ++ +          L+P+ HL+C   + +  I+FAS+G PEG+CG
Sbjct  734   VCADIYE-WQPTLMNYQMQASG--KVNKPLRPKAHLSCSPGQKISSIKFASFGTPEGICG  790

Query  1556  NFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             +F  GSC   ++  + +K C+G+  C VPV   +F  G D CP ++K L+V+A C
Sbjct  791   SFREGSCHAFHSYDVFQKTCVGQNSCTVPVTPEIF--GGDPCPSVMKKLSVEAIC  843



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   423 bits (1088),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 222/600 (37%), Positives = 340/600 (57%), Gaps = 38/600 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG     R AED++F+V RF    G+++NYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFTEFGGTIRHRPAEDLAFAVARFIQNGGSFINYYMYHGGTNFGRTAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+ HL++ H+A+KLC++ L+     +  +    +   F +++ 
Sbjct  312   SYDYDAPIDEYGLIREPKYGHLKELHKAIKLCEQALVSADPTVTSLGSLQQAHVF-SSES  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN+       + F    Y LP  S+SILPDC+N++FNT  I  Q +     P+
Sbjct  371   GGCAAFLSNHEPNSYAKIMFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMYPT  430

Query  539   KVAGNLKWEMFQESIPTIDTLP-AKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                 +L WE + E + +++      +    E   +T+ T+DY+W+ T V ++  +  ++ 
Sbjct  431   NTQ-SLMWERYDEEVASLEENSLITATGLLEQINVTRDTSDYLWYITSVDISSAEEFLKG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                PVL V S GHA+ +F+NG+ +G  +G    K       +NL+ GTN I  L   +  
Sbjct  490   GKLPVLTVRSAGHALHIFVNGQLSGSAYGTRENKRIKFSGNINLRAGTNRIALLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PNSG   E    G    V+L  L  G++D+T  +WSY +G +GE + L + EGA   +W 
Sbjct  550   PNSGVHYELWSTGVLGPVVLHELDEGSRDLTWQTWSYQVGLKGEDMNLNSLEGASSVEWM  609

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL------  1234
               +   N +  TWY+ +FD P+G++P+A++M  M KG VW+NG+SIGRYW ++       
Sbjct  610   QGSLVQNQQPLTWYRAYFDAPDGDEPLALDMASMGKGHVWINGQSIGRYWTAYAPKENCK  669

Query  1235  --------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRD  1372
                           +  GQPTQ  YH+PR WL+P  NLLVVFEE GGD   I +M+ +  
Sbjct  670   SCSYTGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDATKIALMMRSVS  729

Query  1373  TICSSVAENYPPDVKIWERKG----DEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNP  1540
             ++C+ V+E + P +K W  +     +E+R      KP++HL C   + +  I+FASYG P
Sbjct  730   SVCADVSE-WHPTIKNWHIESYGEPEEYR------KPKVHLRCAPGQSISAIKFASYGTP  782

Query  1541  EGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              G CGNF  G+C  PN+  I+EK C+GK +C V + ++ F  G D CP ++K +AV+A C
Sbjct  783   LGTCGNFQQGACHSPNSHTILEKKCIGKEKCVVAISQANF--GGDPCPNVMKKVAVEAVC  840



>gb|ABK24373.1| unknown [Picea sitchensis]
Length=861

 Score =   423 bits (1087),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 225/611 (37%), Positives = 330/611 (54%), Gaps = 43/611 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFG-MTGSSFVST  178
             TENW+  +  FG     R  ED++FSV RF+ + GT+ NYYMY GG NFG  TG  F++T
Sbjct  255   TENWSGWFLSFGGRLPFRPTEDLAFSVARFFQRGGTFQNYYMYHGGTNFGRTTGGPFIAT  314

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL++ H+A+KLC+  L+   +N   +    E   +     
Sbjct  315   SYDYDAPIDEYGIVRQPKWGHLKELHKAIKLCEAALVNAESNYTSLGSGLEAHVYSPGS-  373

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N+NT    T+ F G  Y+LPA SVSILPDCKN++FNT  I +Q      +P+
Sbjct  374   GTCAAFLANSNTQSDATVKFNGNSYHLPAWSVSILPDCKNVVFNTAKIGSQTTSVQMNPA  433

Query  539   KV-------------AGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTR  679
              +             A    W    E I    +     P   E    T  ++DY+W++T 
Sbjct  434   NLILAGSNSMKGTDSANAASWSWLHEQIGIGGSNTFSKPGLLEQINTTVDSSDYLWYTTS  493

Query  680   VVMNKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGT  859
             + ++  +  +     PVL V+S+GHA+ VFINGEFAG   G++ + +  L  P+ LK G 
Sbjct  494   IQVDDNEPFLHNGTQPVLHVQSLGHALHVFINGEFAGRGAGSSSSSKIALQTPITLKSGK  553

Query  860   NDITFLCSILSYPNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKL  1036
             N+I  L   +   N G++ +   AG    V+L     G  D++   W+Y IG  GE+L +
Sbjct  554   NNIDLLSITVGLQNYGSFFDTWGAGITGPVILQGFKDGEHDLSTQQWTYQIGLTGEQLGI  613

Query  1037  FTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGR  1216
             ++ +    A+W   +     +   WYKT+FD P GNDP+A+N+  M KG+ WVNG+SIGR
Sbjct  614   YSGDTKASAQWVAGSDLPTKQPMIWYKTNFDAPSGNDPVALNLLGMGKGVAWVNGQSIGR  673

Query  1217  YWVSFL----------------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFG  1330
             YW S++                      T  GQP+Q  YH+PR W++P  N+LV+FEE G
Sbjct  674   YWPSYIASQSGCTDSCDYRGAYSSTKCQTNCGQPSQKLYHVPRSWIQPTGNVLVLFEELG  733

Query  1331  GDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAK-VM  1507
             GDP  I  M  +  ++C+ V+E + P V  W+          +  K  + L CP ++ ++
Sbjct  734   GDPTQISFMTRSVGSLCAQVSETHLPPVDSWKSSATS-GLEVNKPKAELQLHCPSSRHLI  792

Query  1508  KKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPK  1687
             K I+FAS+G  +G CG+F  G C+  + + IVE+AC+G+  C V V    F    D C  
Sbjct  793   KSIKFASFGTSKGSCGSFTYGHCNTNSTMSIVEEACIGRESCSVEVSIEKF---GDPCKG  849

Query  1688  IVKTLAVQAKC  1720
              VK LAV+A C
Sbjct  850   TVKNLAVEASC  860



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   422 bits (1086),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 337/598 (56%), Gaps = 33/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG     R  ED++F+V RF  K G+++NYYMY GG NFG T G  F++T
Sbjct  245   TEAWSGWFTEFGGTIHHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITT  304

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+ HL++ HRA+KLC++ L+     +  +    +   F +   
Sbjct  305   SYDYDAPIDEYGLVREPKYGHLKELHRAIKLCERALVSADPTVISLGSLQQAHVFSSQSG  364

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN+N      + F    Y +P  S+SILPDC+N++FNT  +  Q +     P 
Sbjct  365   G-CAAFLSNHNPNSFARVMFNNMHYNIPPWSISILPDCRNVVFNTAKVGVQTSQMQMYPI  423

Query  539   KVAGNLKWEMFQESIPTIDTLP-AKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              V  +L WE + E + +++      +    E   +T+ T+DY+W+ T V ++  +  +R 
Sbjct  424   NVQ-SLMWERYDEEVASLEENSLITTTGLLEQINVTRDTSDYLWYITSVDVSPAEGFLRG  482

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                PVL VES GHA+ +F+NG+ +G  +G+   +       VNL+ GTN I  L   +  
Sbjct  483   RKRPVLMVESAGHALHIFVNGQLSGSAYGSREDRRIKFSGNVNLRAGTNRIALLSVAVGL  542

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN+G   E    G    V+L  L  G++D+T   WSY +G +GE + L + EGA   +W 
Sbjct  543   PNAGVHYELWSTGVLGPVVLHGLDEGSRDLTWQKWSYQLGLKGEAMNLNSLEGASSVEWM  602

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL----  1234
              G +    N +  TWY+ +FD P+GNDP+A++M  M KG VW+NG+SIGRYW ++     
Sbjct  603   QGSLVA-QNQQPLTWYRAYFDAPDGNDPLALDMGSMGKGHVWINGQSIGRYWTAYAPSEY  661

Query  1235  ----------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                             +  GQPTQ  YH+PR WL+P  NLL+VFEE GGD   I +   +
Sbjct  662   CNSCSYRGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRNLLIVFEELGGDATKISLAKRS  721

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               ++C+ V+E + P +K W    + +    +  KP++HL C   + +  I+FASYG P G
Sbjct  722   VSSVCADVSE-WHPTIKNWHI--ENYGRPEEHHKPKVHLRCAQGQFISAIKFASYGTPIG  778

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CGNF  G+C  PN+  I+EK C+GK +C V + +++F  G D C  ++K +AV+A C
Sbjct  779   TCGNFQQGACHSPNSHTILEKMCIGKEKCMVAISQNIF--GGDPCRNVMKRVAVEAIC  834



>gb|AEC33272.1| beta-galactosidase [Ziziphus jujuba]
Length=730

 Score =   419 bits (1077),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 228/606 (38%), Positives = 332/606 (55%), Gaps = 41/606 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG    QR  +D++F+V RF  K G+Y NYYMY GG NFG T G  FV+T
Sbjct  126   TEAWSGWFTEFGGTVHQRPVQDLAFAVARFIQKGGSYFNYYMYHGGTNFGRTAGGPFVTT  185

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+SHL++ H+A+KL +  L+     +  + G +E     N+  
Sbjct  186   SYDYDAPIDEYGLTREPKYSHLKELHKAIKLSEDALVSAGPTITSL-GTYEQAYIYNSGP  244

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL+N N+     + F    Y LP  S+SILPDC+N+ +NT  +  Q +H    P+
Sbjct  245   RKCAAFLANYNSKSAARVLFNNRHYNLPPWSISILPDCRNVAYNTALVGVQTSHVHMLPT  304

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPK-EMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +  L WE + E I ++D     +     E   +T+ T+DY+W+ T V ++  +  +R 
Sbjct  305   GTS-LLSWETYDEVISSLDERARMTAVGLLEQINVTRDTSDYLWYMTSVDISSSESFLRG  363

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ VFING+F+G   G    ++F    PVNL+ G+N I+ L   +  
Sbjct  364   GQKPTLNVQSAGHAVRVFINGQFSGSAFGTREHRQFTFTGPVNLRAGSNKISLLSIAVGL  423

Query  896   PNSG----AWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKA  1063
             PN G     W E    GP  V L  L  G +D+T   WSY +G +GE + L T EGA  A
Sbjct  424   PNVGFHYELW-ETGVLGP--VFLNGLDNGKRDLTWQKWSYQVGLKGEAMNLVTPEGASSA  480

Query  1064  KWGPVTGNHNTRRA---TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL  1234
              W  V G+   R     TWYK +F+ P GN+P+A+++  M KG V +NG+SIGRYW ++ 
Sbjct  481   DW--VRGSLAARSVQPLTWYKAYFNAPNGNEPLALDLRSMGKGQVRINGQSIGRYWTAYA  538

Query  1235  TP-------------------LGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVM  1357
                                  +  PTQ  YH+PR WLKPK NLLV+FEE GGD   I ++
Sbjct  539   KGDCEACSYTGHSGRQNVNLVVASPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKIALL  598

Query  1358  LVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGN  1537
               +   +C++  EN+P   K      D  +      +  ++L C   + +  IEFAS+G 
Sbjct  599   RRSLTNVCANAFENHPSMAKYSTSSQDGSKVK----EATVNLQCGPGQSISAIEFASFGT  654

Query  1538  PEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAK  1717
             P G CG+F  G+C  PN+  I+EK C+G+  C V +  S+F  G D CP ++K L V+A 
Sbjct  655   PSGTCGSFHIGTCHAPNSRSIIEKKCVGQKSCSVTISNSIF--GADPCPNVLKRLTVEAV  712

Query  1718  CVRQGK  1735
             C +  K
Sbjct  713   CSKAVK  718



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   421 bits (1083),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/601 (37%), Positives = 329/601 (55%), Gaps = 38/601 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  QR  +D++F+  RF  + G++VNYYMY GG NFG T G  F++T
Sbjct  250   TEAWSGWFTEFGGPIHQRPVQDLAFAAARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIAT  309

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+   A +  + G+ +      T+ 
Sbjct  310   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSTDAIVTSL-GESQQAHVYTTES  368

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN ++     + F    Y LP  SVSILPDC+N++FNT  +  Q +     P+
Sbjct  369   GECAAFLSNYDSKSSVRVMFNNMHYNLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPT  428

Query  539   KVAGNLKWEMFQESIPTI-DTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                    WE F E I ++ D+    +P   E   +TK  +DY+W+ T V +   +  +  
Sbjct  429   NTQ-MFSWESFDEDIYSVEDSSAITAPGLLEQINVTKDESDYLWYITSVDIGSSESFLHG  487

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ VFING+ +G   G    + F     VNL+ GTN I  L   +  
Sbjct  488   GELPTLLVQSTGHAVHVFINGQLSGSAFGTREYRRFKYTDKVNLRAGTNRIALLSVAIGL  547

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W 
Sbjct  548   PNVGEHFESWNTGILGPVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISNVAWM  607

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT----  1237
                      +  TW++T FD PEG++P+A++ME M KG +W+NG+SIGRYW +F T    
Sbjct  608   QSAIVVQKNQPLTWHRTSFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNCN  667

Query  1238  ---------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRD  1372
                              GQPTQ  YH+PR WLKP  NLLV+FEE GGDP  I ++  +  
Sbjct  668   DCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGDPSKISLVKRSVS  727

Query  1373  TICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNP  1540
             ++C+ V+E + P++K W      K +EFR       P++HL C   + +  I+FAS+G P
Sbjct  728   SVCADVSE-FHPNIKNWHIESYGKSEEFR------PPKVHLHCSPGQTISSIKFASFGTP  780

Query  1541  EGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              G CGN++ G+C  P +   +EK C+GK+ C + V  S F  G+D CP ++K L+V+A C
Sbjct  781   LGTCGNYVQGACHSPASYATLEKRCVGKSRCTITVSNSNF--GQDPCPNVLKRLSVEAVC  838

Query  1721  V  1723
              
Sbjct  839   A  839



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   421 bits (1082),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/599 (37%), Positives = 330/599 (55%), Gaps = 34/599 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  QR  +D++F+V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFNEFGGPLHQRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HR++KLC++ L+     ++ + G  +     ++D 
Sbjct  312   SYDYDAPIDEYGLVRQPKYGHLKELHRSIKLCERALVSADPIVSSL-GSFQQAHVYSSDA  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN +T     + F    Y LP  S+SILPDC+N +FNT  +  Q  H    P+
Sbjct  371   GDCAAFLSNYDTKSSARVMFNNMHYNLPPWSISILPDCRNAVFNTAKVGVQTAHMEMLPT  430

Query  539   KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               A  L WE + E I ++D +    +    E   +T+  +DY+W+ TR+ +   +  +R 
Sbjct  431   N-AEMLSWESYDEDISSLDDSSTFTTLGLLEQINVTRDASDYLWYITRIDIGSSESFLRG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L +++ GHA+ VFING+  G   G    + F   + VNL  GTN I  L   +  
Sbjct  490   GELPTLILQTTGHAVHVFINGQLTGSAFGTREYRRFTFTEKVNLHAGTNTIALLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W 
Sbjct  550   PNVGGHFETWNTGILGPVALHGLNQGKWDLSWQRWTYKVGLKGEAMNLVSPNGISSVDW-  608

Query  1073  PVTGNHNTRRA---TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTP-  1240
              + G+   +R    TW+K  F+ PEG++P+A++ME M KG VW+NG+SIGRYW ++    
Sbjct  609   -MQGSLAAQRQQPLTWHKAFFNAPEGDEPLALDMEGMGKGQVWINGQSIGRYWTAYANGN  667

Query  1241  ------------------LGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                                GQPTQ  YH+PR WLKP  NLLVVFEE GGDP  I ++  +
Sbjct  668   CQGCSYSGTYRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVVFEELGGDPSRISLVRRS  727

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               ++C+ V E Y P++K W    + +  T +  KP++HL C   + +  I+FASYG P G
Sbjct  728   MTSVCADVFE-YHPNIKNWHI--ESYGKTEELHKPKVHLRCGPGQSISSIKFASYGTPLG  784

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
              CG+F  G C  P++  IVEK C+G+  C V +  + F +  D CP ++K L+V+A C 
Sbjct  785   TCGSFEQGPCHAPDSYAIVEKRCIGRQRCAVTISNTNFAQ--DPCPNVLKRLSVEAVCA  841



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   421 bits (1081),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 222/597 (37%), Positives = 331/597 (55%), Gaps = 32/597 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE WTA Y  FG P  +R AED++F+V RF  K G ++NYYMY GG NFG T G  F++T
Sbjct  256   TEAWTAWYTEFGGPVPKRPAEDLAFAVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIAT  315

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL+D HRA+KLC+  L+ G   + ++ G++E      +  
Sbjct  316   SYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTQL-GNYEQAHVFKSKS  374

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N N      ++F    Y LP  S+SILPDC+N ++NT  + AQ +       
Sbjct  375   GACAAFLANYNPNSFAKVSFGNMHYNLPPWSISILPDCENTVYNTARVGAQSSTMKMTRV  434

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              + G L W+ + E   + +          E    T+  +DY+W+ T V ++  +  +R  
Sbjct  435   PIHGGLSWQAYNEQTASYEETSFTVSGLLEQINTTRDASDYLWYMTDVKIDPSEEFLRSG  494

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
              +PVL V S GHA+ VF+NG+ AG ++G+    +  L + VNL+ G N I  L   +  P
Sbjct  495   KYPVLTVSSAGHALHVFVNGQLAGTSYGSLEFPKLTLSKGVNLRAGINTIALLSIAVGLP  554

Query  899   NSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             N G   E   AG    V L  L  G +D++   WSY +G +GE L L +  G+    W  
Sbjct  555   NVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKVGLRGEALSLHSLTGSSSVDW--  612

Query  1076  VTGNHNTRRA--TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF------  1231
             + G+   R+   TW+KT FD P G  P+A++M  M KG +W+NG+S+GRYW ++      
Sbjct  613   IQGSLVARKQPLTWFKTSFDAPAGYAPLALDMGSMGKGQIWINGQSLGRYWPAYKAQGSC  672

Query  1232  --------------LTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                           L+  G  +Q  YH+P+ WLKP  NLLVVFEE+GGDP+ + ++  + 
Sbjct  673   GGCDYAGTYNEKKCLSNCGDASQRWYHVPKSWLKPTGNLLVVFEEWGGDPNGVFLVRRDV  732

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGV  1549
             DT+C+ + E + P +  W+ +          L+P+ HL+C   + + KI+FAS+G PEG 
Sbjct  733   DTVCADIYE-WQPTLMNWQMQSSG--KVDKPLRPKAHLSCGAGQKISKIKFASFGTPEGA  789

Query  1550  CGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             CG+F  GSC   ++    E+ C+G+  C V V   +F  G D CP ++K L+V+A C
Sbjct  790   CGSFREGSCHAHHSYDAFERLCVGQNSCSVTVAAEMF--GGDPCPSVMKKLSVEAIC  844



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=853

 Score =   421 bits (1081),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 217/597 (36%), Positives = 328/597 (55%), Gaps = 31/597 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  QR  +D++++V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFTEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ H+A+K+C++ L+     +  + GD +      ++ 
Sbjct  312   SYDYDAPLDEYGLIRQPKYGHLKELHKAIKMCERALVSADPIITSL-GDFQQAHVYTSES  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN+N+     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  371   GDCAAFLSNHNSKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPT  430

Query  539   KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              V   L WE + E + ++D +    +    E   +T+ TTDY+W+ T V +   +  +  
Sbjct  431   NVE-TLLWETYDEDLTSLDDSSTMTASGLLEQINVTRDTTDYLWYITSVDIGSSESFLHG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ +FING+ +G   G   ++ F     VNL+ GTN I  L   +  
Sbjct  490   GELPTLIVQSTGHALHIFINGQLSGSAFGTRESRRFTYTGKVNLRAGTNKIALLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L + +      W 
Sbjct  550   PNVGGHFEAYNTGILGPVALHGLNQGKWDLSWQKWTYQVGLKGEAMNLVSPDSISSVDWL  609

Query  1073  PVTGNHNTRR-ATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL-----  1234
               +     ++  TW+K+ FD PEG++P+A++ME M KG +W+NG+S+GRYW +F      
Sbjct  610   QASLVAQKQQPLTWHKSIFDAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAFANGDCN  669

Query  1235  --------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRD  1372
                           T  GQPTQ  YH+PR WLKP  NLLV+FEE GGDP  + ++  +  
Sbjct  670   GCSYAGGFKPTKCQTGCGQPTQRYYHVPRSWLKPTQNLLVIFEELGGDPSRVSIVKRSVS  729

Query  1373  TICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVC  1552
             T+C+ VAE Y P +K W    + +    D   P++HL C   + +  I+FAS+G P G C
Sbjct  730   TVCAEVAE-YHPTIKNWHI--ESYGKVQDFHSPKVHLRCNPGQSISSIKFASFGTPFGTC  786

Query  1553  GNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             G +  GSC    +  ++EK C+GK  C V +  + F    D CPK++K L+V+A C 
Sbjct  787   GTYQQGSCHASTSYSVIEKKCIGKQRCAVTISNTNF---GDPCPKVLKRLSVEAVCA  840



>gb|KDO84694.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=644

 Score =   414 bits (1064),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 322/598 (54%), Gaps = 34/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG    +R  +D++F+V RF  K G++ NYYMY GG NFG T G  F++T
Sbjct  47    TEAWSGWFTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITT  106

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL+  H A+KLC+  L+     +  +    +   F     
Sbjct  107   SYDYDAPLDEYGLMRQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQ  166

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFLSN NT     + F G  Y LP  S+SILPDCKN++FNT  +  QH      P+
Sbjct  167   K-CAAFLSNYNTKSAARVTFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPT  225

Query  539   KVAGNLKWEMFQESIPTI-DTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +  L WE + E I ++ ++    +    E   +T+ T+DY+W+ T V ++  +  +R 
Sbjct  226   G-SKLLSWETYDEDISSLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRG  284

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L VES GHA+ VFING+F G   G    + F    P NL+ G N I  L   +  
Sbjct  285   GQKPTLTVESAGHAVHVFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGL  344

Query  896   PNSGAWMERRYAGPK-SVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G + +V+L  L  GN+D+T   WSY +G +GE + L +   A    W 
Sbjct  345   PNVGLHYETWETGVRGAVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWT  404

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF-----  1231
              G +      +   WYK +FD P GN+P+A+++  M KG VW+NG+SIGRYW+++     
Sbjct  405   RGSLAA-QGQQSLKWYKAYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDC  463

Query  1232  --------LTPL------GQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                       P+      G PTQ  YH+PR WLKP  NLLVVFEE GGD   I ++  + 
Sbjct  464   KTCSYAGTFRPINCQRRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSV  523

Query  1370  DTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               +C+   E++P  D    E KG+    +      ++ L C   + +  IEFAS+G P G
Sbjct  524   ARVCADAHEHHPTTDNNDIENKGN----SNSTGNAKVLLQCAPGQSITSIEFASFGTPSG  579

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CG+F  G+C  PN+  ++EK C+G+  C + +   +F  G D CP ++K L+VQA C
Sbjct  580   TCGSFQKGTCHAPNSHAMLEKECIGQESCSIFISSGVF--GTDPCPNVLKRLSVQAVC  635



>gb|KDO65276.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=618

 Score =   413 bits (1062),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/595 (37%), Positives = 317/595 (53%), Gaps = 29/595 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE WT  Y  FG P   R  ED++FSV +F  K G+++NYYMY GG NFG T G  F++T
Sbjct  30    TEAWTGWYTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIAT  89

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL+D HRA+KLC+  L+ G   +  +    E   F++   
Sbjct  90    SYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKSA  149

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N N      + F    Y LP  S+SILPDCKN ++NT  +  Q       P 
Sbjct  150   --CAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPV  207

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
              + G   W+ F E                E    T+  TDY+W+ T V ++  +  +R  
Sbjct  208   PIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSG  267

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
              +PVL V S GHA+ VF+NG+ AG  +G+    +    + VN++ G N I  L   +  P
Sbjct  268   NYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLP  327

Query  899   NSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGP  1075
             N G   E   AG    V L  L  G +D++   W+Y IG +GEKL L +  G    +W  
Sbjct  328   NVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAE  387

Query  1076  VTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF--------  1231
              +     +  TWY+T F  P GN P+A++M  M KG VWVNG+SIGR+W ++        
Sbjct  388   GSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKASGSCGY  447

Query  1232  ------------LTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDT  1375
                         L+  G+ +Q  YH+PR WLKP  NLLVVFEE+GG+P+ I ++    D+
Sbjct  448   CSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDS  507

Query  1376  ICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCG  1555
             +C+ + E + P +  W+            L+P+ HL C   + +K I+FAS+G PEGVCG
Sbjct  508   VCAYMYE-WQPTLINWQLHASG--KVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCG  564

Query  1556  NFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             ++  GSC   ++    ++ C+G+  C V V   +F  G D CP I+K LAV+A C
Sbjct  565   SYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMF--GGDPCPSIMKQLAVEAIC  617



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   419 bits (1078),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 231/598 (39%), Positives = 326/598 (55%), Gaps = 37/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSS-FVST  178
             TENWT  Y  FG     R AED++FSV RF    G+++NYYMY GG NFG T +  F++T
Sbjct  254   TENWTGWYTEFGGAVPYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTSAGLFIAT  313

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  RDPKW HLRD H+A+KLC+  L+     +  +  + E   F++   
Sbjct  314   SYDYDAPLDEYGLTRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKSS  373

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N +T     + F    Y LP  S+SILPDCK  +FNT  + AQ +     P 
Sbjct  374   --CAAFLANYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSQMKMTP-  430

Query  539   KVAGNLKWEMFQESIPTIDTLPAKS-PAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              V G L W+ + E   T  T    +     E   +T+  +DY+W+ T V ++  +  ++ 
Sbjct  431   -VGGALSWQSYIEEAATGYTDDTTTLEGLWEQINVTRDASDYLWYMTNVNIDSDEGFLKN  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                PVL + S GH++ VFING+ AG  +G+    +    Q V L  G N I+ L   +  
Sbjct  490   GDSPVLTIFSAGHSLHVFINGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN G   E+  AG    V L  L  G +D++   WSY IG +GE L L T  G+   +W 
Sbjct  550   PNVGVHFEKWNAGILGPVTLKGLNEGTRDLSGWKWSYKIGLKGEALSLHTVTGSSSVEW-  608

Query  1073  PVTGNHNTRRA--TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL----  1234
              V G+ + ++   TWYK  FD PEGNDP+A++M  M KG +WVNG+SIGR+W ++     
Sbjct  609   -VEGSLSAKKQPLTWYKATFDAPEGNDPVALDMSSMGKGQIWVNGQSIGRHWPAYTARGS  667

Query  1235  ----------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                             +  G+P+Q  YH+PR WL P  NLLVVFEE+GG+P  I ++   
Sbjct  668   CSACNYAGTYDDKKCRSNCGEPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPSGISLVKRT  727

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               ++C+ + E  P  +K W+          D L+P+ HL CP  + + KI+FASYG+P+G
Sbjct  728   TGSVCADIFEGQPA-LKNWQMIA---LGRLDHLQPKAHLWCPHGQKISKIKFASYGSPQG  783

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CG+F  GSC    +    EK C+GK  C V V   +F  G D CP   K L+V+A C
Sbjct  784   TCGSFKAGSCHAHKSYDAFEKKCIGKQSCSVTVAAEVF--GGDPCPDSSKKLSVEAVC  839



>gb|EYU22313.1| hypothetical protein MIMGU_mgv1a001532mg [Erythranthe guttata]
Length=801

 Score =   418 bits (1075),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 222/609 (36%), Positives = 330/609 (54%), Gaps = 39/609 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG     R  ED++FSV RF+ K G+  NYYMY GG NFG T G  F++T
Sbjct  195   TENWPGWFKTFGASDPHRPPEDVAFSVARFFQKGGSLQNYYMYHGGTNFGRTSGGPFITT  254

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL+D HR++KLC++ LL G      +    E   +E +  
Sbjct  255   SYDYDAPIDEYGLARCPKWGHLKDLHRSIKLCERALLNGQPTFLSLGPSQEADVYEESS-  313

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               C AF+SN + +   T+ FR T  YLPA SVSILPDCKN++FNT  + AQ +     P+
Sbjct  314   GACVAFISNMDDINGKTVVFRNTSLYLPAWSVSILPDCKNVVFNTAKVGAQTSTVEMIPT  373

Query  539   KVAGN----------LKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVM  688
             ++  +          ++W++F+E     DT         +    TK TTDY+W++T +++
Sbjct  374   ELLASTASANKGLKGVQWQVFKERAGIWDTADFTKNGLVDHINTTKDTTDYLWYTTSLLV  433

Query  689   NKRDLPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDI  868
             +  +  +     P+L VES GHAM VFIN +      GN     F    P++LK G N+I
Sbjct  434   HGTEEFLTSGKSPMLIVESKGHAMHVFINQKLQVSASGNGTVPSFKFTTPISLKAGKNEI  493

Query  869   TFLCSILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEE  1048
               L   +   N+GA+ E   AGP SV ++ +  G  D++ N+W Y IG QGE L+++  +
Sbjct  494   ALLSMTVGLQNAGAFYEWVGAGPTSVRIVGMRNGTMDLSTNTWRYKIGLQGEHLRIYDRD  553

Query  1049  GAEKAKWGPVTGNHNTRR-ATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV  1225
                 A W   +     ++  TWYK   D P G +P+ ++M  M KG+ W+NG  IGRYW 
Sbjct  554   DLNSANWVSTSSAPPKQQPLTWYKALVDPPPGKEPVGLDMIHMGKGLAWLNGNEIGRYWP  613

Query  1226  -----------------SFL-----TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDP  1339
                               F+     T  G+PTQ  YH+PR W KP  N LV+FEE GGDP
Sbjct  614   IKASINEKCVQKCDYRGKFMPNKCNTGCGEPTQRWYHVPRSWFKPSGNTLVIFEEKGGDP  673

Query  1340  DSIKVMLVNRDTICSSVAENYPPDVKIWE--RKGDEFRATTDDLKPRMHLTCPDAKVMKK  1513
               I+       ++C+ +++++P    + E  +KG+            ++L CP +  +  
Sbjct  674   TQIRFSKRKVSSVCAHISQDHPLSEDMIESLQKGETGYPYKKKASVSLNLKCPVSTQISD  733

Query  1514  IEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIV  1693
             ++FAS+G+P G CG +  G C  PN++ +V+KACL + EC+V +    F    +LCP +V
Sbjct  734   VKFASFGDPVGNCGAYAVGECHDPNSVSMVQKACLNRNECQVELSGENF--DIELCPNLV  791

Query  1694  KTLAVQAKC  1720
             K LAV+A C
Sbjct  792   KKLAVEAVC  800



>gb|KDP32835.1| hypothetical protein JCGZ_12127 [Jatropha curcas]
Length=778

 Score =   417 bits (1072),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 230/577 (40%), Positives = 328/577 (57%), Gaps = 43/577 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+ Y+ +G     RSAEDI+F    F +K G+Y+NYYMY GG NFG T S+F+ T+
Sbjct  240   TENWTSFYQTYGGETYMRSAEDIAFHAALFIAKKGSYINYYMYHGGTNFGRTASAFMITS  299

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWG---TANLNKINGDHEITTFENT  352
             YYD+ P+D YG    PKW HL+  H  +K C   LL G   T +L K+   +     EN+
Sbjct  300   YYDQSPLDEYGQISQPKWGHLKKLHATIKSCSDTLLHGANYTVHLGKLQQAYVFK--ENS  357

Query  353   DLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFD  532
                 C AFL NN++ +   + F+   Y +P KS+SILP+CK + FNT  +  Q+N R+  
Sbjct  358   GA--CVAFLVNNSSRRDAQVLFQNISYQIPRKSISILPNCKTVTFNTAKVNTQYNTRSMI  415

Query  533   PSKVAG-NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
              S+       WE ++E+IP  D    +  +  +  ++TK  +DY+W++ R    K D P 
Sbjct  416   KSRRFNPTETWEEYEETIPAFDKTSLRETSLLDHMSITKDQSDYLWYTFRF---KNDFP-  471

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
               +   V+   S GH +  +ING +AG  HGN+    F L   + LK G ND+  L + +
Sbjct  472   --NAQAVIQAFSHGHVLHAYINGVYAGSAHGNHSNPIFTLENSIYLKEGENDVALLSATV  529

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW  1069
               PN+GA++ER+ AG + V L      N+D T+  W Y +G  GE+L+++TE+G+   +W
Sbjct  530   GLPNAGAYLERKIAGLRRVSLQ-----NKDFTRYEWGYQVGLVGEELQIYTEKGSSNVQW  584

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQ  1249
                 G+ + R  TWYKT FD P GNDP+A+N+  M KG  WVNG+SIGRYWVSF T  G+
Sbjct  585   NKFKGS-SQRPLTWYKTLFDAPAGNDPVALNLHSMGKGEAWVNGQSIGRYWVSFHTYKGR  643

Query  1250  PTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWER  1429
             P+QT YHIPR +LKP  NLLV+ EE  G P  I V  ++   +C  V+E++         
Sbjct  644   PSQTWYHIPRSFLKPTGNLLVLLEEEQGYPPDITVDTISITRVCRHVSESH---------  694

Query  1430  KGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEK  1609
                 F A        +HL+CP    +  I+FAS+G P G C ++  G+C   N+  + EK
Sbjct  695   ----FSA--------VHLSCPRNMKISSIQFASFGTPVGNCESYAIGNCHSSNSKAVAEK  742

Query  1610  ACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             AC+GK +C +      F  G D CP I K L V A+C
Sbjct  743   ACIGKQKCSIVRSNQFF--GGDPCPGIPKALLVAAEC  777



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =   419 bits (1077),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 226/598 (38%), Positives = 330/598 (55%), Gaps = 34/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG     R  +D++F+V RF  K G++VNYYMY GG NFG + G  F++T
Sbjct  252   TEAWSGWFTEFGGAFHHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRSAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+ HL++ HRA+KLC+  L+     +  +    +   F ++  
Sbjct  312   SYDYDAPIDEYGLIREPKYGHLKELHRAIKLCEHELVSSDPTITLLGTYQQAHVF-SSGK  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + C+AFL+N +T     + F    Y LP  S+SILPDC+N++FNT  +  Q +H    P+
Sbjct  371   RSCSAFLANYHTQSAARVMFNNMHYVLPPWSISILPDCRNVVFNTAKVGVQTSHVQMLPT  430

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSP-APKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +    WE + E I ++      +     E   +T+ TTDY+W+ T V +N  +  +R 
Sbjct  431   G-SRFFSWESYDEDISSLGASSRMTALGLMEQINVTRDTTDYLWYITSVNINPSESFLRG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L VES GHA+ VFING+F+G   G    +EF    PVNL+ GTN I  L   +  
Sbjct  490   GQWPTLTVESAGHALHVFINGQFSGSAFGTRENREFTFTGPVNLRAGTNRIALLSIAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN G   E    G    V+L  L  GN+D+T   WSY +G +GE + L +   A    W 
Sbjct  550   PNVGVHYETWKTGILGPVMLHGLNQGNKDLTWQQWSYQVGLKGEAMNLVSPNRASSVDW-  608

Query  1073  PVTGNHNTRRA--TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT---  1237
              + G+  TR+    WYK +FD P GN+P+A++M  M KG VW+NG+SIGRYW+S+     
Sbjct  609   -IQGSLATRQQPLKWYKAYFDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSYAKGDC  667

Query  1238  ----------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLKPK NLLV+FEE GGD   I ++  + 
Sbjct  668   SSCGYSGTFRPPKCQLGCGQPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRST  727

Query  1370  DTICSSVAENYPP-DVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
              ++C+   E++P  +    E  G+  R   +  + ++HL C   + +  I FAS+G P G
Sbjct  728   TSVCADAFEHHPTIENYNTESNGESER---NLHQAKVHLRCAPGQSISAINFASFGTPTG  784

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CG+F  G+C  PN+  +VEK C+G+  C V +  S F  G D CP  +K L+V+A C
Sbjct  785   TCGSFQEGTCHAPNSHSVVEKKCIGRESCMVAISNSNF--GADPCPSKLKKLSVEAVC  840



>gb|KDO84693.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=698

 Score =   414 bits (1064),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 322/598 (54%), Gaps = 34/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG    +R  +D++F+V RF  K G++ NYYMY GG NFG T G  F++T
Sbjct  101   TEAWSGWFTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITT  160

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL+  H A+KLC+  L+     +  +    +   F     
Sbjct  161   SYDYDAPLDEYGLMRQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQ  220

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFLSN NT     + F G  Y LP  S+SILPDCKN++FNT  +  QH      P+
Sbjct  221   K-CAAFLSNYNTKSAARVTFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPT  279

Query  539   KVAGNLKWEMFQESIPTI-DTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +  L WE + E I ++ ++    +    E   +T+ T+DY+W+ T V ++  +  +R 
Sbjct  280   G-SKLLSWETYDEDISSLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRG  338

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L VES GHA+ VFING+F G   G    + F    P NL+ G N I  L   +  
Sbjct  339   GQKPTLTVESAGHAVHVFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGL  398

Query  896   PNSGAWMERRYAGPK-SVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G + +V+L  L  GN+D+T   WSY +G +GE + L +   A    W 
Sbjct  399   PNVGLHYETWETGVRGAVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWT  458

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF-----  1231
              G +      +   WYK +FD P GN+P+A+++  M KG VW+NG+SIGRYW+++     
Sbjct  459   RGSLAA-QGQQSLKWYKAYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDC  517

Query  1232  --------LTPL------GQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                       P+      G PTQ  YH+PR WLKP  NLLVVFEE GGD   I ++  + 
Sbjct  518   KTCSYAGTFRPINCQRRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSV  577

Query  1370  DTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               +C+   E++P  D    E KG+    +      ++ L C   + +  IEFAS+G P G
Sbjct  578   ARVCADAHEHHPTTDNNDIENKGN----SNSTGNAKVLLQCAPGQSITSIEFASFGTPSG  633

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CG+F  G+C  PN+  ++EK C+G+  C + +   +F  G D CP ++K L+VQA C
Sbjct  634   TCGSFQKGTCHAPNSHAMLEKECIGQESCSIFISSGVF--GTDPCPNVLKRLSVQAVC  689



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   418 bits (1075),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 223/604 (37%), Positives = 337/604 (56%), Gaps = 42/604 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F+V RF ++ G++VNYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFTEFGGPIHKRPVQDLAFAVARFVTRGGSFVNYYMYHGGTNFGRTAGGPFIAT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+     +  +    +   + +T+ 
Sbjct  312   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSTDPIVTSLGSSQQAHVY-STES  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILA--QHNHRTFD  532
               CAAFLSN ++     + F    Y LP  SVSILPDC+N +FNT  +    Q +     
Sbjct  371   GDCAAFLSNYDSKSAARVLFNNMHYNLPPWSVSILPDCRNAVFNTAKVCVGVQTSQMQML  430

Query  533   PSKVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
             P+       WE F E   ++D +    +P   E   +T+  +DY+W+ T V ++  +  +
Sbjct  431   PTNTQ-MFSWESFDEDTSSLDDSSTLTAPGLLEQINVTRDASDYLWYITSVDISSSESFL  489

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
                  P L V+S GHA+ VFING+ +G  +G+   + F+ +  VNL+ GTN I  L   +
Sbjct  490   HGGELPTLIVQSTGHAVHVFINGQLSGSTYGSREYRRFMHIGKVNLRAGTNRIALLSVAI  549

Query  890   SYPNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
               PN G   E    G    V L  L  G +D+++  W+Y +G +GE + L +       +
Sbjct  550   GLPNVGEHFETWNTGILGPVALHGLDQGKRDLSQQKWTYQVGLKGEAMNLASPNSISSVE  609

Query  1067  W--GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT-  1237
             W    +    N +  TW+KT+FD PEG++P+A++ME M KG +W+NG+SIGRYW +F   
Sbjct  610   WMQSAIVVQRN-QPLTWHKTNFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANG  668

Query  1238  ------------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLV  1363
                                 GQPTQ  YH+PR WLKP  NLLV+FEE GG+P  I ++  
Sbjct  669   NCNDCNYAGSFRPQKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKR  728

Query  1364  NRDTICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASY  1531
             +  ++C+ V+E Y P++K W      K +EF A      P++HL C   + +  I+FAS+
Sbjct  729   SVSSVCADVSE-YHPNIKNWHIDSYGKSEEFHA------PKVHLHCSPGQTISSIKFASF  781

Query  1532  GNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQ  1711
             G P G CGN+  G+C  P +  I+EK CLGK  C V V  S F  G+D CP+++K L+V+
Sbjct  782   GTPLGTCGNYEQGACHSPTSYAILEKKCLGKPRCVVTVSNSNF--GQDPCPRVMKRLSVE  839

Query  1712  AKCV  1723
             A C 
Sbjct  840   AVCA  843



>emb|CAC84109.1| putative galactosidae, partial [Gossypium hirsutum]
Length=383

 Score =   402 bits (1034),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 262/386 (68%), Gaps = 7/386 (2%)
 Frame = +2

Query  194   GPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLKLCAA  373
             GP+D +G  R+PKW HL+D HRAL LCK+ L WG     K+  D +   ++      CAA
Sbjct  4     GPLDEFGLQREPKWGHLKDVHRALSLCKRALFWGFPTTLKLGPDQQAIVWQQPGTSACAA  63

Query  374   FLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSKVAG-  550
              L+NNNT     +NFRG D  LPA+S+S+LPDCK ++FNTQ +  QHN R F  S++A  
Sbjct  64    LLANNNTRLAQHVNFRGQDIRLPARSISVLPDCKTVVFNTQLVTTQHNSRNFVRSEIANK  123

Query  551   NLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPDIHPV  730
             N  WEM++E  P    L  K   P+E++ LTK TTDY W++T +++ +RDLPM+ ++ PV
Sbjct  124   NFNWEMYREVPPV--GLGFKFDVPRELFHLTKDTTDYAWYTTSLLLGRRDLPMKKNVRPV  181

Query  731   LFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPNSGA  910
             L V S+GH +  ++NGE+AG  HG+ V K F+  +  +LK G N I  L  ++  P+SGA
Sbjct  182   LRVASLGHGIHAYVNGEYAGSAHGSKVEKSFVCRELSSLKEGENHIALLGYLVGLPDSGA  241

Query  911   WMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNH  1090
             +ME+R+AGP+S+ +L L TG  DI++N W + +GT GEK KLFTEEG++  +W   T   
Sbjct  242   YMEKRFAGPRSITILGLNTGTLDISQNGWGHQVGTDGEKKKLFTEEGSKSVQW---TKPD  298

Query  1091  NTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPLGQPTQTEYH  1270
                  TWYK +FD PEG++P+A+ M  M KGMVWVNG+SIGRYW ++L+PL +PTQ+EYH
Sbjct  299   QGGPLTWYKGYFDAPEGDNPVAIVMTGMGKGMVWVNGRSIGRYWNNYLSPLKKPTQSEYH  358

Query  1271  IPRPWLKPKNNLLVVFEEFGGDPDSI  1348
             IPR +LKPK NL+V+ EE GG+P  +
Sbjct  359   IPRAYLKPK-NLIVLLEEEGGNPKDV  383



>ref|XP_006435077.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48317.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=644

 Score =   412 bits (1058),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 321/598 (54%), Gaps = 34/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG    +R  +D++F+V RF  K G++ NYYMY GG NFG T G  F++T
Sbjct  47    TEAWSGWFTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITT  106

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL+  H A+KLC+  L+     +  +    +   F     
Sbjct  107   SYDYDAPLDEYGLMRQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQ  166

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             K CAAFLSN NT     + F G  Y LP  S+SILPDCKN +FNT  +  QH      P+
Sbjct  167   K-CAAFLSNYNTKSAARVTFNGRHYNLPPWSISILPDCKNDVFNTAKVAVQHTKMQMLPT  225

Query  539   KVAGNLKWEMFQESIPTI-DTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +  L WE + E I ++ ++    +    E   +T+ T+DY+W+ T V ++  +  +R 
Sbjct  226   G-SKLLSWETYDEDISSLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRG  284

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L VES GHA+ VFING+F G   G    + F    P NL+ G N I  L   +  
Sbjct  285   GQKPTLTVESAGHAVHVFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGL  344

Query  896   PNSGAWMERRYAGPK-SVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G + +V+L  L  GN+D+T   WSY +G +GE + L +   A    W 
Sbjct  345   PNVGLHYETWETGVRGAVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWT  404

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSF-----  1231
              G +      +   WYK +FD P GN+P+A+++  M KG VW+NG+SIGRYW+++     
Sbjct  405   RGSLAA-QGQQSLKWYKAYFDAPAGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDC  463

Query  1232  --------LTPL------GQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                       P+      G PTQ  YH+PR WLKP  NLLVVFEE GGD   I ++  + 
Sbjct  464   KTCSYAGTFRPINCQRRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSV  523

Query  1370  DTICSSVAENYP-PDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               +C+   E++P  D    E KG+    +      ++ L C   + +  IEFAS+G P G
Sbjct  524   ARVCADAHEHHPTTDNNDIENKGN----SNSTGNAKVLLQCAPGQSITSIEFASFGTPSG  579

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CG+F  G+C  PN+  ++EK C+G+  C + +   +F  G D CP ++K L+VQA C
Sbjct  580   TCGSFQKGTCHAPNSHAMLEKECIGQDSCSIFISSGVF--GTDPCPNVLKRLSVQAVC  635



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =   417 bits (1073),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 217/598 (36%), Positives = 330/598 (55%), Gaps = 33/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  QR  +D++++V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFSEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+     +  + G+ +      ++ 
Sbjct  312   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSADPIITSL-GNFQQAYVYTSES  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               C+AFLSN+++     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  371   GDCSAFLSNHDSKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMGMLPT  430

Query  539   KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              +   L WE + E I ++D +    +P   E   +T+ +TDY+W+ T V +   +  +R 
Sbjct  431   NIQ-MLSWESYDEDITSLDDSSTITAPGLLEQINVTRDSTDYLWYKTSVDIGSSESFLRG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ +FING+ +G + G   ++ F     VNL  GTN I  L   +  
Sbjct  490   GELPTLIVQSTGHAVHIFINGQLSGSSFGTRESRRFTYTGKVNLHAGTNRIALLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +        W 
Sbjct  550   PNVGGHFEAWNTGILGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLVSPNSISSVDWM  609

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL----  1234
              G +      +  TW+KT F+ PEG++P+A++ME M KG +W+NG+SIGRYW +F     
Sbjct  610   RGSLAA-QKQQPLTWHKTLFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNC  668

Query  1235  ---------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLKP  NLLV+FEEFGGDP  I ++  + 
Sbjct  669   NGCSYAGGFRPPKCQVGCGQPTQRVYHVPRSWLKPMQNLLVIFEEFGGDPSRISLVKRSV  728

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGV  1549
              ++C+ VAE Y P +K W    + +    D   P++HL C   + +  I+FAS+G P G 
Sbjct  729   SSVCAEVAE-YHPTIKNWHI--ESYGKAEDFHSPKVHLRCNPGQAISSIKFASFGTPLGT  785

Query  1550  CGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             CG++  G+C    +  +++K C+GK  C V +  S F    D CPK++K L+V+A C 
Sbjct  786   CGSYQEGTCHAATSYSVLQKKCIGKQRCAVTISNSNF---GDPCPKVLKRLSVEAVCA  840



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   417 bits (1072),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 228/602 (38%), Positives = 329/602 (55%), Gaps = 40/602 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F+  RF  + G++VNYYMY GG NFG T G  F++T
Sbjct  251   TEAWSGWFTEFGGPIHKRPVQDLAFAAARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIAT  310

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+  T  +    G+ +      T+ 
Sbjct  311   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALV-STDPIVTSLGEFQQAHVYTTES  369

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN ++     + F    Y LP  SVSILPDC+N++FNT  +  Q +     P+
Sbjct  370   GDCAAFLSNYDSKSSARVMFNNMHYSLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPT  429

Query  539   KVAGNLKWEMFQESIPTIDTLPA-KSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                    WE F E I ++D   A  +P   E   +TK  +DY+W+ T V +   +  +R 
Sbjct  430   NTQ-LFSWESFDEDIYSVDESSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRG  488

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ VFING+ +G   G    + F     VNL  G N I  L   +  
Sbjct  489   GELPTLIVQSTGHAVHVFINGQLSGSAFGTREYRRFTYTGKVNLLAGINRIALLSVAIGL  548

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W 
Sbjct  549   PNVGEHFESWSTGILGPVALHGLDKGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWM  608

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT---  1237
                +    N +  TW+KT+FD PEG++P+A++ME M KG +W+NG+SIGRYW +F T   
Sbjct  609   QSAIVVQRN-QPLTWHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNC  667

Query  1238  ----------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLK   NLLV+FEE GG+P  I ++  + 
Sbjct  668   NDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSV  727

Query  1370  DTICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGN  1537
              ++C+ V+E Y P++K W      K +EFR       P++HL C   + +  I+FAS+G 
Sbjct  728   SSVCADVSE-YHPNIKNWHIESYGKSEEFR------PPKVHLHCSPGQTISSIKFASFGT  780

Query  1538  PEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAK  1717
             P G CGN+  G+C  P +  I+EK C+GK  C V V  S F  G+D CPK++K L+V+A 
Sbjct  781   PLGTCGNYEQGACHSPASYVILEKRCIGKPRCTVTVSNSNF--GQDPCPKVLKRLSVEAV  838

Query  1718  CV  1723
             C 
Sbjct  839   CA  840



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   417 bits (1072),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 219/601 (36%), Positives = 331/601 (55%), Gaps = 32/601 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG    +R  +D+++SV RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  248   TEAWSGWFTEFGGSVPERPVQDLAYSVARFVQKGGSFVNYYMYHGGTNFGRTAGGPFITT  307

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL++ HRA+KLC+  L+     +  +    + + F ++D 
Sbjct  308   SYDYDAPIDEYGLLRQPKWGHLKELHRAIKLCEPALISADPIVTTLGSLQQSSVF-SSDS  366

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N ++     + F    Y LP  S+SILPDC+N++FNT  I  Q +      S
Sbjct  367   GGCAAFLANFDSRSTARVMFNNVHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMEMKVS  426

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
               +    W+M+ E +         +    E   +T+ TTDY+W+ T V ++  +  ++  
Sbjct  427   D-SETFSWDMYDEDVAAFSDDTITAVGLLEQLNVTRDTTDYLWYMTSVEISPSESFLQNG  485

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               PVL V+S GHA+ VFING+ +G  +G+   ++F     +NL+ GTN I+ L   +  P
Sbjct  486   QFPVLSVQSAGHALHVFINGQLSGSAYGSRENQKFTYSGGINLRAGTNKISLLSMAVGLP  545

Query  899   NSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW--  1069
             N+G   E    G    V +  L  G +DIT   WSY +G +GE + L +  G    +W  
Sbjct  546   NNGPHFETWNTGVLGPVTIKGLDEGRRDITWQKWSYQVGLKGESMGLHSINGISSVEWIK  605

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL-----  1234
               +      +  TWYK +FD P G+DP+A++M  M KG VWVNG+SIGRYW ++L     
Sbjct  606   ASLVAQKQQQTLTWYKAYFDAPAGDDPLALDMGTMHKGQVWVNGQSIGRYWPAYLAQGQC  665

Query  1235  ---------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                            T  G PTQ  YH+PR WL+P  NLL+VFEE GGD   I +   + 
Sbjct  666   GACDYTGTYRPNKCQTGCGHPTQRWYHVPRSWLQPTGNLLIVFEEIGGDVSGISLGRRSV  725

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGV  1549
             +++C+ V+E + P VK W    + +      +KP++HL C   + +  I+FAS+G P G 
Sbjct  726   ESVCADVSE-FHPVVKNWHI--ESYGRAQPVIKPKVHLHCSPGQSISAIKFASFGTPLGT  782

Query  1550  CGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCVRQ  1729
             CG+F  G+C  PN+  +++K C+G+  C V +  ++F    D CP I+K +AV+A C   
Sbjct  783   CGSFQQGACHSPNSHDVLQKKCIGRQRCSVTISTNIF---GDPCPNIMKRVAVEAVCSAG  839

Query  1730  G  1732
             G
Sbjct  840   G  840



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =   417 bits (1072),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 223/599 (37%), Positives = 330/599 (55%), Gaps = 36/599 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG     R  +D++F+V RF  K G++VNYYMY GG NFG + G  F++T
Sbjct  252   TEAWSGWFTEFGGAFHHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRSAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+ HL++ HRA+KLC+  L+     +  +    +   F ++  
Sbjct  312   SYDYDAPIDEYGLIREPKYGHLKELHRAIKLCEHELVSSDPTITLLGTYQQAHVF-SSGK  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
             + CAAFL+N +T     + F    Y LP  S+SILPDC+N++FNT  +  Q +H    P+
Sbjct  371   RSCAAFLANYHTKSAARVMFNNMHYVLPPWSISILPDCRNVVFNTAKVGVQTSHVQMLPT  430

Query  539   KVAGNLKWEMFQESIPTIDTLPAKSPAP-KEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
               +    WE + E I ++      +     E   +T+ TTDY+W+ T V +N  +  ++ 
Sbjct  431   G-SRFFSWETYDEDISSLGASSRMTALGFMEQINVTRDTTDYLWYITSVNINPSESFLQG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L VES GHA+ VFING+F+G   G    +EF    PVNL+ G N I  L   +  
Sbjct  490   GQWPTLTVESAGHALHVFINGQFSGSAFGTRENREFTYTGPVNLRAGANRIALLSIAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN G   E    G    V+L  L  GN+D+T   WSY +G +GE + + +  GA    W 
Sbjct  550   PNVGVHYETWKTGILGPVMLRGLNQGNKDLTWQQWSYQVGLKGEAMHIVSPNGASSVDW-  608

Query  1073  PVTGNHNTRRA--TWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT---  1237
              + G+  TR+    WYK +FD P GN+P+A++M  M KG VW+NG+SIGRYW+S+     
Sbjct  609   -IQGSLATRQQPLKWYKAYFDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSYAKGDC  667

Query  1238  ----------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               G+PTQ  YH+PR WLKPK NLLV+FEE GGD   I ++  + 
Sbjct  668   SSCSYSGTFRPPKCQLGCGRPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRST  727

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDD--LKPRMHLTCPDAKVMKKIEFASYGNPE  1543
              ++C+   E++P      E   +E    ++    + ++HL C   + +  I+FAS+G P 
Sbjct  728   TSVCADAFEHHPAI----ENYNNESNGESERNLHQAKVHLQCAPGQSISAIKFASFGTPT  783

Query  1544  GVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             G CG+F  G+C  PN+  +VEK C+G+  C V +  S F  G D CP  +K L+V+A C
Sbjct  784   GTCGSFQEGACHSPNSHSVVEKKCIGRESCMVTISNSNF--GADPCPSKLKKLSVEAVC  840



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   417 bits (1072),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 223/598 (37%), Positives = 330/598 (55%), Gaps = 32/598 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  256   TEAWSGWFSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  315

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ H+A+K+C++ L+     +  + G+ +      T  
Sbjct  316   SYDYDAPLDEYGLIRQPKYGHLKELHKAIKMCERALVSADPAVTSM-GNFQQAHVYTTKS  374

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN +T     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  375   GDCAAFLSNFDTKSSVRVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPT  434

Query  539   KVAGNLKWEMFQESIPTID---TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
                    WE F E I ++D    +   +    E   +T+ T+DY+W+ T V +   +  +
Sbjct  435   NTH-MFSWESFDEDISSLDDGSAITITTSGLLEQINVTRDTSDYLWYITSVDIGSSESFL  493

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             R    P L V+S GHA+ VFING+ +G  +G    + F     VNL+ GTN I  L   +
Sbjct  494   RGGKLPTLIVQSTGHAVHVFINGQLSGSAYGTREDRRFRYTGTVNLRAGTNRIALLSVAV  553

Query  890   SYPNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
               PN G   E    G    V+L  L  G  D++   W+Y +G +GE + L +  G    +
Sbjct  554   GLPNVGGHFETWNTGILGPVVLRGLNQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVE  613

Query  1067  W-GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVS-----  1228
             W      +   +  TW+KT+FD P+G++P+A++ME M KG +W+NG SIGRYW +     
Sbjct  614   WMQSALVSEKNQPLTWHKTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAAGI  673

Query  1229  ---------FLTP-----LGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                      F  P      GQPTQ  YH+PR WLKP +NLLVVFEE GGDP  I ++  +
Sbjct  674   CNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRS  733

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               +IC+ V+E Y P+++ W    D +  + +   P++HL C  ++ +  I+FAS+G P G
Sbjct  734   VSSICADVSE-YHPNIRNWHI--DSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLG  790

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CGN+  G C  P +   +EK C+GK  C V V  S F  G+D CP ++K L+V+A C
Sbjct  791   TCGNYEKGVCHSPTSYATLEKKCIGKPRCTVTVSNSNF--GQDPCPNVLKRLSVEAVC  846



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   417 bits (1073),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 223/598 (37%), Positives = 330/598 (55%), Gaps = 32/598 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  +R  +D++F V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  265   TEAWSGWFSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  324

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ H+A+K+C++ L+     +  + G+ +      T  
Sbjct  325   SYDYDAPLDEYGLIRQPKYGHLKELHKAIKMCERALVSADPAVTSM-GNFQQAHVYTTKS  383

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFLSN +T     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  384   GDCAAFLSNFDTKSSVRVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPT  443

Query  539   KVAGNLKWEMFQESIPTID---TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
                    WE F E I ++D    +   +    E   +T+ T+DY+W+ T V +   +  +
Sbjct  444   NTH-MFSWESFDEDISSLDDGSAITITTSGLLEQINVTRDTSDYLWYITSVDIGSSESFL  502

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
             R    P L V+S GHA+ VFING+ +G  +G    + F     VNL+ GTN I  L   +
Sbjct  503   RGGKLPTLIVQSTGHAVHVFINGQLSGSAYGTREDRRFRYTGTVNLRAGTNRIALLSVAV  562

Query  890   SYPNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAK  1066
               PN G   E    G    V+L  L  G  D++   W+Y +G +GE + L +  G    +
Sbjct  563   GLPNVGGHFETWNTGILGPVVLRGLNQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVE  622

Query  1067  W-GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVS-----  1228
             W      +   +  TW+KT+FD P+G++P+A++ME M KG +W+NG SIGRYW +     
Sbjct  623   WMQSALVSEKNQPLTWHKTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAAGI  682

Query  1229  ---------FLTP-----LGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                      F  P      GQPTQ  YH+PR WLKP +NLLVVFEE GGDP  I ++  +
Sbjct  683   CNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRS  742

Query  1367  RDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEG  1546
               +IC+ V+E Y P+++ W    D +  + +   P++HL C  ++ +  I+FAS+G P G
Sbjct  743   VSSICADVSE-YHPNIRNWHI--DSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLG  799

Query  1547  VCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              CGN+  G C  P +   +EK C+GK  C V V  S F  G+D CP ++K L+V+A C
Sbjct  800   TCGNYEKGVCHSPTSYATLEKKCIGKPRCTVTVSNSNF--GQDPCPNVLKRLSVEAVC  855



>ref|XP_006645099.1| PREDICTED: beta-galactosidase 3-like [Oryza brachyantha]
Length=836

 Score =   416 bits (1070),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 220/601 (37%), Positives = 335/601 (56%), Gaps = 40/601 (7%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG+    R  ED++F+V RF+ K GT  NYYMY GG NFG T G  F++T
Sbjct  247   TENWPGWFQTFGESNPHRPPEDVAFAVARFFGKGGTVQNYYMYHGGTNFGRTAGGPFITT  306

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW+HL+D H+++KLC+  LL+G ++   +    E   + +   
Sbjct  307   SYDYDAPIDEYGLRRLPKWAHLKDLHKSIKLCENTLLYGNSSFLSLGPQQEADVYTDHSG  366

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               C AFLSN ++     + F+   Y LP+ SVSILPDCKN++FNT  + +Q       P+
Sbjct  367   G-CVAFLSNLDSEMDKVVTFQNRSYDLPSWSVSILPDCKNVVFNTAKVRSQTMMMDMMPA  425

Query  539   --KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMR  712
               +V+    W +F+E I   D          +    TK TTDY+W++T   ++   L   
Sbjct  426   NLQVSKRNGWSIFREKIGIWDKSDFVRNGFVDHINSTKDTTDYLWYTTSFDVDGSHLVGG  485

Query  713   PDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILS  892
                + VL ++S GHA+  F+N EF G  +GN     F +   +NL+PG N+++ L   + 
Sbjct  486   ---NHVLHIDSKGHAVQAFLNNEFIGNAYGNGSKSNFTVEMAINLRPGKNELSLLSMTIG  542

Query  893   YPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
                +G + E   AG  SV +  +  G  +++ N+W+Y IG +GE   LF  +  +  +W 
Sbjct  543   SQYAGPFYEWVGAGITSVKISGMGNGIVNLSSNNWAYKIGLEGEHYNLFKPDQGKNVRWK  602

Query  1073  PVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV---------  1225
             P +     +  TWYK + D+P+G+DP+ ++M+ M KG+ W+NG +IGRYW+         
Sbjct  603   PQSEPPKNQPLTWYKVNVDVPQGDDPVGLDMQSMGKGLAWLNGNAIGRYWLRTSPVSDGC  662

Query  1226  -------------SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVN  1366
                             T  GQPTQ  YH+P+ W +P  N LV+FEE GGDP +I      
Sbjct  663   TSSCNYRGTFSPNKCRTGCGQPTQRWYHVPQSWFRPSGNTLVIFEEKGGDPTNITFSRRT  722

Query  1367  RDTICSSVAENYPP-DVKIWERKGDEFRATTDDLK--PRMHLTCPDAKVMKKIEFASYGN  1537
               ++CS V+E+YP  D++ W+      ++T +D +   ++ LTCP  K +  ++FAS+GN
Sbjct  723   VASVCSFVSEHYPSIDLESWD------KSTPNDSRDSAKVQLTCPKGKNISSVKFASFGN  776

Query  1538  PEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAK  1717
             P G C ++  GSC  PN++ +VEKACL    C V +    F  G+DLCP I KTLA++A 
Sbjct  777   PSGTCRSYQQGSCHHPNSLSVVEKACLKLNGCTVSLSDKGF--GEDLCPGITKTLAIEAD  834

Query  1718  C  1720
             C
Sbjct  835   C  835



>ref|XP_003523206.1| PREDICTED: beta-galactosidase 10 [Glycine max]
Length=843

 Score =   416 bits (1070),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 224/603 (37%), Positives = 325/603 (54%), Gaps = 36/603 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG     R AED++FSV RF+ K G+  NYYMY GG NFG T G  F++T
Sbjct  246   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  305

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL++ HRA+KLC+  LL G +    +    E   + ++  
Sbjct  306   SYDYDAPVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYTDSS-  364

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAF+SN +     T+ FR   Y+LPA SVSILPDCKN++FNT  + +Q N     P 
Sbjct  365   GACAAFISNVDDKNDKTVEFRNASYHLPAWSVSILPDCKNVVFNTAKVTSQTNVVAMIPE  424

Query  539   ------KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRD  700
                   K   +LKW++ +E                ++   TK TTDY+W +T + +++ +
Sbjct  425   SLQQSDKGVNSLKWDIVKEKPGIWGKADFVKSGFVDLINTTKDTTDYLWHTTSIFVSENE  484

Query  701   LPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLC  880
               ++    PVL +ES GHA+  F+N E+ G   GN     F    P++L+ G N+I  LC
Sbjct  485   EFLKKGSKPVLLIESTGHALHAFVNQEYQGTGTGNGTHSPFSFKNPISLRAGKNEIALLC  544

Query  881   SILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEK  1060
               +    +G + +   AG  SV +  L  G  D++  +W+Y IG QGE L+L+   G  K
Sbjct  545   LTVGLQTAGPFYDFIGAGLTSVKIKGLKNGTIDLSSYAWTYKIGVQGEYLRLYQGNGLNK  604

Query  1061  AKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV-----  1225
               W   +     +  TWYK   D P G++P+ ++M  M KG+ W+NG+ IGRYW      
Sbjct  605   VNWTSTSEPQKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGRYWPRKSEF  664

Query  1226  ------------------SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIK  1351
                                  T  G+PTQ  YH+PR W KP  N+LV+FEE GGDP+ IK
Sbjct  665   KSEDCVKECDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSGNILVLFEEKGGDPEKIK  724

Query  1352  VMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASY  1531
              +       C+ VAE+Y P V +  +  D+ +   +   P  HLTCP    +  ++FAS+
Sbjct  725   FVRRKVSGACALVAEDY-PSVGLLSQGEDKIQNNKN--VPFAHLTCPSNTRISAVKFASF  781

Query  1532  GNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQ  1711
             G P G CG+++ G C  PN+  IVEKACL K +C + + +  F    +LCP + + LAV+
Sbjct  782   GTPSGSCGSYLKGDCHDPNSSTIVEKACLNKNDCVIKLTEENF--KTNLCPGLSRKLAVE  839

Query  1712  AKC  1720
             A C
Sbjct  840   AVC  842



>gb|AAG29193.1|AC078898_3 beta-galactosidase, putative [Arabidopsis thaliana]
Length=780

 Score =   414 bits (1065),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 234/582 (40%), Positives = 326/582 (56%), Gaps = 49/582 (8%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMTGSSFVSTA  181
             TENWT+            SAEDI+F V  F +K+G++VNYYMY GG NFG   S FV T+
Sbjct  238   TENWTS-----------LSAEDIAFHVALFIAKNGSFVNYYMYHGGTNFGRNASQFVITS  286

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             YYD+ P+D YG  R PKW HL++ H A+KLC++PLL G      + G  +          
Sbjct  287   YYDQAPLDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISL-GKLQTAFVFGKKAN  345

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
             LCAA L N +  + +T+ FR + Y L  KSVS+LPDCKN+ FNT  + AQ+N RT    K
Sbjct  346   LCAAILVNQDKCE-STVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRT---RK  401

Query  542   VAGNLK----WEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPM  709
                NL     WE F E++P+      +S +  E    T+ T+DY+W +TR   ++     
Sbjct  402   ARQNLSSPQMWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSE-----  456

Query  710   RPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSIL  889
                   VL V  +GHA+  F+NG F G  HG   A  F+L + ++L  GTN++  L  ++
Sbjct  457   --GAPSVLKVNHLGHALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMV  514

Query  890   SYPNSGAWMERRYAGPKSVLLLALMTGNQDITKN--SWSYSIGTQGEKLKLFTEEGAEKA  1063
               PNSGA +ERR  G +SV    +  G   +  N  SW Y +G +GEK  ++TE+G+ K 
Sbjct  515   GLPNSGAHLERRVVGSRSV---KIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKV  571

Query  1064  KWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLTPL  1243
             +W     +  ++  TWYK  FD PEG DP+A+N+  M KG  WVNG+SI  +        
Sbjct  572   QWKQYR-DSKSQPLTWYKASFDTPEGEDPVALNLGSMGKGEAWVNGQSIAMF--------  622

Query  1244  GQPTQTEYHIPRPWLKPKNNLLVVF-EEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKI  1420
                +   YHIPR +LKP +NLLV+  EE  G+P  I +  V+   +C  V+   P  V  
Sbjct  623   ---SYFRYHIPRSFLKPNSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVIS  679

Query  1421  WERKGDEFRATT--DDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAI  1594
               +KG   +  T   D KP++ L CP  + + KI FAS+G P G CG++  GSC  PN++
Sbjct  680   PRKKGLNRKNLTYRYDRKPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSL  739

Query  1595  KIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              +V+KACL K+ C VPV    F  G D CP  VK+L V+A+C
Sbjct  740   AVVQKACLKKSRCSVPVWSKTF--GGDSCPHTVKSLLVRAQC  779



>gb|KHN31190.1| Beta-galactosidase 10 [Glycine soja]
Length=862

 Score =   417 bits (1071),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 224/603 (37%), Positives = 325/603 (54%), Gaps = 36/603 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TENW   ++ FG     R AED++FSV RF+ K G+  NYYMY GG NFG T G  F++T
Sbjct  265   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  324

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PKW HL++ HRA+KLC+  LL G +    +    E   + ++  
Sbjct  325   SYDYDAPVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYTDSS-  383

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAF+SN +     T+ FR   Y+LPA SVSILPDCKN++FNT  + +Q N     P 
Sbjct  384   GACAAFISNVDDKNDKTVEFRNASYHLPAWSVSILPDCKNVVFNTAKVTSQTNVVAMIPE  443

Query  539   ------KVAGNLKWEMFQESIPTIDTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRD  700
                   K   +LKW++ +E                ++   TK TTDY+W +T + +++ +
Sbjct  444   SLQQSDKGVNSLKWDIVKEKPGIWGKADFVKSGFVDLINTTKDTTDYLWHTTSIFVSENE  503

Query  701   LPMRPDIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLC  880
               ++    PVL +ES GHA+  F+N E+ G   GN     F    P++L+ G N+I  LC
Sbjct  504   EFLKKGSKPVLLIESTGHALHAFVNQEYQGTGTGNGTHSPFSFKNPISLRAGKNEIALLC  563

Query  881   SILSYPNSGAWMERRYAGPKSVLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEK  1060
               +    +G + +   AG  SV +  L  G  D++  +W+Y IG QGE L+L+   G  K
Sbjct  564   LTVGLQTAGPFYDFIGAGLTSVKIKGLKNGTIDLSSYAWTYKIGVQGEYLRLYQGNGLNK  623

Query  1061  AKWGPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWV-----  1225
               W   +     +  TWYK   D P G++P+ ++M  M KG+ W+NG+ IGRYW      
Sbjct  624   VNWTSTSEPQKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGRYWPRKSEF  683

Query  1226  ------------------SFLTPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIK  1351
                                  T  G+PTQ  YH+PR W KP  N+LV+FEE GGDP+ IK
Sbjct  684   KSEDCVKECDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSGNILVLFEEKGGDPEKIK  743

Query  1352  VMLVNRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASY  1531
              +       C+ VAE+Y P V +  +  D+ +   +   P  HLTCP    +  ++FAS+
Sbjct  744   FVRRKVSGACALVAEDY-PSVGLLSQGEDKIQNNKN--VPFAHLTCPSNTRISAVKFASF  800

Query  1532  GNPEGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQ  1711
             G P G CG+++ G C  PN+  IVEKACL K +C + + +  F    +LCP + + LAV+
Sbjct  801   GTPSGSCGSYLKGDCHDPNSSTIVEKACLNKNDCVIKLTEENF--KTNLCPGLSRKLAVE  858

Query  1712  AKC  1720
             A C
Sbjct  859   AVC  861



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score =   412 bits (1058),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 213/598 (36%), Positives = 328/598 (55%), Gaps = 32/598 (5%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+     FG P  QR  +D++++V  F  K G++VNYYMY GG NFG T G  F++T
Sbjct  95    TETWSGWVTEFGGPIHQRPVQDLAYAVATFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  154

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ H+A+K+C++ L+     +  + G+ +      ++ 
Sbjct  155   SYDYDAPLDEYGLIRQPKYGHLKELHKAIKMCERALVSADPIITSL-GNFQQAYVYTSES  213

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               C+AFLSN+++     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  214   GDCSAFLSNHDSKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPT  273

Query  539   KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              +   L WE + E + ++D +    +P   E   +T+ +TDY+W+ T V ++  +  +  
Sbjct  274   NIP-MLSWESYDEDLTSMDDSSTMTAPGLLEQINVTRDSTDYLWYITSVDIDSSESFLHG  332

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ +FING+  G   G   ++ F     VNL+ GTN I  L   +  
Sbjct  333   GELPTLIVQSTGHAVHIFINGQLTGSAFGTRESRRFTYTGKVNLRAGTNKIALLSVAVGL  392

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L ++      +W 
Sbjct  393   PNVGGHFEAWNTGILGPVALHGLNQGKWDLSWQKWTYQVGLKGEAMNLVSQNAFSSVEWI  452

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL----  1234
              G +      +  TW+KT F+ PEG++P+A++ME M KG +W+NG+SIGRYW +F     
Sbjct  453   SGSLIAQKKQQPLTWHKTIFNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNC  512

Query  1235  ---------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                            +  G+PTQ  YH+PR WLKP  NLLV+FEE GGDP  I ++    
Sbjct  513   NGCSYAGGFRPTKCQSGCGKPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAV  572

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGV  1549
              ++CS VAE Y P +K W    + +    D   P++HL C   + +  I+FAS+G P G 
Sbjct  573   SSVCSEVAE-YHPTIKNWHI--ESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGT  629

Query  1550  CGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             CG++  G+C    +  +V+K C+GK  C V +  S F    D CPK++K L+V+A C 
Sbjct  630   CGSYQEGTCHATTSYSVVQKKCIGKQRCAVTISNSNF---GDPCPKVLKRLSVEAVCA  684



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   416 bits (1069),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 227/601 (38%), Positives = 328/601 (55%), Gaps = 40/601 (7%)
 Frame = +2

Query  5     ENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVSTA  181
             E W+  +  FG P  +R  +D++F+V RF  + G++VNYYMY GG NFG T G  F++T+
Sbjct  252   EAWSGWFTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATS  311

Query  182   YYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDLK  361
             Y  + P+D YG  R PK+ H ++ HRA+K+C++ L+  T  +    G+ +      T+  
Sbjct  312   YDYDAPLDEYGLIRQPKYGHFKELHRAIKMCERALV-STDPIVTSLGEFQQAHVYTTESG  370

Query  362   LCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPSK  541
              CAAFLSN ++     + F    Y LP  SVSILPDC+N++FNT  +  Q +     P+ 
Sbjct  371   DCAAFLSNYDSKSSARVMFNNMHYSLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPTN  430

Query  542   VAGNLKWEMFQESIPTIDTLPA-KSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRPD  718
                   WE F E I ++D   A  +P   E   +TK  +DY+W+ T V +   +  +R  
Sbjct  431   TQ-LFSWESFDEDIYSVDESSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRGG  489

Query  719   IHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSYP  898
               P L V+S GHA+ VFING+ +G   G    + F     VNL  G N I  L   +  P
Sbjct  490   ELPTLIVQSTGHAVHVFINGQLSGSAFGTREYRRFTYTGKVNLLAGINRIALLSVAIGLP  549

Query  899   NSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW--  1069
             N G   E    G    V L  L  G  D++   W+Y +G +GE + L +  G     W  
Sbjct  550   NVGEHFESWSTGILGPVALHGLDKGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWMQ  609

Query  1070  GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFLT----  1237
               +    N +  TW+KT+FD PEG++P+A++ME M KG +W+NG+SIGRYW +F T    
Sbjct  610   SAIVVQRN-QPLTWHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNCN  668

Query  1238  ---------------PLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRD  1372
                              GQPTQ  YH+PR WLK   NLLV+FEE GG+P  I ++  +  
Sbjct  669   DCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSVS  728

Query  1373  TICSSVAENYPPDVKIWE----RKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNP  1540
             ++C+ V+E Y P++K W      K +EFR       P++HL C   + +  I+FAS+G P
Sbjct  729   SVCADVSE-YHPNIKNWHIESYGKSEEFRP------PKVHLHCSPGQTISSIKFASFGTP  781

Query  1541  EGVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
              G CGN+  G+C  P +  I+EK C+GK  C V V  S F  G+D CPK++K L+V+A C
Sbjct  782   LGTCGNYEQGACHSPASYVILEKRCIGKPRCTVTVSNSNF--GQDPCPKVLKRLSVEAVC  839

Query  1721  V  1723
              
Sbjct  840   A  840



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   416 bits (1069),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 219/599 (37%), Positives = 337/599 (56%), Gaps = 35/599 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P   R  ED++F+V RF  K G+++NYYMY GG NFG T G  F++T
Sbjct  250   TEAWSGWFTEFGSPIHHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITT  309

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R+PK+ HL++ HRA+KLC++ L+     +  +    +   F ++  
Sbjct  310   SYDYDAPIDEYGLIREPKYGHLKELHRAIKLCEQALVSADPTVTSLGSLQQAHVF-SSQT  368

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               CAAFL+N N      + F    Y +P  S+SILPDC N++FNT  +  Q +     P+
Sbjct  369   GGCAAFLANYNPDSFARVMFNNVHYNIPPWSISILPDCSNVVFNTAKVGVQTSQMQMYPA  428

Query  539   KVAGNLKWEMFQESIPTI-DTLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
                 +L WE + E + ++ D     +    E   +T+ T+DY+W+ + V ++  +  +  
Sbjct  429   NTQ-SLMWERYDEVVASLEDNSLITTTGLLEQINVTRDTSDYLWYISSVDVSPAEGFLHG  487

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                PVL V+S GHA+ +F+NG+ +G  +G+   +       VN++ GTN I  L   +  
Sbjct  488   GQLPVLTVQSAGHALHIFLNGQLSGSAYGSREDRRIKFSGNVNIRAGTNKIAILSVAVGL  547

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWG  1072
             PN+G   E    G    V+L  L  G++D+T   WSY +G +GE + L + EGA   +W 
Sbjct  548   PNAGVHYEFWSTGVLGPVVLHGLDEGSRDLTWQKWSYQVGLKGEAMNLNSLEGASSVEW-  606

Query  1073  PVTGN---HNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL---  1234
              + G+    + +  TWY+ +FD P+GNDP+A++M  M KG VW+NG+SIGRYW ++    
Sbjct  607   -MQGSLAVQDQQPLTWYRAYFDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAYAPNG  665

Query  1235  -----------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLV  1363
                              +  GQPTQ  YH+PR WL+P  NLLV+FEE GGD   I +M  
Sbjct  666   DCNSCSYIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKR  725

Query  1364  NRDTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPE  1543
             +  ++C+ V+E + P +K W+ + D      +  KP++HL C   + +  I+FASYG P 
Sbjct  726   SVSSVCADVSE-WHPTIKNWDIESD--GQPEEYHKPKVHLRCAPGQSISAIKFASYGTPL  782

Query  1544  GVCGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKC  1720
             G CGNF  G+C  PN+  I+EK C+G+  C V +  + F  G D CP ++K +AV+A C
Sbjct  783   GTCGNFQQGACHSPNSYTILEKNCIGQERCAVVISTTNF--GGDPCPNVMKRVAVEAIC  839



>ref|XP_010069008.1| PREDICTED: beta-galactosidase 9 isoform X2 [Eucalyptus grandis]
Length=733

 Score =   412 bits (1060),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 234/632 (37%), Positives = 337/632 (53%), Gaps = 66/632 (10%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE+W   +  +G     R AED++F+V RF+ + G++ NYYMYFGG NFG T G  F  T
Sbjct  101   TEDWDGWFASWGGRLPHRPAEDLAFAVARFFERGGSFQNYYMYFGGTNFGRTSGGPFYVT  160

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTA---------------NLNK  313
             +Y  + P+D YG    PKW HL+D H A++LC+  L+   A               + N 
Sbjct  161   SYDYDAPLDEYGLLSQPKWGHLKDLHAAIRLCEAALVASDAAQYLKLGPKQEAHVYHGNN  220

Query  314   INGDHEITTFENTDLKLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNT  493
                DH +T +  T   +C+AFL+N +  +  T++F G  Y LP  SVSILPDC+N++FNT
Sbjct  221   HIEDHNLTRY--TGQGVCSAFLANIDEHRSATVHFLGQAYILPPWSVSILPDCRNVVFNT  278

Query  494   QHILAQHNHRTFDP-----SKVAGNL------------KWEMFQESIPTIDTLPAKSPAP  622
               + AQ + ++        S V+G+              W   QE I     +       
Sbjct  279   AKVAAQTSIKSTANELPLNSIVSGDKIKKTSGTCYFGKSWTWSQEPISVWSPVNFTVEGI  338

Query  623   KEMYTLTKHTTDYVWFSTRVVMNKRDLPM--RPDIHPVLFVESMGHAMIVFINGEFAGYN  796
              E   +TK  +DY+W  TR+ +++ D+      D+ P + ++S+   + VF+NG+ AG  
Sbjct  339   LEHLNVTKDLSDYLWHFTRIYVSEDDIAFWKEKDMRPTVIIDSIRDVLRVFVNGQLAGST  398

Query  797   HGNNVAKEFILLQPVNLKPGTNDITFLCSILSYPNSGAWMERRYAGPKS-VLLLALMTGN  973
              G+ V      +QPV+L  G ND+  L   +   N GA+ E+  AG +  V L     G+
Sbjct  399   FGHWVKA----VQPVDLLQGYNDLVLLSQTVGLQNYGAFFEKDGAGFRGKVKLTGFKDGD  454

Query  974   QDITKNSWSYSIGTQGEKLKLFTEEGAEKAKWGPVTGNHNTRRATWYKTHFDLPEGNDPI  1153
              D+ K+ W+Y +G +GE LK++T E  EKA+W  +T +      +WYKT+FD P+G DP+
Sbjct  455   MDLAKSLWTYQVGLRGEFLKIYTTEDNEKAEWTYLTQDDLPSTFSWYKTYFDSPDGTDPV  514

Query  1154  AVNMEKMSKGMVWVNGKSIGRYWV---------------------SFLTPLGQPTQTEYH  1270
             A+++  M KG  WVNG  IGRYW                         T  G+ TQT YH
Sbjct  515   AIDLGSMGKGQAWVNGHHIGRYWTLVAPKGGCQPICDYRGPYNSEKCCTNCGKSTQTRYH  574

Query  1271  IPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNRDTICSSVAENYPPDVKIWERKGD-EFR  1447
             IPR WL+  +NLLV+FEE GG+P  I + L   + IC  V+E++ P V+ W        R
Sbjct  575   IPRSWLQGSDNLLVIFEETGGNPFDISIKLHFSEIICGQVSESHYPPVQKWSLPDSVGGR  634

Query  1448  ATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGVCGNFMTGSCSFPNAIKIVEKACLGKT  1627
              + +D+ P MHL C D  V+  IEFASYG P+G C NF   SC  PN++ +V KAC G+ 
Sbjct  635   ISINDMTPEMHLHCEDGYVISSIEFASYGTPKGSCQNFRKSSCHAPNSLLVVTKACQGRN  694

Query  1628  ECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
              C V +  + F    D C   VKTLAVQAKC+
Sbjct  695   SCSVRISNTEF--DSDPCRGTVKTLAVQAKCI  724



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =   416 bits (1068),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/598 (36%), Positives = 329/598 (55%), Gaps = 33/598 (6%)
 Frame = +2

Query  2     TENWTAQYRVFGDPPGQRSAEDISFSVVRFYSKSGTYVNYYMYFGGNNFGMT-GSSFVST  178
             TE W+  +  FG P  QR  +D++++V RF  K G++VNYYMY GG NFG T G  F++T
Sbjct  252   TEAWSGWFSEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITT  311

Query  179   AYYDEGPMDIYGFNRDPKWSHLRDTHRALKLCKKPLLWGTANLNKINGDHEITTFENTDL  358
             +Y  + P+D YG  R PK+ HL++ HRA+K+C++ L+     +  + G+ +      ++ 
Sbjct  312   SYDYDAPLDEYGLIRQPKYGHLKELHRAIKMCERALVSADPIITSL-GNFQQAYVYTSES  370

Query  359   KLCAAFLSNNNTLKPTTLNFRGTDYYLPAKSVSILPDCKNMIFNTQHILAQHNHRTFDPS  538
               C+AFLSN+++     + F    Y LP  S+SILPDC+N++FNT  +  Q +     P+
Sbjct  371   GDCSAFLSNHDSKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMEMLPT  430

Query  539   KVAGNLKWEMFQESIPTID-TLPAKSPAPKEMYTLTKHTTDYVWFSTRVVMNKRDLPMRP  715
              +   L WE + E I ++D +    +P   E   +T+ +TDY+W+ T V +   +  +R 
Sbjct  431   NIQ-MLSWESYDEDISSLDDSSTITAPGLLEQINVTRDSTDYLWYITSVDIGSSESFLRG  489

Query  716   DIHPVLFVESMGHAMIVFINGEFAGYNHGNNVAKEFILLQPVNLKPGTNDITFLCSILSY  895
                P L V+S GHA+ +FING+ +G + G   ++ F     VNL  GTN I  L   +  
Sbjct  490   GELPTLIVQSTGHAVHIFINGQLSGSSFGTRESRRFTYTGKVNLHAGTNRIALLSVAVGL  549

Query  896   PNSGAWMERRYAGPKS-VLLLALMTGNQDITKNSWSYSIGTQGEKLKLFTEEGAEKAKW-  1069
             PN G   E    G    V L  L  G  D++   W+Y +G +GE + L +        W 
Sbjct  550   PNVGGHFEAWNTGILGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLVSPNSISSVDWM  609

Query  1070  -GPVTGNHNTRRATWYKTHFDLPEGNDPIAVNMEKMSKGMVWVNGKSIGRYWVSFL----  1234
              G +      +  TW+KT F+ PEG++P+A++ME M KG +W+NG+SIGRYW +F     
Sbjct  610   RGSLAA-QKQQPLTWHKTLFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNC  668

Query  1235  ---------------TPLGQPTQTEYHIPRPWLKPKNNLLVVFEEFGGDPDSIKVMLVNR  1369
                               GQPTQ  YH+PR WLKP  NLLV+FEE GGDP  I ++  + 
Sbjct  669   NGCSYAGGFRPPKCQVGCGQPTQRVYHVPRSWLKPMQNLLVIFEELGGDPSRISLVKRSV  728

Query  1370  DTICSSVAENYPPDVKIWERKGDEFRATTDDLKPRMHLTCPDAKVMKKIEFASYGNPEGV  1549
              ++C+ VAE Y P +K W    + +    D   P++HL C   + +  I+FAS+G P G 
Sbjct  729   SSVCAEVAE-YHPTIKNWHI--ESYGKAEDFQSPKVHLRCNPGQAISSIKFASFGTPLGT  785

Query  1550  CGNFMTGSCSFPNAIKIVEKACLGKTECEVPVEKSLFVEGKDLCPKIVKTLAVQAKCV  1723
             CG++  G+C    +  +++K C+GK  C V +  S F    D CPK++K L+V+A C 
Sbjct  786   CGSYQEGTCHATTSYSVLQKKCIGKQRCAVTISNSNF---GDPCPKVLKRLSVEAVCA  840



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5599886480952