BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21878_g2_i1 len=2688 path=[3755:0-113 9338:114-114 @3869@!:115-393
4148:394-1337 3754:1338-1363 25:1364-2687]

Length=2688
                                                                      Score     E

gb|ACC60982.1|  beta-galactosidase 2 precursor                         1129   0.0     Petunia x hybrida [garden petunia]
ref|XP_009784203.1|  PREDICTED: beta-galactosidase 13-like             1125   0.0     
ref|XP_009631007.1|  PREDICTED: beta-galactosidase 13-like             1123   0.0     
ref|XP_009764615.1|  PREDICTED: beta-galactosidase 13-like             1120   0.0     
dbj|BAO02512.1|  predicted beta-galactosidase ortholog                 1118   0.0     
ref|XP_009605185.1|  PREDICTED: beta-galactosidase 13-like             1115   0.0     
ref|XP_009789713.1|  PREDICTED: beta-galactosidase 13-like             1111   0.0     
ref|XP_009608903.1|  PREDICTED: beta-galactosidase 13-like             1106   0.0     
ref|XP_006366982.1|  PREDICTED: beta-galactosidase 13-like             1096   0.0     
ref|XP_004248657.1|  PREDICTED: beta-galactosidase 13-like             1095   0.0     
ref|XP_010315380.1|  PREDICTED: beta-galactosidase 13-like             1082   0.0     
emb|CDO96919.1|  unnamed protein product                               1070   0.0     
gb|EYU37950.1|  hypothetical protein MIMGU_mgv1a001345mg               1027   0.0     
ref|XP_011088601.1|  PREDICTED: beta-galactosidase 13                  1020   0.0     
ref|XP_011092984.1|  PREDICTED: beta-galactosidase 13-like             1005   0.0     
ref|XP_002278545.1|  PREDICTED: beta-galactosidase 13                  1004   0.0     Vitis vinifera
gb|EPS74283.1|  beta-galactosidase                                     1003   0.0     
gb|KCW64119.1|  hypothetical protein EUGRSUZ_G01775                     988   0.0     
ref|XP_010090335.1|  Beta-galactosidase 11                              978   0.0     
gb|KCW55522.1|  hypothetical protein EUGRSUZ_I01412                     977   0.0     
ref|XP_007041847.1|  Glycosyl hydrolase family 35 protein isoform 1     977   0.0     
ref|XP_011092985.1|  PREDICTED: beta-galactosidase 13-like              971   0.0     
ref|XP_002306183.1|  glycosyl hydrolase family 35 family protein        971   0.0     Populus trichocarpa [western balsam poplar]
emb|CAC13966.1|  putative beta-galactosidase                            967   0.0     Nicotiana tabacum [American tobacco]
gb|KGN43246.1|  hypothetical protein Csa_7G011860                       964   0.0     
ref|XP_002312963.1|  glycosyl hydrolase family 35 family protein        964   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011046271.1|  PREDICTED: beta-galactosidase 13-like              963   0.0     
ref|XP_008447961.1|  PREDICTED: beta-galactosidase 13-like              963   0.0     
ref|XP_010266335.1|  PREDICTED: beta-galactosidase 13-like              960   0.0     
ref|XP_011046693.1|  PREDICTED: beta-galactosidase 13-like              957   0.0     
gb|KCW56611.1|  hypothetical protein EUGRSUZ_I02332                     956   0.0     
ref|XP_010066272.1|  PREDICTED: beta-galactosidase 13-like              953   0.0     
ref|XP_006590856.1|  PREDICTED: beta-galactosidase 13-like isofor...    953   0.0     
gb|KDO71286.1|  hypothetical protein CISIN_1g045037mg                   952   0.0     
ref|XP_006590857.1|  PREDICTED: beta-galactosidase 13-like isofor...    951   0.0     
ref|XP_007221604.1|  hypothetical protein PRUPE_ppa026900mg             950   0.0     
ref|XP_006467171.1|  PREDICTED: beta-galactosidase 13-like              949   0.0     
ref|XP_003607189.1|  Beta-galactosidase                                 948   0.0     
ref|XP_006425408.1|  hypothetical protein CICLE_v10026929mg             947   0.0     
ref|XP_007224244.1|  hypothetical protein PRUPE_ppa019277mg             947   0.0     
ref|XP_004505828.1|  PREDICTED: beta-galactosidase 13-like              947   0.0     
ref|XP_008224548.1|  PREDICTED: beta-galactosidase 13-like              946   0.0     
gb|KHN25472.1|  Beta-galactosidase 13                                   943   0.0     
ref|XP_008224549.1|  PREDICTED: beta-galactosidase 13-like              943   0.0     
ref|XP_010028723.1|  PREDICTED: beta-galactosidase 13                   943   0.0     
ref|XP_006592069.1|  PREDICTED: beta-galactosidase 13-like              941   0.0     
ref|XP_004144843.1|  PREDICTED: beta-galactosidase 13-like              933   0.0     
ref|XP_010029662.1|  PREDICTED: beta-galactosidase 13-like              927   0.0     
ref|XP_006422606.1|  hypothetical protein CICLE_v10030124mg             924   0.0     
ref|XP_010941318.1|  PREDICTED: beta-galactosidase 11-like isofor...    923   0.0     
ref|XP_009374634.1|  PREDICTED: beta-galactosidase 13-like              921   0.0     
gb|AAS76480.1|  beta-galactosidase                                      921   0.0     Gossypium hirsutum [American cotton]
ref|XP_006486854.1|  PREDICTED: beta-galactosidase 13-like              919   0.0     
gb|AES74289.2|  glycoside hydrolase family 35 protein                   916   0.0     
ref|XP_004500729.1|  PREDICTED: beta-galactosidase 13-like              915   0.0     
ref|XP_003523495.1|  PREDICTED: beta-galactosidase 13                   915   0.0     
gb|KHN33673.1|  Beta-galactosidase 13                                   915   0.0     
gb|KDO68060.1|  hypothetical protein CISIN_1g035496mg                   914   0.0     
ref|XP_007201748.1|  hypothetical protein PRUPE_ppa001308mg             912   0.0     
ref|XP_008236010.1|  PREDICTED: beta-galactosidase 11-like              911   0.0     
ref|XP_010935389.1|  PREDICTED: beta-galactosidase 11-like              910   0.0     
ref|XP_008811847.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    907   0.0     
ref|XP_007137346.1|  hypothetical protein PHAVU_009G119400g             907   0.0     
ref|XP_004298189.1|  PREDICTED: beta-galactosidase 13-like              905   0.0     
ref|XP_007137348.1|  hypothetical protein PHAVU_009G119600g             905   0.0     
ref|XP_003604038.1|  Beta-galactosidase                                 905   0.0     
ref|XP_009376956.1|  PREDICTED: beta-galactosidase 11-like              902   0.0     
gb|KHG26973.1|  Beta-galactosidase 13 -like protein                     902   0.0     
ref|NP_179264.2|  beta-galactosidase 13                                 902   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAD24606.1|  putative beta-galactosidase                             900   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131709.1|  hypothetical protein PHAVU_011G035300g             900   0.0     
ref|XP_002886073.1|  beta-galactosidase 13                              899   0.0     
ref|XP_008811843.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    898   0.0     
ref|XP_008377743.1|  PREDICTED: beta-galactosidase 13                   897   0.0     
gb|KDP29648.1|  hypothetical protein JCGZ_18810                         895   0.0     
ref|XP_010516330.1|  PREDICTED: beta-galactosidase 13 isoform X1        895   0.0     
ref|XP_009406477.1|  PREDICTED: beta-galactosidase 11-like              894   0.0     
ref|XP_010516339.1|  PREDICTED: beta-galactosidase 13 isoform X2        894   0.0     
gb|KDP29649.1|  hypothetical protein JCGZ_18811                         892   0.0     
ref|XP_006299920.1|  hypothetical protein CARUB_v10016129mg             892   0.0     
ref|XP_006409401.1|  hypothetical protein EUTSA_v10022550mg             887   0.0     
ref|XP_006412163.1|  hypothetical protein EUTSA_v10024392mg             885   0.0     
ref|XP_002867095.1|  beta-galactosidase 11                              884   0.0     
ref|XP_010530895.1|  PREDICTED: beta-galactosidase 11-like isofor...    883   0.0     
ref|XP_010432357.1|  PREDICTED: beta-galactosidase 11-like              883   0.0     
ref|XP_010447011.1|  PREDICTED: beta-galactosidase 11                   881   0.0     
ref|XP_010941319.1|  PREDICTED: beta-galactosidase 11-like isofor...    880   0.0     
gb|KFK30139.1|  hypothetical protein AALP_AA7G221900                    879   0.0     
ref|XP_009386767.1|  PREDICTED: beta-galactosidase 11-like              878   0.0     
ref|NP_567973.1|  beta-galactosidase 11                                 877   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437540.1|  PREDICTED: beta-galactosidase 11-like              876   0.0     
ref|XP_009136326.1|  PREDICTED: beta-galactosidase 13                   876   0.0     
ref|XP_010468659.1|  PREDICTED: beta-galactosidase 13-like              874   0.0     
ref|XP_010431800.1|  PREDICTED: beta-galactosidase 14                   873   0.0     
ref|XP_010489252.1|  PREDICTED: beta-galactosidase 13-like              872   0.0     
emb|CDX75479.1|  BnaA01g02230D                                          872   0.0     
ref|XP_006826593.1|  hypothetical protein AMTR_s00138p00054750          871   0.0     
ref|XP_009107264.1|  PREDICTED: beta-galactosidase 11                   870   0.0     
ref|XP_010690373.1|  PREDICTED: beta-galactosidase 13-like              869   0.0     
ref|XP_010548094.1|  PREDICTED: beta-galactosidase 11                   869   0.0     
ref|XP_010446366.1|  PREDICTED: beta-galactosidase 14-like              868   0.0     
ref|XP_009121204.1|  PREDICTED: beta-galactosidase 13-like              868   0.0     
gb|KFK36758.1|  hypothetical protein AALP_AA4G166000                    867   0.0     
ref|XP_004292170.1|  PREDICTED: beta-galactosidase 13-like              867   0.0     
ref|XP_008347518.1|  PREDICTED: beta-galactosidase 13-like              866   0.0     
gb|KFK30461.1|  hypothetical protein AALP_AA7G264100                    866   0.0     
ref|XP_009419064.1|  PREDICTED: beta-galactosidase 11-like              861   0.0     
emb|CAB64750.1|  putative beta-galactosidase                            865   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX69103.1|  BnaC01g03500D                                          863   0.0     
sp|Q9SCU8.2|BGA14_ARATH  RecName: Full=Beta-galactosidase 14; Sho...    865   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436953.1|  PREDICTED: beta-galactosidase 14-like isofor...    863   0.0     
ref|XP_006285214.1|  hypothetical protein CARUB_v10006573mg             860   0.0     
emb|CDX89744.1|  BnaC03g46580D                                          866   0.0     
emb|CDX72512.1|  BnaC07g45340D                                          855   0.0     
emb|CDY40650.1|  BnaA03g53130D                                          854   0.0     
ref|XP_009138336.1|  PREDICTED: beta-galactosidase 11-like              853   0.0     
emb|CDX72747.1|  BnaC07g47690D                                          854   0.0     
ref|XP_009101935.1|  PREDICTED: beta-galactosidase 14                   850   0.0     
emb|CDY22419.1|  BnaA06g37410D                                          849   0.0     
ref|XP_010690372.1|  PREDICTED: beta-galactosidase 14-like              840   0.0     
emb|CAN73625.1|  hypothetical protein VITISV_026637                     834   0.0     Vitis vinifera
gb|EYU40437.1|  hypothetical protein MIMGU_mgv1a002461mg                827   0.0     
dbj|BAK07425.1|  predicted protein                                      832   0.0     
ref|XP_002445734.1|  hypothetical protein SORBIDRAFT_07g024870          829   0.0     Sorghum bicolor [broomcorn]
ref|NP_195571.2|  beta-galactosidase 14                                 833   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663872.1|  PREDICTED: uncharacterized protein LOC100194...    825   0.0     
emb|CDY31414.1|  BnaA07g03490D                                          821   0.0     
ref|XP_008677698.1|  PREDICTED: uncharacterized protein LOC100384...    822   0.0     
ref|XP_004974148.1|  PREDICTED: beta-galactosidase 11-like              818   0.0     
ref|NP_001154292.1|  beta-galactosidase 14                              819   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EMS61528.1|  Beta-galactosidase 11                                   811   0.0     
ref|XP_010690706.1|  PREDICTED: beta-galactosidase 14-like              808   0.0     
ref|XP_006660363.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    808   0.0     
gb|EMT25927.1|  Beta-galactosidase 11                                   807   0.0     
ref|NP_001062440.1|  Os08g0549200                                       801   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396587.1|  PREDICTED: beta-galactosidase 11-like              797   0.0     
gb|EEE69115.1|  hypothetical protein OsJ_28192                          799   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959631.1|  PREDICTED: beta-galactosidase 12-like              792   0.0     
ref|XP_006660050.1|  PREDICTED: beta-galactosidase 12-like              783   0.0     
emb|CAA17766.1|  beta-galactosidase-like protein                        783   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668408.1|  PREDICTED: uncharacterized protein LOC100383...    783   0.0     
ref|XP_003576777.1|  PREDICTED: beta-galactosidase 12-like              779   0.0     
emb|CAB37515.1|  galactosidase like protein                             784   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008653570.1|  PREDICTED: beta-galactosidase 12-like              775   0.0     
gb|EEE70132.1|  hypothetical protein OsJ_30164                          775   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAG30731.1|  beta-galactosidase precursor                           773   0.0     Triticum monococcum [einkorn wheat]
ref|XP_007041849.1|  Beta-galactosidase 14 isoform 3                    763   0.0     
sp|Q0IZZ8.2|BGA12_ORYSJ  RecName: Full=Beta-galactosidase 12; Sho...    768   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235388.1|  PREDICTED: beta-galactosidase 11-like              757   0.0     
emb|CAG30724.1|  putative beta-galactosidase precursor                  754   0.0     Hordeum vulgare [barley]
ref|XP_006473025.1|  PREDICTED: beta-galactosidase 16-like              750   0.0     
ref|XP_006434246.1|  hypothetical protein CICLE_v10004034mg             747   0.0     
gb|KDO80552.1|  hypothetical protein CISIN_1g003612mg                   743   0.0     
tpg|DAA64336.1|  TPA: hypothetical protein ZEAMMB73_578897              744   0.0     
ref|XP_002460584.1|  hypothetical protein SORBIDRAFT_02g031260          743   0.0     Sorghum bicolor [broomcorn]
ref|XP_004149808.1|  PREDICTED: beta-galactosidase 16-like              733   0.0     
ref|XP_010428819.1|  PREDICTED: beta-galactosidase 16-like              733   0.0     
ref|XP_006390092.1|  hypothetical protein EUTSA_v10018129mg             733   0.0     
ref|XP_002889142.1|  hypothetical protein ARALYDRAFT_476906             732   0.0     
ref|XP_007041848.1|  Beta-galactosidase 14 isoform 2                    726   0.0     
ref|XP_010419240.1|  PREDICTED: beta-galactosidase 16                   728   0.0     
ref|NP_177866.2|  beta-galactosidase 16                                 728   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472815.1|  PREDICTED: beta-galactosidase 16-like isofor...    726   0.0     
ref|XP_010471934.1|  PREDICTED: beta-galactosidase 16-like              724   0.0     
ref|XP_008466742.1|  PREDICTED: beta-galactosidase 16 isoform X2        721   0.0     
ref|XP_006434247.1|  hypothetical protein CICLE_v10003478mg             718   0.0     
dbj|BAC43014.1|  unknown protein                                        717   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EEC84965.1|  hypothetical protein OsI_32205                          716   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008338663.1|  PREDICTED: beta-galactosidase 16 isoform X1        715   0.0     
ref|XP_010269108.1|  PREDICTED: beta-galactosidase 16-like              712   0.0     
ref|XP_006301847.1|  hypothetical protein CARUB_v10022317mg             714   0.0     
ref|XP_002302225.2|  beta-galactosidase family protein                  712   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007019136.1|  Beta-galactosidase isoform 1                       711   0.0     
ref|XP_010243519.1|  PREDICTED: beta-galactosidase 16                   709   0.0     
ref|XP_004171523.1|  PREDICTED: beta-galactosidase 16-like              705   0.0     
ref|XP_011027489.1|  PREDICTED: beta-galactosidase 16                   706   0.0     
gb|EYU31765.1|  hypothetical protein MIMGU_mgv1a018569mg                705   0.0     
ref|XP_011003960.1|  PREDICTED: beta-galactosidase 16-like              705   0.0     
ref|XP_008466741.1|  PREDICTED: beta-galactosidase 16 isoform X1        705   0.0     
ref|XP_009385110.1|  PREDICTED: beta-galactosidase 7                    703   0.0     
ref|XP_008219605.1|  PREDICTED: beta-galactosidase 16                   702   0.0     
ref|XP_004292712.1|  PREDICTED: beta-galactosidase 16-like              701   0.0     
ref|XP_010664184.1|  PREDICTED: beta-galactosidase 16-like              700   0.0     
ref|XP_011069386.1|  PREDICTED: beta-galactosidase 16                   697   0.0     
ref|XP_004961993.1|  PREDICTED: beta-galactosidase 7-like isoform X2    695   0.0     
ref|XP_002521778.1|  beta-galactosidase, putative                       696   0.0     Ricinus communis
ref|XP_007019138.1|  Beta-galactosidase                                 692   0.0     
ref|XP_006351205.1|  PREDICTED: beta-galactosidase 16-like              692   0.0     
ref|XP_002284529.2|  PREDICTED: beta-galactosidase 16-like              691   0.0     Vitis vinifera
emb|CBI18990.3|  unnamed protein product                                691   0.0     
dbj|BAK06282.1|  predicted protein                                      691   0.0     
ref|XP_010233215.1|  PREDICTED: beta-galactosidase 7                    689   0.0     
ref|XP_009376872.1|  PREDICTED: beta-galactosidase 16                   686   0.0     
ref|XP_008783343.1|  PREDICTED: beta-galactosidase 7-like               684   0.0     
ref|XP_008338665.1|  PREDICTED: beta-galactosidase 16 isoform X2        682   0.0     
ref|XP_006441550.1|  hypothetical protein CICLE_v10023501mg             684   0.0     
ref|XP_011069425.1|  PREDICTED: beta-galactosidase 14-like              673   0.0     
tpg|DAA48742.1|  TPA: hypothetical protein ZEAMMB73_126543              679   0.0     
gb|AAG29193.1|AC078898_3  beta-galactosidase, putative                  681   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010312841.1|  PREDICTED: beta-galactosidase 16                   681   0.0     
ref|XP_002306647.2|  beta-galactosidase family protein                  674   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011003430.1|  PREDICTED: beta-galactosidase 16-like              674   0.0     
gb|ACC64531.1|  beta-galactosidase 6                                    674   0.0     Oryza sativa Indica Group [Indian rice]
gb|KDP31634.1|  hypothetical protein JCGZ_14859                         673   0.0     
ref|XP_006376211.1|  beta-galactosidase family protein                  671   0.0     
gb|KDP32835.1|  hypothetical protein JCGZ_12127                         670   0.0     
ref|XP_010095419.1|  Beta-galactosidase 16                              668   0.0     
ref|XP_008656261.1|  PREDICTED: beta-galactosidase 7-like isoform X1    667   0.0     
ref|XP_008656262.1|  PREDICTED: beta-galactosidase 7-like isoform X2    667   0.0     
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               667   0.0     
gb|EMT17497.1|  Beta-galactosidase 12                                   665   0.0     
ref|XP_004970752.1|  PREDICTED: beta-galactosidase 7-like               664   0.0     
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    662   0.0     
ref|XP_006655346.1|  PREDICTED: beta-galactosidase 7-like               660   0.0     
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                661   0.0     
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      655   0.0     
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               655   0.0     
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      655   0.0     
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               653   0.0     
ref|NP_001234317.1|  TBG6 protein precursor                             653   0.0     
gb|ADO34791.1|  beta-galactosidase STBG6                                653   0.0     
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    653   0.0     
ref|XP_002514108.1|  beta-galactosidase, putative                       652   0.0     Ricinus communis
ref|XP_008674765.1|  PREDICTED: beta-galactosidase 7 isoform X1         651   0.0     
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               652   0.0     
ref|NP_001049068.1|  Os03g0165400                                       651   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EMS61058.1|  Beta-galactosidase 7                                    651   0.0     
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               651   0.0     
dbj|BAF31233.1|  beta-D-galactosidase                                   651   0.0     Persea americana
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    650   0.0     
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    650   0.0     
gb|EMT10431.1|  Beta-galactosidase 7                                    649   0.0     
gb|AAM22973.1|AF499737_1  beta-galactosidase                            649   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    649   0.0     
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    649   0.0     
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               649   0.0     
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    648   0.0     
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               648   0.0     
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      647   0.0     
ref|XP_010090040.1|  hypothetical protein L484_027271                   646   0.0     
ref|XP_003522573.1|  PREDICTED: beta-galactosidase 16-like              641   0.0     
ref|XP_010106660.1|  Beta-galactosidase 1                               646   0.0     
ref|XP_010436954.1|  PREDICTED: beta-galactosidase 14-like isofor...    638   0.0     
ref|XP_010436955.1|  PREDICTED: beta-galactosidase 14-like isofor...    638   0.0     
ref|XP_007137444.1|  hypothetical protein PHAVU_009G127500g             642   0.0     
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               645   0.0     
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   645   0.0     
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    645   0.0     
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               645   0.0     
dbj|BAF01618.1|  beta-galactosidase like protein                        640   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854486.1|  hypothetical protein AMTR_s00175p00032740          646   0.0     
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    645   0.0     
ref|XP_003602682.1|  Beta-galactosidase                                 640   0.0     
emb|CAB16852.1|  beta-galactosidase like protein                        645   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351141.1|  PREDICTED: beta-galactosidase 16-like              639   0.0     
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             645   0.0     
gb|KHN36067.1|  Beta-galactosidase 3                                    644   0.0     
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               644   0.0     
ref|NP_568001.1|  beta-galactosidase 3                                  644   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      644   0.0     
gb|KHN41933.1|  Beta-galactosidase 3                                    644   0.0     
dbj|BAJ34544.1|  unnamed protein product                                644   0.0     
ref|NP_568978.2|  beta-galactosidase 6                                  639   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003527942.1|  PREDICTED: beta-galactosidase 16-like              638   0.0     
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    643   0.0     Vitis vinifera
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 642   0.0     
gb|AES67466.2|  beta-galactosidase-like protein                         642   0.0     
ref|XP_008674766.1|  PREDICTED: beta-galactosidase 7 isoform X2         642   0.0     
gb|EEE58382.1|  hypothetical protein OsJ_09539                          643   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             642   0.0     
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         642   0.0     
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      642   0.0     
emb|CAB64742.1|  putative beta-galactosidase                            638   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EEC74580.1|  hypothetical protein OsI_10152                          642   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_004250388.2|  PREDICTED: beta-galactosidase 16-like isofor...    636   0.0     
ref|XP_003602061.1|  Beta-galactosidase                                 636   0.0     
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             641   0.0     
ref|XP_006584659.1|  PREDICTED: beta-galactosidase 6-like isoform X1    636   0.0     
ref|XP_007024475.1|  Beta galactosidase 1                               641   0.0     
ref|XP_009798708.1|  PREDICTED: beta-galactosidase 16-like isofor...    637   0.0     
ref|XP_010063413.1|  PREDICTED: beta-galactosidase 16-like              635   0.0     
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             640   0.0     
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               640   0.0     
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   640   0.0     
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         640   0.0     
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               640   0.0     
ref|NP_849506.1|  beta-galactosidase 3                                  640   0.0     
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               639   0.0     
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    640   0.0     
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like               639   0.0     
ref|XP_002510455.1|  beta-galactosidase, putative                       639   0.0     
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             639   0.0     
ref|XP_007012844.1|  Beta-galactosidase                                 639   0.0     
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               639   0.0     
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                639   0.0     
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      638   0.0     
gb|ABK24373.1|  unknown                                                 639   0.0     
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               638   0.0     
gb|KCW62455.1|  hypothetical protein EUGRSUZ_H05090                     633   0.0     
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               638   0.0     
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    638   0.0     
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          637   0.0     
ref|XP_010025737.1|  PREDICTED: beta-galactosidase 6 isoform X1         633   0.0     
emb|CDY59693.1|  BnaC07g51120D                                          638   0.0     
emb|CDY39845.1|  BnaC02g42730D                                          633   0.0     
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             637   0.0     
dbj|BAF31234.1|  beta-D-galactosidase                                   637   0.0     
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             637   0.0     
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    636   0.0     
gb|KHN27041.1|  Beta-galactosidase 3                                    637   0.0     
ref|XP_004289501.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    632   0.0     
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      636   0.0     
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               636   0.0     
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               636   0.0     
ref|XP_010674349.1|  PREDICTED: beta-galactosidase 6 isoform X1         632   0.0     
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               636   0.0     
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               636   0.0     
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               635   0.0     
gb|AHL69742.1|  beta-galactosidase                                      635   0.0     
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    636   0.0     
ref|XP_003612092.1|  Beta-galactosidase                                 635   0.0     
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             635   0.0     
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    635   0.0     
gb|KDO80551.1|  hypothetical protein CISIN_1g004533mg                   631   0.0     
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    635   0.0     
ref|XP_009130274.1|  PREDICTED: beta-galactosidase 6                    630   0.0     
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         634   0.0     
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               634   0.0     
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          634   0.0     
ref|XP_009150443.1|  PREDICTED: beta-galactosidase 6                    630   0.0     
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like               633   0.0     
ref|XP_004505982.1|  PREDICTED: beta-galactosidase 8-like               633   0.0     
ref|XP_010444300.1|  PREDICTED: beta-galactosidase 6                    630   0.0     
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 633   0.0     
ref|XP_003597217.1|  Beta-galactosidase                                 633   0.0     
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     634   0.0     
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    633   0.0     
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             633   0.0     
gb|KFK28074.1|  hypothetical protein AALP_AA8G468900                    629   0.0     
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               633   0.0     
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    633   0.0     
ref|XP_002306893.1|  beta-galactosidase family protein                  633   0.0     
emb|CDP01954.1|  unnamed protein product                                633   0.0     
ref|XP_006282368.1|  hypothetical protein CARUB_v10028665mg             628   0.0     
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               633   0.0     
gb|KHN39301.1|  Beta-galactosidase 1                                    632   0.0     
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             633   0.0     
gb|AAW47739.1|  beta-galactosidase                                      633   0.0     
emb|CBI35944.3|  unnamed protein product                                632   0.0     
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    632   0.0     
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 633   0.0     
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    632   0.0     
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               632   0.0     
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               632   0.0     
ref|XP_009803571.1|  PREDICTED: beta-galactosidase 16-like isofor...    627   0.0     
gb|ABV32546.1|  beta-galactosidase protein 1                            632   0.0     
ref|XP_002864867.1|  beta-galactosidase 6                               627   0.0     
gb|ABY71826.1|  beta-galactosidase                                      632   0.0     
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               632   0.0     
ref|XP_004502496.1|  PREDICTED: beta-galactosidase 16-like              627   0.0     
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      632   0.0     
gb|ACC60981.1|  beta-galactosidase 1 precursor                          632   0.0     
ref|XP_003597608.1|  Beta-galactosidase                                 632   0.0     
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    632   0.0     
emb|CDX84445.1|  BnaC03g50550D                                          627   0.0     
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             631   0.0     
ref|XP_010113483.1|  Beta-galactosidase 3                               631   0.0     
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             631   0.0     
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      630   0.0     
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               631   0.0     
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    631   0.0     
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    630   0.0     
dbj|BAJ96054.1|  predicted protein                                      631   0.0     
ref|XP_008227610.1|  PREDICTED: beta-galactosidase 6                    626   0.0     
gb|KEH18344.1|  beta-galactosidase                                      630   0.0     
dbj|BAD91082.1|  beta-D-galactosidase                                   631   0.0     
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    631   0.0     
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    630   0.0     
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       629   0.0     
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 631   0.0     
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    630   0.0     
emb|CAA18137.1|  beta-galactosidase like protein                        630   0.0     
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    630   0.0     
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      629   0.0     
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     629   0.0     
gb|KHN32687.1|  Beta-galactosidase 1                                    629   0.0     
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 629   0.0     
ref|XP_009620066.1|  PREDICTED: beta-galactosidase 16                   625   0.0     
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 629   0.0     
dbj|BAK07157.1|  predicted protein                                      629   0.0     
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    629   0.0     
emb|CDM85194.1|  unnamed protein product                                627   0.0     
emb|CAC44501.1|  beta-galactosidase                                     629   0.0     
ref|XP_002530296.1|  beta-galactosidase, putative                       629   0.0     
emb|CDP10946.1|  unnamed protein product                                624   0.0     
ref|NP_001234465.1|  beta-galactosidase precursor                       628   0.0     
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      629   0.0     
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               629   0.0     
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 629   0.0     
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               629   0.0     
emb|CAC44500.1|  beta-galactosidase                                     628   0.0     
gb|ABV32545.1|  beta-galactosidase protein 2                            628   0.0     
gb|KHN00504.1|  Beta-galactosidase 3                                    628   0.0     
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               629   0.0     
ref|XP_010484137.1|  PREDICTED: beta-galactosidase 6-like isoform X2    624   0.0     
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 627   0.0     
ref|XP_004487127.1|  PREDICTED: beta-galactosidase 8-like               627   0.0     
gb|ABK96254.1|  unknown                                                 628   0.0     
ref|XP_003538054.1|  PREDICTED: beta-galactosidase 8-like               627   0.0     
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             627   0.0     
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               627   0.0     
ref|XP_003528064.1|  PREDICTED: beta-galactosidase 6-like               622   0.0     
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    627   0.0     
ref|XP_006385360.1|  beta-galactosidase 1 family protein                627   0.0     
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    627   0.0     
ref|NP_001234303.1|  beta-galactosidase precursor                       627   0.0     
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    627   0.0     
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like               627   0.0     
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             627   0.0     
ref|XP_002310279.2|  beta-galactosidase family protein                  627   0.0     
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    627   0.0     
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               627   0.0     
gb|ADO34788.1|  beta-galactosidase STBG3                                626   0.0     
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    627   0.0     
ref|XP_003630451.1|  Beta-galactosidase                                 621   0.0     
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    625   0.0     
emb|CDY31349.1|  BnaA02g33920D                                          622   0.0     
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               625   0.0     
gb|AAQ21371.2|  beta-galactosidase                                      625   0.0     
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             625   0.0     
gb|AGW47883.1|  beta-galactosidase precursor                            625   0.0     
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 625   0.0     
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      625   0.0     
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               625   0.0     
ref|XP_002520337.1|  beta-galactosidase, putative                       623   0.0     
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              625   0.0     
ref|XP_003606403.1|  Beta-galactosidase                                 625   0.0     
gb|AGR44466.1|  beta-D-galactosidase 7                                  625   0.0     
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 625   0.0     
dbj|BAD91084.1|  beta-D-galactosidase                                   625   0.0     
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    625   0.0     
emb|CAN78072.1|  hypothetical protein VITISV_013292                     625   0.0     
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           624   0.0     
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 624   0.0     
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   625   0.0     
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                    624   0.0     
ref|XP_007048525.1|  Beta-galactosidase 3                               624   0.0     
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             624   0.0     
gb|AHG94611.1|  beta-galactosidase                                      624   0.0     
emb|CBI19767.3|  unnamed protein product                                624   0.0     
ref|XP_007137753.1|  hypothetical protein PHAVU_009G153000g             619   0.0     
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               623   0.0     
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    623   0.0     
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               624   0.0     
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like               623   0.0     
ref|NP_001043405.1|  Os01g0580200                                       622   0.0     
ref|XP_010461014.1|  PREDICTED: beta-galactosidase 6-like               619   0.0     
emb|CDO97918.1|  unnamed protein product                                622   0.0     
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   623   0.0     
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    622   0.0     
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             622   0.0     
ref|XP_009355858.1|  PREDICTED: beta-galactosidase 6 isoform X1         618   0.0     
emb|CDP10947.1|  unnamed protein product                                618   0.0     
ref|XP_009338265.1|  PREDICTED: beta-galactosidase 8-like isoform X1    622   0.0     
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    622   0.0     
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    622   0.0     
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   620   0.0     
ref|XP_007132205.1|  hypothetical protein PHAVU_011G074900g             620   0.0     
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               622   0.0     
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    621   0.0     
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    622   0.0     
ref|XP_002527409.1|  beta-galactosidase, putative                       621   0.0     
ref|XP_006432094.1|  hypothetical protein CICLE_v10000420mg             617   0.0     
emb|CDX97513.1|  BnaA05g25660D                                          621   0.0     
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             621   0.0     
gb|KDP44070.1|  hypothetical protein JCGZ_05537                         621   0.0     
ref|XP_007048527.1|  Glycosyl hydrolase family 35 protein isoform 1     618   0.0     
emb|CDY23637.1|  BnaC05g39570D                                          620   0.0     
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               621   0.0     
ref|XP_004502986.1|  PREDICTED: beta-galactosidase 6-like isoform X1    616   0.0     
gb|EMT10014.1|  Beta-galactosidase 5                                    621   0.0     
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    621   0.0     
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                620   0.0     
ref|XP_003523206.1|  PREDICTED: beta-galactosidase 10                   620   0.0     
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 620   0.0     
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               620   0.0     
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               620   0.0     
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               620   0.0     
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    620   0.0     
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    619   0.0     
emb|CDP07463.1|  unnamed protein product                                620   0.0     
emb|CDY51738.1|  BnaA01g37210D                                          620   0.0     
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               620   0.0     
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             620   0.0     
ref|XP_002314274.2|  beta-galactosidase family protein                  620   0.0     
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               619   0.0     
ref|XP_010110010.1|  Beta-galactosidase 3                               618   0.0     
ref|NP_187988.1|  beta galactosidase 1                                  619   0.0     
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           619   0.0     
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    619   0.0     



>gb|ACC60982.1| beta-galactosidase 2 precursor [Petunia x hybrida]
Length=830

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/805 (67%), Positives = 657/805 (82%), Gaps = 13/805 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPPEMWP+++++AKEGGLNVIQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPEMWPEIIRKAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK IG+ G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF++HMKK
Sbjct  95    NYDLVKFIKAIGEQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIHHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D++KK KLFAPQGGPII+AQIENEY++++    A     KKYI WAA+MA  LY
Sbjct  155   YSEMVIDLVKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYIEWAANMATSLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +APP+VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   NGVPWIMCKQKDAPPQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMYYGGTNYGRT++SFVTTRYYDE PLDEFGLYR+PK
Sbjct  272   AAEDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTSSSFVTTRYYDEAPLDEFGLYREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTPT+QK+  + EI  FE      CAAFLTNN+TT P++I
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPTVQKINQDLEITVFEKPGSTDCAAFLTNNHTTQPSTI  390

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+Q IVSQHN+R F+ S+ +   +LKWEM+QE +P
Sbjct  391   KFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFITSEKS--KNLKWEMYQEKVP  448

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI +LP+KN  PLELY+LTKDTSDYAWYST I     DL  R DILPVL + SMGHAL A
Sbjct  449   TIADLPLKNREPLELYSLTKDTSDYAWYSTSITLERHDLPMRPDILPVLQIASMGHALAA  508

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+VG  HGNN +K+   +KP+ LKPG N IT+L    GFPNSGA M+KRF GPR V
Sbjct  509   FVNGEYVGFGHGNNIEKSFVFQKPIILKPGTNTITILAETVGFPNSGAYMEKRFAGPRGV  568

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPP---VTWYKTY  1904
             TIQGLMAGTL +T N+W H VGV GEK +LFTEEG++KV+W PVT   PP   VTWYKTY
Sbjct  569   TIQGLMAGTLDITQNNWGHEVGVFGEKQELFTEEGAKKVQWTPVTG--PPKGAVTWYKTY  626

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNN  2084
             FDAPEGNNPVAL+MD M KGM+WVNGKS+GRYW +FLSPLGQP+Q EYHIPRA++KP NN
Sbjct  627   FDAPEGNNPVALKMDKMEKGMMWVNGKSLGRYWTSFLSPLGQPTQAEYHIPRAYLKPTNN  686

Query  2085  LMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             L+V+FEE GG P++IE+  VNRDTICS +++Y+P +VKSWER G +   VVED++    L
Sbjct  687   LLVIFEETGGHPTNIEVQTVNRDTICSIITEYHPPHVKSWERSGTDFVAVVEDLKSGAHL  746

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
              CP++K+++K+EFA+YG+PDGACGN   GNC+  N+ K+VE+ CLGK+ C +P+E+ ++ 
Sbjct  747   TCPDNKIIEKVEFASYGNPDGACGNLFNGNCNSANSLKVVEQHCLGKNTCTIPIEREIYD  806

Query  2445  EGSKDLCPNLVHKTLAVQAKCGLRH  2519
             E SKD CPN + KTLAVQ KCG ++
Sbjct  807   EPSKDPCPN-IFKTLAVQVKCGKKN  830



>ref|XP_009784203.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=831

 Score =  1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/802 (67%), Positives = 656/802 (82%), Gaps = 11/802 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR PPEMW D++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  37    MIINGNRELLFSGSIHYPRSPPEMWHDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIKMIG+  +YV LRVGP++EAEWN GGFPYWL+EVP I FR+YNEPFM+HMKK
Sbjct  97    NYDLVKFIKMIGEQDLYVNLRVGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFMHHMKK  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AEM++D+MKK KLFAPQGGPII+AQIENEY++++     D    KKYI WAADMA GLY
Sbjct  157   YAEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQLAYRED---GKKYIKWAADMATGLY  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PW+MCKQ +APP+VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  214   NGVPWVMCKQKDAPPQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMY+GGTN+GRT +SFVTTRYYDE PLDEFGL R+PK
Sbjct  274   AAEDIAFSVARFFA-KNGTLTNYYMYHGGTNFGRTGSSFVTTRYYDEAPLDEFGLKREPK  332

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H A+RLS+R L  GTPT+QK+  + EI  +E      CAAFLTNN+T  P++I
Sbjct  333   WSHLRDLHRAIRLSRRALLWGTPTVQKISQDLEITVWEKPGSD-CAAFLTNNHTKLPSTI  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFR  +YYLP  S S+LPDCKT V+N+Q +V+QHN+R F+ S+ A   +LKWEM+QE +P
Sbjct  392   KFRDQEYYLPEKSVSILPDCKTVVYNTQTVVAQHNSRNFIASEKA--KNLKWEMYQEKVP  449

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI++LP+KN  PLELY+LTKDTSDYAWYST I F+  DL  R DILPV+ + SMGHAL A
Sbjct  450   TINDLPLKNREPLELYSLTKDTSDYAWYSTSINFNRHDLPMRPDILPVMSIASMGHALAA  509

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HGNN +K+   +KPV LKPG N ITLL    GFPNSGA M+KRF GPR +
Sbjct  510   FVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNHITLLAETIGFPNSGAYMEKRFAGPRGI  569

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYFD  1910
             T+QGLMAGTL +T N+W H VG+SGEK ++FTEEG++KVKW PV+   P P+TWYKTYFD
Sbjct  570   TLQGLMAGTLDITLNNWGHKVGISGEKEQIFTEEGAKKVKWTPVSGPPPGPITWYKTYFD  629

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVAL+MD M KGM+WVNG S+GRYWV+FLSPLGQP+Q EYHIPRAF+KPK+NL+
Sbjct  630   APEGNNPVALKMDKMQKGMMWVNGNSLGRYWVSFLSPLGQPTQSEYHIPRAFLKPKDNLL  689

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE GG P +I++  VNRDTICS +S+Y P +VKS+ER G +   +VED++   +L C
Sbjct  690   VIFEETGGLPETIKVQTVNRDTICSIISEYRPPSVKSFERSGSQFNAIVEDLKSGAQLAC  749

Query  2271  PE-DKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             PE ++V+KKIEFA+YG+PDGACGN  +GNC+ PN+ K+VE+ CLGK+ C +PVE+  F E
Sbjct  750   PENNQVIKKIEFASYGNPDGACGNLYLGNCTSPNSLKVVEQHCLGKNTCAIPVEREAFDE  809

Query  2448  GSKDLCPNLVHKTLAVQAKCGL  2513
              SKD CPN   KTLAVQAKCGL
Sbjct  810   LSKDPCPN-TFKTLAVQAKCGL  830



>ref|XP_009631007.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=831

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/802 (67%), Positives = 655/802 (82%), Gaps = 11/802 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR PPEMW D++++AKEGGLN+IQTYVFWNIHEP+QGQFNFEG
Sbjct  37    MIINGNRELLFSGSIHYPRSPPEMWHDIIRKAKEGGLNLIQTYVFWNIHEPIQGQFNFEG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIKMIG+  +YV LRVGP++EAEWN GGFPYWL+EVP I FR+YNEPFM+HMKK
Sbjct  97    NYDLVKFIKMIGEQDLYVNLRVGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFMHHMKK  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AEM++D+MKK KLFAPQGGPII+AQIENEY++++     D    KKYI WAA+MA GLY
Sbjct  157   YAEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQLAYRED---GKKYIKWAAEMATGLY  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PW+MCKQ +APP+VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  214   NGVPWVMCKQKDAPPQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMY+GGTN+GRT +SFVTTRYYDE PLDEFGL R+PK
Sbjct  274   AAEDIAFSVARFFA-KNGTLTNYYMYHGGTNFGRTGSSFVTTRYYDEAPLDEFGLKREPK  332

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTPT+QK+ ++ EI  +E      CAAFLTNN+T  P++I
Sbjct  333   WSHLRDLHRALRLSRRALLWGTPTVQKISHDLEITVWEKPGSD-CAAFLTNNHTKLPSTI  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+Q +V+QHN+R F+ S+ A   +LKWEM+QE +P
Sbjct  392   KFRGQEYYLPEKSVSILPDCKTVVYNTQTVVAQHNSRNFIASEKA--KNLKWEMYQEKVP  449

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI++LP+KN  PLELY+LTKDTSDYAWYST I  +  DL  R DILPV+ + SMGHAL A
Sbjct  450   TINDLPLKNREPLELYSLTKDTSDYAWYSTSINLNRHDLPMRPDILPVMSIASMGHALAA  509

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HGNN +K+   +KPV LKPG N ITLL    GFPNSGA M+KRF GPR +
Sbjct  510   FVNGEFVGFAHGNNIEKSFVFQKPVILKPGTNHITLLAETVGFPNSGAYMEKRFAGPRAI  569

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYFD  1910
             T+QGLMAGTL ++ N+W H VG+ GEK ++FTEEG++KVKW PV+   P P+TWYKTYFD
Sbjct  570   TLQGLMAGTLDISLNNWGHKVGIYGEKKQIFTEEGAKKVKWTPVSGPPPGPITWYKTYFD  629

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVAL+MD M KGM+WVNG S+GRYWV+FLSPLGQP+Q EYHIPRAF+KPK+NL+
Sbjct  630   APEGNNPVALKMDKMQKGMMWVNGNSLGRYWVSFLSPLGQPTQSEYHIPRAFLKPKDNLL  689

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE GG   +IE+  VNRDTICS +S+Y P +VKS+ER G +   +VED++   +L C
Sbjct  690   VIFEETGGHSETIEVQTVNRDTICSIISEYRPPSVKSFERSGRQFNAIVEDLKSGAQLAC  749

Query  2271  PE-DKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             PE ++V+K+IEFA+YG+PDGACGN  +GNC+ PN+ K+VEK CLGK+ C +PVE+  F E
Sbjct  750   PENNQVIKQIEFASYGNPDGACGNLYLGNCTSPNSLKVVEKHCLGKNTCAIPVEREAFDE  809

Query  2448  GSKDLCPNLVHKTLAVQAKCGL  2513
              SKD CPN   KTLAVQAKCGL
Sbjct  810   LSKDPCPN-TFKTLAVQAKCGL  830



>ref|XP_009764615.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=829

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/800 (67%), Positives = 650/800 (81%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPPEMWPD++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPEMWPDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK IG+ G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF++HMKK
Sbjct  95    NYDVVKFIKAIGEQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIHHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D+MKK KLFAPQGGPII+AQIENEY++++    A     KKY+ WAA+MA GLY
Sbjct  155   YSEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYVEWAANMATGLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +AP +VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   NGVPWIMCKQKDAPAQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMYYGGTNYGRT +SFVTTRYYDE PLDEFGLYR+PK
Sbjct  272   AAEDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTGSSFVTTRYYDEAPLDEFGLYREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTP++QK+  + EI  +E      CAAFLTNN+TT P +I
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPSVQKINQHLEITVYEKPGTD-CAAFLTNNHTTLPATI  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+Q IVSQHN+R F+PS+ A   +LKWEM+QE +P
Sbjct  390   KFRGREYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFLPSEKA--KNLKWEMYQEKVP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI +L +KN  PLELY+LTKDTSDYAWYST I F   DL  R DILPVL + SMGHAL A
Sbjct  448   TISDLSLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDILPVLQIASMGHALSA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HGNN +K+   +KPV LKPG N I++L    GFPNSGA M+KRF GPR +
Sbjct  508   FVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPNSGAYMEKRFAGPRGI  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFD  1910
             T+QGLMAGTL +T N+W H VGV GEK +LFTEEG++KVKW PV       VTWYKTYFD
Sbjct  568   TVQGLMAGTLDITQNNWGHEVGVFGEKEQLFTEEGAKKVKWTPVNGPTKGAVTWYKTYFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVAL+MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KP NNL+
Sbjct  628   APEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQFEYHIPRAFLKPTNNLL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE GG P +IE+ +VNRDTICS +++Y+P +VKSWER G +   VVED++    L C
Sbjct  688   VIFEETGGHPETIEVQIVNRDTICSIITEYHPPHVKSWERSGTDFVAVVEDLKSGAHLTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P +K+++K+EFA+YG+PDGACGN   GNC+  N+ K+VEK CLGK+ C VP+E+ ++ E 
Sbjct  748   PSNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVVEKYCLGKNTCTVPIEREVYDEA  807

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
             SKD CPN + KTLAVQ KCG
Sbjct  808   SKDPCPN-IFKTLAVQMKCG  826



>dbj|BAO02512.1| predicted beta-galactosidase ortholog [Nicotiana alata]
Length=829

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/800 (67%), Positives = 651/800 (81%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPP+MWPD++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPKMWPDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK IG+ G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF++HMKK
Sbjct  95    NYDVVKFIKTIGEQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIHHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D+MKK KLFAPQGGPII+AQIENEY++++    A     KKY++WAA+MA GLY
Sbjct  155   YSEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYVDWAANMATGLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +AP +VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   NGVPWIMCKQKDAPAQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMYYGGTNYGRT++SFVTTRYYDE PLDEFGLYR+PK
Sbjct  272   AAEDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTSSSFVTTRYYDEAPLDEFGLYREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTP++QK+  + EI  +E      CAAFLTNN+TT P +I
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPSVQKINQDLEITVYEKPGTD-CAAFLTNNHTTLPATI  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+Q IVSQHN+R F+ S+ A   +LKWEM+QE +P
Sbjct  390   KFRGKEYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFIASEKA--KNLKWEMYQEKVP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI +L +KN  PLELY+LTKDTSDYAWYST I F   DL  R DILPVL + SMGHAL A
Sbjct  448   TISDLSLKNKEPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDILPVLQIASMGHALSA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HGNN +K+   +KPV LKPG N I++L    GFPNSGA M+KRF GPR V
Sbjct  508   FVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPNSGAYMEKRFAGPRGV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFD  1910
             T+QGLMAGTL VT N+W H VGV GEK +LFTEEG++KVKW PV       VTWYKTYFD
Sbjct  568   TVQGLMAGTLDVTQNNWGHEVGVFGEKEQLFTEEGTKKVKWTPVNGPTKGAVTWYKTYFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVAL+MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KP NNL+
Sbjct  628   APEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQFEYHIPRAFLKPTNNLL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE GG P +IE+  VNRDTICS +++Y+P +VKSWER G +   VVED++    L C
Sbjct  688   VIFEETGGHPETIEVQTVNRDTICSIITEYHPPHVKSWERSGTDFVAVVEDLKSGAHLTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P++K+++K+EFA+YG+PDGACGN   GNC+  N+ K+VEK CLGK+ C +P+E+ ++ E 
Sbjct  748   PDNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVVEKHCLGKNTCTIPIEREVYDEP  807

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
             SKD CPN+  KTLAVQ KCG
Sbjct  808   SKDPCPNMF-KTLAVQMKCG  826



>ref|XP_009605185.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=829

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/800 (66%), Positives = 649/800 (81%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPPEMWPD++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPEMWPDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK IG+ G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF++HMKK
Sbjct  95    NYDVVKFIKTIGEQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIHHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D+MKK KLFAPQGGPII+AQIENEY++++    A     KKY+ WAA+MA GLY
Sbjct  155   YSEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYVEWAANMATGLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +AP +VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   NGVPWIMCKQKDAPAQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMYYGGTNYGRT +SFVTTRYYDE PLDEFGLYR+PK
Sbjct  272   AAEDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTGSSFVTTRYYDEAPLDEFGLYREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTP++QK+  N EI  +E      CAAFLTNN+TT P +I
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPSVQKINQNLEITVYEKPGSD-CAAFLTNNHTTLPATI  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+Q IVSQHN+R F+PS+ A   +LKWEM+QE +P
Sbjct  390   KFRGKEYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFLPSEKA--KNLKWEMYQEKVP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI +LP+KN  PLELY+LTKDTSDYAWYST I F   DL  R DILPVL + SMGHAL A
Sbjct  448   TISDLPLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDILPVLQIASMGHALSA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HGNN +K+   +KPV LKPG N I++L    GFPNSGA M+KRF GPR V
Sbjct  508   FVNGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPNSGAYMEKRFAGPRGV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFD  1910
             T+QGLM+GTL +T N+W H VGV GEK +LFTEEG++KVKW PV       VTWYKTYFD
Sbjct  568   TVQGLMSGTLDITLNNWGHEVGVFGEKEQLFTEEGAKKVKWTPVNGPTKGAVTWYKTYFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVAL+MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KPKNNL+
Sbjct  628   APEGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQYEYHIPRAFLKPKNNLL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE GG P +IE+  VNRDTICS +++Y+P +VKSW + G +   +VED++    L C
Sbjct  688   VIFEETGGLPETIEVQTVNRDTICSIITEYHPPHVKSWGKSGTDFVAIVEDLKSGAHLTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P++K+++K+EFA+YG+PDGACGN   GNC+  N+ K+ E+ CLGK+ C +P+E+ ++ E 
Sbjct  748   PDNKIIEKVEFASYGNPDGACGNLYNGNCTSINSLKVAERHCLGKNTCTIPIERQVYDEP  807

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
             S D CPN + KTLAVQ KCG
Sbjct  808   SNDPCPN-IFKTLAVQMKCG  826



>ref|XP_009789713.1| PREDICTED: beta-galactosidase 13-like [Nicotiana sylvestris]
Length=837

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/800 (66%), Positives = 644/800 (81%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++ F+GSIHYPR PPEMWPD++++AKEGG+N++QTYVFWNIHEP+QGQFNFEG
Sbjct  39    LIVNGNRELFFSGSIHYPRSPPEMWPDIIRKAKEGGINLVQTYVFWNIHEPIQGQFNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK IG  G+YVTLR+GP++EAEW  GGFPYWL+EV  I FR+YNEPF+ HMKK
Sbjct  99    NYDIVKFIKEIGKQGLYVTLRIGPYIEAEWTSGGFPYWLREVKNITFRSYNEPFVYHMKK  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AE ++++MKK KLFAPQGGPIILAQIENEY++++    A  +  KKYI WAA+MA+GLY
Sbjct  159   YAEKVIELMKKEKLFAPQGGPIILAQIENEYNNVQL---AYKENGKKYIEWAANMAVGLY  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +APP VI+TCNGR CGDTF G NG NKPS+WTENWTAQYRT+GDPPAQR
Sbjct  216   NGVPWIMCKQKDAPPSVINTCNGRHCGDTFTGTNGPNKPSLWTENWTAQYRTYGDPPAQR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE++A+S+ RF A KNG+   YYMYYGGTN+GRT++SFVTTRYYDE P+DEFGL RDPK
Sbjct  276   SAEDLAFSVARFFA-KNGTLTNYYMYYGGTNFGRTSSSFVTTRYYDEAPIDEFGLMRDPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNL-KLCAAFLTNNNTT-PTS  1190
             WSHLRD H ALRLS+R L  GTPT+QK+  N EI  +E      +CAAFLTNN+T  P++
Sbjct  335   WSHLRDLHRALRLSRRALLWGTPTVQKINENLEITVYEKPGPDHMCAAFLTNNHTKLPSN  394

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             I FRG +YYLP  S S+L DCKT V+N+Q +VSQHN+R FVPS+ A   +LKWE++QE I
Sbjct  395   ITFRGAEYYLPEKSISILADCKTVVYNTQTVVSQHNSRNFVPSEKA--KNLKWEIYQEKI  452

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PTI +L +KN  PLELY+LTKD SDYAWYST I    RDL  R DILPVL + SMGHALV
Sbjct  453   PTIHDLALKNRDPLELYSLTKDKSDYAWYSTSINLDRRDLPMRPDILPVLQIASMGHALV  512

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNG++VG  HGNN +K+   R+PV LKPG N ITLL    G+PNSGA M+KRF GPR 
Sbjct  513   AFVNGQYVGFGHGNNIEKSFVFRQPVILKPGINHITLLAETIGYPNSGAYMEKRFAGPRG  572

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             VT+QGLMAGTL +T N W H VGV GEK +LFTEEG++KVKW  +    P PVTW KTYF
Sbjct  573   VTLQGLMAGTLDITLNVWGHEVGVYGEKEQLFTEEGAKKVKWTSLAGPPPGPVTWLKTYF  632

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPEG +PVALRM+ M KGM+WVNGKS+GRYW +FLSPLGQP+Q EYHIPRAF+KPKNNL
Sbjct  633   DAPEGTDPVALRMNKMQKGMMWVNGKSLGRYWASFLSPLGQPTQSEYHIPRAFLKPKNNL  692

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +VVFEE GG P +I++V VNRDTICS +++Y+P NVK WER G + R VVED++    L 
Sbjct  693   LVVFEETGGHPETIQIVTVNRDTICSMITEYHPPNVKYWERSGSKFRAVVEDLKAGAHLT  752

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP+D V++K+EFA+YGDPDGACGNF +GNC+ PN+ K+ EK CLGK  C VPVE+ +F E
Sbjct  753   CPDDNVIEKVEFASYGDPDGACGNFYIGNCTSPNSIKVAEKYCLGKHTCSVPVEREVFDE  812

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
              +KD CPN + KTLAVQ KC
Sbjct  813   PNKDPCPN-IFKTLAVQVKC  831



>ref|XP_009608903.1| PREDICTED: beta-galactosidase 13-like [Nicotiana tomentosiformis]
Length=837

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/800 (66%), Positives = 642/800 (80%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++ F+GSIHYPR PPEMWPD++++AKEGG+N+IQTYVFWNIHE +QGQF+FEG
Sbjct  39    LIVNGNRELFFSGSIHYPRSPPEMWPDIIRKAKEGGINLIQTYVFWNIHEHIQGQFDFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK IG  G+YVTLR+GP++EAEW  GGFPYWL+EV  I FR+YNEPF+ HMKK
Sbjct  99    NYDIVKFIKEIGKQGLYVTLRIGPYIEAEWTSGGFPYWLREVKNITFRSYNEPFVYHMKK  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AEM++++MKK KLFAPQGGPIILAQIENEY++++    A  +  KKYI WAA+MA+GLY
Sbjct  159   YAEMVIELMKKEKLFAPQGGPIILAQIENEYNNVQL---AYKENGKKYIEWAANMAVGLY  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +APP VI+TCNGR CGDTF GPNG NKPS+WTENWTAQYRT+GDPPAQR
Sbjct  216   NGVPWIMCKQKDAPPSVINTCNGRHCGDTFTGPNGPNKPSLWTENWTAQYRTYGDPPAQR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE++A+S+ RF A KNG+   YYMYYGGTN+GRT++SFVTTRYYDE PLDEFGL RDPK
Sbjct  276   SAEDLAFSVARFFA-KNGTLTNYYMYYGGTNFGRTSSSFVTTRYYDEAPLDEFGLMRDPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNL-KLCAAFLTNNNTT-PTS  1190
             WSHLRD H ALRLS+R L  GTPT+QK+  N EI  +E      +CAAFLTNN+T  P++
Sbjct  335   WSHLRDLHRALRLSRRALLWGTPTVQKINENLEITVYEKPGPDHMCAAFLTNNHTKLPSN  394

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             I FRG +YYLP  S S+L DCKT V+N+Q +VSQHN+R FVPS+ A   +LKWE++QE +
Sbjct  395   ITFRGAEYYLPEKSISILADCKTVVYNTQTVVSQHNSRNFVPSEKA--KNLKWEIYQEKV  452

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PTI +L +KN  PLELY+LTKD SDYAWYST I    RDL  R DILPVL + SMGHALV
Sbjct  453   PTIHDLALKNRDPLELYSLTKDKSDYAWYSTSINLDRRDLPMRPDILPVLQIASMGHALV  512

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNG++VG  HGNN +K+   R+PV LKPG N ITLL    G+PNSGA M+KRF GPR 
Sbjct  513   AFVNGQYVGFGHGNNIEKSFVFRQPVVLKPGINHITLLAETIGYPNSGAYMEKRFAGPRG  572

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             VT+QGLMAGTL +T N W H VGV GEK +LFTEEG++KVKW  +    P PVTW KTYF
Sbjct  573   VTLQGLMAGTLDITLNVWGHEVGVYGEKEQLFTEEGAKKVKWNSLAGPPPGPVTWLKTYF  632

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPEG +PVALRMD M KGM+WVNGKS+GRYW +FLSPLGQP+Q EYHIPRAF+KP NNL
Sbjct  633   DAPEGTDPVALRMDKMQKGMMWVNGKSLGRYWASFLSPLGQPTQSEYHIPRAFLKPNNNL  692

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +VVFEE GG P  I++V VNRDTICS +++Y+P NVK WER   + R VVED++    L 
Sbjct  693   LVVFEETGGHPEIIQIVTVNRDTICSMITEYHPPNVKYWERSRSKFRAVVEDLKAGAHLT  752

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP+D V++K+EFA+YGDPDGACGNF +GNC+ PN+ K+ EK CLGK  C +PVE+ +F E
Sbjct  753   CPDDNVIEKVEFASYGDPDGACGNFYMGNCTSPNSIKVAEKYCLGKHTCSIPVEREVFDE  812

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
              +KD CPN + KTLAVQ KC
Sbjct  813   PNKDPCPN-IFKTLAVQVKC  831



>ref|XP_006366982.1| PREDICTED: beta-galactosidase 13-like [Solanum tuberosum]
Length=829

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/800 (65%), Positives = 643/800 (80%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPP+MWPD++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPQMWPDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK I   G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF+ HMKK
Sbjct  95    NYDVVKFIKEIARQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIYHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D+MKK KLFAPQGGPII+AQIENEY++++    A     KKY+ WAA+MA  LY
Sbjct  155   YSEMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYVEWAANMATSLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             + +PWIMCKQ +APP +I+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   DGVPWIMCKQKDAPPHIINTCNGRHCADTFKGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF A KNG+   YYMYYGGTNYGRT++SFVTTRYYDE PLDEFGL+R+PK
Sbjct  272   AAEDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTSSSFVTTRYYDEAPLDEFGLFREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTPT+QK+  + EI  +E +    CAAFLTNN+TT P ++
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPTVQKVNRDIEITIYEKKGSD-CAAFLTNNHTTNPATV  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+Q IVSQHN+R FV S+ A    LKWE +QE +P
Sbjct  390   KFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFVASEKA--KGLKWEKYQEKVP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             TI  L +KN  PLELYTLTKDTSDYAWYST I+F   DL  R DILPVL + SMGHAL A
Sbjct  448   TISELSLKNREPLELYTLTKDTSDYAWYSTSIKFDRHDLPMRPDILPVLQIASMGHALAA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G  HGNN +K+   +KP+ LKPG N I++L    GFPNSGA M+KRF GPR +
Sbjct  508   FVNGEYIGFGHGNNIEKSFVFQKPIVLKPGTNTISILAETVGFPNSGAYMEKRFAGPRAI  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFD  1910
             TIQGLMAGTL +T N W H VGV GEK +LF+EEG++KVKW PVT   +  VTWYKT F+
Sbjct  568   TIQGLMAGTLDITQNDWGHEVGVFGEKEQLFSEEGAKKVKWTPVTGPTNGAVTWYKTTFE  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNP+A++MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KP +N++
Sbjct  628   APEGNNPLAVKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQFEYHIPRAFLKPTDNVL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VVFEE GG+P+ IE+  VNRDTICS +++Y+P NVKSWER G     +VED++    L C
Sbjct  688   VVFEETGGNPADIEIQTVNRDTICSIITEYHPPNVKSWERSGTNFVAIVEDLKTGAHLTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P+DK+++K+EFA+YG+PDGACGN IVG C+   + ++ E+ CLGK+ C +P+E+ ++ E 
Sbjct  748   PDDKIIEKVEFASYGNPDGACGNLIVGTCNSAKSMQVAEEKCLGKNSCTIPIEREIYDEP  807

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
             SKD CP+ + KTLAVQ KCG
Sbjct  808   SKDPCPD-IFKTLAVQMKCG  826



>ref|XP_004248657.1| PREDICTED: beta-galactosidase 13-like [Solanum lycopersicum]
Length=829

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/800 (65%), Positives = 638/800 (80%), Gaps = 10/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPRMPPEMWPDV+++AKEGGLN+IQTYVFWNIHEPVQGQFNFEG
Sbjct  35    MIVNGERELLFSGSIHYPRMPPEMWPDVIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFIK I   G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF+ HMKK
Sbjct  95    NYDVVKFIKEIARQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIYHMKK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++EM++D+MKK +LFAPQGGPII+AQIENEY++++    A  +   KYI WAA+MA  LY
Sbjct  155   YSEMVIDLMKKEQLFAPQGGPIIMAQIENEYNNVQL---AYRENGLKYIQWAANMASSLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PWIMCKQ +APP +I+TCNGR CGDTF GPNG NKPS+WTENWTAQYRTFGDPP+QR
Sbjct  212   NGVPWIMCKQRDAPPHIINTCNGRHCGDTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+++ RF A KNG+   YYMYYGGTNYGRT +SFVTTRYYDE PLDEFGLYR+PK
Sbjct  272   AAEDIAFAVARFFA-KNGTLTNYYMYYGGTNYGRTGSSFVTTRYYDEAPLDEFGLYREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H ALRLS+R L  GTPT+QK+  + EI  +E Q    C AFLTNN+TT P +I
Sbjct  331   WSHLRDLHRALRLSRRALLWGTPTVQKISADLEITVYEKQGTD-CTAFLTNNHTTNPATI  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+Q IVSQHN+R FV S+ A    LKWE +QE +P
Sbjct  390   KFRGKDYYLPEKSVSILPDCKTVVYNTQTIVSQHNSRNFVASEKA--KGLKWEKYQEKVP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T  +LP+KN  PLELY+LTKDTSDYAWYST + F   DL  R DILPVL + SMGHALVA
Sbjct  448   TSSDLPLKNREPLELYSLTKDTSDYAWYSTSVTFERHDLPMRPDILPVLQIASMGHALVA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+VG  HGNN +K    +KPV LKPG N I++L    GFPNSGA M+KRF GPR +
Sbjct  508   FVNGEYVGFGHGNNIEKGFVFQKPVVLKPGTNTISILAETVGFPNSGAYMEKRFAGPRAI  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFD  1910
             TIQGLMAGTL +T N+W H VGV GEK KLFTEEG++KVKW PV+   +   TWYKT FD
Sbjct  568   TIQGLMAGTLDITQNNWGHEVGVFGEKEKLFTEEGAKKVKWTPVSGPTNGATTWYKTTFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNP+A++MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KP  N++
Sbjct  628   APEGNNPLAVKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQFEYHIPRAFVKPTGNVL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VVFEE GG+P+ IE+  VNRDTICS +++Y+P NVKSWER G     +VED++    L C
Sbjct  688   VVFEETGGNPADIEIQTVNRDTICSIITEYHPPNVKSWERSGTNFVAIVEDLKTGAHLTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P++K+++K+EFA+YG+PDGACGN  VG C+   +  + ++ CLGK+ C +P+E+ ++ E 
Sbjct  748   PDNKIIEKVEFASYGNPDGACGNLAVGTCNSAKSMAVAQEKCLGKNSCTIPIEREIYDEP  807

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
             SKD CPN + KTLAVQ KC 
Sbjct  808   SKDPCPN-IFKTLAVQMKCA  826



>ref|XP_010315380.1| PREDICTED: beta-galactosidase 13-like [Solanum lycopersicum]
Length=775

 Score =  1082 bits (2798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/776 (66%), Positives = 628/776 (81%), Gaps = 9/776 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP+++++AKEGG+NVIQTYVFWNIHEPVQGQFNFEGN D+VKFIK I + G+YVTLR+G
Sbjct  1     MWPEIIRKAKEGGINVIQTYVFWNIHEPVQGQFNFEGNFDIVKFIKEIAEQGLYVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             P++EAEW+ GGFPYWL+E+  I FR+YNEPF+ HMKK++EM++D+MKK KLFAPQGGPII
Sbjct  61    PYIEAEWSSGGFPYWLREIKNITFRSYNEPFVYHMKKYSEMVIDLMKKEKLFAPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+++++    +    KKYI WAA+MA+GLY+ +PWIMCKQ EAPP VI+TCNG
Sbjct  121   LAQIENEYNNVQAAYKDN---GKKYIEWAANMAVGLYDGVPWIMCKQKEAPPSVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R C DTF GPNG+NKP++WTENWTAQYRTFGDPP+QRSAE++A+S+ RF A KNG+   Y
Sbjct  178   RHCADTFAGPNGLNKPTLWTENWTAQYRTFGDPPSQRSAEDLAFSVARFFA-KNGTLTNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GR+++SFVTTRYYDE PLDEFGL RDPKWSHLRD H ALRLS+R L  G P
Sbjct  237   YMYHGGTNFGRSSSSFVTTRYYDEAPLDEFGLMRDPKWSHLRDLHRALRLSRRALLWGNP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
             T+QK+  + EI  +EN    +CAAFLTNN+TT P++I FRG  YYLP  S S+L DCKT 
Sbjct  297   TVQKINQDLEITVYENTGEHMCAAFLTNNHTTQPSNITFRGANYYLPEKSVSILADCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+N+Q +VSQHN+R FVPS+ A   +LKWEM+QE +PT++ L +KN  PLELY+LTKD S
Sbjct  357   VYNTQTVVSQHNSRNFVPSEKA--KNLKWEMYQEKVPTVNELALKNREPLELYSLTKDKS  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DYAWYST I  +  DL  R DIL VL V SMGHAL AFVNG+++G  HGNN DK+   R+
Sbjct  415   DYAWYSTSINVNRHDLPMRSDILTVLQVASMGHALAAFVNGQYIGFGHGNNIDKSFVFRQ  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             P+ LK G NDITLLG L G+PNSGA M+KRF GPR VTIQGLMAGTL +T N W H VGV
Sbjct  475   PIVLKRGVNDITLLGELVGYPNSGAYMEKRFAGPRAVTIQGLMAGTLDITLNVWGHEVGV  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
             SGEK ++FTEEG++KVKW PVT   P PVTWYKTYFDAPEG +PVAL+MD M KGM+WVN
Sbjct  535   SGEKEQVFTEEGAKKVKWTPVTATPPGPVTWYKTYFDAPEGTDPVALKMDKMQKGMLWVN  594

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTI  2159
             GKS+GRYWV+FLSPLGQP+Q EYH+PRAF+KP NNL+VVFEE GG P  IE+V VNRDTI
Sbjct  595   GKSLGRYWVSFLSPLGQPTQSEYHVPRAFLKPSNNLLVVFEETGGHPEKIEIVTVNRDTI  654

Query  2160  CSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             CS +++Y+P NVK++E  G +   VVED++    L CP+D V++K+EFA+YGDPDGACGN
Sbjct  655   CSMITEYHPPNVKNFESSGSKFCPVVEDLKAGAHLTCPDDNVIEKVEFASYGDPDGACGN  714

Query  2340  FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             F +G C+  N+ K+ EK CLGK  C +P+E+  F E +KD CPN + KTLAVQ KC
Sbjct  715   FTMGTCTSQNSIKVAEKYCLGKHTCTIPIERVTFDEPNKDPCPN-IFKTLAVQVKC  769



>emb|CDO96919.1| unnamed protein product [Coffea canephora]
Length=842

 Score =  1070 bits (2766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/806 (62%), Positives = 644/806 (80%), Gaps = 16/806 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG+R++LF+GSIHYPR PPEMWP+++++AKEGGLNVIQTYVFWN+HEPVQGQFNF+G
Sbjct  38    IIIDGSRELLFSGSIHYPRSPPEMWPELIQQAKEGGLNVIQTYVFWNLHEPVQGQFNFDG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             NND+VKFIKMIG+ G+YVTLRVGP++EAEWN GGFPYWL+EVP I FR+YNEPFM+HM++
Sbjct  98    NNDIVKFIKMIGEQGLYVTLRVGPYIEAEWNAGGFPYWLREVPNITFRSYNEPFMHHMQR  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + + I+D+MKK KLFAPQGGPII+AQIENEY++++    A   + KKY++WAA+MA+ LY
Sbjct  158   YTDTIIDLMKKNKLFAPQGGPIIMAQIENEYNNVQL---AYRDLGKKYVDWAANMAVSLY  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             +++PW+MCKQ +APP VI TCNGR CG+TF G NG NKP++WTENWTAQYRTFGDPPAQR
Sbjct  215   DQVPWVMCKQKDAPPTVISTCNGRHCGETFRGSNGPNKPTLWTENWTAQYRTFGDPPAQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+++  F A +NG+   YYMY+GGTN+GRT++SFVTTRYYDE PLDE+GL R+PK
Sbjct  275   AAEDIAFAVALFFA-RNGTLNNYYMYHGGTNFGRTSSSFVTTRYYDEAPLDEYGLPREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLK-LCAAFLTNN-NTTPTS  1190
             + HLRD H ALRLSK+ L  GTP++Q++  + ++IT++N N++ +CAAFL NN  TTP +
Sbjct  334   FGHLRDLHRALRLSKKALLWGTPSVQQIEQDLQVITYDNPNVQNVCAAFLINNRTTTPAT  393

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             I FRG  YYLP  S S+LPDCKT V+N+  I SQHN+R F  S   G   L WE F E+I
Sbjct  394   ISFRGVDYYLPAKSISILPDCKTVVYNTVTIASQHNSRNFEESSKVGV--LDWEFFPESI  451

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P++D L  ++  PLELY LTKDTSDYAWY T I F +RDL  +  +LPVL   S+GHAL+
Sbjct  452   PSMDQLSQESKAPLELYGLTKDTSDYAWYRTSIHFDKRDLPMKAGVLPVLQALSLGHALL  511

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGE++G +HGNN +K+   +KP+ LKPG N+I+LLG+  GFPNSGA M+KRF GPR 
Sbjct  512   AFVNGEYIGFQHGNNIEKSFVFQKPISLKPGVNEISLLGMTVGFPNSGAYMEKRFAGPRV  571

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT------NVHPPVTW  1892
             VT+QGLM+GTL +T N+W H VG++GE+L+ FTEEGS KV WK +        V+ P+TW
Sbjct  572   VTLQGLMSGTLDITMNNWKHQVGLNGERLQYFTEEGSSKVGWKKLNAAGNLGGVNAPLTW  631

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK  2072
             YKTYFDAPEGN PVA++MD MAKGM+WVNG++IGRYWV+FLSPLGQP+Q EYHIPRAF+K
Sbjct  632   YKTYFDAPEGNGPVAIQMDKMAKGMIWVNGRNIGRYWVSFLSPLGQPTQSEYHIPRAFLK  691

Query  2073  PKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRP  2252
                NL+VV EE GGDP  I+LV VNRDTICS +++Y+P  VKSW R G+++R VVE+I  
Sbjct  692   QTKNLLVVLEETGGDPREIKLVTVNRDTICSFITEYHPPQVKSWVRTGDQMRAVVENITS  751

Query  2253  SVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEK  2432
                L CP +KV+K IEFA++GDP G CG F +G C+ PNA +I E+ C GK +C +P++K
Sbjct  752   GAHLNCPGNKVIKAIEFASFGDPYGVCGTFAIGECNAPNALQIAEQYCKGKKECTIPMDK  811

Query  2433  SLFQEGSKDLCPNLVHKTLAVQAKCG  2510
              LF  G+ D CP++  KTLAVQA+CG
Sbjct  812   GLF-FGANDACPHIA-KTLAVQARCG  835



>gb|EYU37950.1| hypothetical protein MIMGU_mgv1a001345mg [Erythranthe guttata]
Length=836

 Score =  1027 bits (2655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/798 (61%), Positives = 625/798 (78%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G+R++LF+GSIHYPR  P+MWP ++++AKEGGLNVIQTYVFWNIHEPVQGQFNFEG
Sbjct  39    IIINGSRELLFSGSIHYPRSTPDMWPQLIRKAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D VKFI+MI + G++VTLR+GP++EAEWN GGFPYWLKEVP I FR+YNEPFM HMK+
Sbjct  99    NYDFVKFIRMIQEQGLWVTLRIGPYIEAEWNLGGFPYWLKEVPNITFRSYNEPFMYHMKR  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++E I+D++K  KLFA QGGPII+AQIENEY++++    A     KKY+ WAAD+A+ LY
Sbjct  159   YSEKIIDIVKGEKLFADQGGPIIMAQIENEYNNVQL---AYRDAGKKYVKWAADLAISLY  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PW+MCKQ +AP  VI TCNGRQCGDTF GPNG +KPS+WTENWTAQYR FGDPP+QR
Sbjct  216   NGVPWVMCKQKDAPSTVISTCNGRQCGDTFPGPNGPDKPSLWTENWTAQYRVFGDPPSQR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE++AY++ RF A +NG+   YYMY+GGTN+GRT++SFVTTRYYDE PLDEFGL R+PK
Sbjct  276   AAEDLAYAVARFFA-RNGTLNNYYMYHGGTNFGRTSSSFVTTRYYDEAPLDEFGLKREPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HL+D H ALRLSK+PL  GT  +Q +  + EI T+E     +C AFLTNN++    +I
Sbjct  335   FGHLKDLHKALRLSKKPLLWGTQNVQMVTRDLEITTYEKSGTNICVAFLTNNHSREAMNI  394

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+Q +V+QH++R F  SK +   +  WEMF+ETIP
Sbjct  395   KFRGVDYYLPAKSISILPDCKTVVYNTQTVVAQHSSRNFDLSKTSKFRN--WEMFKETIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T ++LPIK+  P ELY L +DTSDYAWYST I   +RDL  R DI  VL + S+GHA VA
Sbjct  453   TKNDLPIKSKSPRELYRLNQDTSDYAWYSTSINLDKRDLPMRADIRSVLQIASLGHATVA  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG  HG+N +K+   + P++L PG+NDITLLG+  G PNSGA M+KRF GPR V
Sbjct  513   FVNGEFVGFGHGSNIEKSHVFKNPINLHPGDNDITLLGMTVGLPNSGAYMEKRFAGPRAV  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             T++GLM+GTL +T N W+  VGV+GE +K+FTEEGS+KVKW P++    PVTWYK YFDA
Sbjct  573   TLEGLMSGTLDITRNHWAQQVGVNGENMKIFTEEGSKKVKWSPLSETPSPVTWYKAYFDA  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PVALRM +MAKGMVWVNG +IGRYWV++LSPLG+P+Q EYHIPRA++K K+NL+V
Sbjct  633   PEGNDPVALRMMSMAKGMVWVNGLNIGRYWVSYLSPLGKPTQEEYHIPRAYLKEKDNLVV  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE GG+PS I++++VNRDTICS +++Y+P  VK+WERK  + R + + I+ +  L CP
Sbjct  693   VFEEIGGNPSKIDILVVNRDTICSVITEYHPPQVKTWERKDNKFRSIADPIK-AAYLTCP  751

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             + KVV K+EF  +G  +GACG F+ G C    A+K+VE+ CLGK +C +P ++    +  
Sbjct  752   DKKVVTKVEFVTFGTVEGACGTFLPGKCDSTKAHKLVEELCLGKVECTIPFDREDLVDSD  811

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP++  KTLAVQ +C
Sbjct  812   NDSCPDIA-KTLAVQVRC  828



>ref|XP_011088601.1| PREDICTED: beta-galactosidase 13 [Sesamum indicum]
Length=834

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/806 (60%), Positives = 625/806 (78%), Gaps = 11/806 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G+R++LF+GS+HYPR  P MWPD+++++KEGGLN+IQTYVFWNIHEPV+GQFNFEG
Sbjct  38    IIINGSRELLFSGSVHYPRSTPAMWPDIIRKSKEGGLNLIQTYVFWNIHEPVEGQFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+IG+ G++VTLR+GP++EAEWN GGFPYWLK V  I FR+YNEPF++HMKK
Sbjct  98    NYDLVKFIKLIGEEGLWVTLRIGPYIEAEWNLGGFPYWLKGVTNITFRSYNEPFLHHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AE I+++MK+ KLFA QGGPII+AQIENEY++++    A  +   KY+ WAA++A+ L+
Sbjct  158   YAEKIINLMKEHKLFADQGGPIIMAQIENEYNNVQE---AYRESGHKYVKWAAELAVNLH  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N IPW+MCKQ +AP  VI TCNGRQCGDTF GPNG NKPS+WTENWTAQYR +GDPP+QR
Sbjct  215   NGIPWLMCKQRDAPDTVISTCNGRQCGDTFPGPNGPNKPSLWTENWTAQYRVYGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+++ RF A KNG+   YYMY+GGTN+GRT++SFVT+RYYDE PLDEFGL R+PK
Sbjct  275   AAEDIAFAVARFFA-KNGTLNNYYMYHGGTNFGRTSSSFVTSRYYDEAPLDEFGLKREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H ALRLSK+ L  GTP +QKL  + EIITFE  ++  CAAFLTNN+T    +I
Sbjct  334   FGHLRDLHRALRLSKKALLKGTPRVQKLTEDLEIITFEKDDI--CAAFLTNNDTREAGTI  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+Q +V+QH++R FV S  A     KWEMF+E +P
Sbjct  392   KFRGVDYYLPSKSISILPDCKTVVYNTQTVVAQHSSRNFVISTKAKLG--KWEMFKERVP  449

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   L  K+  P ELY L KDTSDYAWYST I F +RDL  R DI P+L V S+GHAL+ 
Sbjct  450   TAHELERKSKSPEELYNLAKDTSDYAWYSTSITFDKRDLPMRSDISPILQVASLGHALLV  509

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVN E++G  HG+N +K+   +K + L PG N I+LL +  G PNSGA M+KRF GPR +
Sbjct  510   FVNAEYIGFGHGSNVEKSHVFKKSIKLFPGVNHISLLAMTVGLPNSGAYMEKRFAGPRAI  569

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TIQGLMAGTL +T N W   VGV GEK++L+TEEGS+K KW        P+TWYKTYFDA
Sbjct  570   TIQGLMAGTLDITRNYWGQEVGVLGEKMQLYTEEGSKKGKWSEFNGTPTPLTWYKTYFDA  629

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG+NPVALRM +MAKGMVW+NG+SIGRYWV++LSPLG+P+Q EYH+PR+F+KP NNL+V
Sbjct  630   PEGSNPVALRMTSMAKGMVWINGQSIGRYWVSYLSPLGKPTQEEYHVPRSFLKPTNNLIV  689

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE GGDP  IE+++VNRDTICS V++Y+P +VKS++ K  +LR  +  I+    L CP
Sbjct  690   VFEETGGDPRKIEILVVNRDTICSVVTEYHPPHVKSFDLKENKLRSNINPIK-GAHLACP  748

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             + K+++K+EF ++G+ DGACG FI G C    A+K+VEK  LGK++C +P ++    +  
Sbjct  749   DKKIIEKVEFVSFGEADGACGAFIAGKCDSKTAHKLVEKXXLGKTECTIPFDRKTLLDSG  808

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
              D CP+ + K+LAVQ KCG   +K D
Sbjct  809   TDPCPD-IEKSLAVQVKCGFGGSKSD  833



>ref|XP_011092984.1| PREDICTED: beta-galactosidase 13-like [Sesamum indicum]
Length=827

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/800 (59%), Positives = 610/800 (76%), Gaps = 11/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G+R++LF+GSIHYPR  P+MWPD++++AKEGGLN+IQTYVFWN+HEP QG++NFEG
Sbjct  35    LIINGSRELLFSGSIHYPRSTPDMWPDIIRKAKEGGLNIIQTYVFWNLHEPNQGEWNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK I + G++VTLR+GP++EAEWN GGFPYWL+EVP I FR+ NE F  HM+K
Sbjct  95    NRDLVKFIKCIWEQGLWVTLRIGPYIEAEWNMGGFPYWLREVPDIIFRSDNEAFKYHMQK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGL  653
             +AE +++MMKK KLFA QGGPI++ QIENEY++++ + R   I     Y+ WAA+MA+ L
Sbjct  155   YAEKVINMMKKEKLFADQGGPIVMMQIENEYNNVQLAYRERGIS----YVKWAANMALSL  210

Query  654   YNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQ  833
             YN +PWIMCKQ +APP VI TCNGRQC DTF GPNG +KPS+WTENWTAQYR FGD P+Q
Sbjct  211   YNGVPWIMCKQKDAPPTVISTCNGRQCADTFAGPNGPDKPSLWTENWTAQYRVFGDTPSQ  270

Query  834   RSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDP  1013
             R+AE+I++++ RF          Y  Y G      +++SFVTTRYYDE PLDE+GL R+P
Sbjct  271   RAAEDISFAVARFFTRNGTLNNYYMYYGGSNFGRTSSSSFVTTRYYDEAPLDEYGLRREP  330

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-S  1190
             K+ HLRD H AL+LSK+PL  GTP ++++  + EI T+E  +  LC AFLTNN+T    +
Sbjct  331   KFGHLRDLHRALKLSKKPLLRGTPKVERISQDLEITTYEKPSENLCVAFLTNNDTREAKT  390

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             I FRG  YYLP  S S+LPDCKT V+N+  IV+QH++R FV  + A     KWEMF+ETI
Sbjct  391   IHFRGKDYYLPSKSVSILPDCKTVVYNTAAIVAQHSSRNFVVPQQAKFS--KWEMFKETI  448

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PTI++L  +   P ELY+ TKD SDYAWYST I+   RDL  R D+ P L + S+GHAL+
Sbjct  449   PTINDLKDRTPAPKELYSFTKDVSDYAWYSTSIKIDARDLPMRPDVRPGLHIASLGHALL  508

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGE++G +HG+N +K+   RKPV+L  G+NDITLL +  GFPNSGA M+KRF GPR 
Sbjct  509   AFVNGEYIGFEHGSNVEKSHIFRKPVNLTAGDNDITLLAMTVGFPNSGAYMEKRFAGPRA  568

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VT++GLM+GTL +T N+W   VGV+GEK+ ++TEEG++ VKW P      PVTWYKTYFD
Sbjct  569   VTLEGLMSGTLDITNNNWGQQVGVNGEKVPVYTEEGAKTVKWVPFAGTPSPVTWYKTYFD  628

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGNNPVALRM +MAKGMVWVNG+SIGRYWV++ SPLG+P+Q EYHIPRAF+KPK+NL+
Sbjct  629   APEGNNPVALRMMSMAKGMVWVNGQSIGRYWVSYNSPLGRPTQEEYHIPRAFLKPKSNLL  688

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VVFEE GG+P  I++++VNRDTICS +++Y+P +V SWERKG ELR +V  +R    L C
Sbjct  689   VVFEETGGNPEKIDILVVNRDTICSVITEYHPPSVNSWERKGNELRALVNPVR-EAELTC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             P++KV+KK+EF  +G+ DGACG F  G C S   A K+VE  CLGK++CKVP E+    +
Sbjct  748   PDNKVIKKVEFVGFGEVDGACGAFKPGKCNSNSKAIKLVESLCLGKNECKVPFERERLVD  807

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
               KD CP+ V KTLA+Q  C
Sbjct  808   VGKDACPD-VSKTLAIQVAC  826



>ref|XP_002278545.1| PREDICTED: beta-galactosidase 13 [Vitis vinifera]
 emb|CBI37877.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/801 (59%), Positives = 617/801 (77%), Gaps = 8/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPR  PEMWPD+L++AK GGLN+IQTYVFWNIHEPV+GQFNFEG
Sbjct  39    LIVNGRRELLFSGSIHYPRSTPEMWPDILQKAKHGGLNLIQTYVFWNIHEPVEGQFNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+IGD G+Y TLR+GPF+EAEWN GGFPYWL+EVP I FR+YNEPF  HM+K
Sbjct  99    NYDLVKFIKLIGDYGLYATLRIGPFIEAEWNHGGFPYWLREVPDIIFRSYNEPFKYHMEK  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++ MI++MMK+AKLFAPQGGPIILAQIENEY+SI+    A  ++  +Y+ WA  MA+GL 
Sbjct  159   YSRMIIEMMKEAKLFAPQGGPIILAQIENEYNSIQL---AYRELGVQYVQWAGKMAVGLG  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QR
Sbjct  216   AGVPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNRPNKPSLWTENWTAQYRVFGDPPSQR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE++A+S+ RF + KNG+   YYMY+GGTN+GRT +SFVTTRYYDE PLDE+GL R+PK
Sbjct  276   AAEDLAFSVARFIS-KNGTLANYYMYHGGTNFGRTGSSFVTTRYYDEAPLDEYGLQREPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H+ALRL K+ LF G+P ++KL  ++E+  +E     +CAAFLTNN++    ++
Sbjct  335   WGHLKDLHSALRLCKKALFTGSPGVEKLGKDKEVRFYEKPGTHICAAFLTNNHSREAATL  394

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +Y+LP  S S+LPDCKT V+N+Q +V+QHNAR FV SK+A ++ LKWEM QE IP
Sbjct  395   TFRGEEYFLPPHSISILPDCKTVVYNTQRVVAQHNARNFVKSKIANKN-LKWEMSQEPIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
              + ++ I    P+ELY   KD SDYAW+ T IE S  DL  + DI+PVL + ++GHA++A
Sbjct  454   VMTDMKILTKSPMELYNFLKDRSDYAWFVTSIELSNYDLPMKKDIIPVLQISNLGHAMLA  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG F+GS HG+N +K    RKPV  K G N I LL +  G PNSGA M+ R+ G   V
Sbjct  514   FVNGNFIGSAHGSNVEKNFVFRKPVKFKAGTNYIALLCMTVGLPNSGAYMEHRYAGIHSV  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL  GTL +T N W   VGV+GE +K +T+ GS +V+W       P +TWYKTYFD 
Sbjct  574   QILGLNTGTLDITNNGWGQQVGVNGEHVKAYTQGGSHRVQWTAAKGKGPAMTWYKTYFDM  633

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PV LRM +MAKGM WVNGK+IGRYW+++LSPL +PSQ EYH+PRA++KP +NL+V
Sbjct  634   PEGNDPVILRMTSMAKGMAWVNGKNIGRYWLSYLSPLEKPSQSEYHVPRAWLKPSDNLLV  693

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+P  IE+ LVNRDTICS V++Y+P +VKSW+R   ++R VV++++P   LKCP
Sbjct  694   IFEETGGNPEEIEVELVNRDTICSIVTEYHPPHVKSWQRHDSKIRAVVDEVKPKGHLKCP  753

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               KV+ K++FA++G+P GACG+F +GNC+ PN+ K+VE+ C+GK+ C++P+E  +F +G+
Sbjct  754   NYKVIVKVDFASFGNPLGACGDFEMGNCTAPNSKKVVEQHCMGKTTCEIPMEAGIF-DGN  812

Query  2454  KDLCPNLVHKTLAVQAKCGLR  2516
                C ++  KTLAVQ +CG +
Sbjct  813   SGACSDIT-KTLAVQVRCGRK  832



>gb|EPS74283.1| beta-galactosidase, partial [Genlisea aurea]
Length=815

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/800 (60%), Positives = 621/800 (78%), Gaps = 11/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G+R++LF+GSIHY R  P+MW D++K+AK+GGLNVIQTYVFWNIHEPV+GQ NF G
Sbjct  24    IIINGSRELLFSGSIHYTRSTPDMWHDLIKQAKQGGLNVIQTYVFWNIHEPVEGQLNFGG  83

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + DL+KFIK+I + GM+VTLR+GP++EAEWN GGFPYWLK +P I FR+YNEPFMN+MKK
Sbjct  84    DYDLIKFIKLISENGMWVTLRIGPYIEAEWNMGGFPYWLKGIPGITFRSYNEPFMNYMKK  143

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +AE +++++K+AKLFA QGGPII+AQIENEY++++    A  +  K+Y+ WAA++A+ LY
Sbjct  144   YAETVINLVKEAKLFADQGGPIIMAQIENEYNNVQL---AYREKGKEYVKWAANLAVSLY  200

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             + +PW+MCKQ +AP  VI TCNGRQCGDTF GPNG +KPS+WTENWTAQYR FGD P+QR
Sbjct  201   SGVPWLMCKQYDAPQLVISTCNGRQCGDTFPGPNGPDKPSLWTENWTAQYRVFGDSPSQR  260

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF A +NG+   YYMY+GGTN+GRT++SFVTTRYYDE PLDEFGL R+PK
Sbjct  261   SAEDIAFSVARFFA-RNGTLNNYYMYHGGTNFGRTSSSFVTTRYYDEAPLDEFGLKREPK  319

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTP-TSI  1193
             + HLRD H ALRLSK+PL  GT  +QK+  + EI T+E     +C AFLTNNNT   +SI
Sbjct  320   FGHLRDLHRALRLSKKPLLWGTQHVQKINQDLEITTYEKSGSNICVAFLTNNNTQEDSSI  379

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y+LP  S S+LPDCKT VFN+Q +V+QH++R FVPS+ A     KWE FQE IP
Sbjct  380   KFRGIDYFLPAKSISILPDCKTVVFNTQTVVAQHSSRNFVPSRKA--TIAKWEAFQEAIP  437

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               ++ P+K+L P ELY  TKDTSDYAWYST I F  RDL  R DI P+L V S+GH L+A
Sbjct  438   EFEDFPLKSLSPKELYDFTKDTSDYAWYSTDINFDRRDLPMRVDIKPILQVASLGHGLLA  497

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+VG  HG+N +K+   R PV+LK G N I++L +  G PNSGA M++RF GPR +
Sbjct  498   FVNGEYVGFGHGSNIEKSFVFRMPVNLKIGLNHISILAMTVGLPNSGAFMERRFAGPRAI  557

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT-NVHPPVTWYKTYFD  1910
             TIQG MAG L +T   WS  VGV+GE  ++FTEEGS+KV W   +     P+TWYKTYFD
Sbjct  558   TIQGTMAGNLDITRTQWSQQVGVNGENAQVFTEEGSKKVTWSSSSLKGGTPITWYKTYFD  617

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEG +PVA+ M +M KGM+WVNG++IGRYWV++LSPLG+P+Q EYHIPR+++KPKNNLM
Sbjct  618   APEGRHPVAVNMTSMGKGMIWVNGRNIGRYWVSYLSPLGKPTQEEYHIPRSYLKPKNNLM  677

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VVFEE GG+P  I++V VNRDTICS +++Y+P +V++WERK  + R +V+ I+ +  L C
Sbjct  678   VVFEEIGGNPEEIKIVTVNRDTICSIITEYHPPHVQTWERKDNQFRSIVDPIK-AAYLNC  736

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSF-PNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             P+ KV++K+EFA++G+ DGACG F  G+C +     +IVEK CLGK+ C +P E+    +
Sbjct  737   PDGKVIEKVEFASFGNSDGACGAFQPGSCDYTAKPQQIVEKLCLGKTDCAIPFEREQLMD  796

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
               KD CP+ + +TLAVQ KC
Sbjct  797   SDKDSCPD-ISRTLAVQVKC  815



>gb|KCW64119.1| hypothetical protein EUGRSUZ_G01775 [Eucalyptus grandis]
Length=830

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/798 (59%), Positives = 608/798 (76%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMWPD++ +AK GGLNVIQTYVFWN HEPVQGQFNFEG
Sbjct  40    LIINGKRELLFSGSIHYPRSTPEMWPDLISKAKHGGLNVIQTYVFWNAHEPVQGQFNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIKMIG+  MYVTLRVGPF++AEWN GG PYWL+EV  I FR  NEPF  HM+K
Sbjct  100   NYDLVKFIKMIGEHDMYVTLRVGPFIQAEWNHGGLPYWLREVKNITFRADNEPFKYHMQK  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+DMMK+ KLFA QGGPIILAQIENEY+ ++    A  ++  +Y+ WA +MA+GL 
Sbjct  160   FVRKIIDMMKEEKLFASQGGPIILAQIENEYNHVQL---AYKELGTRYVQWAGNMALGLN  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  NKP +WTENWTAQYR FGDPP+QR
Sbjct  217   IGVPWIMCKQKDAPGPVINTCNGRHCGDTFTGPNSPNKPILWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF A KNGS   YYMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PK
Sbjct  277   SVEDIAFSVARFFA-KNGSLANYYMYHGGTNFGRTSAVFTTTRYYDEAPLDEYGLQREPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSI-  1193
             WSHLRD H AL L ++PL  G P++Q+L  + E +TFE    K+CAAFLTNN+T    + 
Sbjct  336   WSHLRDVHKALSLCRKPLLWGNPSVQRLGADIEALTFEIPGTKVCAAFLTNNHTKIAQVA  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +FRG  +YLP  S S+LPDCKT V+N+Q IVSQHNAR F  SK+   D+LKWEM +E IP
Sbjct  396   EFRGESFYLPPHSISILPDCKTLVYNTQTIVSQHNARNFRRSKVT--DNLKWEMSREAIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 +P+ +  P E Y LTKDT+DYAW++T I+ S RDL  R +ILPVL + S+GHA+  
Sbjct  454   DTAKVPVDSKIPAEHYKLTKDTTDYAWFTTSIKISPRDLPRRTEILPVLRIASLGHAMQV  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G+ HG++ +K+   +K V+LKPG N I+LLG+  G P+SGA M+ +F GPR V
Sbjct  514   FVNGEYIGTAHGSHIEKSFVFQKAVNLKPGTNYISLLGMTIGLPDSGAYMEHKFAGPRLV  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TI GL  GTL +T N W H VG+ GEK++ +T+ GS +V+WK    V P +TWYK YF A
Sbjct  574   TILGLNTGTLDLTLNGWGHKVGLDGEKVRAYTQAGSHRVQWKKANGVGPALTWYKAYFHA  633

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG+ P+A+R+ N+ KGM+WVNGKSIGR+W ++L+PL QPSQ EYHIPR+F+KP +NLMV
Sbjct  634   PEGDGPLAIRLPNLGKGMIWVNGKSIGRFWNSYLTPLLQPSQSEYHIPRSFIKPSDNLMV  693

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V +E+GG+P SIE++ V+RDTICS +S+ +P +VKSW RK   +R VV++++P+  LKC 
Sbjct  694   VLDEEGGNPQSIEILTVDRDTICSFISENHPPHVKSWARKNSHIRPVVDNVKPTANLKCS  753

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  IEFA++GDPDG CG+F +G C+   + K+VE+ CLGK+ C+VP++++LF + +
Sbjct  754   NHKKIVAIEFASFGDPDGICGSFSLGKCTSSISKKVVEQYCLGKTSCQVPIDRALFDKNN  813

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                CP+++ KTLA+QA+C
Sbjct  814   NG-CPDIM-KTLAIQARC  829



>ref|XP_010090335.1| Beta-galactosidase 11 [Morus notabilis]
 gb|EXB39305.1| Beta-galactosidase 11 [Morus notabilis]
Length=848

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/812 (58%), Positives = 608/812 (75%), Gaps = 19/812 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHY R  P+MWPD++++AK GGLNVIQTYVFWN+HEPV+GQFNFEG
Sbjct  44    LIINGKRELLFSGSIHYTRSTPDMWPDIIQKAKHGGLNVIQTYVFWNVHEPVKGQFNFEG  103

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++ + GMYVTLRVGPF++AEWN GG PYWL+EVP I FR+ N PF  HMK+
Sbjct  104   KYDLVKFIKLVAENGMYVTLRVGPFIQAEWNHGGLPYWLREVPNIIFRSDNAPFKYHMKR  163

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + + I++MMK+ KLFAPQGGPIILAQIENEY+ I+    A  ++  +Y+ W+A+MA+G+ 
Sbjct  164   YVKKIINMMKEEKLFAPQGGPIILAQIENEYNHIQL---AYREMGTRYVQWSANMAVGMK  220

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN   KPS+WTENWTAQYR FGDPP+QR
Sbjct  221   TGVPWVMCKQKDAPDPVINTCNGRHCGDTFTGPNNPYKPSIWTENWTAQYRVFGDPPSQR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IAYS+ RF + KNG+   YYMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PK
Sbjct  281   AAEDIAYSVARFFS-KNGTLANYYMYHGGTNFGRTSAVFTTTRYYDEAPLDEYGLQREPK  339

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L K+ L  GTP  QKL  + E+  +E     +CAAFL+NNN+    ++
Sbjct  340   WSHLRDLHRALNLCKKALLWGTPGGQKLGKHTEVRMYEKPGTNICAAFLSNNNSKVAHTV  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG+ YYLP  S S+LPDCK  V+N+Q IVSQHNAR +V SK+A    LKW+M  E IP
Sbjct  400   KFRGSAYYLPPRSISILPDCKNVVYNTQTIVSQHNARNYVRSKVA--STLKWKMSPEQIP  457

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             ++  +P+ N  P ELY+L KDT+DYAWY+T I+ S+RDL  R DILPVL + S+GHAL A
Sbjct  458   SVHQVPVNNRIPHELYSLLKDTTDYAWYTTSIDLSQRDLPMRPDILPVLRISSLGHALHA  517

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+VGS HG++++K+   +  + LKPG N I +LG+  G P+SGA M+ RF GPR V
Sbjct  518   FVNGEYVGSGHGSHEEKSFVFQHAIVLKPGTNHIAILGMTVGLPDSGAYMEHRFAGPRAV  577

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYK-----  1898
             TI GL  GT+ +T N W + VG++GEK  +FTE+GS+KV+W  V    P +TWYK     
Sbjct  578   TILGLNTGTIDLTPNGWGNQVGLTGEKNHVFTEDGSKKVQWSKVKRQGPALTWYKEKFIQ  637

Query  1899  -----TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRA  2063
                  T FDAPEG +PVA+RM+ M KGM+WVNG++IGRYW+++LSPLG+PSQ EYHIPR+
Sbjct  638   LFFEQTRFDAPEGRDPVAIRMNGMGKGMIWVNGQNIGRYWMSYLSPLGKPSQEEYHIPRS  697

Query  2064  FMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVED  2243
             F+KP  NL+VV EE+   P  IE++ VNRDTICS ++++ P +VKSW R+   +R VV+ 
Sbjct  698   FLKPTQNLLVVLEEEKASPKGIEILKVNRDTICSYITEFSPPHVKSWAREESHIRAVVDI  757

Query  2244  IRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVP  2423
             ++P+  LKCP  K +  ++FA+YGDP G CGNF++G C+ P+   IVE+ CLGK  C VP
Sbjct  758   LQPAAHLKCPNHKKIASVDFASYGDPAGVCGNFVLGTCNSPSTKGIVEQHCLGKPTCVVP  817

Query  2424  VEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRH  2519
             V+K LF +   D CPN V+KTLA+Q KC   H
Sbjct  818   VKKELFDKNG-DACPN-VNKTLAIQVKCAPSH  847



>gb|KCW55522.1| hypothetical protein EUGRSUZ_I01412 [Eucalyptus grandis]
Length=830

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/800 (59%), Positives = 602/800 (75%), Gaps = 12/800 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMWPD++++AK+GGLNVIQTYVFWN HEPVQGQ+NFEG
Sbjct  38    LIINGKRELLFSGSIHYPRSTPEMWPDLIRKAKQGGLNVIQTYVFWNAHEPVQGQYNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+IG+  MYVTLRVGPF++AEWN GG PYWL+EV  I FR+ N PF  HMKK
Sbjct  98    NYDLVKFIKLIGEHKMYVTLRVGPFIQAEWNHGGLPYWLREVQNITFRSDNPPFKYHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGL  653
             + +MI+  MK  KLFA QGGPII++QIENEY+SI+ + R A  +    Y+ WA +MA+GL
Sbjct  158   YVKMIIQKMKDEKLFASQGGPIIISQIENEYNSIQLAYRDAGTR----YVQWAGNMAVGL  213

Query  654   YNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQ  833
                +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+Q
Sbjct  214   KTGVPWIMCKQKDAPDPVINACNGRHCGDTFTGPNKPYKPTLWTENWTAQYRVFGDPPSQ  273

Query  834   RSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDP  1013
             RSAE++A+S+ RF A KNG+   YYMY+GGTN GRT+A F TTRYYDE PLDE+GL R+P
Sbjct  274   RSAEDLAFSVARFFA-KNGTLTNYYMYHGGTNLGRTSAVFTTTRYYDEAPLDEYGLQREP  332

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTS  1190
             KW HL+D H ALRL ++ L  G+P +Q+L  + E   +E    K+CAAFLTNN+T +   
Sbjct  333   KWGHLKDLHKALRLCRKALLWGSPKVQRLSKDLEARYYEIPGTKVCAAFLTNNSTLSAQV  392

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             +KFRG +YYLP  S S+LPDCKT V+N+Q IVSQHN+R  V S+ A +  LKWEM  E I
Sbjct  393   VKFRGQEYYLPQHSISILPDCKTVVYNTQRIVSQHNSRNLVKSEKANK--LKWEMSLEII  450

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P  + +P+    P ELY+L KDT+DYAW++T ++   RDL  R +I PVL V S+GHA++
Sbjct  451   PDTNRVPVNAKIPAELYSLLKDTTDYAWFTTSLDLGVRDLPMRKNIKPVLRVASLGHAML  510

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGEF+GS HG++ DK+  L++P+DLKPG N I+LLG   G P+SGA M+ R+ GPR 
Sbjct  511   AFVNGEFIGSAHGSHIDKSFVLQQPIDLKPGVNHISLLGSTVGLPDSGAYMEHRYAGPRL  570

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYF  1907
             VTI GL  GTL +T N W H VG+ GEK++++T+ GS + +W   T  V   +TWYKTYF
Sbjct  571   VTILGLNTGTLDLTLNGWGHQVGLDGEKVRVYTQSGSHRAQWTEATKGVGRALTWYKTYF  630

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPEG+ PVA+ +  M KGMVWVNGKSIGRYW  +LSPLGQPSQ EYHIPR+F+KP +NL
Sbjct  631   DAPEGDQPVAIHLPQMTKGMVWVNGKSIGRYWYTYLSPLGQPSQSEYHIPRSFIKPTDNL  690

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +VV +E GG+P SIE++ V+RDTICS +++ +P +VKSW RK      V+++++ +  LK
Sbjct  691   LVVLDEDGGNPESIEILNVDRDTICSYITENHPPSVKSWARKNSHFITVLDEVKTAAHLK  750

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  K +  IEFA++GDP G CGNF  GNC+ P +  IVEK CLGK+ C VP+E+ L  +
Sbjct  751   CPNHKKIVAIEFASFGDPYGICGNFKYGNCTSPISKDIVEKHCLGKTSCAVPIERGLLDK  810

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
             G+ D CP+++ KTLA+QAKC
Sbjct  811   GN-DGCPSIM-KTLAIQAKC  828



>ref|XP_007041847.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
 gb|EOX97678.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
Length=843

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/801 (58%), Positives = 601/801 (75%), Gaps = 11/801 (1%)
 Frame = +3

Query  120   FIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGN  299
              I+G R++LF+GSIHYPR  P+ WPD+L +AK GGLNVIQTYVFWNIHEP++GQ+NFEG 
Sbjct  53    IINGKRELLFSGSIHYPRSTPDTWPDLLTKAKYGGLNVIQTYVFWNIHEPIEGQYNFEGQ  112

Query  300   NDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKF  479
              DLVKFIK+IG+  MY TLRVGPF++AEWN GG PYWL+EV  I FR+ NEPF ++MKKF
Sbjct  113   YDLVKFIKLIGEHKMYATLRVGPFIQAEWNHGGLPYWLREVRNITFRSDNEPFKHYMKKF  172

Query  480   AEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYN  659
               MI+DMMKK KLFA QGGPI+L+QIENEY++I+    A  ++   Y+ WA  MA+GL  
Sbjct  173   VTMIIDMMKKEKLFASQGGPIVLSQIENEYNTIQL---AFRELGDSYVQWAGKMAVGLNT  229

Query  660   EIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRS  839
             E+PWIMCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QRS
Sbjct  230   EVPWIMCKQRDAPDPIINTCNGRHCGDTFTGPNRRNKPSLWTENWTAQYRVFGDPPSQRS  289

Query  840   AENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKW  1019
             AE++AYS+ RF + KNGS + YYMY+GGTNYGRT+A+F TTRYYDE PLDE+GL RDPKW
Sbjct  290   AEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAPLDEYGLQRDPKW  348

Query  1020  SHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIK  1196
              HL+D H AL L K+ L  G+PT+QKL  +QE+ T++     LCAAFL NN+T    +  
Sbjct  349   GHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFLANNDTQNAQTFH  408

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FRG QY LP  S S+LPDCKT V+N+Q I +QHN R FV S  A ++   W+M++E +PT
Sbjct  409   FRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSATANKN-FNWQMYKEYVPT  467

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                L      P+ELY LTKDT+DYAWY+T IE   RDL  + +I PVL V S+GH L+AF
Sbjct  468   --QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPVLRVASLGHGLLAF  525

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNGE++G  HG+  +K+   +KPV LK G N ITLLG L G P+SGA M+ RF GPR +T
Sbjct  526   VNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGAYMEHRFAGPRSIT  585

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             I GL  GTL ++ N W H VG++GEK K++TE+GS KV+W+ ++   P +TWYK YFD P
Sbjct  586   ILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSE-SPALTWYKGYFDTP  644

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
             EGNNPVA+RM  M KGMVW+NG++IGRYW+++LSPL QPSQ EY IPR+F+KP  NL+V+
Sbjct  645   EGNNPVAIRMTGMGKGMVWINGQNIGRYWMSYLSPLKQPSQSEYQIPRSFLKPTQNLIVI  704

Query  2097  FEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPE  2276
              EEQ G+P  +E++LVNRDTICS V++Y+P +V+ +E KG  LR  V+D++P   L CP 
Sbjct  705   LEEQEGNPKDVEILLVNRDTICSYVTEYHPPSVRLFESKGGSLRAKVDDLKPKAELTCPN  764

Query  2277  DKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSK  2456
              K +  +EFA++GDP GACG++ +GNC+FP + K+ EK CLGK+ C++P++   F +   
Sbjct  765   HKKIVAVEFASFGDPFGACGSYSLGNCTFPVSKKVAEKFCLGKTSCQIPLDAEDFDK-QN  823

Query  2457  DLCPNLVHKTLAVQAKCGLRH  2519
             D CP++  K LAVQ KC  ++
Sbjct  824   DACPHM-KKALAVQVKCAYKN  843



>ref|XP_011092985.1| PREDICTED: beta-galactosidase 13-like [Sesamum indicum]
Length=770

 Score =   971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/777 (59%), Positives = 591/777 (76%), Gaps = 11/777 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++++AKEGGLN+IQTYVFWN+HEP QG++NFEGN DLVKFIK I + G++VTLR+G
Sbjct  1     MWPDIIRKAKEGGLNIIQTYVFWNLHEPNQGEWNFEGNRDLVKFIKCIWEQGLWVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             P++EAEWN GGFPYWL+EVP I FR+ NE F  HM+K+AE +++MMKK KLFA QGGPI+
Sbjct  61    PYIEAEWNMGGFPYWLREVPDIIFRSDNEAFKYHMQKYAEKVINMMKKEKLFADQGGPIV  120

Query  546   LAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCN  722
             + QIENEY++++ + R   I     Y+ WAA+MA+ LYN +PWIMCKQ +APP VI TCN
Sbjct  121   MMQIENEYNNVQLAYRERGIS----YVKWAANMALSLYNGVPWIMCKQKDAPPTVISTCN  176

Query  723   GRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylg  902
             GRQC DTF GPNG +KPS+WTENWTAQYR FGD P+QR+AE+I++++ RF          
Sbjct  177   GRQCADTFAGPNGPDKPSLWTENWTAQYRVFGDTPSQRAAEDISFAVARFFTRNGTLNNY  236

Query  903   yymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGT  1082
             Y  Y G      +++SFVTTRYYDE PLDE+GL R+PK+ HLRD H AL+LSK+PL  GT
Sbjct  237   YMYYGGSNFGRTSSSSFVTTRYYDEAPLDEYGLRREPKFGHLRDLHRALKLSKKPLLRGT  296

Query  1083  PTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKT  1259
             P ++++  + EI T+E  +  LC AFLTNN+T    +I FRG  YYLP  S S+LPDCKT
Sbjct  297   PKVERISQDLEITTYEKPSENLCVAFLTNNDTREAKTIHFRGKDYYLPSKSVSILPDCKT  356

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
              V+N+  IV+QH++R FV  + A     KWEMF+ETIPTI++L  +   P ELY+ TKD 
Sbjct  357   VVYNTAAIVAQHSSRNFVVPQQAKFS--KWEMFKETIPTINDLKDRTPAPKELYSFTKDV  414

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDYAWYST I+   RDL  R D+ P L + S+GHAL+AFVNGE++G +HG+N +K+   R
Sbjct  415   SDYAWYSTSIKIDARDLPMRPDVRPGLHIASLGHALLAFVNGEYIGFEHGSNVEKSHIFR  474

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             KPV+L  G+NDITLL +  GFPNSGA M+KRF GPR VT++GLM+GTL +T N+W   VG
Sbjct  475   KPVNLTAGDNDITLLAMTVGFPNSGAYMEKRFAGPRAVTLEGLMSGTLDITNNNWGQQVG  534

Query  1800  VSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
             V+GEK+ ++TEEG++ VKW P      PVTWYKTYFDAPEGNNPVALRM +MAKGMVWVN
Sbjct  535   VNGEKVPVYTEEGAKTVKWVPFAGTPSPVTWYKTYFDAPEGNNPVALRMMSMAKGMVWVN  594

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTI  2159
             G+SIGRYWV++ SPLG+P+Q EYHIPRAF+KPK+NL+VVFEE GG+P  I++++VNRDTI
Sbjct  595   GQSIGRYWVSYNSPLGRPTQEEYHIPRAFLKPKSNLLVVFEETGGNPEKIDILVVNRDTI  654

Query  2160  CSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             CS +++Y+P +V SWERKG ELR +V  +R    L CP++KV+KK+EF  +G+ DGACG 
Sbjct  655   CSVITEYHPPSVNSWERKGNELRALVNPVR-EAELTCPDNKVIKKVEFVGFGEVDGACGA  713

Query  2340  FIVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             F  G C S   A K+VE  CLGK++CKVP E+    +  KD CP+ V KTLA+Q  C
Sbjct  714   FKPGKCNSNSKAIKLVESLCLGKNECKVPFERERLVDVGKDACPD-VSKTLAIQIAC  769



>ref|XP_002306183.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
 gb|EEE86694.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
Length=838

 Score =   971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/798 (58%), Positives = 594/798 (74%), Gaps = 10/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMWP+++++AK GGLNVIQTYVFWNIHEP QG+FNFEG
Sbjct  38    LIINGKRELLFSGSIHYPRSTPEMWPELIQKAKRGGLNVIQTYVFWNIHEPEQGKFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + DLVKFIK IG+ GM  T+R+GPF++AEWN GG PYWL+E+P I FR+ N PF  HM++
Sbjct  98    SYDLVKFIKTIGENGMSATIRLGPFIQAEWNHGGLPYWLREIPDIIFRSDNAPFKLHMER  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  MI++ +K+ KLFA QGGPIILAQIENEY++++    A   +   Y+ WA +MA+GL 
Sbjct  158   FVTMIINKLKEEKLFASQGGPIILAQIENEYNTVQL---AYRNLGVSYVQWAGNMALGLK  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  +KPS+WTENWTAQ+R FGDPP+QR
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRHCGDTFTGPNSPDKPSLWTENWTAQFRVFGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+ A+S+ R+ + KNGS + YYMY+GGTN+ RT ASFVTTRYYDE PLDE+GL R+PK
Sbjct  275   SAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFDRTAASFVTTRYYDEAPLDEYGLQREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL+D H AL L K+ L  GTP +Q+L  + E   FE      CAAFL NNNT  P ++
Sbjct  334   WGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFEQPRTNDCAAFLANNNTKDPETV  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +YYLP  S S+LPDCKT V+N+  +VSQHN+R FV S+      L+W+MF ETIP
Sbjct  394   TFRGKKYYLPAKSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTD-GKLEWKMFSETIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +  NL + +  P ELY LTKD +DYAW++T I     DLS R DI PVL V S+GHA+VA
Sbjct  453   S--NLLVDSRIPRELYNLTKDKTDYAWFTTTINVDRNDLSARKDINPVLRVASLGHAMVA  510

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F+NGEF+GS HG+  +K+  L+  V LKPG N +TLLG L G P+SGA M+ R+ GPR V
Sbjct  511   FINGEFIGSAHGSQIEKSFVLQHSVKLKPGINFVTLLGSLVGLPDSGAYMEHRYAGPRGV  570

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  GTL ++ N W H V +SGE  K+FT+EG +KV W  V    PPVTWYKT FDA
Sbjct  571   SILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGRKVTWTKVNKDGPPVTWYKTRFDA  630

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+W+NGKSIGRYW+ ++SPLG+P+Q EYHIPR+++KP NNLMV
Sbjct  631   PEGKSPVAVRMTGMKKGMIWINGKSIGRYWMNYISPLGEPTQSEYHIPRSYLKPTNNLMV  690

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+G  P  IE++ VNRDTICS V++Y+P NV+SWERK ++   V +D +P+ RLKCP
Sbjct  691   ILEEEGASPEKIEILTVNRDTICSYVTEYHPPNVRSWERKNKKFTPVADDAKPAARLKCP  750

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++GDP G CGNF VG C  P + ++VE+ CLGK+ C +P++K LF  G 
Sbjct  751   NKKKIVAVQFASFGDPSGTCGNFAVGTCDSPISKQVVEQHCLGKTSCDIPMDKGLFN-GK  809

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             KD CPNL  K LAVQ KC
Sbjct  810   KDNCPNLT-KNLAVQVKC  826



>emb|CAC13966.1| putative beta-galactosidase [Nicotiana tabacum]
Length=715

 Score =   967 bits (2501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/680 (69%), Positives = 558/680 (82%), Gaps = 9/680 (1%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             ++G R++LF+GSIHYPRMPPEMWPD++++AKEGGLN+IQTYVFWNIHEPVQGQFNFEGN 
Sbjct  37    VNGERELLFSGSIHYPRMPPEMWPDIIRKAKEGGLNLIQTYVFWNIHEPVQGQFNFEGNY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             D+VKFIK IG+ G+YVTLR+GP++EAEWN GGFPYWL+EVP I FR+YNEPF++HMKK++
Sbjct  97    DVVKFIKTIGEQGLYVTLRIGPYIEAEWNQGGFPYWLREVPNITFRSYNEPFIHHMKKYS  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             EM++D+MKK KLFAPQGGPII+AQIENEY++++    A     KKY+ WAA+MA GLYN 
Sbjct  157   EMVIDLMKKEKLFAPQGGPIIMAQIENEYNNVQL---AYRDNGKKYVEWAANMATGLYNG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PWIMCKQ +AP +VI+TCNGR C DTF GPNG NKPS+WTENWTAQYRTFGDPP+QR+A
Sbjct  214   VPWIMCKQKDAPAQVINTCNGRHCADTFTGPNGPNKPSLWTENWTAQYRTFGDPPSQRAA  273

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E+IA+S+ RF A KNG+   YYMYYGGTNYGRT +SFVTTRYYDE PLDEFGLYR+PKWS
Sbjct  274   EDIAFSVARFFA-KNGTLTNYYMYYGGTNYGRTGSSFVTTRYYDEAPLDEFGLYREPKWS  332

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKF  1199
             HLRD H ALRLS+R L  GTP++QK+  + EI  +E      CAAFLTNN+TT P +IKF
Sbjct  333   HLRDLHRALRLSRRALLWGTPSVQKINQHLEITVYEKPGTD-CAAFLTNNHTTLPATIKF  391

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
             RG +YYLP  S S+LPDCK    N+Q IVSQHN+R F+PS+ A   +LKWEM+QE +PTI
Sbjct  392   RGREYYLPEKSVSILPDCKLLSTNTQTIVSQHNSRNFLPSEKA--KNLKWEMYQEKVPTI  449

Query  1380  DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFV  1559
              +L +KN  PLELY+LTKDTSDYAWYST I F   DL  R DILPVL + SMGHAL AFV
Sbjct  450   SDLSLKNREPLELYSLTKDTSDYAWYSTSINFDRHDLPMRPDILPVLQIASMGHALSAFV  509

Query  1560  NGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTI  1739
             NGEFVG  HGNN +K+   +KPV LKPG N I++L    GFPNSGA M+KRF GPR +T+
Sbjct  510   NGEFVGFGHGNNIEKSFVFQKPVILKPGTNTISILAETVGFPNSGAYMEKRFAGPRGITV  569

Query  1740  QGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYFDAP  1916
             QGLMAGTL +T N+W H VGV GEK +LFTEEG++KVKW PV       VTWYKTYFDAP
Sbjct  570   QGLMAGTLDITQNNWGHEVGVFGEKEQLFTEEGAKKVKWTPVNGPTKGAVTWYKTYFDAP  629

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
             EGNNPVAL+MD M KGM+WVNG S+GRYW +FLSPLGQP+Q EYHIPRAF+KP NNL+V+
Sbjct  630   EGNNPVALKMDKMQKGMMWVNGNSLGRYWSSFLSPLGQPTQFEYHIPRAFLKPTNNLLVI  689

Query  2097  FEEQGGDPSSIELVLVNRDT  2156
             FEE GG P +IE+ +VNRDT
Sbjct  690   FEETGGHPETIEVQIVNRDT  709



>gb|KGN43246.1| hypothetical protein Csa_7G011860 [Cucumis sativus]
Length=828

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/799 (58%), Positives = 595/799 (74%), Gaps = 14/799 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHY R  PEMW D+L +A+ GGLNVIQTYVFWNIHEPV+GQFNFEG
Sbjct  40    LIINGKRELLFSGSIHYTRSTPEMWSDILDKARRGGLNVIQTYVFWNIHEPVEGQFNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+IG+  MYVTLRVGPF++AEWN GG PYWL+E P I FR+YN  F ++MKK
Sbjct  100   NYDLVKFIKLIGEKQMYVTLRVGPFIQAEWNHGGLPYWLREKPNIIFRSYNSQFKHYMKK  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MIVDMMK+ KLFA QGGPI+LAQIENEY+ ++    A  ++  +Y+ WAA+MA+GL 
Sbjct  160   YVAMIVDMMKENKLFASQGGPIVLAQIENEYNHVQL---AYDELGVQYVQWAANMAVGLG  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  217   VGVPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNKPYKPALWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+A F TTRYYDE PLDEFGL R+PK
Sbjct  277   AAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSAVFTTTRYYDEAPLDEFGLQREPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H AL L K+PL  GTP IQ +    E   +E     +CAAFL NN+T +  +I
Sbjct  336   WGHLRDVHKALNLCKKPLLWGTPGIQVIGKGLEARFYEKPGTNICAAFLANNDTKSAQTI  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++ LP  S S+LPDCKT VFN++ IVSQHNAR F+PSK A +  LKW+M  E+IP
Sbjct  396   NFRGREFLLPPRSISILPDCKTVVFNTETIVSQHNARNFIPSKNANK--LKWKMSPESIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T++ +P+ N  PLELY+L KDT+DY WY+T IE  + D+S R DILPVL + S+GHA++ 
Sbjct  454   TVEQVPVNNKIPLELYSLLKDTTDYGWYTTSIELDKEDVSKRPDILPVLRIASLGHAMLV  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G+ HG++++K    +  V  K G N+I LLG+L G P+SGA M+ RF GPR +
Sbjct  514   FVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNNIALLGILVGLPDSGAYMEHRFAGPRSI  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TI GL  GTL ++ N W H V + GEK+K+FT+ GS +V W  +      +TWYKTYFDA
Sbjct  574   TILGLNTGTLDISKNGWGHQVALQGEKVKVFTQGGSHRVDWSEIKEEKSALTWYKTYFDA  633

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PVA+RM+ M KG +WVNGKSIGRYW+++LSPL   +Q EYHIPR+F+KP  NL+V
Sbjct  634   PEGNDPVAIRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLSTQSEYHIPRSFIKPSENLLV  693

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+   P  +E++LVNRDTICS ++ Y+P NVKSWERK ++ R VV+D++    L+CP
Sbjct  694   ILEEENVTPEKVEILLVNRDTICSFITQYHPPNVKSWERKDKQFRAVVDDVKTGAHLRCP  753

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
              DK +  IEFA++GDP G CGNF  G C S  +  K+VE+ CLGK  C VP++     + 
Sbjct  754   HDKKITNIEFASFGDPSGVCGNFEHGKCHSSSDTKKLVEQHCLGKENCSVPMDAF---DN  810

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
              K+ C +   KTLA+QAKC
Sbjct  811   FKNECDS---KTLAIQAKC  826



>ref|XP_002312963.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
 gb|EEE86918.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
Length=835

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/804 (57%), Positives = 595/804 (74%), Gaps = 11/804 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  P+MWP+++ +AK GGLNVIQTYVFWNIHEP QG+FNFEG
Sbjct  38    LIINGKRELLFSGSIHYPRSTPDMWPELILKAKRGGLNVIQTYVFWNIHEPEQGKFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK IG+ GM+ TLR+GPF++AEWN GG PYWL+E+P I FR+ N PF +HM+K
Sbjct  98    PYDLVKFIKTIGENGMFATLRLGPFIQAEWNHGGLPYWLREIPDIIFRSDNAPFKHHMEK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+DMMK+ KLFA QGGPIIL+QIENEY++++    A   +   YI WA +MA+GL 
Sbjct  158   FVTKIIDMMKEEKLFASQGGPIILSQIENEYNTVQL---AYKNLGVSYIQWAGNMALGLN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQ+R FGDPP+QR
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRHCGDTFTGPNKPNKPSLWTENWTAQFRVFGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+ A+S+ R+ + KNGS + YYMY+GGTN+ RT ASFVTTRYYDE PLDE+GL R+PK
Sbjct  275   SAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFDRTAASFVTTRYYDEAPLDEYGLQREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HL+D H AL L K+ L  G P +QKL  + E   +E    K+CAAFL +NN+    ++
Sbjct  334   WGHLKDLHRALNLCKKALLWGNPNVQKLSADVEARFYEQPGTKVCAAFLASNNSKEAETV  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+  +VSQHN+R FV S+   +  L+W M+ ETIP
Sbjct  394   KFRGQEYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTNK--LEWNMYSETIP  451

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L + +  P ELY LTKD +DY W++T I    RD++ R  I PVL V S+GHA+VA
Sbjct  452   A--QLQVDSSLPKELYNLTKDKTDYVWFTTTINVDRRDMNERKRINPVLRVASLGHAMVA  509

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG+  +K+  L+  VDLKPG N +TLLG L G P+SGA M+ R+ GPR V
Sbjct  510   FVNGEFIGSAHGSQIEKSFVLQHSVDLKPGINFVTLLGTLVGLPDSGAYMEHRYAGPRGV  569

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  GTL +T N W H VG+SGE  KLFT+EG  KV W  V    PPVTWYKT+FDA
Sbjct  570   SILGLNTGTLDLTSNGWGHQVGLSGETAKLFTKEGGGKVTWTKVQKAGPPVTWYKTHFDA  629

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+W+NGKSIGRYW+ ++SPLG+P+Q EYHIPR+++KP +NLMV
Sbjct  630   PEGKSPVAVRMTGMNKGMIWINGKSIGRYWMTYVSPLGEPTQSEYHIPRSYLKPTDNLMV  689

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+  +P  IE++ VNRDTICS V++Y+P +VKSWERK  +   VV++ +P+  LKCP
Sbjct  690   IFEEEEANPEKIEILTVNRDTICSYVTEYHPPSVKSWERKNNKFTPVVDNAKPAAHLKCP  749

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++GDP G CG++ VG C    + ++VE+ CLGK+ C +P++K LF  G 
Sbjct  750   NQKKIIAVQFASFGDPLGTCGDYAVGTCHSLVSKQVVEEHCLGKTSCDIPIDKGLFA-GK  808

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAK  2525
             KD CP  + KTLAVQ KC  +  K
Sbjct  809   KDDCPG-ISKTLAVQVKCSTKDPK  831



>ref|XP_011046271.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=835

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/804 (58%), Positives = 596/804 (74%), Gaps = 11/804 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  P+MWP+++ +AK GGLNVIQTYVFWNIHEP QG+FNFEG
Sbjct  38    LIINGKRELLFSGSIHYPRSTPDMWPELILKAKRGGLNVIQTYVFWNIHEPEQGKFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK IG+ GM+ TLR+GPF++AEWN GG PYWL+E+P I FR+ N PF +HM+K
Sbjct  98    PYDLVKFIKTIGENGMFATLRLGPFIQAEWNHGGLPYWLREIPDIIFRSDNAPFKHHMEK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+DMMK+ KLFA QGGPIIL+QIENEY++++    A   +   YI WA +MA+GL 
Sbjct  158   FVTKIIDMMKEEKLFASQGGPIILSQIENEYNTVQL---AYKNLGVSYIQWAGNMALGLN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQ+R FGDPP+QR
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRHCGDTFTGPNKPNKPSLWTENWTAQFRVFGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+ A+S+ R+ + KNGS + YYMY+GGTN+GRT ASFVTTRYYDE PLDE+GL R+PK
Sbjct  275   SAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFGRTAASFVTTRYYDEAPLDEYGLQREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HL+D H AL L K+ L  G P +QKL  + E   +E    K+CAAFLT+NN+    ++
Sbjct  334   WGHLKDLHRALNLCKKALLWGNPNVQKLSADVEARFYEQPGTKVCAAFLTSNNSKEAETV  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +YYLP  S S+LPDCKT V+N+  +VSQHN+R FV S+   +  L+W+M+ ETIP
Sbjct  394   KFRGQEYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTNK--LEWKMYSETIP  451

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L + +  P ELY LTKD +DY W++T I    RD++ R  I PVL V S+GHA+VA
Sbjct  452   A--QLQVDSSLPKELYNLTKDKTDYVWFTTTINVDRRDMNERKRINPVLRVASLGHAMVA  509

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG+  +K+  L+  VDLKPG N +TLLG L G P+SGA M+ R+ GPR V
Sbjct  510   FVNGEFIGSAHGSQIEKSFVLQHSVDLKPGINFVTLLGTLVGLPDSGAYMEHRYAGPRGV  569

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  GTL +T N W H VG+SGE  KLFT+EG  KV W  V    PPVTWYKT+FDA
Sbjct  570   SILGLNTGTLDLTSNGWGHQVGLSGETAKLFTKEGGGKVTWTKVQKAGPPVTWYKTHFDA  629

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P G +PVA+RM  M KGM+W+NGKSIGRYW+ ++SPLG+P+Q EYHIPR+++KP +NLMV
Sbjct  630   PGGKSPVAVRMTGMNKGMIWINGKSIGRYWMTYVSPLGEPTQSEYHIPRSYLKPTDNLMV  689

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+  +P  IE+  VNRDTICS V++Y+P +VKSWERK  +   VV++ +P+  LKCP
Sbjct  690   IFEEEEANPEKIEIFTVNRDTICSYVTEYHPPSVKSWERKNNKFTPVVDNAKPAAHLKCP  749

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++GDP GACG + VG C    + ++VE+ CLGK+ C +P++K LF  G 
Sbjct  750   NQKKIIAVQFASFGDPLGACGGYAVGTCHSRVSKQVVEEHCLGKTSCDIPIDKGLFA-GK  808

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAK  2525
             KD CP  + KTLAVQ KC  +  K
Sbjct  809   KDDCPG-ISKTLAVQVKCSSKDPK  831



>ref|XP_008447961.1| PREDICTED: beta-galactosidase 13-like [Cucumis melo]
Length=828

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/799 (58%), Positives = 595/799 (74%), Gaps = 14/799 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHY R  PEMWPD+L +A+ GGLNVIQTYVFWNIHEPV+G+FNFEG
Sbjct  40    LIINGKRELLFSGSIHYTRSTPEMWPDILDKARRGGLNVIQTYVFWNIHEPVEGKFNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+I +  MYVTLRVGPF++AEWN GG PYWL+E P I FR+YN  F ++MKK
Sbjct  100   NYDLVKFIKLIAEKKMYVTLRVGPFIQAEWNHGGLPYWLREKPNIIFRSYNSQFKHYMKK  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MIVDMMK+ KLFA QGGPI+LAQIENEY+ ++    A  ++  +Y+ WAA+MA+GL 
Sbjct  160   YVTMIVDMMKENKLFASQGGPIVLAQIENEYNHVQL---AYDELGVQYVQWAANMAVGLG  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  217   AGVPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNKPYKPALWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+A F TTRYYDE PLDEFGL R+PK
Sbjct  277   AAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSAVFTTTRYYDEAPLDEFGLQREPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H AL L K+PL  GTP  Q +    E   +E     +CAAFL NN+T    +I
Sbjct  336   WGHLRDVHKALNLCKKPLLWGTPGTQVMGKGLEARFYEKPGTNICAAFLANNDTKNAQTI  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +Y LP  S S+LPDCKT VFN++ IVSQHNAR FVPSK+A  ++LKW+M  ETIP
Sbjct  396   NFRGREYLLPPRSISILPDCKTVVFNTETIVSQHNARNFVPSKVA--NNLKWKMSPETIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T+  +P+ N  PLELY+L KDT+DY WY+T IE  + D+S R DILPVL + S+GHA++ 
Sbjct  454   TVQQVPVNNKIPLELYSLLKDTTDYGWYTTSIELEKEDVSKRPDILPVLRIASLGHAILV  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G+ HG++++K    +  V  K G NDI LLGVL G P+SGA M+ RF GPR V
Sbjct  514   FVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNDIALLGVLVGLPDSGAYMEHRFAGPRSV  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TI GL  GTL ++ N W H VG+ GEK++++T+ GS +V W  +      +TWYKTYFDA
Sbjct  574   TILGLNTGTLDISKNGWGHQVGLQGEKVRVYTQGGSHRVDWSEIKEEKSALTWYKTYFDA  633

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PVA+RM+ M KG +WVNGKSIGRYW+++LSPL  P+Q EYHIPR+F+KP  NL+V
Sbjct  634   PEGNDPVAVRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLPTQSEYHIPRSFIKPSENLLV  693

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+   P  +E+++VNRDTICS ++ Y+P NVKSWERK ++ R VV+D++    L+CP
Sbjct  694   ILEEENFTPEKVEILVVNRDTICSFITQYHPPNVKSWERKDKQFRAVVDDVKTGAHLRCP  753

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
              +K +  IEFA++GDP G CGN+  G C S     K+VE+ CLGK  C VP++     + 
Sbjct  754   INKKMATIEFASFGDPSGVCGNYEHGKCHSSSETKKLVEQHCLGKENCSVPMDAF---DN  810

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
              K+ C +   KTLA+QAKC
Sbjct  811   FKNECES---KTLAIQAKC  826



>ref|XP_010266335.1| PREDICTED: beta-galactosidase 13-like [Nelumbo nucifera]
Length=831

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/809 (56%), Positives = 583/809 (72%), Gaps = 15/809 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
             F I+G R++ F+GS+HYPR+P  MWP++  ++K GGLN I+TYVFWN+HEP QG++NFEG
Sbjct  34    FIINGKRELFFSGSVHYPRVPVGMWPEIFNKSKHGGLNTIETYVFWNVHEPKQGKYNFEG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+I +M MY  LR+GPF++AEWN+GG PYWL+EVP I FRT NEP+  HM+K
Sbjct  94    NYDLVKFIKLIKEMDMYAVLRIGPFVQAEWNYGGLPYWLREVPNITFRTDNEPYKYHMQK  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGL  653
             F E+IV  MK  KLFA QGGPI+L+QIENEY++I+ + R A I     Y++WAA MA+GL
Sbjct  154   FTELIVKKMKDEKLFASQGGPIVLSQIENEYNTIQLAYREAGIS----YVHWAAKMAVGL  209

Query  654   YNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQ  833
                +PW+MCKQ EAP  VI++CNGR CGDTF GPN  NKP +WTENWTAQYR FGDPP+Q
Sbjct  210   NTGVPWVMCKQKEAPDPVINSCNGRNCGDTFIGPNKPNKPFIWTENWTAQYRVFGDPPSQ  269

Query  834   RSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDP  1013
             R+AE++A+++ RF + K      Y  + G     RT+A FVTTRYYDE PLDE+GL +DP
Sbjct  270   RAAEDLAFAVARFFSKKGTLNNYYMYHGGTNYG-RTSADFVTTRYYDEAPLDEYGLQKDP  328

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTS  1190
             KW HLRD HAALRL K+ L  GTP++QKL N  E   FEN   K+CAAFL NNNT  P +
Sbjct  329   KWGHLRDLHAALRLCKKALLWGTPSVQKLENGVEARIFENSESKVCAAFLCNNNTREPAT  388

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
              KFRG +YY P  S S+LPDCKT VFN+QN+VSQHN+R +  SK A ++ L+WEM+ E I
Sbjct  389   AKFRGKEYYFPPRSISILPDCKTVVFNTQNVVSQHNSRSYKISKRANKN-LEWEMYHEKI  447

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P ID  P+K   PLEL   TKD SDY WY+T+I+ +  DL  R DI PVL V + GH + 
Sbjct  448   PIIDESPVKYKNPLELMNQTKDRSDYLWYTTKIQLTRDDLPFRRDIHPVLQVSNFGHVMH  507

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F NGE+VGS HG++ +K+ + +KPV LKPG N I LLG+  GFP+SGA ++ R  G   
Sbjct  508   TFANGEYVGSGHGSHIEKSFTFQKPVPLKPGTNHIQLLGMTVGFPDSGAYLNIRLAGVHR  567

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V +QGL  GTL ++ N W H VGV GEK ++FT EG++KV WK        +TWYKTYFD
Sbjct  568   VAVQGLNTGTLDLSANGWGHQVGVDGEKNEIFTPEGTEKVSWKEAKGGGHALTWYKTYFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEG+NPVAL + +M KGMVWVNGKSIGRYWV + SPLG+P+Q EYH+PR F+KP  NL+
Sbjct  628   APEGDNPVALNLTSMGKGMVWVNGKSIGRYWVDYKSPLGKPTQSEYHVPRVFLKPSGNLL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VV EE GG+P  I+++ VNRDTICS +++++  NV+SW+R+  ++R VV D  P   LKC
Sbjct  688   VVLEEMGGNPEEIKILTVNRDTICSIITEHHSANVQSWQRENGKIRAVVGDTNPKAHLKC  747

Query  2271  PEDKVVKKIEFANYGD-PDGACGNFIVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             P  KV+  ++FA +G+ P GACG F  GNC S   A K+VE+ CLGK+ C +PV++  F 
Sbjct  748   PNHKVIVNVDFATFGNVPTGACGAFTPGNCTSSSEAKKVVEQYCLGKTTCDIPVDQKTFG  807

Query  2445  EGSKDLCPNLVHKTLAVQAKCGLRHAKDD  2531
              G  D CP +  K+LAVQ  C     KDD
Sbjct  808   GGKGDECPGI--KSLAVQVHCA---GKDD  831



>ref|XP_011046693.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=838

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/798 (58%), Positives = 586/798 (73%), Gaps = 10/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMWP+++++AK GGLNVIQTYVFWNIHEP QG+FNFEG
Sbjct  38    LIINGKRELLFSGSIHYPRSTPEMWPELIQKAKRGGLNVIQTYVFWNIHEPEQGKFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK IG+ GM  T+R+GPF++AEWN GG PYWL+E+P I FR+ N PF  HM++
Sbjct  98    PYDLVKFIKTIGENGMSATIRLGPFIQAEWNHGGLPYWLREIPDIIFRSDNAPFKLHMER  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  MI++ MK+ KLFA QGGPIILAQIENEY++++    A   +   Y+ WA +MA+GL 
Sbjct  158   FVTMIINKMKEEKLFASQGGPIILAQIENEYNTVQL---AYRNLGVSYVQWAGNMALGLK  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  +KPS+WTENWTAQ+R FGDPP+QR
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRHCGDTFTGPNSPDKPSLWTENWTAQFRVFGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+ A+S+ R+ + KNGS + YYMY+GGTN+ RT ASFVTTRYYDE PLDE+GL R+PK
Sbjct  275   SAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFDRTAASFVTTRYYDEAPLDEYGLQREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL+D H AL L K+ L  GTP +Q+L  + E   F+      CAAFL NNNT  P ++
Sbjct  334   WGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFQQPGTNDCAAFLANNNTKDPETV  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +YYLP  S S+LPDCKT V+N+  +VSQHN+R FV S+      L+W+MF ETIP
Sbjct  394   TFRGKKYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTD-GKLEWKMFSETIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +  NL + +  P ELY LTKD +DYAW++T I     DLS R DI PVL V S+GHA+VA
Sbjct  453   S--NLLVDSRIPRELYNLTKDRTDYAWFTTTINVDRNDLSARKDINPVLRVASLGHAMVA  510

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F+NGEF+GS HG+  +K+  L+    LKPG N +TLLG L G P+SGA M+ R+ GPR V
Sbjct  511   FINGEFIGSAHGSQIEKSFVLQHSAKLKPGINFVTLLGSLVGLPDSGAYMEHRYAGPRGV  570

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  GTL ++ N W H V +SGE  K+FT+EG  KV W  V    PPVTWYKT FDA
Sbjct  571   SILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGSKVTWTKVNKDGPPVTWYKTRFDA  630

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KG +W+NGKSIGRYW+ ++SPLG+P+Q EYHIPR  +KP NNLMV
Sbjct  631   PEGKSPVAVRMTGMKKGTIWINGKSIGRYWMNYISPLGEPTQSEYHIPRYSLKPTNNLMV  690

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+   P  IE++ VNRDTICS V++++P NV+SWERK  +   V +D +P+ RLKCP
Sbjct  691   ILEEEEASPEKIEILTVNRDTICSYVTEHHPPNVRSWERKNSKFTPVADDAKPAARLKCP  750

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++GDP G CGNF VG C  P + ++VE+ CLGK+ C +P++K LF  G 
Sbjct  751   NKKKIVTVQFASFGDPSGTCGNFAVGTCDSPISKQVVEQHCLGKTICDIPMDKGLFN-GK  809

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             KD CPNL  K LAVQ KC
Sbjct  810   KDNCPNLT-KNLAVQVKC  826



>gb|KCW56611.1| hypothetical protein EUGRSUZ_I02332, partial [Eucalyptus grandis]
Length=823

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/795 (57%), Positives = 596/795 (75%), Gaps = 8/795 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G+R++LF+GSIHYPR  PEMW D+L +AK+GGLNVIQTYVFWN+HEPVQGQ+NF G
Sbjct  36    LIINGSRELLFSGSIHYPRSTPEMWGDILHKAKKGGLNVIQTYVFWNVHEPVQGQYNFNG  95

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIKMIG +GMY TLRVGPF+EAEWNFGGFPYWL+EVP I FRT NEPF  HMKK
Sbjct  96    NYDLVKFIKMIGKLGMYATLRVGPFIEAEWNFGGFPYWLREVPNITFRTDNEPFKYHMKK  155

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F ++I+  MK  KLFA QGGPIIL+QIENEY++++    A   +  +YI WA  MA+GL 
Sbjct  156   FTKVIIKKMKDEKLFASQGGPIILSQIENEYTNVQL---AYKMLGTRYIQWAGKMAVGLK  212

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MC Q +AP  VI+ CNGR CGDTF GPN  NKP +WTENWTAQYR FGDPP+QR
Sbjct  213   TGVPWVMCMQKDAPDPVINACNGRNCGDTFTGPNSPNKPRLWTENWTAQYRVFGDPPSQR  272

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE++AYS+ RF + KNG+   YYMYYGGTN+GRT +SFVTTRYYDE P+DE+GL R+PK
Sbjct  273   SAEDLAYSVARFFS-KNGTLANYYMYYGGTNFGRTPSSFVTTRYYDEAPIDEYGLLREPK  331

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H+ALRL K+ L  GTPT+Q L    E   +E     +CAAFL+NN+T  P  +
Sbjct  332   WGHLRDLHSALRLCKKALLWGTPTVQNLGEGLEAQVYEKPGTGICAAFLSNNSTRLPRQV  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+G +YYLP  S S+L DCKT V+N+  +VSQH++R++  S++A ++ L+WEM+++ IP
Sbjct  392   MFKGIEYYLPQRSISILVDCKTVVYNTGTVVSQHSSRKYHQSEIANKN-LRWEMWRDNIP  450

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T  + PIK+  PLEL + TKDT+DY WY+T I+    DL  R DI+PVL V ++GH + A
Sbjct  451   TTSDAPIKSKSPLELMSTTKDTTDYLWYATSIKLYPTDLPFRKDIIPVLQVANLGHLMHA  510

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++GS HG+N +K+  L+KP++LKPG N+I+LL    G P+SGA M+ RF G   V
Sbjct  511   FVNGEYIGSGHGSNIEKSFVLQKPIELKPGLNNISLLSATVGLPDSGAYMEHRFAGVHKV  570

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             T++GL  GTL ++ N W+H VG+ GEKL ++ + GS +V+W        P+TWYK YFDA
Sbjct  571   TLKGLNTGTLDLSLNGWAHKVGLDGEKLHVYRQGGSHRVQWTKAKKHGQPLTWYKAYFDA  630

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PV +++  M+KGM WVNGKSIGRYW ++LSPL +PSQ  YH+PRAF+KP +NL+V
Sbjct  631   PEGNDPVVMQLGTMSKGMAWVNGKSIGRYWSSYLSPLERPSQDVYHVPRAFLKPTDNLLV  690

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE GG+P  ++++ V+RD +CS + +  P  VKSW+  G  +R V +D++P   L+CP
Sbjct  691   LLEEIGGNPEGVKILTVSRDVVCSFIHERDPVTVKSWKTNGGLIRTVADDMKPRAHLQCP  750

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             EDK + K+EFA+YG+P GACG++ VGNCS   + K+VE+ CLG+S+C V VE+  F +  
Sbjct  751   EDKKIVKVEFASYGNPFGACGSYGVGNCSAAKSQKVVEQRCLGRSKCSVKVERKNFDKAG  810

Query  2454  KDLCPNLVHKTLAVQ  2498
               LCP+++ K LAVQ
Sbjct  811   -SLCPDVL-KMLAVQ  823



>ref|XP_010066272.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=768

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/775 (59%), Positives = 590/775 (76%), Gaps = 9/775 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++ +AK GGLNVIQTYVFWN HEPVQGQFNFEGN DLVKFIKMIG+  MYVTLRVG
Sbjct  1     MWPDLISKAKHGGLNVIQTYVFWNAHEPVQGQFNFEGNYDLVKFIKMIGEHDMYVTLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EV  I FR  NEPF  HM+KF   I+DMMK+ KLFA QGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVKNITFRADNEPFKYHMQKFVRKIIDMMKEEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+ ++    A  ++  +Y+ WA +MA+GL   +PWIMCKQ +AP  VI+TCNG
Sbjct  121   LAQIENEYNHVQL---AYKELGTRYVQWAGNMALGLNIGVPWIMCKQKDAPGPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  NKP +WTENWTAQYR FGDPP+QRS E+IA+S+ RF A KNGS   Y
Sbjct  178   RHCGDTFTGPNSPNKPILWTENWTAQYRVFGDPPSQRSVEDIAFSVARFFA-KNGSLANY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PKWSHLRD H AL L ++PL  G P
Sbjct  237   YMYHGGTNFGRTSAVFTTTRYYDEAPLDEYGLQREPKWSHLRDVHKALSLCRKPLLWGNP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSI-KFRGTQYYLPGFSTSVLPDCKTA  1262
             ++Q+L  + E +TFE    K+CAAFLTNN+T    + +FRG  +YLP  S S+LPDCKT 
Sbjct  297   SVQRLGADIEALTFEIPGTKVCAAFLTNNHTKIAQVAEFRGESFYLPPHSISILPDCKTL  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+N+Q IVSQHNAR F  SK+   D+LKWEM +E IP    +P+ +  P E Y LTKDT+
Sbjct  357   VYNTQTIVSQHNARNFRRSKVT--DNLKWEMSREAIPDTAKVPVDSKIPAEHYKLTKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DYAW++T I+ S RDL  R +ILPVL + S+GHA+  FVNGE++G+ HG++ +K+   +K
Sbjct  415   DYAWFTTSIKISPRDLPRRTEILPVLRIASLGHAMQVFVNGEYIGTAHGSHIEKSFVFQK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
              V+LKPG N I+LLG+  G P+SGA M+ +F GPR VTI GL  GTL +T N W H VG+
Sbjct  475   AVNLKPGTNYISLLGMTIGLPDSGAYMEHKFAGPRLVTILGLNTGTLDLTLNGWGHKVGL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
              GEK++ +T+ GS +V+WK    V P +TWYK YF APEG+ P+A+R+ N+ KGM+WVNG
Sbjct  535   DGEKVRAYTQAGSHRVQWKKANGVGPALTWYKAYFHAPEGDGPLAIRLPNLGKGMIWVNG  594

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             KSIGR+W ++L+PL QPSQ EYHIPR+F+KP +NLMVV +E+GG+P SIE++ V+RDTIC
Sbjct  595   KSIGRFWNSYLTPLLQPSQSEYHIPRSFIKPSDNLMVVLDEEGGNPQSIEILTVDRDTIC  654

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             S +S+ +P +VKSW RK   +R VV++++P+  LKC   K +  IEFA++GDPDG CG+F
Sbjct  655   SFISENHPPHVKSWARKNSHIRPVVDNVKPTANLKCSNHKKIVAIEFASFGDPDGICGSF  714

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              +G C+   + K+VE+ CLGK+ C+VP++++LF + +   CP+++ KTLA+QA+C
Sbjct  715   SLGKCTSSISKKVVEQYCLGKTSCQVPIDRALFDKNNNG-CPDIM-KTLAIQARC  767



>ref|XP_006590856.1| PREDICTED: beta-galactosidase 13-like isoform X1 [Glycine max]
 gb|KHN39877.1| Beta-galactosidase 13 [Glycine soja]
Length=842

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/798 (57%), Positives = 584/798 (73%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PE W  +L +A++GG+NV+QTYVFWNIHE  +G+++ E 
Sbjct  52    LIINGRRELLFSGSIHYPRSTPEEWAGILDKARQGGINVVQTYVFWNIHETEKGKYSIEP  111

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D +KFIK+I   GMYVTLRVGPF++AEWN GG PYWL+EVP+I FR+ NEPF  HMKK
Sbjct  112   QYDYIKFIKLIQKKGMYVTLRVGPFIQAEWNHGGLPYWLREVPEIIFRSNNEPFKKHMKK  171

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++  +K A LFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA MA+ L 
Sbjct  172   YVSTVIKTVKDANLFAPQGGPIILAQIENEYNHIQR---AFREEGDNYVQWAAKMAVSLD  228

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  229   IGVPWIMCKQTDAPDPVINACNGRHCGDTFSGPNKPYKPAIWTENWTAQYRVFGDPPSQR  288

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TTRYYDE PLDE+G+ R+PK
Sbjct  289   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEYGMQREPK  347

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L KR LF G  T+ K+  + E+I FE     LCAAF+TNN+T  PT+I
Sbjct  348   WSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSNLCAAFITNNHTKVPTTI  407

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT YY+P  S S+LPDCKT VFN+Q I SQH++R F  S  A  +D KWE++ ETIP
Sbjct  408   SFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSMAA--NDHKWEVYSETIP  465

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P     P+ELY+L KDTSDYAWY+T +E    DL  + DI  +L + S+GH+L+A
Sbjct  466   TTKQIPTHEKNPIELYSLLKDTSDYAWYTTSVELRPEDLPKKNDIPTILRIMSLGHSLLA  525

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG++++K    +KPV LK G N I +L    G P+SGA M+ RF GP+ +
Sbjct  526   FVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPDSGAYMEHRFAGPKSI  585

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL +G + +T N W H VG+ GEKL +FTEEGS+KV+WK      P V+WYKT F  
Sbjct  586   FILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAKGPGPAVSWYKTNFAT  645

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGMVW+NGKSIGR+W+++LSPLGQP+Q EYHIPR +  PK+NL+V
Sbjct  646   PEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQSEYHIPRTYFNPKDNLLV  705

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+  +P  +E++ VNRDTICS V++ +P NVKSW  K E+ + VV D+ PS  LKCP
Sbjct  706   VFEEEIANPEKVEILTVNRDTICSFVTENHPPNVKSWAIKSEKFQAVVNDLVPSASLKCP  765

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +K +EFA++GDP GACG F +G C+ P   +IVEK CLGK+ C VP++K  F +G 
Sbjct  766   HQRTIKAVEFASFGDPAGACGAFALGKCNAPAIKQIVEKQCLGKASCLVPIDKDAFTKG-  824

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             +D CPN V K LA+Q +C
Sbjct  825   QDACPN-VTKALAIQVRC  841



>gb|KDO71286.1| hypothetical protein CISIN_1g045037mg [Citrus sinensis]
Length=832

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/799 (56%), Positives = 605/799 (76%), Gaps = 8/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPRMPPEMW D+LK+AK GGLNVIQTYVFWNIHEP +GQFNFEG
Sbjct  38    LIINGKRELFFSGSIHYPRMPPEMWWDILKKAKAGGLNVIQTYVFWNIHEPEKGQFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N +L KFIKMIGD+GMY TLRVGPF+EAEWN+GGFP+WL+EVP I FR+ N PF  HMK+
Sbjct  98    NYNLTKFIKMIGDLGMYATLRVGPFIEAEWNYGGFPFWLREVPNITFRSDNPPFKYHMKE  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F +MI+DMMK A+L+A QGGPIIL+Q+ENEY++I+    A  ++  +Y++WA  MA+ L 
Sbjct  158   FTKMIIDMMKDAQLYASQGGPIILSQVENEYNTIQL---AFRELGTRYVHWAGTMAVRLN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  +KP +WTENWTA+YR FGDPP++R
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRNCGDTFTGPNKPSKPVLWTENWTARYRVFGDPPSRR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAEN+A+S+ RF + KNG+   YYMYYGGTNYGR  +SFVTTRYYDE P+DE+G+ R+PK
Sbjct  275   SAENLAFSVARFFS-KNGTLANYYMYYGGTNYGRLGSSFVTTRYYDEAPIDEYGMLREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H+ALRL K+ L  G P+++    N E   +E    K C AFL+NN++ TP ++
Sbjct  334   WGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTKACVAFLSNNDSRTPATL  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG++YYLP +S S+LPDCKT V+N++ IV+QH++R +  SK A +D L+WEMF E IP
Sbjct  394   TFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSKAANKD-LRWEMFIEDIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T++   IK+  PLE +++TKDT+DY W++T I      L  R  +LPVL + S+GH +  
Sbjct  453   TLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREKVLPVLRIASLGHMMHG  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS HG N + +   +KP+ LKPG N I+LLGV  G P+SG  +++R+ G R V
Sbjct  513   FVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLPDSGVYLERRYAGTRTV  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL VT++ W   VG+ GEK +++T+EGS +VKW     +  P+TWYKTYFDA
Sbjct  573   AIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKTKGLGGPLTWYKTYFDA  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+P+A+ +  M+KGMVWVNGKSIGRYWV+FLSP G+PSQ  YHIPRAF+KPK+NL+ 
Sbjct  633   PEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQSVYHIPRAFLKPKDNLLA  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+   +++V VNR+TICS + +  P  V + +R+   +++V +D R S  L CP
Sbjct  693   IFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDIVIQKVFDDARRSATLMCP  752

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             +++ + ++EFA+YG+P GACGN+I+GNCS P++ +I+E+ CLGK++C +P ++++F    
Sbjct  753   DNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCLGKNRCAIPFDQNIFDR-E  811

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
             + LCPN V K LA+Q +CG
Sbjct  812   RKLCPN-VPKNLAIQVQCG  829



>ref|XP_006590857.1| PREDICTED: beta-galactosidase 13-like isoform X2 [Glycine max]
Length=814

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/798 (57%), Positives = 584/798 (73%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PE W  +L +A++GG+NV+QTYVFWNIHE  +G+++ E 
Sbjct  24    LIINGRRELLFSGSIHYPRSTPEEWAGILDKARQGGINVVQTYVFWNIHETEKGKYSIEP  83

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D +KFIK+I   GMYVTLRVGPF++AEWN GG PYWL+EVP+I FR+ NEPF  HMKK
Sbjct  84    QYDYIKFIKLIQKKGMYVTLRVGPFIQAEWNHGGLPYWLREVPEIIFRSNNEPFKKHMKK  143

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++  +K A LFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA MA+ L 
Sbjct  144   YVSTVIKTVKDANLFAPQGGPIILAQIENEYNHIQR---AFREEGDNYVQWAAKMAVSLD  200

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  201   IGVPWIMCKQTDAPDPVINACNGRHCGDTFSGPNKPYKPAIWTENWTAQYRVFGDPPSQR  260

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TTRYYDE PLDE+G+ R+PK
Sbjct  261   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEYGMQREPK  319

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L KR LF G  T+ K+  + E+I FE     LCAAF+TNN+T  PT+I
Sbjct  320   WSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSNLCAAFITNNHTKVPTTI  379

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT YY+P  S S+LPDCKT VFN+Q I SQH++R F  S  A  +D KWE++ ETIP
Sbjct  380   SFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSMAA--NDHKWEVYSETIP  437

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P     P+ELY+L KDTSDYAWY+T +E    DL  + DI  +L + S+GH+L+A
Sbjct  438   TTKQIPTHEKNPIELYSLLKDTSDYAWYTTSVELRPEDLPKKNDIPTILRIMSLGHSLLA  497

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG++++K    +KPV LK G N I +L    G P+SGA M+ RF GP+ +
Sbjct  498   FVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPDSGAYMEHRFAGPKSI  557

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL +G + +T N W H VG+ GEKL +FTEEGS+KV+WK      P V+WYKT F  
Sbjct  558   FILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAKGPGPAVSWYKTNFAT  617

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGMVW+NGKSIGR+W+++LSPLGQP+Q EYHIPR +  PK+NL+V
Sbjct  618   PEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQSEYHIPRTYFNPKDNLLV  677

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+  +P  +E++ VNRDTICS V++ +P NVKSW  K E+ + VV D+ PS  LKCP
Sbjct  678   VFEEEIANPEKVEILTVNRDTICSFVTENHPPNVKSWAIKSEKFQAVVNDLVPSASLKCP  737

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +K +EFA++GDP GACG F +G C+ P   +IVEK CLGK+ C VP++K  F +G 
Sbjct  738   HQRTIKAVEFASFGDPAGACGAFALGKCNAPAIKQIVEKQCLGKASCLVPIDKDAFTKG-  796

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             +D CPN V K LA+Q +C
Sbjct  797   QDACPN-VTKALAIQVRC  813



>ref|XP_007221604.1| hypothetical protein PRUPE_ppa026900mg [Prunus persica]
 gb|EMJ22803.1| hypothetical protein PRUPE_ppa026900mg [Prunus persica]
Length=837

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/801 (55%), Positives = 588/801 (73%), Gaps = 9/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+G+IHY R  PEMWPD++K+AK GGLN+I+TYVFWNIHEPVQGQ+NFEG
Sbjct  44    LIINGKRELLFSGAIHYTRSTPEMWPDLIKKAKHGGLNMIETYVFWNIHEPVQGQYNFEG  103

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLV+FI ++ +  MY T+R+GPF++AEWN GG PYWL+EVP + FR+ +E F  HM+K
Sbjct  104   NYDLVRFIMLVQEYKMYATIRLGPFIQAEWNHGGLPYWLREVPGVIFRSDSEAFKYHMEK  163

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++IV+ +K+AKLFAPQGGPI+LAQIENEY+ ++    A  ++   Y+ WAA MA+   
Sbjct  164   YVQLIVNKLKEAKLFAPQGGPIVLAQIENEYNMVQL---AYRELGNNYVRWAAAMAVQQN  220

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGRQCGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  221   IGVPWVMCKQKDAPDPVINTCNGRQCGDTFMGPNKPYKPTLWTENWTAQYRVFGDPPSQR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E+IA+++ RF + K      Y  + G     RT+A F TTRYYDE PLDE+GL RDPK
Sbjct  281   PVEDIAFAVARFFSKKGSLTNYYMYHGGTNFG-RTSAIFTTTRYYDEAPLDEYGLPRDPK  339

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             WSHLRD H ALRLS++ +  G P +QK+  + E+  +E     +CAAFLTNNN TT  ++
Sbjct  340   WSHLRDLHKALRLSRKSMLWGVPGVQKMSADTEVYFYEMPATDICAAFLTNNNLTTEATV  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG  YYLP  S S+LPDCKT VFN+Q IV+QHN+R FV S +A  ++ KW  + E IP
Sbjct  400   SWRGQDYYLPPHSVSILPDCKTIVFNTQTIVAQHNSRNFVRSTVA--NNHKWMKYAEPIP  457

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +P+ N  PLELYTL KDTSDYAWY+T +  + +DL  +  I PVL + S+GHAL  
Sbjct  458   STLQVPVNNPTPLELYTLLKDTSDYAWYTTSLALNPQDLPRKESIQPVLRIASLGHALHL  517

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G  HG++D+K+  L KPV  K G N ITLL +  G P+ GA M+ R+ GP  V
Sbjct  518   FVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPDGGAYMEHRYAGPNLV  577

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  GTL +T N W H VG++GEKL++FTEEGS++V+W         +TWYKTYFDA
Sbjct  578   IVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTKGSAQGLTWYKTYFDA  637

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGNNPVA+RM  M KGM+WVNGKSIGR+W++FLSPLG+P+Q EYHIPR+F+KP  NL+V
Sbjct  638   PEGNNPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGEPTQSEYHIPRSFIKPTQNLLV  697

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ G P  IE++ VNRDTICS +++Y+P NVKSW R+    R V++ IR S  +KCP
Sbjct  698   VLEEQPGKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSVFRPVLDVIRSSADIKCP  757

Query  2274  EDKVVKKIEFANYGD-PDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             ++K V  +EFA++GD P G+CG++++G C+ P + ++VE+ CLGKS C VP++++LF + 
Sbjct  758   DNKKVVAVEFASFGDPPAGSCGSYVLGKCNSPVSKEVVEQHCLGKSSCSVPIDRNLFFKN  817

Query  2451  SKDLCPNLVHKTLAVQAKCGL  2513
             + D CP  + KTLA Q KC +
Sbjct  818   TTDGCPG-IKKTLAFQVKCAI  837



>ref|XP_006467171.1| PREDICTED: beta-galactosidase 13-like [Citrus sinensis]
Length=832

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/799 (56%), Positives = 605/799 (76%), Gaps = 8/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPRMPPEMW D+LK+AK GGLNVIQTYVFWNIHEP +GQFNFEG
Sbjct  38    LIINGKRELFFSGSIHYPRMPPEMWWDILKKAKAGGLNVIQTYVFWNIHEPEKGQFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N +L KFIKMIGD+GMY TLRVGPF+EAEWN+GGFP+WL+EVP I FR+ N PF  HMK+
Sbjct  98    NYNLTKFIKMIGDLGMYATLRVGPFIEAEWNYGGFPFWLREVPNITFRSDNPPFKYHMKE  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F +MI+DMMK A+L+A QGGPIIL+Q+ENEY++I+    A  ++  +Y++WA  MA+ L 
Sbjct  158   FTKMIIDMMKDAQLYASQGGPIILSQVENEYNTIQL---AFRELGTRYVHWAGTMAVRLN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  +KP +WTENWTA+YR FGDPP++R
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRNCGDTFTGPNKPSKPVLWTENWTARYRVFGDPPSRR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA+N+A+S+ RF + KNG+   YYMYYGGTNYGR+ +SFVTTRYYDE P+DE+G+ R+PK
Sbjct  275   SAQNLAFSVARFFS-KNGTLANYYMYYGGTNYGRSGSSFVTTRYYDEAPIDEYGMLREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H+ALRL K+ L  G P+++    N E   +E    K C AFL+NN++ TP ++
Sbjct  334   WGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTKACVAFLSNNDSRTPATL  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG++YYLP +S S+LPDCKT V+N++ IV+QH++R +  SK A +  L+WEMF E IP
Sbjct  394   TFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSKAANKA-LRWEMFIEDIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T++   IK+  PLE +++TKDT+DY W++T I      L  R  +LPVL + S+GH +  
Sbjct  453   TLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREKVLPVLRIASLGHMMHG  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS HG N + +   +KP+ LKPG N I+LLGV  G P+SG  +++R+ G R V
Sbjct  513   FVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLPDSGVYLERRYAGTRTV  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL VT++ W   VG+ GEK +++T+EGS +VKW     +  P+TWYKTYFDA
Sbjct  573   AIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKTKGLGGPLTWYKTYFDA  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+P+A+ +  M+KGMVWVNGKSIGRYWV+FLSP G+PSQ  YHIPRAF+KPK+NL+ 
Sbjct  633   PEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQSVYHIPRAFLKPKDNLLA  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+   +++V VNR+TICS + +  P  V + +R+   +++V +D R S  L CP
Sbjct  693   IFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDIVIQKVFDDARRSATLMCP  752

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             +++ + ++EFA+YG+P GACGN+I+GNCS P++ +I+E+ CLGK++C +P ++++F    
Sbjct  753   DNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCLGKNRCAIPFDQNIFDR-E  811

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
             + LCPN V K LA+Q +CG
Sbjct  812   RKLCPN-VPKNLAIQVQCG  829



>ref|XP_003607189.1| Beta-galactosidase [Medicago truncatula]
 gb|AES89386.1| beta-galactosidase-like protein [Medicago truncatula]
Length=825

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/799 (56%), Positives = 593/799 (74%), Gaps = 9/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG  ++ F+GSIHYPR  P+MWPD+L +A+ GGLN+IQTYVFWN HEP + + NFEG
Sbjct  35    LLLDGKGELFFSGSIHYPRSTPDMWPDILDKARRGGLNLIQTYVFWNGHEPEKDKVNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKF+K++ + GMYVTLR+GPF++AEWN GG PYWL+EVP I FR+ NEPF  +MK+
Sbjct  95    RYDLVKFLKLVQEKGMYVTLRIGPFIQAEWNHGGLPYWLREVPDIIFRSNNEPFKKYMKE  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  ++++ MK+ KLFAPQGGPIILAQIENEY+ I+    AD      Y+ WAA MA+ LY
Sbjct  155   YVSIVINRMKEEKLFAPQGGPIILAQIENEYNHIQLAYEAD---GDNYVQWAAKMAVSLY  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
             N +PW+MCKQ +AP  VI+ CNGR CGDTF GPN   KP +WTENWTAQYR FGDPP+QR
Sbjct  212   NGVPWVMCKQKDAPDPVINACNGRHCGDTFTGPNKPYKPFIWTENWTAQYRVFGDPPSQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K+GS + YYMY+GGTN+GRTT++F TTRYYDE PLDEFGL R+PK
Sbjct  272   SAEDIAFSVARFFS-KHGSLVNYYMYHGGTNFGRTTSAFTTTRYYDEAPLDEFGLQREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H A+ L K+ L  G PT QK+    E+I +E +   LCAAF+TNN+T T  ++
Sbjct  331   WSHLRDAHKAVNLCKKSLLNGVPTTQKISQYHEVIVYEKKESNLCAAFITNNHTQTAKTL  390

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG+ Y+LP  S S+LPDCKT VFN+QNI SQH++R F  SK    +D KWE+F E IP
Sbjct  391   SFRGSDYFLPPRSISILPDCKTVVFNTQNIASQHSSRHFEKSKTG--NDFKWEVFSEPIP  448

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   LP K   P ELY+L KD +DY WY+T +E    D+  + D+ PVL + S+GH+L A
Sbjct  449   SAKELPSKQKLPAELYSLLKDKTDYGWYTTSVELGPEDIPKKSDVAPVLRILSLGHSLQA  508

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++GSKHG++++K    +KPV+ K G N I +L  L G P+SGA M+ R+ GP+ +
Sbjct  509   FVNGEYIGSKHGSHEEKGFEFQKPVNFKVGVNQIAILANLVGLPDSGAYMEHRYAGPKTI  568

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TI GLM+GT+ +T N W H VG+ GE   +FTE+GS+KV+WK        ++WYKT FD 
Sbjct  569   TILGLMSGTIDLTSNGWGHQVGLQGENDSIFTEKGSKKVEWKDGKGKGSTISWYKTNFDT  628

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG NPVA+ M+ MAKGM+WVNG+SIGR+W+++LSPLG+P+Q EYHIPR+F+KPK+NL+V
Sbjct  629   PEGTNPVAIGMEGMAKGMIWVNGESIGRHWMSYLSPLGKPTQSEYHIPRSFLKPKDNLLV  688

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+   P  I ++ VNRDTICS +++ +P N++S+  K ++L +V E++ P   + CP
Sbjct  689   IFEEEAISPDKIAILTVNRDTICSFITENHPPNIRSFASKNQKLERVGENLTPEAFITCP  748

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             + K +  +EFA++GDP G CG+FI+G C+ P++ KIVE+ CLGK  C VP+ K+ F  G 
Sbjct  749   DQKKITAVEFASFGDPSGFCGSFIMGKCNAPSSKKIVEQLCLGKPTCSVPMVKATFT-GG  807

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D CP++V KTLA+Q KCG
Sbjct  808   NDGCPDVV-KTLAIQVKCG  825



>ref|XP_006425408.1| hypothetical protein CICLE_v10026929mg [Citrus clementina]
 gb|ESR38648.1| hypothetical protein CICLE_v10026929mg [Citrus clementina]
Length=832

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/799 (56%), Positives = 605/799 (76%), Gaps = 8/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPRMPPEMW D+LK+AK GGLNVIQTYVFWNIHEP +GQFNFEG
Sbjct  38    LIINGKRELFFSGSIHYPRMPPEMWWDILKKAKAGGLNVIQTYVFWNIHEPEKGQFNFEG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N +L KFIKMIGD+GMY TLRVGPF+EAEWN+GGFP+WL+EVP I FR+ N PF  HMKK
Sbjct  98    NYNLTKFIKMIGDLGMYATLRVGPFIEAEWNYGGFPFWLREVPNITFRSDNPPFKYHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F +MI+DMMK A+L+A QGGPIIL+Q+ENEY++I+    A  ++  +Y++WA  MA+ L 
Sbjct  158   FTKMIIDMMKDAQLYASQGGPIILSQVENEYNTIQL---AFRELGTRYVHWAGTMAVRLN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+TCNGR CGDTF GPN  +KP +WTENWTA+YR FGDPP++R
Sbjct  215   TGVPWVMCKQKDAPGPVINTCNGRNCGDTFTGPNKPSKPVLWTENWTARYRVFGDPPSRR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA+N+A+S+ RF + KNG+   YYMYYGGTNYGR+ +SFVTTRYYDE P+DE+G+ R+PK
Sbjct  275   SAQNLAFSVARFFS-KNGTLANYYMYYGGTNYGRSGSSFVTTRYYDEAPIDEYGMLREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HLRD H+ALRL K+ L  G P+++    N E   +E    K C AFL+NN++ TP ++
Sbjct  334   WGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTKACVAFLSNNDSRTPATL  393

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG++YYLP +S S+LPDCKT V+N++ IV+QH++R +  SK A +  L+WEMF E IP
Sbjct  394   TFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSKAANKA-LRWEMFIEDIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T++   IK+  PLE +++TKDT+DY W++T I      L  R ++LPVL + S+GH +  
Sbjct  453   TLNENLIKSASPLEQWSVTKDTTDYLWHTTGISLDGFHLPLRENVLPVLRIASLGHMMHG  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS HG N + +   +KP+ LKPG N I+LLGV  G P+SG  +++R+ G R V
Sbjct  513   FVNGHYIGSGHGTNIENSFVFQKPIILKPGINHISLLGVTIGLPDSGVYLERRYAGTRTV  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL VT++ W   VG+ GEK +++T+EGS +VKW     +  P+TWYKTYFDA
Sbjct  573   AIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKTKGLGGPLTWYKTYFDA  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+P+A+ +  M+KGMVWVNGKSIGRYWV+FLSP G+PSQ  YHIPRAF+KPK+NL+ 
Sbjct  633   PEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQSVYHIPRAFLKPKDNLLA  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+   +++V VNR+TICS + +  P  V + +R+   +++V +D R S  L CP
Sbjct  693   IFEEIGGNIDGVQIVTVNRNTICSYIKESDPTRVNNRKREDIVIQKVFDDARRSATLMCP  752

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             +++ + ++EFA+YG+P GACGN+I+GNCS P++ +I+E+ CLGK++C +P ++++F    
Sbjct  753   DNRKILRVEFASYGNPFGACGNYILGNCSAPSSKRIIEQYCLGKNRCAIPFDQNIFDR-E  811

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
             K LC N V K LA+Q +CG
Sbjct  812   KKLCLN-VPKNLAIQVQCG  829



>ref|XP_007224244.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
 gb|EMJ25443.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
Length=804

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/801 (55%), Positives = 586/801 (73%), Gaps = 9/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+G+IHY R  PEMWP ++K+AK GGLN+I+TYVFWNIHEPVQGQ+NFEG
Sbjct  11    LIINGKRELLFSGAIHYTRSTPEMWPYLIKKAKHGGLNMIETYVFWNIHEPVQGQYNFEG  70

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLV+FIK++ + GMY T+R+GPF++AEWN GG PYWL+EVP I FR+ N+ F  HM+K
Sbjct  71    NYDLVRFIKLVQEHGMYATIRLGPFIQAEWNHGGLPYWLREVPGIIFRSDNKAFKYHMEK  130

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++IV+ +K+AKLFAPQGGPI+LAQIENEY+ ++    A  ++   Y+ WAA MA+   
Sbjct  131   YVQLIVNKLKEAKLFAPQGGPIVLAQIENEYNMVQL---AYRELGSSYMRWAAAMAVQQN  187

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGRQCGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  188   IGVPWIMCKQKDAPDPVINTCNGRQCGDTFMGPNKPYKPTLWTENWTAQYRVFGDPPSQR  247

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               ++IA+++ RF + K      Y  + G     RT+A F TTRYYDE PLDE+GL RDPK
Sbjct  248   PVDDIAFAVARFFSKKGSLTNYYMYHGGTNFG-RTSAIFTTTRYYDEAPLDEYGLPRDPK  306

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             WSHL+D H ALRLS++ L  G P +QK+  N E+  +E     +CAAFLTNNN TT  ++
Sbjct  307   WSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATNICAAFLTNNNLTTEATV  366

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG  YYLP  S S+LPDCKT VFN+Q IV+QHN+R FV S +A  ++LKW+ + E IP
Sbjct  367   SWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVQSTVA--NNLKWKKYAEPIP  424

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +P+ N  PLELYTL KDTSDYAWY+T +  + +DL  +  I PVL + S+GHAL  
Sbjct  425   STLQVPVNNPTPLELYTLLKDTSDYAWYTTSLALNPQDLPRKASIQPVLRIASLGHALHL  484

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+++G  HG++D+K+  L KPV  K G N ITLL +  G P+ GA M+ R+ GP  +
Sbjct  485   FVNGKYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPDGGAYMEHRYAGPNLI  544

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  GTL +T N W H VG++GEKL++FTEEGS++V+W         +TWYKTYFDA
Sbjct  545   IVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTKGSAQGLTWYKTYFDA  604

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGNNPVA+RM  M KGM+WVNG+SIGR+W++FLSPLG+P+Q EYHIPR+F+KP  N++V
Sbjct  605   PEGNNPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQSEYHIPRSFIKPTQNILV  664

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ   P  IE++ VNRDTICS +++Y+P NVKSW R+    R V++ IR S  +KCP
Sbjct  665   VLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSVFRPVLDVIRSSADIKCP  724

Query  2274  EDKVVKKIEFANYGD-PDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
               K V  +EFA++GD P G CG++++G C+ P + ++VE+ CLGKS C VP+ ++LF + 
Sbjct  725   NKKKVVAVEFASFGDPPAGYCGSYVLGKCNSPVSKEVVEQHCLGKSSCSVPINRNLFLKN  784

Query  2451  SKDLCPNLVHKTLAVQAKCGL  2513
               D CP  + KTLA+Q KC +
Sbjct  785   ITDGCPG-IKKTLAIQVKCAI  804



>ref|XP_004505828.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=851

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/813 (56%), Positives = 592/813 (73%), Gaps = 23/813 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPR  P+MWP++L +A+ GGLN+IQTYVFWN+HE  +GQ +FEG
Sbjct  39    LIINGKRELFFSGSIHYPRSTPDMWPEILDKARHGGLNLIQTYVFWNVHEADKGQLSFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++ + GMYVTLRVGPF++AEWN GG PYWL+EVP I FR+ NEPF  HMK+
Sbjct  99    RYDLVKFIKLVQEKGMYVTLRVGPFIQAEWNHGGLPYWLREVPDIIFRSNNEPFKKHMKE  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V+ M++AKLFAPQGGPIILAQIENEY+ I+    AD      Y+ WAA MA+ L 
Sbjct  159   YVSSVVEKMREAKLFAPQGGPIILAQIENEYNHIQLAYEAD---GDNYVQWAAKMAISLD  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDPP+QR
Sbjct  216   VGVPWIMCKQKDAPDPVINACNGRHCGDTFTGPNKPYKPSIWTENWTAQYRVFGDPPSQR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TTRYYDE PLDEFGL RDPK
Sbjct  276   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEFGLQRDPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHL+D H AL L K+PL  G PT QK+    E+I +EN+   LCAAF+TNN+T    +I
Sbjct  335   WSHLKDVHKALSLCKKPLLNGEPTTQKISQFHEVIVYENKGSNLCAAFITNNHTKMAKTI  394

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +FRG+ YYLP  S S+LPDCKT VFN+QNI SQHN+R F  SK A  ++ KWE+F E IP
Sbjct  395   QFRGSNYYLPPRSISILPDCKTVVFNTQNIASQHNSRNFKQSKNA--NNHKWEVFTEPIP  452

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   LP     P ELY++ KDT+DY WY+T +E    DL  + +I PVL + S+GH+L+A
Sbjct  453   TTKELPPSKKVPAELYSMLKDTTDYGWYTTSVELGPEDLPKKNEISPVLRIMSLGHSLLA  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++GS HG++++K    +KPV  K G N I +LG L G P+SGA M+ R+ GP+ +
Sbjct  513   FVNGEYIGSNHGSHEEKGFEFQKPVSFKVGVNQIAILGSLVGLPDSGAYMEHRYAGPKTI  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TI GL +GT+ +T N W H VG+ GEK  +FTEEGS+KV+WK V    PP++WYKT F+ 
Sbjct  573   TILGLNSGTIGLTVNGWGHQVGLYGEKHSIFTEEGSKKVQWKEVKGHGPPLSWYKTNFET  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM--KPKNNL  2087
             PEG  PVA+++D M KGM+W+NG+S+GR+W+++LSPLG+P+Q EYHIPR+F   K KNNL
Sbjct  633   PEGKGPVAIKLDGMGKGMIWINGESVGRHWLSYLSPLGKPTQSEYHIPRSFFNAKSKNNL  692

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +V+ EE+   P  + + +VNRDT+CS +++ +P NV SW  K ++L  +V+++ P   LK
Sbjct  693   LVILEEEAASPEKVVIQIVNRDTVCSYITENHPPNVNSWASKDQKLTPIVDNLGPQASLK  752

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKA------------CLGKSQ  2411
             CP  K +  ++FA+YGDP G CG FI+G C  P + KIVE+             CLGK  
Sbjct  753   CPNHKTIIAVDFASYGDPLGFCGEFIMGKCHAPASKKIVEQVKLLFLYKQKNQHCLGKES  812

Query  2412  CKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCG  2510
             C VP+ K+ F  G +D CP+ V KTLA+Q +CG
Sbjct  813   CSVPMNKASFTNG-QDGCPD-VMKTLAIQVQCG  843



>ref|XP_008224548.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=826

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/801 (55%), Positives = 584/801 (73%), Gaps = 9/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+G+IHY R  PEMWP ++K+AK GGLN+I+TYVFWNIHEPVQGQ+NFEG
Sbjct  33    LIINGKRELLFSGAIHYTRSTPEMWPYLIKKAKHGGLNMIETYVFWNIHEPVQGQYNFEG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLV+FIK++ + GMY T+R+GPF++AEWN GG PYWL+EVP I FR+ N+ F  HM+K
Sbjct  93    NYDLVRFIKLVQEHGMYATIRLGPFIQAEWNHGGLPYWLREVPGIIFRSDNKAFKYHMEK  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++IV+ +K+AKLFAPQGGPI+LAQIENEY+ ++    A  ++   Y+ WAA MA+   
Sbjct  153   YVQLIVNKLKEAKLFAPQGGPIVLAQIENEYNMVQL---AYRELGSSYMRWAAAMAVQQN  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGRQCGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  210   IGVPWIMCKQKDAPDPVINTCNGRQCGDTFMGPNKPYKPTLWTENWTAQYRVFGDPPSQR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               ++IA+++ RF + K      Y  + G     RT+A F TTRYYDE PLDE+GL RDPK
Sbjct  270   PVDDIAFAVARFFSKKGSLTNYYMYHGGTNFG-RTSAIFTTTRYYDEAPLDEYGLRRDPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             WSHL+D H ALRLS++ L  G P +QK+  N E+  +E     +CAAFLTNNN TT  ++
Sbjct  329   WSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATNICAAFLTNNNLTTEATV  388

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG  YYLP  S S+LPDCKT VFN+Q IV+QHN+R FV S +A  ++LKW+ + E IP
Sbjct  389   SWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVRSTVA--NNLKWKKYAEPIP  446

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P+ N  PLELYTL KD+SDYAWY+T +  + +DL  +  I PVL + S+GHAL  
Sbjct  447   TSLQVPVNNPTPLELYTLLKDSSDYAWYTTSLALNPQDLPRKASIQPVLRIASLGHALHL  506

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G  HG++D+K+  L KPV  K G N ITLL +  G P+ GA M+ R+ GP  +
Sbjct  507   FVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPDGGAYMEHRYAGPNLI  566

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  GTL +T N W H VG++GEKL++FTEEGS++V+W         +TWYKTYFDA
Sbjct  567   IVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTKGSAQGLTWYKTYFDA  626

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN PVA+RM  M KGM+WVNG+SIGR+W++FLSPLG+P+Q EYHIPR+F+KP  N +V
Sbjct  627   PEGNKPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQSEYHIPRSFIKPTQNTLV  686

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ   P  IE++ VNRDTICS +++Y+P NVKSW R+    R V + IR S  +KCP
Sbjct  687   VLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSVFRPVSDVIRSSADIKCP  746

Query  2274  EDKVVKKIEFANYGD-PDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
               + V  +EFA++GD P G CG++++G C+ P + ++VE+ CLGKS C VP+ ++LF + 
Sbjct  747   NKRKVVAVEFASFGDPPAGYCGSYVLGKCNSPVSKEVVEQHCLGKSSCSVPINRNLFLKN  806

Query  2451  SKDLCPNLVHKTLAVQAKCGL  2513
               D CP+ + KTLA+Q KC +
Sbjct  807   ITDGCPD-IKKTLAIQVKCAI  826



>gb|KHN25472.1| Beta-galactosidase 13 [Glycine soja]
Length=854

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/798 (56%), Positives = 584/798 (73%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMW D+L++AK GG+ V+QTY+FWNIHEP +G+F+ E 
Sbjct  63    LIINGRRELLFSGSIHYPRSTPEMWADILEKAKHGGIKVVQTYIFWNIHEPEKGKFSIEP  122

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D +KF+K++   GMYVTLRVGPF++AEWN GG PYWL+E+P I FR+ NEPF  HMK+
Sbjct  123   QYDYIKFMKLVQKKGMYVTLRVGPFIQAEWNHGGLPYWLREIPDIIFRSNNEPFKKHMKE  182

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V  +K+AKLF PQGGPIILAQIENEY+ I+    A  +    Y+ WAA MA+ L 
Sbjct  183   YVSTVVKTLKEAKLFGPQGGPIILAQIENEYNHIQR---AFREEGDNYVQWAAKMAVSLD  239

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWT QYR FGDPP++R
Sbjct  240   VGVPWIMCKQRDAPDPVINACNGRHCGDTFAGPNKPYKPSLWTENWTVQYRVFGDPPSRR  299

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TT+YYDE PLDE+G+ R+PK
Sbjct  300   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTQYYDEAPLDEYGMQREPK  358

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L K+ LF G  T+ KL  + E I FE     LCAAFLTNN+T TP +I
Sbjct  359   WSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSDLCAAFLTNNHTLTPATI  418

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRGT YY+P  S S+LPDCKT VFN+Q I SQHN+R F  S  A  ++ KWE++ E IP
Sbjct  419   KFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSMAA--NNHKWEVYSENIP  476

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P     P ELY+L KDTSDYAWY+T +E    DL  + DI PVL + S+GH+LVA
Sbjct  477   TTKQIPTNEKIPTELYSLLKDTSDYAWYTTSVELGPEDLPKKNDISPVLRIMSLGHSLVA  536

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG++++K+   +KPV LK G N I +L    G P+SGA M+ RF GP+ +
Sbjct  537   FVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPDSGAYMEHRFAGPKSI  596

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL +G + +  N W H VG+ GE+L +FTEEGS+KV+WK      P ++WYKT F+ 
Sbjct  597   FILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAKGSGPALSWYKTNFET  656

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+W+NGKSIGR+W+++LSPLG P+Q EYHIPRAF  PK+NL+V
Sbjct  657   PEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQSEYHIPRAFFNPKDNLIV  716

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+  +P  +E++ V+RDTICS +++ +P NVKSW  K E+ + +  ++ P+  LKCP
Sbjct  717   VFEEEIANPEKVEILTVDRDTICSFITENHPPNVKSWAVKSEKFQALSNNLVPTATLKCP  776

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +K +EFA++GDP G CG + +G C+ P+  +IVEK CLGK  C VP++K  F +G 
Sbjct  777   NRRTIKAVEFASFGDPAGVCGAYTLGKCNAPSTKQIVEKHCLGKQSCNVPIDKDAFTKG-  835

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             +D C N+V KTLA+Q KC
Sbjct  836   QDACRNMV-KTLAIQVKC  852



>ref|XP_008224549.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=871

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/805 (54%), Positives = 587/805 (73%), Gaps = 9/805 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+G+IHY R  PEMWPD++K+AK GGLN+I+TYVFWNIHEPVQGQ+NFEG
Sbjct  40    LIINGKRELLFSGAIHYTRSTPEMWPDLIKKAKHGGLNMIETYVFWNIHEPVQGQYNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DL +FIK++ + GMY T+R+GPF++AEWN GG PYWL+EVP + FR+ +  F  HM+K
Sbjct  100   NYDLARFIKLVQEHGMYATIRLGPFIQAEWNHGGLPYWLREVPGVIFRSDSIAFKYHMEK  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++IV+ +K+AKLF+PQGGPI+LAQIENEY+ ++    A  ++   Y+ WAA MA+   
Sbjct  160   YVQLIVNKLKEAKLFSPQGGPIVLAQIENEYNMVQL---AYRELGNNYVRWAAAMAVQQN  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGRQCGDTF GPN   KP++WTENWTAQYR FGDPP+QR
Sbjct  217   IGVPWIMCKQKDAPDPVINTCNGRQCGDTFMGPNKPYKPTLWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E+IA+++ RF + K      Y  + G     RT+A F TTRYYDE PLDE+GL RDPK
Sbjct  277   PVEDIAFAVARFFSKKGSLTNYYMYHGGTNFG-RTSAIFTTTRYYDEAPLDEYGLPRDPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             WSHL+D H ALRLS++ +  G P +QK+  + E+  +E     +CAAFLTNNN TT  ++
Sbjct  336   WSHLKDLHKALRLSRKAMLWGVPGVQKMSADTEVYFYEMPATDICAAFLTNNNLTTEATV  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG  YYLP  S S+LPDCKT VFN+Q IV+QHN+R +V S +A  ++LKW    E IP
Sbjct  396   SWRGQDYYLPPHSVSILPDCKTIVFNTQTIVAQHNSRNYVRSTVA--NNLKWMKNAEPIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P+ N  PLELYTL KD+SDYAWY+T +  + +DL  +  I PVL + S+GHAL  
Sbjct  454   TTLQVPVNNSTPLELYTLLKDSSDYAWYTTSLALNPQDLPRKASIQPVLRIASLGHALHL  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G  HG++D+K+  L KPV  K G N ITLL +  G P+ GA M+ R+ GP  +
Sbjct  514   FVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPDGGAYMEHRYAGPNLI  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  GTL +T N W H VG++GEKL++FTEEGS++V+W         +TWYKTYFDA
Sbjct  574   IVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTKGSAQGLTWYKTYFDA  633

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGNNPVA+RM  M KGM+WVNGKSIGR+W++FLSPLG+P+Q EYHIPR+F+KP  NL+V
Sbjct  634   PEGNNPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGEPTQSEYHIPRSFIKPTQNLLV  693

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ   P  IE++ VNRDTICS +++Y+P NVKSW R+    R V++ IR S  +KCP
Sbjct  694   VLEEQPAKPKHIEILTVNRDTICSFITEYHPPNVKSWARQDSVFRPVLDVIRSSADIKCP  753

Query  2274  EDKVVKKIEFANYGD-PDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             ++K V  +EFA++G+ P G CG++++G C+ P + ++VE+ CLGKS C VP++++LF + 
Sbjct  754   DNKKVVAVEFASFGNPPAGLCGSYVLGKCNSPVSKEVVEQHCLGKSSCSVPIDRNLFFKN  813

Query  2451  SKDLCPNLVHKTLAVQAKCGLRHAK  2525
             + D CP  + KTLA Q +C  +  K
Sbjct  814   TTDGCPG-IKKTLAFQVRCDKQRGK  837



>ref|XP_010028723.1| PREDICTED: beta-galactosidase 13 [Eucalyptus grandis]
Length=770

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/777 (58%), Positives = 584/777 (75%), Gaps = 12/777 (2%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++++AK+GGLNVIQTYVFWN HEPVQGQ+NFEGN DLVKFIK+IG+  MYVTLRVG
Sbjct  1     MWPDLIRKAKQGGLNVIQTYVFWNAHEPVQGQYNFEGNYDLVKFIKLIGEHKMYVTLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EV  I FR+ N PF  HMKK+ +MI+  MK  KLFA QGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVQNITFRSDNPPFKYHMKKYVKMIIQKMKDEKLFASQGGPII  120

Query  546   LAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCN  722
             ++QIENEY+SI+ + R A  +    Y+ WA +MA+GL   +PWIMCKQ +AP  VI+ CN
Sbjct  121   ISQIENEYNSIQLAYRDAGTR----YVQWAGNMAVGLKTGVPWIMCKQKDAPDPVINACN  176

Query  723   GRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylg  902
             GR CGDTF GPN   KP++WTENWTAQYR FGDPP+QRSAE++A+S+ RF A KNG+   
Sbjct  177   GRHCGDTFTGPNKPYKPTLWTENWTAQYRVFGDPPSQRSAEDLAFSVARFFA-KNGTLTN  235

Query  903   yymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGT  1082
             YYMY+GGTN GRT+A F TTRYYDE PLDE+GL R+PKW HL+D H ALRL ++ L  G+
Sbjct  236   YYMYHGGTNLGRTSAVFTTTRYYDEAPLDEYGLQREPKWGHLKDLHKALRLCRKALLWGS  295

Query  1083  PTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIKFRGTQYYLPGFSTSVLPDCKT  1259
             P +Q+L  + E   +E    K+CAAFLTNN+T +   +KFRG +YYLP  S S+LPDCKT
Sbjct  296   PKVQRLSKDLEARYYEIPGTKVCAAFLTNNSTLSAQVVKFRGQEYYLPQHSISILPDCKT  355

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
              V+N+Q IVSQHN+R  V S+ A +  LKWEM  E IP  + +P+    P ELY+L KDT
Sbjct  356   VVYNTQRIVSQHNSRNLVKSEKANK--LKWEMSLEIIPDTNRVPVNAKIPAELYSLLKDT  413

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             +DYAW++T ++   RDL  R +I PVL V S+GHA++AFVNGEF+GS HG++ DK+  L+
Sbjct  414   TDYAWFTTSLDLGVRDLPMRKNIKPVLRVASLGHAMLAFVNGEFIGSAHGSHIDKSFVLQ  473

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             +P+DLKPG N I+LLG   G P+SGA M+ R+ GPR VTI GL  GTL +T N W H VG
Sbjct  474   QPIDLKPGVNHISLLGSTVGLPDSGAYMEHRYAGPRLVTILGLNTGTLDLTLNGWGHQVG  533

Query  1800  VSGEKLKLFTEEGSQKVKWKPVT-NVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWV  1976
             + GEK++++T+ GS + +W   T  V   +TWYKTYFDAPEG+ PVA+ +  M KGMVWV
Sbjct  534   LDGEKVRVYTQSGSHRAQWTEATKGVGRALTWYKTYFDAPEGDQPVAIHLPQMTKGMVWV  593

Query  1977  NGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDT  2156
             NGKSIGRYW  +LSPLGQPSQ EYHIPR+F+KP +NL+VV +E GG+P SIE++ V+RDT
Sbjct  594   NGKSIGRYWYTYLSPLGQPSQSEYHIPRSFIKPTDNLLVVLDEDGGNPESIEILNVDRDT  653

Query  2157  ICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACG  2336
             ICS +++ +P +VKSW RK      V+++++ +  LKCP  K +  IEFA++GDP G CG
Sbjct  654   ICSYITENHPPSVKSWARKNSHFITVLDEVKTAAHLKCPNHKKIVAIEFASFGDPYGICG  713

Query  2337  NFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             NF  GNC+ P +  IVEK CLGK+ C VP+E+ L  +G+ D CP+++ KTLA+QAKC
Sbjct  714   NFKYGNCTSPISKDIVEKHCLGKTSCAVPIERGLLDKGN-DGCPSIM-KTLAIQAKC  768



>ref|XP_006592069.1| PREDICTED: beta-galactosidase 13-like [Glycine max]
Length=843

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/798 (56%), Positives = 583/798 (73%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMW D+L++AK GG+ V+QTY+FWNIHEP +G+F+ E 
Sbjct  52    LIINGRRELLFSGSIHYPRSTPEMWADILEKAKHGGIKVVQTYIFWNIHEPEKGKFSIEP  111

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D +KF+K++   GMYVTLRVGPF++AEWN GG PYWL+E+P I FR+ NEPF  HMK+
Sbjct  112   QYDYIKFMKLVQKKGMYVTLRVGPFIQAEWNHGGLPYWLREIPDIIFRSNNEPFKKHMKE  171

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V  +K+AKLF PQGGPIILAQIENEY+ I+    A  +    Y+ WAA MA+ L 
Sbjct  172   YVSTVVKTLKEAKLFGPQGGPIILAQIENEYNHIQR---AFREEGDNYVQWAAKMAVSLD  228

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWT QYR FGDPP++R
Sbjct  229   VGVPWIMCKQRDAPDPVINACNGRHCGDTFAGPNKPYKPSLWTENWTVQYRVFGDPPSRR  288

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TT+YYDE PLDE+G+ R+PK
Sbjct  289   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTQYYDEAPLDEYGMQREPK  347

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L K+ LF G  T+ KL  + E I FE     LCAAFLTNN+T TP +I
Sbjct  348   WSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSDLCAAFLTNNHTLTPATI  407

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRGT YY+P  S S+LPDCKT VFN+Q I SQHN+R F  S  A  ++ KWE++ E IP
Sbjct  408   KFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSMAA--NNHKWEVYSENIP  465

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P     P ELY+L KDTSDYAWY+T +E    DL  + DI PVL + S+GH+LVA
Sbjct  466   TTKQIPTNEKIPTELYSLLKDTSDYAWYTTSVELGPEDLPKKNDISPVLRIMSLGHSLVA  525

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEF+GS HG++++K+   +KPV LK G N I +L    G P+SGA M+ RF GP+ +
Sbjct  526   FVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPDSGAYMEHRFAGPKSI  585

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL +G + +  N W H VG+ GE+L +FTEEGS+KV+WK      P ++WYKT F+ 
Sbjct  586   FILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAKGSGPALSWYKTNFET  645

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+W+NGKSIGR+W+++LSPLG P+Q EYHIPRAF  PK+NL+V
Sbjct  646   PEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQSEYHIPRAFFNPKDNLIV  705

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+  +P  +E++ V+RDTICS +++ +P NVKSW  K E+ + +  ++ P+  LKCP
Sbjct  706   VFEEEIANPEKVEILTVDRDTICSFITENHPPNVKSWAVKSEKFQALSNNLVPTATLKCP  765

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +K +EFA++GDP G CG + +G C+ P+  +IVEK CLGK  C VP++K  F +G 
Sbjct  766   NRRTIKAVEFASFGDPAGVCGAYTLGKCNAPSTKQIVEKHCLGKQSCNVPIDKDAFTKG-  824

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             +D C N+V K LA+Q KC
Sbjct  825   QDACRNMV-KALAIQVKC  841



>ref|XP_004144843.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
 ref|XP_004162905.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
Length=766

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/776 (58%), Positives = 578/776 (74%), Gaps = 14/776 (2%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MW D+L +A+ GGLNVIQTYVFWNIHEPV+GQFNFEGN DLVKFIK+IG+  MYVTLRVG
Sbjct  1     MWSDILDKARRGGLNVIQTYVFWNIHEPVEGQFNFEGNYDLVKFIKLIGEKQMYVTLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+E P I FR+YN  F ++MKK+  MIVDMMK+ KLFA QGGPI+
Sbjct  61    PFIQAEWNHGGLPYWLREKPNIIFRSYNSQFKHYMKKYVAMIVDMMKENKLFASQGGPIV  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+ ++    A  ++  +Y+ WAA+MA+GL   +PWIMCKQ +AP  VI+TCNG
Sbjct  121   LAQIENEYNHVQL---AYDELGVQYVQWAANMAVGLGVGVPWIMCKQKDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN   KP++WTENWTAQYR FGDPP+QR+AE+IA+S+ RF + KNGS + Y
Sbjct  178   RHCGDTFTGPNKPYKPALWTENWTAQYRVFGDPPSQRAAEDIAFSVARFFS-KNGSLVNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A F TTRYYDE PLDEFGL R+PKW HLRD H AL L K+PL  GTP
Sbjct  237   YMYHGGTNFGRTSAVFTTTRYYDEAPLDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
              IQ +    E   +E     +CAAFL NN+T +  +I FRG ++ LP  S S+LPDCKT 
Sbjct  297   GIQVIGKGLEARFYEKPGTNICAAFLANNDTKSAQTINFRGREFLLPPRSISILPDCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFN++ IVSQHNAR F+PSK A +  LKW+M  E+IPT++ +P+ N  PLELY+L KDT+
Sbjct  357   VFNTETIVSQHNARNFIPSKNANK--LKWKMSPESIPTVEQVPVNNKIPLELYSLLKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T IE  + D+S R DILPVL + S+GHA++ FVNGE++G+ HG++++K    + 
Sbjct  415   DYGWYTTSIELDKEDVSKRPDILPVLRIASLGHAMLVFVNGEYIGTAHGSHEEKNFVFQG  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
              V  K G N+I LLG+L G P+SGA M+ RF GPR +TI GL  GTL ++ N W H V +
Sbjct  475   SVPFKAGVNNIALLGILVGLPDSGAYMEHRFAGPRSITILGLNTGTLDISKNGWGHQVAL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
              GEK+K+FT+ GS +V W  +      +TWYKTYFDAPEGN+PVA+RM+ M KG +WVNG
Sbjct  535   QGEKVKVFTQGGSHRVDWSEIKEEKSALTWYKTYFDAPEGNDPVAIRMNGMGKGQIWVNG  594

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             KSIGRYW+++LSPL   +Q EYHIPR+F+KP  NL+V+ EE+   P  +E++LVNRDTIC
Sbjct  595   KSIGRYWMSYLSPLKLSTQSEYHIPRSFIKPSENLLVILEEENVTPEKVEILLVNRDTIC  654

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             S ++ Y+P NVKSWERK ++ R VV+D++    L+CP DK +  IEFA++GDP G CGNF
Sbjct  655   SFITQYHPPNVKSWERKDKQFRAVVDDVKTGAHLRCPHDKKITNIEFASFGDPSGVCGNF  714

Query  2343  IVGNC-SFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
               G C S  +  K+VE+ CLGK  C VP++     +  K+ C +   KTLA+QAKC
Sbjct  715   EHGKCHSSSDTKKLVEQHCLGKENCSVPMDAF---DNFKNECDS---KTLAIQAKC  764



>ref|XP_010029662.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=784

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/776 (57%), Positives = 580/776 (75%), Gaps = 8/776 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MW D+L +AK+GGLNVIQTYVFWN+HEPVQGQ+NF GN DLVKFIKMIG +GMY TLRVG
Sbjct  1     MWGDILHKAKKGGLNVIQTYVFWNVHEPVQGQYNFNGNYDLVKFIKMIGKLGMYATLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF+EAEWNFGGFPYWL+EVP I FRT NEPF  HMKKF ++I+  MK  KLFA QGGPII
Sbjct  61    PFIEAEWNFGGFPYWLREVPNITFRTDNEPFKYHMKKFTKVIIKKMKDEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L+QIENEY++++    A   +  +YI WA  MA+GL   +PW+MC Q +AP  VI+ CNG
Sbjct  121   LSQIENEYTNVQL---AYKMLGTRYIQWAGKMAVGLKTGVPWVMCMQKDAPDPVINACNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  NKP +WTENWTAQYR FGDPP+QRSAE++AYS+ RF + KNG+   Y
Sbjct  178   RNCGDTFTGPNSPNKPRLWTENWTAQYRVFGDPPSQRSAEDLAYSVARFFS-KNGTLANY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMYYGGTN+GRT +SFVTTRYYDE P+DE+GL R+PKW HLRD H+ALRL K+ L  GTP
Sbjct  237   YMYYGGTNFGRTPSSFVTTRYYDEAPIDEYGLLREPKWGHLRDLHSALRLCKKALLWGTP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
             T+Q L    E   +E     +CAAFL+NN+T  P  + F+G +YYLP  S S+L DCKT 
Sbjct  297   TVQNLGEGLEAQVYEKPGTGICAAFLSNNSTRLPRQVMFKGIEYYLPQRSISILVDCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+N+  +VSQH++R++  S++A ++ L+WEM+++ IPT  + PIK+  PLEL + TKDT+
Sbjct  357   VYNTGTVVSQHSSRKYHQSEIANKN-LRWEMWRDNIPTTSDAPIKSKSPLELMSTTKDTT  415

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T I+    DL  R DI+PVL V ++GH + AFVNGE++GS HG+N +K+  L+K
Sbjct  416   DYLWYATSIKLYPTDLPFRKDIIPVLQVANLGHLMHAFVNGEYIGSGHGSNIEKSFVLQK  475

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             P++LKPG N+I+LL    G P+SGA M+ RF G   VT++GL  GTL ++ N W+H VG+
Sbjct  476   PIELKPGLNNISLLSATVGLPDSGAYMEHRFAGVHKVTLKGLNTGTLDLSLNGWAHKVGL  535

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
              GEKL ++ + GS +V+W        P+TWYK YFDAPEGN+PV +++  M+KGM WVNG
Sbjct  536   DGEKLHVYRQGGSHRVQWTKAKKHGQPLTWYKAYFDAPEGNDPVVMQLGTMSKGMAWVNG  595

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             KSIGRYW ++LSPL +PSQ  YH+PRAF+KP +NL+V+ EE GG+P  ++++ V+RD +C
Sbjct  596   KSIGRYWSSYLSPLERPSQDVYHVPRAFLKPTDNLLVLLEEIGGNPEGVKILTVSRDVVC  655

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             S + +  P  VKSW+  G  +R V +D++P   L+CPEDK + K+EFA+YG+P GACG++
Sbjct  656   SFIHERDPVTVKSWKTNGGLIRTVADDMKPRAHLQCPEDKKIVKVEFASYGNPFGACGSY  715

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCG  2510
              VGNCS   + K+VE+ CLG+S+C V VE+  F +    LCP+++ K LAVQ +CG
Sbjct  716   GVGNCSAAKSQKVVEQRCLGRSKCSVKVERKNFDKAG-SLCPDVL-KMLAVQVRCG  769



>ref|XP_006422606.1| hypothetical protein CICLE_v10030124mg [Citrus clementina]
 gb|ESR35846.1| hypothetical protein CICLE_v10030124mg [Citrus clementina]
Length=832

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/803 (57%), Positives = 583/803 (73%), Gaps = 11/803 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+ILF+GSIHY R  P+MWPD++++AK GGLNVIQTYVFWNIHEPVQGQ+NF+G
Sbjct  38    LIINGKREILFSGSIHYTRSTPDMWPDLIQKAKRGGLNVIQTYVFWNIHEPVQGQYNFQG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIKMIG+ GMY +LR+GPF++AEWN GG PYWL+EV  I FR+ NEPF  HMKK
Sbjct  98    QYDLVKFIKMIGEHGMYASLRLGPFIQAEWNHGGLPYWLREVQNITFRSDNEPFKYHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+  MK  KLFA QGGPIIL QIENEYS+I+    A  +   KY+ W  ++A+G+ 
Sbjct  158   YVTMIIKKMKDEKLFASQGGPIILVQIENEYSTIQL---AYREKGNKYVQWTGNLAVGMN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQ+R +GDPP+QR
Sbjct  215   IGVPWVMCKQKDAPDPIINTCNGRYCGDTFTGPNKPNKPSLWTENWTAQFRVYGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E++A+S  RF + +NG+ + YYMY+GGTN+GRT+A+FVTTRYYDE PLDEFGL RDPK
Sbjct  275   SVEDLAFSTARFIS-RNGTLINYYMYHGGTNFGRTSANFVTTRYYDEAPLDEFGLQRDPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H AL+L K+ L  G P++QKL  + E I +E      CAAFL+NN+T    +I
Sbjct  334   WGHLKDLHRALKLCKKALLWGYPSVQKLGQDLEAIVYEGHGA--CAAFLSNNSTYMAKTI  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAG-RDDLKWEMFQETI  1370
              FRG  YYLP  S S+LPDC+T V+N+Q IVSQHN+R FVPS +A  R    WE + E+I
Sbjct  392   SFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPSVVANKRLSWDWETYTESI  451

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PT + L  K   PLEL+ LTKDT+DYAWYS  I     DL  R +  PVL V S+GHALV
Sbjct  452   PTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPMRANASPVLIVASLGHALV  511

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGE+VG+ HG++ DK+   RKP+ LK G N I +LG + GFP+SGA M+KRF GP  
Sbjct  512   AFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVVGFPDSGAYMEKRFAGPHR  571

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL  GTL +T N W+H VG+ GE+ K+FT  G  KVKW  +    P +TW+KTYFD
Sbjct  572   VEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKWTKIEGKRPALTWFKTYFD  631

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGN+P+A++M+ M KGM+W+NG+SIGRYW+++LSPLGQP+Q EYHIPR+++KP  NLM
Sbjct  632   APEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQPTQSEYHIPRSYLKPTGNLM  691

Query  2091  VVF-EEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+  EE+   P  I+ V+V+RDTICS +SD +P  V+SW  K         + + S  L 
Sbjct  692   VILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWGSKNNVSEYTANNRKASAVLT  751

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP+ KV+  ++FA+YGD  G CG +  GNC+  +  ++VE+ CLGK  C++P EK L   
Sbjct  752   CPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVERFCLGKHTCQIPFEKELLIR  811

Query  2448  GSKDLCPNLVHKTLAVQAKCGLR  2516
              + D CPN V K+LAVQ KCG +
Sbjct  812   -NWDPCPN-VKKSLAVQVKCGFK  832



>ref|XP_010941318.1| PREDICTED: beta-galactosidase 11-like isoform X1 [Elaeis guineensis]
Length=843

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/806 (56%), Positives = 577/806 (72%), Gaps = 11/806 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPR  PEMWPD++++AK GGLNVIQTYVFWN+HEPVQG FNF G
Sbjct  46    IMINGRRELFFSGSIHYPRSTPEMWPDLIQKAKRGGLNVIQTYVFWNVHEPVQGHFNFTG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK+I    MYVTLR+GPF++AEWN GGFPYWLKE+P I FRT NEPF  HM+ 
Sbjct  106   RYDLVRFIKLIHKHKMYVTLRLGPFIQAEWNHGGFPYWLKEIPGIVFRTDNEPFKYHMQN  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+DMMK  KLF PQGGPIILAQIENEY+ +E+    D     KY+ WAA++A+G  
Sbjct  166   FVTKIMDMMKSEKLFFPQGGPIILAQIENEYNMVEAAYRED---GLKYVQWAANLALGFN  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ  AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDPP+QR
Sbjct  223   AGIPWVMCKQKNAPGPVINACNGRNCGDTFTGPNSPTKPSIWTENWTAQYRVFGDPPSQR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS+ RF +N NG+ + YYMY+GGTN+GR  AS+V TRYYDE PLDE+GL ++PK
Sbjct  283   SAEDIAYSVARFFSN-NGALVNYYMYHGGTNFGREGASYVMTRYYDEAPLDEYGLPKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HLRD H AL+LS++ L  G P++Q L    E   +E+ + K+C AFLTN N  T  ++
Sbjct  342   YGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSKVCVAFLTNTNPRTDATV  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG  Y+LP  S S+LPDCKT +FN+Q + +QHN+R F  +    ++D KW MFQE IP
Sbjct  402   NFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAGETNKND-KWHMFQERIP  460

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                N  I + +PLELY +TKDT+DY WY+TR    + DL  R DI PVL V S+GHA+ A
Sbjct  461   KFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPDIRPVLLVSSLGHAMHA  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS +G   +K+   +KP++LK G N I++LG+  GFP++GA ++ R  G    
Sbjct  521   FVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFPDNGAYLEHRLAGIHTA  580

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL ++ N W H VG+ GEKL +FTEEGS+KV+W    N   PVTWYK YFD 
Sbjct  581   AIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQWTEAKN-DKPVTWYKRYFDM  639

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PVAL M  M KG+ WVNG  IGRYWV++LSPLG+PSQ  YHIPR ++KPK+NL+V
Sbjct  640   PRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHIPREWLKPKDNLLV  699

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG P  I +V V RD IC+ V++++P  +KS+ R+  E++ +V+D++P   LKC 
Sbjct  700   IFEEHGGKPEGILIVTVKRDNICTVVTEFHPPTIKSFSREDNEIKTLVQDVKPRAYLKCD  759

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             ++KV++ I FA++G+P GACGNF VG C  P A  +VEKACL K+ C +PV    +  G+
Sbjct  760   DNKVIRSIAFASFGNPTGACGNFTVGTCHSPQAASVVEKACLEKNSCVLPVSAQAY--GA  817

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
                CP     TL VQAKC  R  KDD
Sbjct  818   DPACPGTT-STLVVQAKCA-RKKKDD  841



>ref|XP_009374634.1| PREDICTED: beta-galactosidase 13-like [Pyrus x bretschneideri]
Length=769

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/777 (56%), Positives = 582/777 (75%), Gaps = 9/777 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD+L++AK GGLNVIQTYVFWNIHEPVQ Q+NFEGN DLVKFIK++   GMY T+R+G
Sbjct  1     MWPDILEKAKRGGLNVIQTYVFWNIHEPVQAQYNFEGNYDLVKFIKLVQKHGMYATIRLG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EVP I FR+ N  + +HMK + +MIV  ++ AKLFAPQGGPI+
Sbjct  61    PFIQAEWNHGGLPYWLREVPGIIFRSDNTAYKHHMKNYVDMIVKKLRDAKLFAPQGGPIV  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+ ++    A  ++   Y+ WAA++A+     +PWIMCKQ +AP  VI+TCNG
Sbjct  121   LAQIENEYNMVQL---AYRELGNNYVKWAAEIAVNQNIGVPWIMCKQKDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QRSAE+IA+S+ RF + KNG+   Y
Sbjct  178   RHCGDTFTGPNKPNKPSLWTENWTAQYRVFGDPPSQRSAEDIAFSVARFFS-KNGTLTNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT++ F TTRYYDE PLDE+GL RDPKWSHL+D H AL+LS++ L  G P
Sbjct  237   YMYHGGTNFGRTSSIFTTTRYYDEAPLDEYGLPRDPKWSHLKDLHKALKLSRKALLWGVP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
              +QK+  + E+  +E     +CAAFLTNNN  T   + +RG  Y+LP  S S+LPDCKT 
Sbjct  297   GVQKISKDIEVHFYETAATNICAAFLTNNNFQTEAIVNWRGVDYHLPPRSISILPDCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFN+Q +VSQ N+R FV SK+A  ++LKW  + E +P+   +P+ N  PLELY+L KDT+
Sbjct  357   VFNTQRVVSQLNSRNFVRSKVA--NNLKWTKYVEPVPSTLQVPVNNPTPLELYSLLKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DYAWY+T++  S +DL  +  I PVL + S+GHAL AFV+GE++G  HG++D+K+    K
Sbjct  415   DYAWYTTKLALSPQDLPMKESIRPVLRIASLGHALHAFVDGEYIGFAHGSHDEKSFVFEK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             PV LK G N I+LL +  G P+SGA M+ R+ GP  V + GL  GTL +T N W H +G+
Sbjct  475   PVPLKAGINQISLLAMTIGLPDSGAYMEHRYAGPNLVAVLGLNTGTLDLTRNGWGHQLGL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
             SGEKL++FTEEGS++V+W         +TWYKTYFDAPEG++P+A+RM  M KGM+WVNG
Sbjct  535   SGEKLQVFTEEGSKQVQWHKTKEAPEGLTWYKTYFDAPEGHDPIAIRMAGMGKGMIWVNG  594

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             KSIGR+W +FLSPLG+P+Q EYHIPR+F+KPK NL+VV EEQ   P  IE++ VNRDT+C
Sbjct  595   KSIGRHWTSFLSPLGEPTQAEYHIPRSFIKPKQNLLVVLEEQPAKPKPIEILTVNRDTVC  654

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             S +++Y+P NV SWERK    + V + ++ S  +KCP++K V  +EFA++GDP G CGNF
Sbjct  655   SFITEYHPPNVNSWERKDSVFQPVFDVVKSSADIKCPKNKKVVAVEFASFGDPAGTCGNF  714

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGL  2513
             ++G C+ P + ++VE+ CLGK+ C VP++++LF   + D CP+ + KTLA+Q KC +
Sbjct  715   VLGKCNSPVSKEVVERHCLGKTICSVPIDRNLFASKT-DGCPD-IKKTLAIQVKCAI  769



>gb|AAS76480.1| beta-galactosidase [Gossypium hirsutum]
Length=843

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/800 (57%), Positives = 582/800 (73%), Gaps = 14/800 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+G+IHYPR  P+MWPD++K+AK+GG+N I+TYVFWN HEPV+GQ+NFEG
Sbjct  56    LIINGKRELLFSGAIHYPRSTPDMWPDLIKKAKQGGINAIETYVFWNGHEPVEGQYNFEG  115

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I +  +Y  +RVGPF++AEWN GG PYWL+EVP I FR+ NEPF  HMK+
Sbjct  116   EFDLVKFIKLIHEHKLYAVVRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPFKKHMKR  175

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  +IVD +K+ KLFAPQGGPIILAQIENEY++I+    A  +    Y+ WA  +A+ L 
Sbjct  176   FVTLIVDKLKQEKLFAPQGGPIILAQIENEYNTIQR---AFREKGDSYVQWAGKLALSLN  232

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  +I+TCNGR CGDTF+GPN  NKP++WTENWTAQYR FGDPP+QR
Sbjct  233   ANVPWIMCKQRDAPDPIINTCNGRHCGDTFYGPNKRNKPALWTENWTAQYRVFGDPPSQR  292

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE++AYS+ RF + KNGS + YYM+YGGTN+GRT+ASF TTRYYDEGPLDEFGL R+PK
Sbjct  293   SAEDLAYSVARFFS-KNGSMVNYYMHYGGTNFGRTSASFTTTRYYDEGPLDEFGLQREPK  351

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H AL L KR LF G PT  KL  +Q+ I ++      CAAFL NNNT     +
Sbjct  352   WGHLKDVHRALSLCKRALFWGFPTTLKLGPDQQAIVWQQPGTSACAAFLANNNTRLAQHV  411

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG    LP  S SVLPDCKT VFN+Q + +QHN+R FV S++A + +  WEM +E  P
Sbjct  412   NFRGQDIRLPARSISVLPDCKTVVFNTQLVTTQHNSRNFVRSEIANK-NFNWEMCREVPP  470

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L  K   P EL+ LTKDT+DYAWY+T +    RDL  + ++ PVL V S+GH + A
Sbjct  471   V--GLGFKFDVPRELFHLTKDTTDYAWYTTSLLLGRRDLPMKKNVRPVLRVASLGHGIHA  528

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ GS HG+  +K+  L++ V LK G N I LLG L G P+SGA M+KRF GPR +
Sbjct  529   YVNGEYAGSAHGSKVEKSFVLQRAVSLKEGENHIALLGYLVGLPDSGAYMEKRFAGPRSI  588

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW-KPVTNVHPPVTWYKTYFD  1910
             TI GL  GTL ++ N W H VG+ GEK KLFTEEGS+ V+W KP  +   P+TWYK YFD
Sbjct  589   TILGLNTGTLDISQNGWGHQVGIDGEKKKLFTEEGSKSVQWTKP--DQGGPLTWYKGYFD  646

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEG+NPVA+ M  M KGMVWVNG+SIGRYW  +LSPL +P+Q EYHIPRA++KPK NL+
Sbjct  647   APEGDNPVAIVMTGMGKGMVWVNGRSIGRYWNNYLSPLKKPTQSEYHIPRAYLKPK-NLI  705

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+ EE+GG+P  + +V VNRDTICS+VS+ +P + + +E K   L+  V D++P   LKC
Sbjct  706   VLLEEEGGNPKDVHIVTVNRDTICSAVSEIHPPSPRLFETKNGSLQAKVNDLKPRAELKC  765

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P  K +  +EFA+YGDP GACG + +GNC+ P + ++VEK CLGK  C++P++   F   
Sbjct  766   PGKKQIVAVEFASYGDPFGACGAYFIGNCTAPESKQVVEKYCLGKPSCQIPLDSIPFSN-  824

Query  2451  SKDLCPNLVHKTLAVQAKCG  2510
               D C +L  KTLAVQ KC 
Sbjct  825   QNDACTHL-RKTLAVQLKCA  843



>ref|XP_006486854.1| PREDICTED: beta-galactosidase 13-like [Citrus sinensis]
Length=832

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/803 (56%), Positives = 583/803 (73%), Gaps = 11/803 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+ILF+GSIHY R  P+MWPD++++AK GGLNVIQTYVFWNIHEPVQGQ+NF+G
Sbjct  38    LIINGKREILFSGSIHYTRSTPDMWPDLIQKAKRGGLNVIQTYVFWNIHEPVQGQYNFQG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIKMIG+ GMY +LR+GPF++AEWN GG PYWL+EV  I FR+ NEPF  HMKK
Sbjct  98    QYDLVKFIKMIGEHGMYASLRLGPFIQAEWNHGGLPYWLREVQNITFRSDNEPFKYHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+  MK  KLFA QGGPIIL QIENEYS+I+    A  +   KY+ W  ++A+G+ 
Sbjct  158   YVTMIIKKMKNEKLFASQGGPIILVQIENEYSTIQL---AYREKGNKYVQWTGNLAVGMN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQ+R +GDPP+QR
Sbjct  215   IGVPWVMCKQKDAPDPIINTCNGRYCGDTFTGPNKPNKPSLWTENWTAQFRVYGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E++A+S  RF + +NG+ + YYMY+GGTN+GRT+A+FVTTRYYDE PLDEFGL R+PK
Sbjct  275   SVEDLAFSTARFIS-RNGTLINYYMYHGGTNFGRTSANFVTTRYYDEAPLDEFGLQREPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H AL+L K+ L  G P+++KL  + E I +E      CAAFL+NN+T    +I
Sbjct  334   WGHLKDLHRALKLCKKALLWGYPSVKKLGQDLEAIVYEGHGA--CAAFLSNNSTYMEKTI  391

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAG-RDDLKWEMFQETI  1370
              FRG  YYLP  S S+LPDC+T V+N+Q IVSQHN+R FVPS +A  R    WE + E+I
Sbjct  392   SFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPSVVANKRLSWDWETYTESI  451

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PT + L  K   PLEL+ LTKDT+DYAWYS  I     DL  R +  PVL V S+GHALV
Sbjct  452   PTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPMRANASPVLIVASLGHALV  511

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGE+VG+ HG++ DK+   RKP+ LK G N I +LG + GFP+SGA M+KRF GP  
Sbjct  512   AFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVVGFPDSGAYMEKRFAGPHR  571

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL  GTL +T N W+H VG+ GE+ K+FT  G  KVKW  +    P +TW+KT+FD
Sbjct  572   VEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKWTKIEGKRPALTWFKTHFD  631

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEGN+P+A++M+ M KGM+W+NG+SIGRYW+++LSPLGQP+Q EYHIPR+++KP  NLM
Sbjct  632   APEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQPTQSEYHIPRSYLKPTGNLM  691

Query  2091  VVF-EEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+  EE+   P  I+ V+V+RDTICS +SD +P  V+SW  K         + + S  L 
Sbjct  692   VILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWGSKNNVSEYTANNRKASAVLT  751

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP+ KV+  ++FA+YGD  G CG +  GNC+  +  ++VE+ CLGK  C++P EK L   
Sbjct  752   CPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVERFCLGKHTCQIPFEKELLIR  811

Query  2448  GSKDLCPNLVHKTLAVQAKCGLR  2516
              + D CPN V K+LAVQ KCG +
Sbjct  812   -NWDPCPN-VKKSLAVQVKCGFK  832



>gb|AES74289.2| glycoside hydrolase family 35 protein [Medicago truncatula]
Length=828

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/798 (56%), Positives = 572/798 (72%), Gaps = 14/798 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              F++G R++LF+GSIHY R  P+ WPD+L +A+ GGLNVIQTYVFWN HEP QG+FNFEG
Sbjct  42    LFVNGRRELLFSGSIHYTRSTPDAWPDILDKARHGGLNVIQTYVFWNAHEPEQGKFNFEG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             NNDLVKFI+++   GMYVTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  +MK 
Sbjct  102   NNDLVKFIRLVQSKGMYVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKKYMKA  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA+MA+ L 
Sbjct  162   YVSKIIQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWAANMAVALD  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDP +QR
Sbjct  219   IGVPWIMCKQKDAPDPVINACNGRHCGDTFSGPNKPYKPSLWTENWTAQYRVFGDPVSQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNG+ + YYMY+GGTN+GRTT++F TTRYYDE PLDE+G+ R PK
Sbjct  279   SAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTTSAFTTTRYYDEAPLDEYGMERQPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H AL L ++ +  G PT+QKL +  E+  FE      C+AF+TNN+T    +I
Sbjct  338   WSHLRDAHKALLLCRKAILGGVPTVQKLNDYHEVRIFEKPGTSTCSAFITNNHTNQAATI  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG+ Y+LP  S SVLPDCKT V+N+QNIVSQHN R FV S +A  ++LKWE+F E IP
Sbjct  398   SFRGSNYFLPAHSISVLPDCKTVVYNTQNIVSQHNKRNFVKSAVA--NNLKWELFLEAIP  455

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L      PLELYTL KDT+DY WY+T  E    DL  +  IL ++   S+GH L A
Sbjct  456   SSKKLESNQKIPLELYTLLKDTTDYGWYTTSFELGPEDLPKKSAILRIM---SLGHTLSA  512

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+++G+ HG +++K+    +P + K G N I++L    G P+SGA M+ R+ GP+ +
Sbjct  513   FVNGQYIGTDHGTHEEKSFEFEQPANFKVGTNYISILATTVGLPDSGAYMEHRYAGPKSI  572

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  G L +T N W H VG+ GE+LK+FTEEGS+KV+W PVT     ++W KT F  
Sbjct  573   SILGLNKGKLELTKNGWGHRVGLRGEQLKVFTEEGSKKVQWDPVTGETRALSWLKTRFAT  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  M KGM+WVNGKSIGR+W++FLSPLGQPSQ EYHIPR ++  K+NL+V
Sbjct  633   PEGRGPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGQPSQEEYHIPRDYLNAKDNLLV  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EE+ G P  IE+++V+RDTICS +++  P NV SW  K  E R V ++  P   LKCP
Sbjct  693   VLEEEKGSPEKIEIMIVDRDTICSYITENSPANVNSWGSKNGEFRSVGKNSGPQASLKCP  752

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G+P G CG+F +GNC+   A  +VEKACLGK +C V V ++ F   +
Sbjct  753   SGKKIVAVEFASFGNPSGYCGDFALGNCNGGAAKGVVEKACLGKEECLVEVNRANF---N  809

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                C   V+ TLA+QAKC
Sbjct  810   GQGCAGSVN-TLAIQAKC  826



>ref|XP_004500729.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=843

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/798 (54%), Positives = 573/798 (72%), Gaps = 8/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              F++G R++LF+GSIHY R  P+MWPD+L +A+ GGLNVIQTYVFWN HEP QG+FNFEG
Sbjct  51    LFVNGRRELLFSGSIHYTRSTPDMWPDILDKARHGGLNVIQTYVFWNAHEPEQGKFNFEG  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFI+++   GMYVTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  HM+K
Sbjct  111   QYDLVKFIRLVQAKGMYVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKYHMQK  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA+MA+   
Sbjct  171   FVSKIIQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWAANMAVAFD  227

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR FGDP ++R
Sbjct  228   VGVPWIMCKQRDAPDPVINACNGRHCGDTFSGPNKPYKPAIWTENWTAQYRVFGDPISKR  287

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNG+ + YYMY+GGTN+GRT+++F TTRYYDE PLDE+GL R+PK
Sbjct  288   SAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEYGLEREPK  346

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H A+ L ++ +  G P++QKL    E+ TFE     +CAAF+TNN++T   +I
Sbjct  347   WSHLRDAHKAMLLCRKAILGGVPSVQKLNAYHEVRTFEKPESNICAAFITNNHSTEAATI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG+ Y+LP  S SVLPDCKT V+N+Q+IVSQHNAR FV S +A  ++ KWE++ E IP
Sbjct  407   SFRGSNYFLPAHSISVLPDCKTVVYNTQSIVSQHNARNFVKSAVA--NNHKWEVYSEAIP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L      P ELY L KD SDYAWY+T  E S +DL T+  + PVL + S+GH+L A
Sbjct  465   NTMTLQPNQKVPAELYLLLKDRSDYAWYTTSFELSPQDLPTKNGVAPVLRIMSLGHSLAA  524

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+++G+ HG +++K+    +P + K G N +T+L    G P+SGA M+ R+ GP+ +
Sbjct  525   FVNGQYIGTGHGTHEEKSFEFEQPANFKVGTNYVTILASTVGLPDSGAYMEHRYAGPKSI  584

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I GL  GT+ +T N W H VG+ GE L++F+EEGS+KV W PV      ++W+KT F  
Sbjct  585   SILGLNTGTIDLTKNGWGHQVGLKGEGLEIFSEEGSKKVTWTPVNGPTRALSWFKTRFAT  644

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  M KG+V+VNG+SIGR+W+ FLSPLG P+Q EYHIPR+++  K+NL+V
Sbjct  645   PEGRGPVAIRMTGMGKGIVYVNGQSIGRHWMTFLSPLGHPTQSEYHIPRSYLNQKDNLLV  704

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+   P  IE++ V+RDTICS++ +  P NV SW  +  +   V++++ P   LKCP
Sbjct  705   ILEEEKASPEKIEILNVDRDTICSNILESDPANVNSWVSRHGQFHAVIKNVTPQASLKCP  764

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  IEFA++G+P G CGNF  GNC+     ++VEK CLGK +C V V ++ F    
Sbjct  765   SGKRIVAIEFASFGNPSGLCGNFTFGNCNAAATKRVVEKECLGKEECLVAVNRASFNRKK  824

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP+LV K LA+QAKC
Sbjct  825   GDACPDLV-KRLAIQAKC  841



>ref|XP_003523495.1| PREDICTED: beta-galactosidase 13 [Glycine max]
Length=844

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/799 (55%), Positives = 576/799 (72%), Gaps = 8/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              FI+G R+ILF+GS+HY R  P+MWPD+L +A+ GGLNVIQTYVFWN HEP  G+FNF+G
Sbjct  53    LFINGRREILFSGSVHYTRSTPDMWPDILDKARRGGLNVIQTYVFWNAHEPEPGKFNFQG  112

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFI+++   GM+VTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  HMK 
Sbjct  113   NYDLVKFIRLVQAKGMFVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKFHMKA  172

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA+MA+   
Sbjct  173   FVSKIIQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWAANMAVATD  229

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR  GDPP+QR
Sbjct  230   IGVPWLMCKQRDAPDPVINACNGRHCGDTFAGPNKPYKPAIWTENWTAQYRVHGDPPSQR  289

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNG+ + YYMY+GGTN+GRT++ F TTRYYDE PLDE+GL R+PK
Sbjct  290   SAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTSSVFSTTRYYDEAPLDEYGLPREPK  348

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H AL L +R +  G P++QKL +  E+ TFE     +CAAF+TNN+T  P +I
Sbjct  349   WSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTNMCAAFITNNHTMEPATI  408

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT Y+LP  S S+LPDCKT VFN+Q IVSQHN+R +  S  A  ++  WEMF E IP
Sbjct  409   NFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSPAA--NNFHWEMFNEAIP  466

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +PI    P ELY+L KDT+DYAWY+T  E S+ D+S +  +LPVL V S+GH++VA
Sbjct  467   TAKKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGVLPVLRVMSLGHSMVA  526

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VG+ HG +++K+   + PV L+ G N I+LL    G P+SGA M+ R+ GP+ +
Sbjct  527   FVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPDSGAYMEHRYAGPKSI  586

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL  GTL +T N W H VG+ GE  K+F+EEGS  VKWKP+  V   ++WY+T F  
Sbjct  587   NILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLGAVPRALSWYRTRFGT  646

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  MAKGMVWVNG +IGRYW+++LSPLG+P+Q EYHIPR+F+ P++NL+V
Sbjct  647   PEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQSEYHIPRSFLNPQDNLLV  706

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+   P+ +E++ VNRDTICS V +  P NV SW  +      VV+ +  +  + C 
Sbjct  707   IFEEEARVPAQVEILNVNRDTICSVVGERDPANVNSWVSRRGNFHPVVKSVGAAASMACA  766

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G+P G CG+F +G+C+   + +IVE+ CLG+  C + +++++F    
Sbjct  767   TGKRIVAVEFASFGNPSGYCGDFAMGSCNAAASKQIVERECLGQEACTLALDRAVFNNNG  826

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D CP+LV K LAVQ +C 
Sbjct  827   VDACPDLV-KQLAVQVRCA  844



>gb|KHN33673.1| Beta-galactosidase 13 [Glycine soja]
Length=833

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/799 (55%), Positives = 576/799 (72%), Gaps = 8/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              FI+G R+ILF+GS+HY R  P+MWPD+L +A+ GGLNVIQTYVFWN HEP  G+FNF+G
Sbjct  42    LFINGRREILFSGSVHYTRSTPDMWPDILDKARRGGLNVIQTYVFWNAHEPEPGKFNFQG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFI+++   GM+VTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  HMK 
Sbjct  102   NYDLVKFIRLVQAKGMFVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKFHMKA  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA+MA+   
Sbjct  162   FVSKIIQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWAANMAVATD  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR  GDPP+QR
Sbjct  219   IGVPWLMCKQRDAPDPVINACNGRHCGDTFAGPNKPYKPAIWTENWTAQYRVHGDPPSQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNG+ + YYMY+GGTN+GRT++ F TTRYYDE PLDE+GL R+PK
Sbjct  279   SAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTSSVFSTTRYYDEAPLDEYGLPREPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H AL L +R +  G P++QKL +  E+ TFE     +CAAF+TNN+T  P +I
Sbjct  338   WSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTNMCAAFITNNHTMEPATI  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT Y+LP  S S+LPDCKT VFN+Q IVSQHN+R +  S  A  ++  WEMF E IP
Sbjct  398   NFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSPAA--NNFHWEMFNEAIP  455

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +PI    P ELY+L KDT+DYAWY+T  E S+ D+S +  +LPVL V S+GH++VA
Sbjct  456   TAKKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGVLPVLRVMSLGHSMVA  515

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VG+ HG +++K+   + PV L+ G N I+LL    G P+SGA M+ R+ GP+ +
Sbjct  516   FVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPDSGAYMEHRYAGPKSI  575

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL  GTL +T N W H VG+ GE  K+F+EEGS  VKWKP+  V   ++WY+T F  
Sbjct  576   NILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLGAVPRALSWYRTRFGT  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  MAKGMVWVNG +IGRYW+++LSPLG+P+Q EYHIPR+F+ P++NL+V
Sbjct  636   PEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQSEYHIPRSFLNPQDNLLV  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+   P+ +E++ VNRDTICS V +  P NV SW  +      VV+ +  +  + C 
Sbjct  696   IFEEEARVPAQVEILNVNRDTICSVVGERDPANVNSWVSRRGNFHPVVKSVGAAASMACA  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G+P G CG+F +G+C+   + +IVE+ CLG+  C + +++++F    
Sbjct  756   TGKRIVAVEFASFGNPSGYCGDFAMGSCNAAASKQIVERECLGQEACTLALDRAVFNNNG  815

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D CP+LV K LAVQ +C 
Sbjct  816   VDACPDLV-KQLAVQVRCA  833



>gb|KDO68060.1| hypothetical protein CISIN_1g035496mg [Citrus sinensis]
Length=833

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/804 (56%), Positives = 582/804 (72%), Gaps = 12/804 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+ILF+GSIHY R  P+MWPD++++AK GGLNVIQTYVFWNIHEPVQGQ+NF+G
Sbjct  38    LIINGKREILFSGSIHYTRSTPDMWPDLIQKAKRGGLNVIQTYVFWNIHEPVQGQYNFQG  97

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIKMIG+ GMY +LR+GPF++AEWN GG PYWL+EV  I FR+ NEPF  HMKK
Sbjct  98    QYDLVKFIKMIGEHGMYASLRLGPFIQAEWNHGGLPYWLREVQNITFRSDNEPFKYHMKK  157

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+  MK  KLFA QGGPIIL QIENEYS+I+    A  +   KY+ W  ++A+G+ 
Sbjct  158   YVTMIIKKMKDEKLFASQGGPIILVQIENEYSTIQL---AYREKGNKYVQWTGNLAVGMN  214

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQ+R +GDPP+QR
Sbjct  215   IGVPWVMCKQKDAPDPIINTCNGRYCGDTFTGPNKPNKPSLWTENWTAQFRVYGDPPSQR  274

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLY-RDP  1013
             S E++A+S  RF + +NG+ + YYMY+GGTN+GRT+A+FVTTRYYDE PLDEF ++ + P
Sbjct  275   SVEDLAFSTARFIS-RNGTLINYYMYHGGTNFGRTSANFVTTRYYDEAPLDEFAVFAKGP  333

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTS  1190
             KW HL+D H AL+L K+ L  G P++QKL  + E I +E      CAAFL+NN+T    +
Sbjct  334   KWGHLKDLHRALKLCKKALLWGYPSVQKLGQDLEAIVYEGHGA--CAAFLSNNSTYMEKT  391

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAG-RDDLKWEMFQET  1367
             I FRG  YYLP  S S+LPDC+T V+N+Q IVSQHN+R FVPS +A  R    WE + E+
Sbjct  392   ISFRGRNYYLPSKSISILPDCQTVVYNTQTIVSQHNSRNFVPSVVANKRLSWDWETYTES  451

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             IPT + L  K   PLEL+ LTKDT+DYAWYS  I     DL  R +  PVL V S+GHAL
Sbjct  452   IPTFEQLENKATNPLELFNLTKDTTDYAWYSMIITLGRGDLPMRANASPVLIVASLGHAL  511

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
             VAFVNGE+VG+ HG++ DK+   RKP+ LK G N I +LG + GFP+SGA M+KRF GP 
Sbjct  512   VAFVNGEYVGNGHGSHLDKSFVFRKPIKLKEGPNHIQILGSVVGFPDSGAYMEKRFAGPH  571

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
              V I GL  GTL +T N W+H VG+ GE+ K+FT  G  KVKW  +    P +TW+KTYF
Sbjct  572   RVEILGLNTGTLELTKNRWAHQVGLYGEEAKIFTLGGLNKVKWTKIEGKRPALTWFKTYF  631

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPEGN+P+A++M+ M KGM+W+NG+SIGRYW+++LSPLGQP+Q EYHIPR+++KP  NL
Sbjct  632   DAPEGNHPIAIQMNRMGKGMIWINGQSIGRYWISYLSPLGQPTQSEYHIPRSYLKPTGNL  691

Query  2088  MVVF-EEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             MV+  EE+   P  I+ V+V+RDTICS +SD +P  V+SW  K         + + S  L
Sbjct  692   MVILEEEEEARPEEIKFVVVDRDTICSYISDIHPPPVQSWGSKNNVSEYTANNRKASAVL  751

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
              CP+ KV+  ++FA+YGD  G CG +  GNC+  +  ++VE+ CLGK  C++P EK L  
Sbjct  752   TCPDFKVITNVQFASYGDSIGICGGYQYGNCNAQDTKEVVERFCLGKHTCQIPFEKELLI  811

Query  2445  EGSKDLCPNLVHKTLAVQAKCGLR  2516
               + D CPN V K+LAVQ KCG +
Sbjct  812   R-NWDPCPN-VKKSLAVQVKCGFK  833



>ref|XP_007201748.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
 gb|EMJ02947.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
Length=857

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/800 (55%), Positives = 572/800 (72%), Gaps = 9/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R + F+GSIHYPR   EMWPD+LK+AK GGLNVI+TYVFWN+HEPV+G+FNFEG
Sbjct  66    LMINGRRKLFFSGSIHYPRSTVEMWPDLLKKAKLGGLNVIETYVFWNLHEPVKGKFNFEG  125

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFI+++ +  MYVTLRVGPF++AEWN GG PYWL+E P I FR+ N  + +HM+ 
Sbjct  126   NADLVKFIRLVQEHKMYVTLRVGPFIQAEWNHGGLPYWLREEPDIIFRSDNPSYKHHMET  185

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQIENEY+ ++    A  ++   YI WAA+MA+   
Sbjct  186   FVTKIIAMMKHEKLFAPQGGPIILAQIENEYTHVQL---AYKELGNSYIQWAANMALSQN  242

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ +AP  VI+TCNGR CGDTF GPN  +KP++WTENWTAQYR FGDPP+QR
Sbjct  243   AGIPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNKPHKPTLWTENWTAQYRVFGDPPSQR  302

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K+G+   YYMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PK
Sbjct  303   SAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLKREPK  361

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL+D H AL L K+PLF GTP +Q+L    E   +E     +C AFL NN++T  T++
Sbjct  362   WGHLKDLHRALSLCKKPLFAGTPGVQRLGKETEARFYERPGTDICVAFLANNHSTIETTV  421

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG +Y+LP  S S+LPDCKT VFNSQ IVSQHN+R FV SK A +    WE F E IP
Sbjct  422   NWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRSKAANK--FNWERFSEPIP  479

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P+    P ELY L KD +DY W+++ +E    DL  +  I PVL + S+GHA+  
Sbjct  480   TTVQIPVNQKSPQELYHLLKDATDYGWFTSSLELGPYDLPMKESIRPVLRIPSLGHAMSV  539

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG++HG++ +K     +PV  K G N I+LL +  G P+SGA M+ R+ GPR +
Sbjct  540   FVNGEFVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPDSGAYMEHRYAGPRTI  599

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             T+ GL  GT+ ++ N W H VG++GE L++FT++G+QKV+W         +TWYKT F+A
Sbjct  600   TVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTKKGAQKVQWTKAAGKGRALTWYKTNFEA  659

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+WVNGKSIGR+W++FLSPLGQP+Q EYHIPRAF++P  N +V
Sbjct  660   PEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQSEYHIPRAFIEPGQNFLV  719

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ  DP  IE++  NRDTIC+  ++ +P +VKSWERKG EL+ V      S +L CP
Sbjct  720   VLEEQEADPKDIEILTANRDTICAISTEMHPPHVKSWERKGGELKTVGPVSGASAQLMCP  779

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++G P+G CG +  G C  P   K+VE+ CLG++ C VPV+  LF +  
Sbjct  780   NLKKIVGVDFASFGTPEGMCGAYKPGKCDSPATRKVVEEHCLGQTSCTVPVDPKLFFKA-  838

Query  2454  KDLCPNLVHKTLAVQAKCGL  2513
              D CP++  KTLA+Q  C L
Sbjct  839   -DPCPDINIKTLAIQVTCAL  857



>ref|XP_008236010.1| PREDICTED: beta-galactosidase 11-like [Prunus mume]
Length=851

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/800 (55%), Positives = 573/800 (72%), Gaps = 9/800 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R + F+GSIHYPR   EMWPD+LK+AK GGLNVI TYVFWN+HEPV+GQFNFEG
Sbjct  60    LMINGKRKLFFSGSIHYPRSTVEMWPDLLKKAKLGGLNVIDTYVFWNLHEPVKGQFNFEG  119

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFI+++ +  MYVTLRVGPF++AEWN GG PYWL+E P I FR+ N  + +HM+ 
Sbjct  120   NADVVKFIRLVQEHKMYVTLRVGPFIQAEWNHGGLPYWLREEPDIIFRSDNPSYKHHMEA  179

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQIENEY+ ++    A  ++   YI WAA+MA+   
Sbjct  180   FVTKIIAMMKHEKLFAPQGGPIILAQIENEYTHVQL---AYKELGSSYIQWAANMALSQN  236

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  +KP++WTENWTAQYR FGDPP+QR
Sbjct  237   AGVPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNKPHKPTLWTENWTAQYRVFGDPPSQR  296

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K+G+   YYMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PK
Sbjct  297   SAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLQREPK  355

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL+D H AL L K+PLF GTP +Q+L    E   +E     +C AFL NN++T  T++
Sbjct  356   WGHLKDLHRALNLCKKPLFGGTPGVQRLGKETEARFYERPGTDICVAFLANNHSTIETTV  415

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG +Y+LP  S S+LPDC+T VFNSQ IVSQHN+R FV SK A +    WEMF E IP
Sbjct  416   NWRGQEYFLPPHSISILPDCRTVVFNSQQIVSQHNSRNFVRSKAANK--FNWEMFSEPIP  473

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +P+ +  P ELY L KD +DY W+++ ++    DL  +  I PVL + S+GHA+  
Sbjct  474   TTVQIPVNHKSPQELYHLLKDATDYGWFTSSLDLGPYDLPMKESIRPVLRIPSLGHAMSV  533

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+VG++HG++ +K     +PV  K G N I+LL +  G P+SGA M+ R+ GPR +
Sbjct  534   FVNGEYVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPDSGAYMEHRYAGPRTI  593

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             T+ GL  GT+ ++ N W H VG++GE L++FTE+G+QKV+W         +TWYKT F+A
Sbjct  594   TVLGLNTGTIDLSQNGWGHRVGLNGENLRVFTEKGAQKVQWTKAAGKGRALTWYKTNFEA  653

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+WVNGKSIGR+W++FLSPLGQP+Q EYHIPRAF+KP  N ++
Sbjct  654   PEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQSEYHIPRAFIKPGQNFLL  713

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ  DP  IE++ VNRDTIC+  ++ +P +VKSWERKG +L+ +      S +L CP
Sbjct  714   VLEEQEADPKDIEILTVNRDTICAISTEMHPPHVKSWERKGGDLKTIGPVSGASAQLMCP  773

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  ++FA++G P+G CG +  G C  P   K+VE+ CLG++ C VPVE  LF +  
Sbjct  774   NLKKIVGVDFASFGTPEGMCGAYKPGKCDSPATRKVVEEHCLGQTLCTVPVEPKLFFKA-  832

Query  2454  KDLCPNLVHKTLAVQAKCGL  2513
              D CP++  KTLA+Q  C  
Sbjct  833   -DPCPDIKIKTLAIQVTCAF  851



>ref|XP_010935389.1| PREDICTED: beta-galactosidase 11-like [Elaeis guineensis]
Length=843

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/806 (55%), Positives = 576/806 (71%), Gaps = 11/806 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
             F I+G R++ F+GSIHYPR  PEMWP ++++AK GGLNVIQTYVFWNIHEPVQGQ+NF G
Sbjct  46    FMINGRRELFFSGSIHYPRSTPEMWPHLIQKAKLGGLNVIQTYVFWNIHEPVQGQYNFTG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK+I    MYVTLR+GPF++AEWN+GGFPYW+KEVP + FRT NEPF  HM+ 
Sbjct  106   RYDLVRFIKLIHKHKMYVTLRLGPFIQAEWNYGGFPYWMKEVPGVVFRTDNEPFKYHMQN  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I++MMK  KLF PQGGPIIL QIENEY+ +E+   A  +    Y+ WAA++A+G  
Sbjct  166   FVTKIMEMMKSEKLFFPQGGPIILGQIENEYNMVEA---AYREGGLTYVQWAANLALGFN  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDPP+QR
Sbjct  223   AGIPWVMCKQKDAPGPVINACNGRNCGDTFTGPNSPTKPSVWTENWTAQYRVFGDPPSQR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS+ RF + KNG+ + YYMY+GGTN+GR  AS+V TRYYDE PLDE+GL ++PK
Sbjct  283   SAEDIAYSVARFFS-KNGTLVNYYMYHGGTNFGREGASYVMTRYYDEAPLDEYGLLKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HLRD H AL+LS++ L  G P++Q L    E   +E+    +C AFLTN N     ++
Sbjct  342   YGHLRDLHQALKLSRKGLLWGVPSVQPLGEWYEARLYESPESNVCVAFLTNTNPRVDGTV  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT Y+LP  S S+LPDCKT VFN+Q + +QHNAR F    +  ++D KW+MFQE IP
Sbjct  402   NFRGTDYFLPHRSISILPDCKTVVFNTQMVNAQHNARTFRTEDVTRKND-KWQMFQERIP  460

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   I   RPL+LY +TKD +DY WY+TR    + DL  R DI PVL V S+GHA+ A
Sbjct  461   KFLKKGIVASRPLDLYNMTKDITDYMWYTTRFRLEDVDLPMRPDIRPVLLVSSLGHAMHA  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS HG   +K+   +KP+DLK G N I++LG+  GFP++GA ++ R  G    
Sbjct  521   FVNGIYIGSGHGAKLEKSFVFQKPMDLKQGVNHISILGMTVGFPDNGAYLEHRLAGVHTA  580

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL ++ N W H VG+ GEKL ++TEEGS+KVKW    +   PVTWYK YFD 
Sbjct  581   AIQGLNTGTLDLSPNKWGHEVGMKGEKLGIYTEEGSKKVKWTEAKSGQ-PVTWYKRYFDM  639

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PVAL M  M KG+ WVNG  IGRYWV++LSPLG+PSQ  YH+PR ++KPK+NL+V
Sbjct  640   PSGNDPVALDMTGMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHVPRGWLKPKDNLLV  699

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+P  + +V V RD IC+ V+D +P  ++S+ R+  E++ +V+D +PS  L C 
Sbjct  700   IFEESGGNPEGLLVVTVKRDNICTVVTDLHPPTIESFSREDSEIKNLVQDGKPSAHLTCD  759

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             + KV++ I FA++G+P GACGNF VG C  P    IVEKACLGK+ C +PV  S  + G+
Sbjct  760   KKKVIRSIAFASFGNPTGACGNFTVGTCHSPQTASIVEKACLGKNSCVLPV--SAQEYGA  817

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
                CP   + TLAVQAKC  R  K+D
Sbjct  818   DPACPGTTN-TLAVQAKCA-RQKKED  841



>ref|XP_008811847.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like [Phoenix 
dactylifera]
Length=905

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/798 (54%), Positives = 572/798 (72%), Gaps = 10/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  PEMWP+++ +AK GGLN I+TYVFWNIHEPVQGQFNF G
Sbjct  103   LIINGRRELLFSGSIHYPRSTPEMWPEIINKAKHGGLNAIETYVFWNIHEPVQGQFNFSG  162

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK++ + GM++ LR+GP++EAEWNFGGFPYWLKE+P + FRT NEPF +HM+K
Sbjct  163   RYDLVRFIKVVQEAGMFLILRIGPYVEAEWNFGGFPYWLKEIPGMIFRTDNEPFKDHMQK  222

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  MIV+ M+  KLFAPQGGPIILAQIENEY+++E+   A  +   +Y+ WA +MA+ L 
Sbjct  223   FVTMIVEKMRSEKLFAPQGGPIILAQIENEYNNVEA---AFQEGGLRYVKWAGEMALSLN  279

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+  AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QR
Sbjct  280   AGVPWVMCKEKNAPGAVINTCNGRNCGDTFTGPNSPNKPSLWTENWTAQYRVFGDPPSQR  339

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE++AY++ RF + KNG+ + YYMY+GGTN+GR  ++FV TRYYDE PLDE+GLY++PK
Sbjct  340   AAEDLAYAVTRFFSAKNGTLVNYYMYHGGTNFGREGSAFVMTRYYDEAPLDEYGLYKEPK  399

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HLRD H ALRL ++ LF G P+ Q L    E++ +E    K+CAAFLTN N     ++
Sbjct  400   FGHLRDVHHALRLCRKALFYGNPSTQNLGKGYEVVIYEKPERKVCAAFLTNTNPRIDGTV  459

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +Y LP  S S+LPDCKT VFNSQ  ++QHNAR F  +K     + KW M+QE IP
Sbjct  460   NFRGVEYSLPRRSISILPDCKTVVFNSQRTMAQHNARTFHTAKETTEKN-KWWMYQEYIP  518

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                +  + + +PLEL  +TKDT+DY WY+T  +    DL  R DI PVL V S+GHA+ A
Sbjct  519   KFRDTKVTSRQPLELMNMTKDTTDYLWYTTSFKLDSEDLPMRHDIRPVLQVSSLGHAIHA  578

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++G+ HG++ +K+    KP+DL  G N IT+LG+  G PNSGA ++ R  G   V
Sbjct  579   FVNGFYIGTGHGSHVEKSFVFTKPMDLNRGYNHITILGLTIGLPNSGAYLEHRLAGVHTV  638

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL AGTL ++ N W H VG+ GE+L +FTEEG + V+W    +   P TWYK YFDA
Sbjct  639   GIQGLNAGTLDLSNNRWGHRVGLDGERLGIFTEEGLKNVQWTEAKS-DTPATWYKRYFDA  697

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PV+L M +M KG  WVNG+ IGRYWV++L P G+PSQ  YH+PR+++KPK+NL+V
Sbjct  698   PRGNDPVSLNMTSMGKGRAWVNGECIGRYWVSYLDPYGKPSQSTYHVPRSWLKPKDNLLV  757

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEEQGG P  I ++   RD IC+ VS+ +P + +S++ KG EL Q +ED +P   LKC 
Sbjct  758   LFEEQGGKPEDIIIMTAKRDNICAFVSEDHPPSARSFQMKGNEL-QTIEDAKPKAHLKCD  816

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               KV++ I FA++G+P G CGN+ +G+C  P    I+EK CLGKS C +PV    +  G+
Sbjct  817   SKKVIQAIVFASFGNPTGPCGNYTIGSCHAPQTWSIIEKECLGKSSCVLPVSAQAY--GA  874

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                CP   + TL VQ KC
Sbjct  875   DPKCPGTTN-TLTVQVKC  891



>ref|XP_007137346.1| hypothetical protein PHAVU_009G119400g [Phaseolus vulgaris]
 gb|ESW09340.1| hypothetical protein PHAVU_009G119400g [Phaseolus vulgaris]
Length=845

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/798 (53%), Positives = 575/798 (72%), Gaps = 7/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              FI+G R++LF+GSIHYPR   +MWP +L  A+ GG+NVIQTYVFWN HEP QGQFNF G
Sbjct  53    MFINGRRELLFSGSIHYPRSTQDMWPVLLDNARRGGINVIQTYVFWNAHEPQQGQFNFAG  112

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK++ + GM+VTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  HM+ 
Sbjct  113   NYDLVKFIKLVQEHGMFVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKQHMQA  172

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ W+A+MA+ L 
Sbjct  173   FVTKIVQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWSANMAVALN  229

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR  GDPP+QR
Sbjct  230   VGVPWVMCKQRDAPDPVINACNGRHCGDTFSGPNKPYKPSIWTENWTAQYRVHGDPPSQR  289

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K G+ + YYMY+GGTN+GRT+++F TTRYYDE PLDE+GL R+PK
Sbjct  290   SAEDIAFSVARFFS-KGGNLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEYGLQREPK  348

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H A+ L ++ +  G   ++KL    EI TFE     +CAAF+TNN+T    +I
Sbjct  349   WSHLRDVHKAVLLCRKAILGGDTNVEKLNEFHEIRTFEKLGTNMCAAFITNNHTIDAATI  408

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT Y+LP  S SVLPDCKT V+N+Q+IVSQHN+R +  S +A  ++ +WEMF E IP
Sbjct  409   NFRGTNYFLPPHSISVLPDCKTVVYNTQSIVSQHNSRNYERSPIA--NNFQWEMFIEAIP  466

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +      P ELY+L KDT+DYAWY+T  E S +DL T+  ++PVL + S+GH++VA
Sbjct  467   TTKKMDTYQKLPAELYSLLKDTTDYAWYTTSFELSPQDLPTKPGVIPVLRIMSLGHSMVA  526

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VG+ HG +++K+   ++PV  K G N I++L    G P+SGA M+ R+ GP+ +
Sbjct  527   FVNGDLVGTAHGTHEEKSFEFQRPVAFKVGTNYISILASTVGLPDSGAYMEHRYAGPKSI  586

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I  L  GT+ ++ N W H VG+ GE +K+F+EEGS K KW P+  V  P+TWY+T F  
Sbjct  587   SILDLNTGTIDISNNMWGHRVGLKGEGMKVFSEEGSLKAKWMPLAPVPRPLTWYRTRFAT  646

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  M KG++WVNG+SIGR+W+ FLSPLG P+Q E+HIPRAF+ P++NL+V
Sbjct  647   PEGTGPVAVRMTGMGKGLIWVNGQSIGRHWMTFLSPLGTPTQSEFHIPRAFLNPQDNLLV  706

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+  +P  +E++ VNRDTICS +++  P NV SW  +      +V +I P   L+C 
Sbjct  707   IFEEEAMNPGQVEVLNVNRDTICSFIAENEPANVNSWVSRRGNFHPIVSNIGPQAALECN  766

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G+P G CG++++G+C+     +IVE+ CLGK  C V +++++  +  
Sbjct  767   PGKKITAVEFASFGNPSGYCGDYVLGSCNVAATKQIVEQQCLGKETCTVALDRAVLNQNG  826

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP ++ KTLA+QA+C
Sbjct  827   ADPCPEILVKTLAIQARC  844



>ref|XP_004298189.1| PREDICTED: beta-galactosidase 13-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/776 (56%), Positives = 571/776 (74%), Gaps = 10/776 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD+L++AK GGLNVIQTYVFWN+HEPV+G +NF GN DLV+FIK++ + GMYVT+RVG
Sbjct  1     MWPDLLRKAKHGGLNVIQTYVFWNVHEPVKGHYNFSGNYDLVRFIKLVQEHGMYVTIRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EVP + FRT N P+  +MKK+  MIV+ +K+AKLF+PQGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVPDLIFRTDNAPYKYYMKKYVTMIVNKLKEAKLFSPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+ I+     +      Y+ WAA MA+     +PWIMCKQ +AP   I+TCNG
Sbjct  121   LAQIENEYNHIQLAYEEN---GSNYVRWAAKMAVKQNVGVPWIMCKQTDAPDPAINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGD+F G N   KP++WTENWT QYR FGDP +QR AE+IA+S+ RF + KNGS   Y
Sbjct  178   RHCGDSFSGANKPYKPALWTENWTGQYRVFGDPASQRPAEDIAFSVARFFS-KNGSLANY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A F TTRYYDE PLDE+GL RDPKWSHL+D H ALRL ++PL  G P
Sbjct  237   YMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLPRDPKWSHLKDLHKALRLCRKPLLWGVP  296

Query  1086  TIQKLPNNQEIITFE-NQNLKLCAAFLTNNNTTPTSI-KFRGTQYYLPGFSTSVLPDCKT  1259
              +Q L  N E   +E   N  +CAAFL NNN+   +I  +RG  YYLP  S S+LPDCKT
Sbjct  297   GVQNLGKNIEARFYELKGNSSICAAFLANNNSRSEAIVNWRGQDYYLPPHSISILPDCKT  356

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
              V+N+Q IVSQHNAR FV S LA +  ++W    E IP+   +PI N  PLELY L KD 
Sbjct  357   VVYNTQTIVSQHNARSFVGSNLANK--MRWMESPEPIPSTKEIPINNRTPLELYGLLKDN  414

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDYAWY+T +E +  D+S +  I PVL V S+GHA++ FVNGE+VGS HG++D+K+    
Sbjct  415   SDYAWYTTSLELNSMDMSMKKSIQPVLRVGSLGHAMLVFVNGEYVGSGHGSHDEKSFVFE  474

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             K V  K G N I LL +  G P+SGA M+ R+ GP+D+ + GL  GTL +T N W H VG
Sbjct  475   KVVSFKAGVNQIALLAMTVGLPDSGAYMEHRYAGPKDIVVLGLNTGTLDLTQNGWGHQVG  534

Query  1800  VSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
             ++GEKL+ FT+EGS++V+W         +TWYKTYFDAPEGN+PVA+RM  M KGM+WVN
Sbjct  535   LNGEKLRAFTKEGSKQVQWGETNGPKKALTWYKTYFDAPEGNDPVAIRMTGMGKGMIWVN  594

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTI  2159
             G+SIGR+W++FLSPLGQP+Q EYHIPR+F+KP+ NL+VV EE+   PSSI++V VNRDTI
Sbjct  595   GESIGRHWISFLSPLGQPTQSEYHIPRSFIKPRKNLLVVLEEELAKPSSIDIVTVNRDTI  654

Query  2160  CSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             CS +++Y+P NVKSW R+    R V++ +R S  LKCP  K V  +EFA++GDP G+CG+
Sbjct  655   CSFITEYHPPNVKSWARQNSVFRPVLDVVRTSAELKCPNYKKVVAVEFASFGDPTGSCGS  714

Query  2340  FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             + +G C+ P + ++VE+ CLG + C VP++++++ + + D CP+ + KTLA+Q KC
Sbjct  715   YTLGKCNSPVSKEVVEQHCLGNTSCVVPIDRNVYFK-NNDECPD-IKKTLAIQVKC  768



>ref|XP_007137348.1| hypothetical protein PHAVU_009G119600g [Phaseolus vulgaris]
 gb|ESW09342.1| hypothetical protein PHAVU_009G119600g [Phaseolus vulgaris]
Length=843

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/798 (53%), Positives = 576/798 (72%), Gaps = 7/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              FI+G R++LF+GSIHYPR   +MWP +L  A+ GG+NVIQTYVFWN HEP QGQFNF G
Sbjct  51    MFINGRRELLFSGSIHYPRSTQDMWPVLLDNARRGGINVIQTYVFWNAHEPQQGQFNFAG  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK++ + GM+VTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  +M+ 
Sbjct  111   NYDLVKFIKLVQEHGMFVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKQYMQA  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ W+A+MA+ L 
Sbjct  171   FVTKIVQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWSANMAVALN  227

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR  GDPP+QR
Sbjct  228   VGVPWVMCKQRDAPDPVINACNGRNCGDTFSGPNKPYKPSIWTENWTAQYRVHGDPPSQR  287

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K G+ + YYMY+GGTN+GRT+++F TTRYYDE PLDE+GL R+PK
Sbjct  288   SAEDIAFSVARFFS-KGGNLVNYYMYHGGTNFGRTSSAFTTTRYYDEAPLDEYGLQREPK  346

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H A+ L ++ +  G   ++KL    EI TFE     +CAAF+TNN+T    +I
Sbjct  347   WSHLRDVHKAVLLCRKAILGGDTNVEKLNQFHEIRTFEKLGTNMCAAFITNNHTIDAATI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRGT Y+LP  S SVLPDCKT V+N+Q+IVSQHN+R +  S +A  ++ +WEMF E IP
Sbjct  407   NFRGTNYFLPPHSISVLPDCKTVVYNTQSIVSQHNSRNYERSPIA--NNFQWEMFIEAIP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   +      P ELY+L KDT+DYAWY+T  E S +DL T+  ++PVL + S+GH++VA
Sbjct  465   TTKKMDTYQNLPAELYSLLKDTTDYAWYTTSFELSPQDLPTKPGVIPVLRIMSLGHSMVA  524

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VG+ HG +++K+   ++PV  K G N I++L    G P+SGA M+ R+ GP+ +
Sbjct  525   FVNGDLVGTAHGTHEEKSFEFQRPVAFKVGTNYISILASTVGLPDSGAYMEHRYAGPKSI  584

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             +I  L +GT+ V+ N W H VG+ GE +K+F+EEGS + KW P+  V  P+TWY+T F  
Sbjct  585   SILDLNSGTIDVSDNMWGHRVGLKGEGMKVFSEEGSLRAKWMPLAPVPRPLTWYRTRFAT  644

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG  PVA+RM  M KG++WVNG+SIGR+W+ FLSPLG P+Q E+HIPRAF+ P++NL+V
Sbjct  645   PEGTGPVAIRMTGMGKGLIWVNGQSIGRHWMTFLSPLGTPTQSEFHIPRAFLNPQDNLLV  704

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+  +P  +E++ VNRDTICS +++  P NV SW  +      +V +I P   L+C 
Sbjct  705   IFEEEAMNPGQVEVLNVNRDTICSFIAENDPANVNSWVSRRGNFHPIVSNIGPQAALECI  764

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  IEFA++G+P G CG+F++G+C+     +IVE+ CLGK  C V +++++  +  
Sbjct  765   PGKKITAIEFASFGNPSGYCGDFVLGSCNAAATKQIVEQQCLGKETCTVALDRAMLNQNG  824

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP ++ KTLA+QA+C
Sbjct  825   ADPCPEILVKTLAIQARC  842



>ref|XP_003604038.1| Beta-galactosidase [Medicago truncatula]
Length=847

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/817 (54%), Positives = 572/817 (70%), Gaps = 33/817 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              F++G R++LF+GSIHY R  P+ WPD+L +A+ GGLNVIQTYVFWN HEP QG+FNFEG
Sbjct  42    LFVNGRRELLFSGSIHYTRSTPDAWPDILDKARHGGLNVIQTYVFWNAHEPEQGKFNFEG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             NNDLVKFI+++   GMYVTLRVGPF++AEWN GG PYWL+EVP I FR+ NEP+  +MK 
Sbjct  102   NNDLVKFIRLVQSKGMYVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKKYMKA  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK  KLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA+MA+ L 
Sbjct  162   YVSKIIQMMKDEKLFAPQGGPIILAQIENEYNHIQL---AYEEKGDSYVQWAANMAVALD  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDP +QR
Sbjct  219   IGVPWIMCKQKDAPDPVINACNGRHCGDTFSGPNKPYKPSLWTENWTAQYRVFGDPVSQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNG+ + YYMY+GGTN+GRTT++F TTRYYDE PLDE+G+ R PK
Sbjct  279   SAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTTSAFTTTRYYDEAPLDEYGMERQPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHLRD H AL L ++ +  G PT+QKL +  E+  FE      C+AF+TNN+T    +I
Sbjct  338   WSHLRDAHKALLLCRKAILGGVPTVQKLNDYHEVRIFEKPGTSTCSAFITNNHTNQAATI  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQN-------------------IVSQHNARRFVP  1316
              FRG+ Y+LP  S SVLPDCKT V+N+QN                   IVSQHN R FV 
Sbjct  398   SFRGSNYFLPAHSISVLPDCKTVVYNTQNVMNQLVYYKLISSHLIIKLIVSQHNKRNFVK  457

Query  1317  SKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLST  1496
             S +A  ++LKWE+F E IP+   L      PLELYTL KDT+DY WY+T  E    DL  
Sbjct  458   SAVA--NNLKWELFLEAIPSSKKLESNQKIPLELYTLLKDTTDYGWYTTSFELGPEDLPK  515

Query  1497  RGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLT  1676
             +  IL ++   S+GH L AFVNG+++G+ HG +++K+    +P + K G N I++L    
Sbjct  516   KSAILRIM---SLGHTLSAFVNGQYIGTDHGTHEEKSFEFEQPANFKVGTNYISILATTV  572

Query  1677  GFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW  1856
             G P+SGA M+ R+ GP+ ++I GL  G L +T N W H VG+ GE+LK+FTEEGS+KV+W
Sbjct  573   GLPDSGAYMEHRYAGPKSISILGLNKGKLELTKNGWGHRVGLRGEQLKVFTEEGSKKVQW  632

Query  1857  KPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPS  2036
              PVT     ++W KT F  PEG  PVA+RM  M KGM+WVNGKSIGR+W++FLSPLGQPS
Sbjct  633   DPVTGETRALSWLKTRFATPEGRGPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGQPS  692

Query  2037  QGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKG  2216
             Q EYHIPR ++  K+NL+VV EE+ G P  IE+++V+RDTICS +++  P NV SW  K 
Sbjct  693   QEEYHIPRDYLNAKDNLLVVLEEEKGSPEKIEIMIVDRDTICSYITENSPANVNSWGSKN  752

Query  2217  EELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKAC  2396
              E R V ++  P   LKCP  K +  +EFA++G+P G CG+F +GNC+   A  +VEKAC
Sbjct  753   GEFRSVGKNSGPQASLKCPSGKKIVAVEFASFGNPSGYCGDFALGNCNGGAAKGVVEKAC  812

Query  2397  LGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             LGK +C V V ++ F   +   C   V+ TLA+QAKC
Sbjct  813   LGKEECLVEVNRANF---NGQGCAGSVN-TLAIQAKC  845



>ref|XP_009376956.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
 ref|XP_009376964.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
Length=859

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/798 (54%), Positives = 570/798 (71%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+I F+GSIHYPR   +MWPD+LK+AK GGLNVIQTYVFWN+HEPV+G++NFEG
Sbjct  68    IMINGKREIFFSGSIHYPRSTVDMWPDLLKKAKRGGLNVIQTYVFWNLHEPVKGKWNFEG  127

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N D+VKFI+++ +  MYVTLRVGPF++AEWN GG PYWL+E P I FR+ N  +  HM+ 
Sbjct  128   NADVVKFIRLVQENKMYVTLRVGPFIQAEWNHGGLPYWLREEPNIVFRSDNPAYKQHMEA  187

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK  KLFAPQGGPIILAQIENEY+ ++    A  ++   Y+ WAA+MA+   
Sbjct  188   YVTKIMKMMKDEKLFAPQGGPIILAQIENEYTHVQL---AYKELGTSYVQWAANMALAQN  244

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ  AP  +I+TCNGR CGDTF GPN  +KPS+WTENWTAQYR FGDPP+QR
Sbjct  245   IGVPWIMCKQTNAPDPIINTCNGRHCGDTFAGPNKPHKPSLWTENWTAQYRVFGDPPSQR  304

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K+G+   YYMY+GGTN+GRT+A F TTRYYDE PLDE+GL R+PK
Sbjct  305   SAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLQREPK  363

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             WSHL+D H AL L K+PLF G   + +L    E   +E      C AFL NN++   TS+
Sbjct  364   WSHLKDLHKALNLCKKPLFAGASGVLRLGKETEARFYEKPGTDSCVAFLANNHSKLETSV  423

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG +Y+LP  S S+LPDCKT VFNSQ IVSQHN+R FV SK A +  L WEM  E IP
Sbjct  424   TWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRSKAANK--LNWEMSPEPIP  481

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T++ +P+   +P ELY   KD +DY W++T +     DL  +  I PVL + S+GHA+  
Sbjct  482   TVEQVPVNQKKPQELYHFLKDATDYGWFTTSLNLGPYDLPMKDSIRPVLRIPSLGHAMGV  541

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++GS+HG++++K     +PV  K G N I+LL +  G P+SGA M+ R+ GPR +
Sbjct  542   FVNGEYIGSEHGSHEEKGFVFERPVTFKQGINHISLLCMTVGLPDSGAYMEHRYAGPRTI  601

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  GTL ++ N W H VG++GE L++FTE+G++KV+W         +TWYKTYFDA
Sbjct  602   NVLGLNTGTLDLSQNGWGHRVGLNGENLQVFTEKGAEKVQWTKAVGKGRGLTWYKTYFDA  661

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGM+WVNG SIGR+W+ FLSPLGQP+Q EYHIPR+F+KP  N +V
Sbjct  662   PEGRDPVAIRMTGMGKGMIWVNGLSIGRHWMCFLSPLGQPTQTEYHIPRSFIKPSKNFLV  721

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ  DP  IE++ VNRDTICS  +  +P +VK+++RK  +L+ V      + +LKCP
Sbjct  722   VLEEQDADPKDIEILTVNRDTICSMSTQMHPPHVKAFDRKAGKLKVVAGVPGATAQLKCP  781

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G P+GACG + +G C  P   KIVE+ CLG++ C VP + +LF +  
Sbjct  782   NYKKIVAVEFASFGSPEGACGTYAIGKCDAPGTKKIVEEKCLGQTTCTVPSDPNLFFK--  839

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP++  KTLA+Q KC
Sbjct  840   VDPCPDVKIKTLAIQVKC  857



>gb|KHG26973.1| Beta-galactosidase 13 -like protein [Gossypium arboreum]
Length=819

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/788 (55%), Positives = 582/788 (74%), Gaps = 11/788 (1%)
 Frame = +3

Query  156   SIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGD  335
             SIHYPR PP+ WPD+L++AK GGLN+++TYVFWN+HEPVQG++NFEG+ DLVKFIK+I  
Sbjct  41    SIHYPRSPPDTWPDLLRKAKMGGLNMVETYVFWNVHEPVQGKYNFEGDYDLVKFIKLIQH  100

Query  336   MGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAK  515
               M+  LRVGPF++ EWN GG PYWL+EVP I FR  NEPF  HMKKF  ++++ MK+AK
Sbjct  101   HKMFAMLRVGPFIQGEWNHGGLPYWLREVPNIIFRCDNEPFKMHMKKFVTLVIEKMKQAK  160

Query  516   LFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEA  695
             LFAPQGGPII++QIENEY++I+    A  +    Y+ WAA MA+ L  ++PWIMCKQ +A
Sbjct  161   LFAPQGGPIIVSQIENEYNTIQL---AFKERGDSYVQWAAKMALSLDTKVPWIMCKQKDA  217

Query  696   PPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFA  875
             P  +I+TCNGR CGDTF GPNG NKP +WTENWTAQ+R FGDPP+QRSAE++A+SIIRF 
Sbjct  218   PDPIINTCNGRHCGDTFTGPNGPNKPFLWTENWTAQFRVFGDPPSQRSAEDLAFSIIRFC  277

Query  876   ANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRL  1055
             + KNG+ + YYMY+GGTN+GRT++S+ TTRYYDE PLDEFGL R PKW HL+D H A+ L
Sbjct  278   S-KNGTLVNYYMYHGGTNFGRTSSSYTTTRYYDEAPLDEFGLIRQPKWGHLKDAHRAVNL  336

Query  1056  SKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFRGTQYYLPGFS  1232
              KR LF G+P +QKL  +QE   +E     LC+AFLTNN+T  P +++FRG  Y LP  S
Sbjct  337   CKRALFSGSPFVQKLGPDQEARVWEQPGTSLCSAFLTNNDTKKPQALRFRGQDYQLPPRS  396

Query  1233  TSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPL  1412
              S+LPDCKT VFNSQ I + HN+R FV S +A   +  WEM++E +P  D+   K   P 
Sbjct  397   ISILPDCKTEVFNSQMITTHHNSRNFVRS-VAANKNFNWEMYREVVP--DDPGNKLNEPR  453

Query  1413  ELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGN  1592
             ELY LTKDTSDYAWY T+++   RDL  + +ILPVL V S+GH L  +VNG+++G+ HG+
Sbjct  454   ELYELTKDTSDYAWYITKLDLGRRDLPMKNEILPVLRVASLGHGLHCYVNGKYIGTAHGS  513

Query  1593  NDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVT  1772
               +K+   +KPV+ + G+N I LLG L G P+SGA M+KR+ GPR +TI GL  GTL +T
Sbjct  514   KVEKSFVFQKPVEFQAGSNQIALLGFLVGLPDSGAYMEKRYAGPRSITILGLNTGTLDIT  573

Query  1773  FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDN  1952
              N+WSH VG+ GEK +++T+ G  KV+W         VTWYK YFDAPEG+NPVA++M  
Sbjct  574   LNTWSHQVGLDGEKNQIYTQNGFPKVQWVK-GGPSEGVTWYKGYFDAPEGDNPVAVKMTG  632

Query  1953  MAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIE  2132
             M KGMV++NG++IGRYW+++LSPL +P+Q EYHIPR++++P  NL+V+ E++ GDP  IE
Sbjct  633   MGKGMVYINGRNIGRYWMSYLSPLKRPTQSEYHIPRSYLQPTMNLIVIVEDEKGDPKDIE  692

Query  2133  LVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANY  2312
             +VLV+RDTIC  +++ +  +V+ +E KG +L  + +D++P V L CP  K +  +EFA++
Sbjct  693   IVLVDRDTICGFITEKHLPSVRLFEGKGGKLVALEKDLKPRVELTCPSQKQIVSVEFASF  752

Query  2313  GDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLA  2492
             GDP GACG+++ GNC+ P A ++VEK CLGK  C +P++         + CP +  KTLA
Sbjct  753   GDPFGACGHYVEGNCTSPVAKQVVEKFCLGKPSCNIPLDTPDLHN-KNEACPEM-KKTLA  810

Query  2493  VQAKCGLR  2516
             +QAKC  +
Sbjct  811   IQAKCAFK  818



>ref|NP_179264.2| beta-galactosidase 13 [Arabidopsis thaliana]
 sp|Q9SCU9.1|BGA13_ARATH RecName: Full=Beta-galactosidase 13; Short=Lactase 13; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64749.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEC06532.1| beta-galactosidase 13 [Arabidopsis thaliana]
Length=848

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/801 (54%), Positives = 585/801 (73%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  51    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   G+YVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  111   RADLVKFIKLIEKNGLYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++++DMMK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  171   YVKVVLDMMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWASKLVHSMD  227

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPPAQR
Sbjct  228   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPAQR  287

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL R+PK
Sbjct  288   SVEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEREPK  346

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+  H AL L K+ L  G P ++K  N  EI  +E    K+CAAFL NNNT     I
Sbjct  347   YGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTKVCAAFLANNNTEAAEKI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +P  S S+LPDCKT V+N+  I+S H +R F+ SK A + +  +++F E++P
Sbjct  407   KFRGKEYLIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSKKANK-NFDFKVFTESVP  465

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD SDY WY+T  +  + DLS +    P L + S+GHAL  
Sbjct  466   S--KIKGDSFIPVELYGLTKDESDYGWYTTSFKIDDNDLSKKKGGKPNLRIASLGHALHV  523

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N +T+LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  524   WLNGEYLGNGHGSHEEKSFVFQKPVTLKEGENHLTMLGVLTGFPDSGSYMEHRYTGPRSV  583

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  N W + VG+ GE+L +  EEG +KVKW+  +   P +TWY+TYFD
Sbjct  584   SILGLGSGTLDLTEENKWGNKVGMEGERLGIHAEEGLKKVKWEKASGKEPGMTWYQTYFD  643

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  644   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQIEYHIPRSFLKPKKNLL  703

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +D+  +  LK
Sbjct  704   VIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRKNDQVQAITDDVHLTANLK  763

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G+C+ P + K+VEK CLGK++C +PV KS F++
Sbjct  764   CSGTKKISAVEFASFGNPNGTCGNFTLGSCNAPVSKKVVEKYCLGKAECVIPVNKSTFEQ  823

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP  V K LAVQ KCG
Sbjct  824   DKKDSCPK-VEKKLAVQVKCG  843



>gb|AAD24606.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=832

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/801 (54%), Positives = 585/801 (73%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  35    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   G+YVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  95    RADLVKFIKLIEKNGLYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++++DMMK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  155   YVKVVLDMMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWASKLVHSMD  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPPAQR
Sbjct  212   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPAQR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL R+PK
Sbjct  272   SVEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEREPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+  H AL L K+ L  G P ++K  N  EI  +E    K+CAAFL NNNT     I
Sbjct  331   YGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTKVCAAFLANNNTEAAEKI  390

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +P  S S+LPDCKT V+N+  I+S H +R F+ SK A + +  +++F E++P
Sbjct  391   KFRGKEYLIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSKKANK-NFDFKVFTESVP  449

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD SDY WY+T  +  + DLS +    P L + S+GHAL  
Sbjct  450   S--KIKGDSFIPVELYGLTKDESDYGWYTTSFKIDDNDLSKKKGGKPNLRIASLGHALHV  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N +T+LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  508   WLNGEYLGNGHGSHEEKSFVFQKPVTLKEGENHLTMLGVLTGFPDSGSYMEHRYTGPRSV  567

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  N W + VG+ GE+L +  EEG +KVKW+  +   P +TWY+TYFD
Sbjct  568   SILGLGSGTLDLTEENKWGNKVGMEGERLGIHAEEGLKKVKWEKASGKEPGMTWYQTYFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  628   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQIEYHIPRSFLKPKKNLL  687

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +D+  +  LK
Sbjct  688   VIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRKNDQVQAITDDVHLTANLK  747

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G+C+ P + K+VEK CLGK++C +PV KS F++
Sbjct  748   CSGTKKISAVEFASFGNPNGTCGNFTLGSCNAPVSKKVVEKYCLGKAECVIPVNKSTFEQ  807

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP  V K LAVQ KCG
Sbjct  808   DKKDSCPK-VEKKLAVQVKCG  827



>ref|XP_007131709.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
 gb|ESW03703.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
Length=842

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/798 (53%), Positives = 578/798 (72%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR PPE WP ++ +A+ GG+NVIQTY+FWNIHE  +G+F  + 
Sbjct  51    LIINGKRELLFSGSVHYPRSPPESWPMLIDKARRGGINVIQTYIFWNIHETEKGKFKMDP  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D V+F+++  + GMYVTLR+GPF++AEWN GG PYWL+EVP+I FR+ NEPF  HMK+
Sbjct  111   EYDFVRFMQICHEKGMYVTLRLGPFIQAEWNHGGLPYWLREVPEIIFRSNNEPFKMHMKE  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++ +++ AKLFAPQGGPIILAQIENEY+ I+    A  +    Y+ WAA MA+ + 
Sbjct  171   YTSNVIKVLQDAKLFAPQGGPIILAQIENEYNHIQR---AFREEGTNYVQWAAKMAVAMD  227

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+ CNGR CGDTF GPN  +KP +WTENWTAQYR FGDPP+QR
Sbjct  228   VGVPWIMCKQTDAPDPVINACNGRHCGDTFSGPNKPHKPYLWTENWTAQYRVFGDPPSQR  287

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS + YYMY+GGTN+GRT+++F TTRYYDE PLDEFGL R+PK
Sbjct  288   SAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFSTTRYYDEAPLDEFGLQRNPK  346

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             WSHLRD H AL L ++ LF G   I KL ++ EII +E     LCAAF+TNN+T TP  I
Sbjct  347   WSHLRDVHKALNLCRKALFGGQSVITKLTHHHEIIVYEKPGSDLCAAFITNNHTKTPIDI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG+ Y+LP  S S+LPDCKT VFN+Q++ S+HN+R F  +K    ++LKWE+F E IP
Sbjct  407   KFRGSTYHLPPRSISILPDCKTVVFNTQHVASEHNSRNFRKTK--NSNNLKWEVFTEAIP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                ++P+    P ELY+L +D +DYAWY+T +E    DL  + +I PVL + S+GHAL A
Sbjct  465   NAKDIPVVLNVPTELYSLLRDVTDYAWYTTSVELGPGDLPRKDEISPVLRIMSLGHALHA  524

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F+NGE++G+ HG +++K    +KPV  K G N I++L    G P+SGA M+ R+ GP+ +
Sbjct  525   FINGEYIGTNHGTHEEKGFEFQKPVTFKVGVNYISILACTVGLPDSGAYMEHRYAGPKSI  584

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL +G + +T N W    G+ GE+L +FTE+GS+KV+WK V      ++WYKT F  
Sbjct  585   LILGLNSGKIDLTSNGWGAKAGIRGEELAIFTEQGSKKVEWKEVKGTGSVLSWYKTNFAT  644

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G +PVA+RM  M KGM+W+NGKSIGR+W++FLSPLG P+Q EYHIPR ++ PK+NL+V
Sbjct  645   PDGRDPVAIRMTGMGKGMIWINGKSIGRHWMSFLSPLGTPTQLEYHIPRIYLNPKDNLLV  704

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+  +P  IE+  V+RDT+CS +++  P N+ SW  K  +   VV+ + P+  + CP
Sbjct  705   IFEEERANPEKIEIETVDRDTVCSFITENQPPNINSWACKAGKFLSVVDKLAPAATITCP  764

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +K +EFA++GDP G CG F++G C  P   +IVE+ CLGK  C +PV+ + F +G 
Sbjct  765   TYKTIKAVEFASFGDPTGICGAFVMGKCDAPATKQIVEQHCLGKQSCTIPVDAATFIKG-  823

Query  2454  KDLCPNLVHKTLAVQAKC  2507
             KD CP+++ K+LAVQAKC
Sbjct  824   KDACPDVI-KSLAVQAKC  840



>ref|XP_002886073.1| beta-galactosidase 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62332.1| beta-galactosidase 13 [Arabidopsis lyrata subsp. lyrata]
Length=848

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/801 (53%), Positives = 584/801 (73%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  51    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N PF  H ++
Sbjct  111   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNTPFKEHTER  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++I+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  171   YVKVILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWASKLVHSMD  227

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R +GDPPAQR
Sbjct  228   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVYGDPPAQR  287

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  288   SVEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  346

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P ++K  N  EI  +E    K+CAAFL NNNT +   I
Sbjct  347   YGHLKHLHNALNLCKKALLWGQPRVEKPSNETEIRYYEQPGTKVCAAFLANNNTESAEKI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCKT V+N+  I+S H +R F+ SK A + +  +++F ET+P
Sbjct  407   KFKGKEYIIPHRSISILPDCKTVVYNTGEIISHHTSRNFMKSKKANK-NFDFKVFTETVP  465

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD +DY WY+T  +  + DLS +    P L + S+GHAL  
Sbjct  466   S--KIKGDSYIPVELYGLTKDETDYGWYTTSFKIDDNDLSKKKGSKPTLRIASLGHALHV  523

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KP+ LK G N +T+LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  524   WLNGEYLGNGHGSHEEKSFVFQKPISLKEGENHLTMLGVLTGFPDSGSYMEHRYTGPRSV  583

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  N W + VG+ GEKL +  EEG +KVKW+  +   P +TWY+TYFD
Sbjct  584   SILGLGSGTLDLTEENKWGNKVGMEGEKLGIHAEEGLKKVKWQKFSGKEPGLTWYQTYFD  643

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  644   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQIEYHIPRSFLKPKKNLL  703

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V++NRDT+CS + + Y  +V+ W RK ++++ + +D+  +  LK
Sbjct  704   VIFEEEPNVKPELIDFVIINRDTVCSHIGENYTPSVRHWTRKNDQVQAITDDVHLTASLK  763

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K + ++EFA++G+P+G CGNF +G C+ P + K+VEK CLGK++C +PV KS FQ+
Sbjct  764   CSGTKKISEVEFASFGNPNGTCGNFTLGTCNAPVSKKVVEKYCLGKAECVIPVNKSTFQQ  823

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP  V K LAVQ KCG
Sbjct  824   DKKDSCPK-VEKKLAVQVKCG  843



>ref|XP_008811843.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like [Phoenix 
dactylifera]
Length=867

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/828 (54%), Positives = 575/828 (69%), Gaps = 35/828 (4%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             IDG R++ F+GSIHYPR  PEMWPD++++AK GGLNVIQTYVFWNIHEPVQG FNF G  
Sbjct  48    IDGRRELFFSGSIHYPRSTPEMWPDLIQKAKLGGLNVIQTYVFWNIHEPVQGHFNFSGRY  107

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK+I    MYVTLR+GPF++AEWN GGFPYW+KE+P + FRT NEPF +HM+ F 
Sbjct  108   DLVRFIKLIHKNKMYVTLRLGPFIQAEWNHGGFPYWMKEIPNVIFRTDNEPFKHHMQNFV  167

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               I++MMK  KLF PQGGPIILAQIENEY+ +E    A  +   +Y+ WAA++A+G    
Sbjct  168   TKIMEMMKSEKLFYPQGGPIILAQIENEYNMVED---AYREGGSRYVQWAANLALGFNAG  224

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             IPW+MCKQ  AP  VI+ CNGR CGDTF GPN   KP++WTENWTAQYR FGDPP+QRSA
Sbjct  225   IPWVMCKQKNAPGPVINACNGRNCGDTFTGPNSPTKPNLWTENWTAQYRVFGDPPSQRSA  284

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLY------  1004
             E+IAYS+ RF + KNG+ + YYMY+GGTN+GR  AS+V TRYYDE PLDE+G +      
Sbjct  285   EDIAYSVARFFS-KNGTLVNYYMYHGGTNFGREGASYVMTRYYDEAPLDEYGFFFILNVY  343

Query  1005  ------------------RDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFE  1130
                               ++PK+ HLR+ H ALRLS++ L  G P++Q L    E   FE
Sbjct  344   RLXDTQLFLMRCVHPGLPKEPKFGHLRELHQALRLSRKGLLWGVPSVQPLGPGYEATLFE  403

Query  1131  NQNLKLCAAFLTNNN-TTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARR  1307
             +   K+C AFLTN N     ++ FRG  Y+LP  S S+LPDCKT VFN+Q +  QHNAR 
Sbjct  404   SPESKICVAFLTNTNPRVDGTVNFRGVNYFLPHRSISILPDCKTVVFNTQRVNGQHNART  463

Query  1308  FVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERD  1487
             F  + + G++D KW MFQE IP   +  I   +PLELY +TKD +DY WY+TR    + D
Sbjct  464   FNTADVTGKND-KWYMFQERIPKFRDSGIVASKPLELYNMTKDVTDYMWYTTRFRLEDED  522

Query  1488  LSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLG  1667
             L  R DI PVL V S+GHA+ AFVNG ++GS +G   +K+   +KP++LK G N I++LG
Sbjct  523   LPMRHDIRPVLLVSSLGHAMHAFVNGIYIGSGNGAKLEKSFVFQKPMELKQGVNHISILG  582

Query  1668  VLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQK  1847
             + TGFP++GA ++ R  G     +QGL  GTL ++ N W H VG+ GEKL ++TEEGS+K
Sbjct  583   LTTGFPDNGAYLEHRLAGIHTAAVQGLNIGTLDLSGNKWGHEVGMKGEKLGIYTEEGSKK  642

Query  1848  VKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLG  2027
             VKW    +   PVTWYK YFD P GN+PVAL M  M KG+ WVNG  IGRYWV++LSPLG
Sbjct  643   VKWTEAKSGQ-PVTWYKRYFDMPRGNDPVALDMTGMGKGLAWVNGNCIGRYWVSYLSPLG  701

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             +PSQ  YH+PR ++KPK+NL+V+FEE GG+P  + +V V RD IC+ V++ +P  ++S+ 
Sbjct  702   KPSQSVYHVPRGWLKPKDNLLVIFEEHGGNPEGLLIVTVKRDNICTVVTELHPPAIESFS  761

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
             R+  E++ +V+D +P   LKC   KV++ I FA++G+P GACGNF VG C       IVE
Sbjct  762   REDNEIKTLVQDTKPRAHLKCDNRKVIRSIAFASFGNPTGACGNFTVGTCHSLQTASIVE  821

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRHAKDD  2531
             KACLGK+ C +PV  S  + G+   CP   + TLAVQAKC  R  KDD
Sbjct  822   KACLGKNSCVLPV--SAQEYGADPACPGTTN-TLAVQAKCA-RQKKDD  865



>ref|XP_008377743.1| PREDICTED: beta-galactosidase 13 [Malus domestica]
Length=860

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/798 (54%), Positives = 565/798 (71%), Gaps = 9/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+I F+GSIHYPR   +MWPD+L++AK+GGLNVIQTYVFWN+HEPV+G++NFEG
Sbjct  69    IMINGKREIFFSGSIHYPRSTVDMWPDLLRKAKQGGLNVIQTYVFWNLHEPVKGKWNFEG  128

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFI++I +  MYVTLRVGPF++AEWN GG PYWL+E P I FR+ N  +  HM+ 
Sbjct  129   NADLVKFIRLIQENNMYVTLRVGPFIQAEWNHGGLPYWLREEPNIVFRSDNPTYKQHMEA  188

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+ MMK  KLFAPQGGPIILAQ+ENEY+ ++    A  ++   Y+ WAA MA+   
Sbjct  189   FVXKIMKMMKDEKLFAPQGGPIILAQVENEYTHVQR---AYRELGDSYVQWAAKMALAQN  245

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  +KPS+WTENWTAQYR FGDPP+QR
Sbjct  246   VGVPWIMCKQKDAPDPVINTCNGRHCGDTFPGPNKPHKPSLWTENWTAQYRVFGDPPSQR  305

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + K+G+   YYMY+GGTN+GRT++ F TTRYYDE PLDE+GL R+PK
Sbjct  306   SAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSSIFTTTRYYDEAPLDEYGLQREPK  364

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL+D H AL L K+ L  G P + KL    E   +E     +C AFL NN++   TS+
Sbjct  365   WGHLKDLHKALNLCKKSLLAGAPGVLKLGKETEARFYEKPGTDICVAFLANNHSKLETSV  424

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              +RG  Y+LP  S S+LPDCKT VFNSQ IVSQHN R FV SK A +  L WEM  E IP
Sbjct  425   TWRGQXYFLPPHSISILPDCKTVVFNSQQIVSQHNTRNFVRSKAAKK--LNWEMSPEPIP  482

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T+  +P+   +P ELY L KD +DY W++T ++    DL  +  I PV+ + S+GHA+  
Sbjct  483   TVVQVPVNQKKPQELYHLLKDATDYGWFTTSLDLGPYDLPMKDSIRPVIRIPSLGHAMGV  542

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE++G++HG++ +K     KPV  K G N I+LL +  G P+SGA M+ R+ GPR +
Sbjct  543   FVNGEYIGTEHGSHAEKGFVFEKPVTFKQGLNYISLLCMTVGLPDSGAYMEHRYAGPRTI  602

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             T+ GL  GT+ ++ N W H VG++GE L++FTE+G+QKV+W         +TWYKTYFDA
Sbjct  603   TVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTEKGAQKVQWTKAAGKGRALTWYKTYFDA  662

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+RM  M KGMVWVNG SIGR+W++FLSPLGQP+Q EYHIPR+F+KP  N +V
Sbjct  663   PEGKDPVAIRMTGMGKGMVWVNGLSIGRHWMSFLSPLGQPTQAEYHIPRSFIKPGKNFLV  722

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             V EEQ  DP  IE++ VNRDTICS  S  +P +V ++ERKG + + V      + +LKCP
Sbjct  723   VLEEQDADPKDIEILTVNRDTICSMSSQMHPPHVNAFERKGGKFQIVAGISAATAQLKCP  782

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++G P+G CG + +G+C  P   KIVE+ CLGK+ C VP +  LF +  
Sbjct  783   NYKKIVAVEFASFGTPEGVCGTYAIGSCDAPGTKKIVEEKCLGKTACTVPSDPGLFFK--  840

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP +  K LA+Q  C
Sbjct  841   VDPCPTVKIKRLAIQVLC  858



>gb|KDP29648.1| hypothetical protein JCGZ_18810 [Jatropha curcas]
Length=774

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/802 (54%), Positives = 571/802 (71%), Gaps = 42/802 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +L +GS+HY R   +MWP++L +A+ GGLNVIQTYVFWN+HEPVQGQ+NFEG
Sbjct  14    LIINGKRQLLLSGSVHYTRSTADMWPNILAKARHGGLNVIQTYVFWNVHEPVQGQYNFEG  73

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIKMIG  GMY T+RVGPF+EAEWN GGFPYWL+E+P I FR+ N PF      
Sbjct  74    QYDLVKFIKMIGIYGMYATIRVGPFIEAEWNHGGFPYWLREIPGITFRSDNPPF------  127

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
                                      +IENEY +IE       +   +Y+ WA  MA+GL 
Sbjct  128   -------------------------KIENEYKNIEK---VYKEAGTRYVQWAGTMAVGLK  159

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ++AP  VI+TCNGRQCGDTF GPN  NKPS+WTENWTA YR FGDPP++R
Sbjct  160   TGVPWIMCKQSDAPDPVINTCNGRQCGDTFPGPNRPNKPSLWTENWTAHYRAFGDPPSRR  219

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E++A+S+ R+ + KNG+   YYMY+GGTN+GR+++SF+TTRYYDE PLDE+GL R+PK
Sbjct  220   AVEDLAFSVARWFS-KNGTLANYYMYHGGTNFGRSSSSFITTRYYDEAPLDEYGLQREPK  278

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H+A+RLSK+ L  GTPT Q L NN E   +E     +CAAFL+NN+T  P ++
Sbjct  279   WGHLRDLHSAIRLSKKALLWGTPTTQSLGNNLEARIYEKPGTDMCAAFLSNNDTKLPMTV  338

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  YYLP  S S+LPDCKT V+N+  IVSQHN R FV S++A ++  KW+M++E +P
Sbjct  339   KFRGQNYYLPALSISILPDCKTMVYNTMMIVSQHNVRSFVSSEIANKN-FKWKMYKELVP  397

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   L   + +PLELY+LTKDT+DY WY+T  E ++RDL    D LPVL + S+GHA++A
Sbjct  398   T--QLEETSKKPLELYSLTKDTTDYGWYTTAFELTKRDLPMWKDSLPVLRIESLGHAMLA  455

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGEFVG+ HG+   K+  L K V+LKPGN  ITLLG + G P+SGA M+ R+ GP  V
Sbjct  456   FVNGEFVGAAHGSKVMKSFVLEKSVNLKPGNITITLLGSIMGLPDSGAYMEHRYAGPIGV  515

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             ++ G   GT+ +T N W H VG+ GEK +L+TE+GS+KV W  V    P +TWYKTYF+A
Sbjct  516   SLLGFSKGTVDLTLNGWGHQVGLDGEKNQLYTEDGSKKVTWTEVKKQGPTLTWYKTYFNA  575

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEG +PVA+ MD M KG++W+NGKSIGRYW+++LSPLG P+Q +YHIPRA++K  NNLMV
Sbjct  576   PEGRDPVAINMDGMGKGILWINGKSIGRYWMSYLSPLGSPTQTQYHIPRAYLKSTNNLMV  635

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+  +P  IE+  VNRDTICS + +  P  VKSW RK  ++  V+++++P+ +L CP
Sbjct  636   ILEEEEANPEKIEIFTVNRDTICSYMVEDQPATVKSWTRKRGKVIPVMDNVKPAAQLTCP  695

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K +  +EFA++GDP+GACG +  G C+ P +  +VE+ CLGK  C +P+++ LF +  
Sbjct  696   NYKQIIAVEFASFGDPEGACGRYSFGKCNSPISKLVVEQLCLGKRSCSIPIDRQLF-DNK  754

Query  2454  KDLCPNLVHKTLAVQAKCGLRH  2519
             KD CP  + K LAVQ KCG RH
Sbjct  755   KDDCPG-IQKVLAVQVKCG-RH  774



>ref|XP_010516330.1| PREDICTED: beta-galactosidase 13 isoform X1 [Camelina sativa]
Length=851

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/801 (53%), Positives = 585/801 (73%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  54    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  113

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  114   RSDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  173

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++I+DMMKK KLFA QGGPIIL QIENEYS+++     D     KYI WA+ +   + 
Sbjct  174   YVKVILDMMKKEKLFASQGGPIILGQIENEYSAVQRAYKED---GLKYIKWASKLVHSMD  230

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  231   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPTQR  290

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMYYGGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  291   SVEDIAFSVARFFS-KNGSHVNYYMYYGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  349

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P +++  N  EI  +E    K+CAAFL NNNT +  +I
Sbjct  350   YGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTKVCAAFLANNNTESAENI  409

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCK  V+N+  IVS H +R ++ SK A + +  +++F ET+P
Sbjct  410   KFKGKEYVIPPRSISILPDCKIIVYNTAEIVSHHTSRNYMKSKKANK-NFDFKVFAETVP  468

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD +DY WY+T  +  + DLS R    P L + S+GHAL  
Sbjct  469   S--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKRKGGKPTLRIASLGHALHV  526

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  527   WLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFPDSGSYMEHRYTGPRSV  586

Query  1734  TIQGLMAGTLVVTFN-SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G   +T    W + VG+ GE+L +  EEG +KVKW+ ++   P +TWY+TYFD
Sbjct  587   SILGLSSGPFDLTQQFKWGNKVGMEGERLGIHAEEGLKKVKWQKLSGKEPGLTWYQTYFD  646

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  647   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQVEYHIPRSFLKPKKNLL  706

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +D++ + +LK
Sbjct  707   VIFEEEPNVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRKNDQVQAITDDVQLTAKLK  766

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G C+ P + ++VEK CLGK+QC +PV KS FQ+
Sbjct  767   CSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKYCLGKAQCAIPVNKSTFQQ  826

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP +  K LAVQ KCG
Sbjct  827   DKKDSCPKVARK-LAVQVKCG  846



>ref|XP_009406477.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/782 (55%), Positives = 557/782 (71%), Gaps = 11/782 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++K+AKEGGLN IQTYVFWN HEP+ GQFNFEG  DLVKFIK++   GMYVTLR+G
Sbjct  1     MWPDIIKKAKEGGLNTIQTYVFWNAHEPLYGQFNFEGRYDLVKFIKLVQAHGMYVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EV  I FRT N+P+M+HM++F +MIV  M   KLFAPQGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVANITFRTNNQPYMSHMERFTKMIVQKMNDEKLFAPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+++        +    YI WA +MA+GL   +PW+MCKQN AP  VI+ CNG
Sbjct  121   LAQIENEYNNVARA----FQGGADYIQWAGNMAVGLNVGVPWVMCKQNNAPGPVINACNG  176

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  +KP++WTENWTAQYR FGDPP+QRSAE++AYS+ RF + KNG+   Y
Sbjct  177   RNCGDTFAGPNHPSKPALWTENWTAQYRVFGDPPSQRSAEDLAYSVARFFS-KNGTLTNY  235

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT A+FV TRYYDE PLDE+GL ++PKW HL+D H AL+L ++ L  GTP
Sbjct  236   YMYHGGTNFGRTGAAFVMTRYYDEAPLDEYGLQKEPKWGHLKDLHNALKLCRKGLLWGTP  295

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSI-KFRGTQYYLPGFSTSVLPDCKTA  1262
             ++QK     E   +E    K+C AFLTN N     +  FRG +YYLP  S S+LPDCKT 
Sbjct  296   SVQKFDAGFEARLYEIPESKVCVAFLTNTNAKKDGVMNFRGVEYYLPRHSISILPDCKTV  355

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFNSQ + SQHNAR F  +K A +++ +W+M+ E IPT  +  +    PLEL  +TKDT+
Sbjct  356   VFNSQQVNSQHNARTFDVAK-AAKENNQWQMYTEQIPTSRDANVSAKGPLELLNMTKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T  +  + DL  R DI PVL V ++GHA+ AFVNG+++GS HG   +K+   +K
Sbjct  415   DYLWYTTSFKLDDDDLPMRHDIRPVLQVSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             P+DLK G N I +LG+  G P+SGA ++ R +G   V IQGL AGTL ++ N W H VG+
Sbjct  475   PMDLKAGVNQIAILGLTVGLPDSGAYLEHRLSGVHTVVIQGLNAGTLDLSQNLWRHQVGL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
             +GE L +F E+ +  VKW+   +    VTWYK YFDAP GN+PVA+ M++M KG VW+NG
Sbjct  535   AGENLGIFDEQRANAVKWEEAQS-DTAVTWYKRYFDAPSGNDPVAVDMNSMGKGQVWING  593

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             +SIGR+WV++LSPLG+ SQ  YH+PR+F+KPKNNLMVVFEE GG P  I ++ V RD IC
Sbjct  594   ESIGRFWVSYLSPLGKASQSIYHVPRSFLKPKNNLMVVFEEHGGKPKDIVILTVKRDNIC  653

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             + VS  +P  + +W R+  ++R VV D +P  RLKC E KV++ I FA++G+PDG CGNF
Sbjct  654   TFVSAQHPAQIGTWSREDSQIRSVVGDAKPEARLKCGEKKVIRSIVFASFGNPDGMCGNF  713

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRHA  2522
              VG+C    A  +VEKACLGK  C +PV    +  G+   CP     TLAVQAKC  +  
Sbjct  714   TVGSCHTQQAKSVVEKACLGKESCALPVSAEAY--GADAGCPGTT-STLAVQAKCARKSK  770

Query  2523  KD  2528
             KD
Sbjct  771   KD  772



>ref|XP_010516339.1| PREDICTED: beta-galactosidase 13 isoform X2 [Camelina sativa]
Length=851

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/801 (53%), Positives = 585/801 (73%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  54    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  113

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  114   RSDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  173

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++I+DMMKK KLFA QGGPIIL QIENEYS+++     D     KYI WA+ +   + 
Sbjct  174   YVKVILDMMKKEKLFASQGGPIILGQIENEYSAVQRAYKED---GLKYIKWASKLVHSMD  230

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  231   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPTQR  290

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMYYGGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  291   SVEDIAFSVARFFS-KNGSHVNYYMYYGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  349

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P +++  N  EI  +E    K+CAAFL NNNT +  +I
Sbjct  350   YGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTKVCAAFLANNNTESAENI  409

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCK  V+N+  IVS H +R ++ SK A + +  +++F ET+P
Sbjct  410   KFKGKEYVIPPRSISILPDCKIIVYNTAEIVSHHTSRNYMKSKKANK-NFDFKVFAETVP  468

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD +DY WY+T  +  + DLS +    P L + S+GHAL  
Sbjct  469   S--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKKKGGKPTLRIASLGHALHV  526

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  527   WLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFPDSGSYMEHRYTGPRSV  586

Query  1734  TIQGLMAGTLVVTFN-SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G   +T    W + VG+ GE+L +  EEG +KVKW+ ++   P +TWY+TYFD
Sbjct  587   SILGLSSGPFDLTQQFKWGNKVGMEGERLGIHAEEGLKKVKWQKLSGKEPGLTWYQTYFD  646

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  647   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQVEYHIPRSFLKPKKNLL  706

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +D++ + +LK
Sbjct  707   VIFEEEPNVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRKNDQVQAITDDVQLTAKLK  766

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G C+ P + ++VEK CLGK+QC +PV KS FQ+
Sbjct  767   CSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKYCLGKAQCAIPVNKSTFQQ  826

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP +  K LAVQ KCG
Sbjct  827   DKKDSCPKVARK-LAVQVKCG  846



>gb|KDP29649.1| hypothetical protein JCGZ_18811 [Jatropha curcas]
Length=844

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/797 (55%), Positives = 576/797 (72%), Gaps = 49/797 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GSIHYPR  P+MWP+++ +AK+GGLNVIQTYVFWNIHEPV+G+++FEG
Sbjct  43    LIINGKRELLFSGSIHYPRSTPDMWPELITKAKQGGLNVIQTYVFWNIHEPVKGEYHFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKF+K+I + GMY TLR+GPF++AEWN GG PYWL+E+P I FR+YNEPFMN M K
Sbjct  103   RFDVVKFMKIIQEKGMYATLRLGPFIQAEWNHGGLPYWLREIPNIIFRSYNEPFMNEMVK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  MI+D MK+ KLF PQGGPI+LAQIENEY++++    A  ++  KY+ WA + A+GL 
Sbjct  163   FITMIIDKMKEEKLFYPQGGPIVLAQIENEYNTVQL---AYRELGDKYVQWAGNFALGLN  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ   P  VI++CNGR CGDTF GP+  NKP +WTENWTAQ+R FGDPPAQR
Sbjct  220   VGVPWVMCKQKNPPGPVINSCNGRHCGDTFVGPDKPNKPYLWTENWTAQFRVFGDPPAQR  279

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+ A+S+ R+ + KNGS + YYMY+GGTN  RT ASFVTTRYYDE PLDEFGL R PK
Sbjct  280   SAEDAAFSVARWFS-KNGSLVNYYMYHGGTNLDRTAASFVTTRYYDEAPLDEFGLQRQPK  338

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+D H AL L K+ LF G+P ++KL  +QE+  +E    KLCAAFLTNN+T   S +
Sbjct  339   YGHLKDLHRALGLCKKALFWGSPGVEKLGKDQEVRFYEQPAEKLCAAFLTNNDTREGSFV  398

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG ++YLP  S SVLPDCKT VFNS  +VSQHN+R F+ S  A + +LKWEM  ETI 
Sbjct  399   KFRGKEFYLPPRSISVLPDCKTVVFNSMQVVSQHNSRNFLRSNEANK-NLKWEMTSETIL  457

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T   L + +  P ELY+LTKDT+DYAWY+T +  + RDLS R DILPVL V S+GHA++A
Sbjct  458   T--QLKMDSKVPKELYSLTKDTTDYAWYTTVMILNPRDLSMRKDILPVLRVASLGHAMLA  515

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+                                       +SGA M+ RF GPR V
Sbjct  516   FVNGQL--------------------------------------DSGAYMEHRFAGPRGV  537

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFD  1910
              I GL  GTL V+ N W H VG++G+  K +TEEG +KV WK V     PP+TWYK YFD
Sbjct  538   EILGLNTGTLDVSSNGWGHQVGLTGQNEKWYTEEGLKKVTWKEVPQGKGPPLTWYKAYFD  597

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEG  PVA+ M  M KGM+W+NG+ IGRYW+++LSPLGQP+Q EYHIPR+++KPKNNL+
Sbjct  598   APEGCKPVAISMIGMVKGMIWINGQCIGRYWMSYLSPLGQPTQPEYHIPRSYLKPKNNLV  657

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+ EE+  +P  IE+VLV+RDTICS + + +P +VKSW R+  +   V++D++P+  LKC
Sbjct  658   VIMEEEPSNPERIEIVLVDRDTICSFIGESHPPHVKSWARQDNKFIPVLDDVKPAAHLKC  717

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P D+ +  +EFA++GDP GACG FI GNC+  N+ ++VE+ C+GK+ C VP+E+ LF + 
Sbjct  718   PADRKIVAVEFASFGDPYGACGGFIAGNCTSANSKQVVEQHCMGKASCDVPIERELFDK-  776

Query  2451  SKDLCPNLVHKTLAVQA  2501
             + D CP+ + KTLAVQ 
Sbjct  777   NNDPCPD-IRKTLAVQV  792



>ref|XP_006299920.1| hypothetical protein CARUB_v10016129mg [Capsella rubella]
 gb|EOA32818.1| hypothetical protein CARUB_v10016129mg [Capsella rubella]
Length=849

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/802 (53%), Positives = 585/802 (73%), Gaps = 14/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTY FWN+HEP QG+FNF G
Sbjct  53    LIVNGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYTFWNVHEPEQGKFNFSG  112

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  113   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  172

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  173   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWASKLVHSMD  229

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPSMWTENWT Q+R FGDPP QR
Sbjct  230   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSMWTENWTTQFRVFGDPPTQR  289

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  290   SAEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  348

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G   ++K  N  EI  +E    K+CAAFL NNNT    +I
Sbjct  349   YGHLKHLHNALNLCKKALLWGQSRVEKPNNETEIRYYEQPGTKVCAAFLANNNTEAAETI  408

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCKT V+N+  IVSQH +R F+ SK A +    +++F ET+P
Sbjct  409   KFKGKEYVIPPRSISILPDCKTVVYNTAEIVSQHTSRNFMKSKKANK-KFDFKVFTETVP  467

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLS-TRGDILPVLDVYSMGHALV  1550
             +   +   +  P ELY LTKD +DYAWY+T  +  + DLS T+G   P + + S+GHAL 
Sbjct  468   S--KIKGDSYVPAELYGLTKDETDYAWYTTSFKVDDSDLSKTKGK--PTVRIASLGHALH  523

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              ++NGE++GS HG++++K+   +KPV LK G N +T+LGVLTGFP+SG+ M+ R+TGPR 
Sbjct  524   VWLNGEYLGSGHGSHEEKSFVFQKPVSLKEGENHLTMLGVLTGFPDSGSYMEHRYTGPRS  583

Query  1731  VTIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
             V+I GL +G L +T  N+W + VG+ GEKL +  +EG +KVKW+ ++   P +TWY+TYF
Sbjct  584   VSIVGLSSGPLDLTEENTWGNKVGMEGEKLGIHAKEGLEKVKWEKLSGKAPGLTWYQTYF  643

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL
Sbjct  644   DAPESQSAAAIRMNGMGKGLIWVNGQGVGRYWMSFLSPLGQPTQIEYHIPRSFLKPKKNL  703

Query  2088  MVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             +V+FEE+    P  I+ V++NRDT+CS + + Y  +V+ W +K ++L+ + +D+  +  L
Sbjct  704   LVIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVRHWTKKKDQLQAITDDVHLTASL  763

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             KC   K +  +EFA++G+P+G CGNF +G+C+ P + ++VEK CLGK++C +PV K+ FQ
Sbjct  764   KCSGTKKITTVEFASFGNPNGTCGNFTLGSCNAPVSKQVVEKYCLGKAECLIPVNKNTFQ  823

Query  2445  EGSKDLCPNLVHKTLAVQAKCG  2510
             +  KD CP  V K LAVQ KCG
Sbjct  824   QDKKDSCPK-VAKKLAVQVKCG  844



>ref|XP_006409401.1| hypothetical protein EUTSA_v10022550mg [Eutrema salsugineum]
 gb|ESQ50854.1| hypothetical protein EUTSA_v10022550mg [Eutrema salsugineum]
Length=846

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/801 (53%), Positives = 583/801 (73%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R+++++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWNIHE  QG+FNF G
Sbjct  50    LIINGKRELIYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNIHEYEQGKFNFSG  109

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  110   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  169

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  +I+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WAA +   + 
Sbjct  170   YVRVILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWAAKLVHSMN  226

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR
Sbjct  227   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDHKPSLWTENWTTQFRVFGDPPTQR  286

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL ++PK
Sbjct  287   SAEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEKEPK  345

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G    +K     EI  +E    K+CAAFL NNNT +   I
Sbjct  346   YGHLKHLHNALNLCKKALLWGQSRTEKPGKETEIRYYEQPGTKVCAAFLANNNTESAEKI  405

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCKT V+N++ IVS H AR FV SK A +    +++F ET+P
Sbjct  406   KFKGKEYVIPPRSISILPDCKTVVYNTKEIVSHHTARNFVKSKKANK-QFDFKVFTETVP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  E  + +L  +G + P L + S+GHAL  
Sbjct  465   S--KLKGDSYVPVELYGLTKDETDYGWYTTNFEIDDNELKKKG-VKPTLRIASLGHALHV  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+    KPV LK G N +TLLGVLTGFP+SG+ M+ R+TGPR V
Sbjct  522   WLNGEYIGNGHGSHEEKSFVFLKPVSLKEGENHLTLLGVLTGFPDSGSYMEHRYTGPRSV  581

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  S W + VG+ GE+L +  E+G +KVKW+  +   P +TWY+TYFD
Sbjct  582   SILGLSSGTLDLTEKSKWGNKVGMEGERLGIHAEKGLKKVKWEKFSKKAPGLTWYQTYFD  641

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLG+P+Q EYHIPR+F+KPK NL+
Sbjct  642   APESQSATAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGKPTQIEYHIPRSFLKPKKNLL  701

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+C+ + + Y  +V+ W +K ++++ + +D+  +  LK
Sbjct  702   VIFEEEPNVKPELIDFVIVNRDTVCTYIGEEYTPSVRHWTKKNDQVQAIGDDVHLTANLK  761

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G+CGNF +G+C+ P + +++EK CLGK++C +PV KS+FQ+
Sbjct  762   CSGTKKISAVEFASFGNPTGSCGNFTLGSCNAPVSKQVIEKYCLGKAECVIPVNKSMFQQ  821

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP +V KTLAVQ KCG
Sbjct  822   DKKDSCPKVV-KTLAVQVKCG  841



>ref|XP_006412163.1| hypothetical protein EUTSA_v10024392mg [Eutrema salsugineum]
 gb|ESQ53616.1| hypothetical protein EUTSA_v10024392mg [Eutrema salsugineum]
Length=844

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/801 (54%), Positives = 576/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPHIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NE F  H ++
Sbjct  108   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEAFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  168   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN   KPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKEYKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL ++PK
Sbjct  285   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +   S S+LPDCKT V+N+  IVSQH AR F+ SK A +    +++F E +P
Sbjct  404   KFRGKEYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSKKANK-KFDFQVFTEALP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  +  E  L  +G +  V+ + S+GHAL  
Sbjct  463   S--KLQGDSYIPVELYGLTKDKTDYGWYTTSFKVHENHLPKKG-VKSVVRIASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  520   WLNGEYIGNGHGSHEEKSFVFQKPVTLKAGENHLIMLGVLTGFPDSGSYMEHRYTGPRSV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + VG+ GE+L + TE+G +KVKW+  +   P +TWY+TYFD
Sbjct  580   SILGLTSGTLDLTESSKWGNKVGMEGERLGIHTEKGLKKVKWQKFSGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N  A+RM  M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  640   APESQNAAAIRMSGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK++C +PV KS FQ+
Sbjct  760   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVVEKHCLGKAECVIPVNKSTFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N V KTLAVQ KCG
Sbjct  820   DKKDSCKNFV-KTLAVQVKCG  839



>ref|XP_002867095.1| beta-galactosidase 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43354.1| beta-galactosidase 11 [Arabidopsis lyrata subsp. lyrata]
Length=844

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/801 (53%), Positives = 577/801 (72%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  47    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPQQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+PF  H ++
Sbjct  107   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKPFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ +LFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  167   YVRMILDKMKEERLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMK  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  224   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDPPTQR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAYSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H+AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHSALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKTCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +   S S+LPDCKT V+N+  IVSQH +R F+ SK A +    +++F ET+P
Sbjct  403   KFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSKKANK-KFDFKVFTETLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  +  +  L T+  +   + + S+GHAL  
Sbjct  462   S--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKGVKTFVRIASLGHALHI  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++GS HG++++K+   +K V LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  520   WLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLIMLGVLTGFPDSGSYMEHRYTGPRGV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + +G+ GEKL + TEEG +KV+WK  T   P +TWY+ YFD
Sbjct  580   SILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKKFTGKAPGLTWYQAYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N  A+RM+ M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  640   APESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  ++ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELMDFVIVNRDTVCSYVGENYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + +++EK CLGK++C +PV KS FQ+
Sbjct  760   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKHCLGKAECVIPVNKSTFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N V KTLAVQ KCG
Sbjct  820   DKKDSCKN-VAKTLAVQVKCG  839



>ref|XP_010530895.1| PREDICTED: beta-galactosidase 11-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010530896.1| PREDICTED: beta-galactosidase 11-like isoform X2 [Tarenaya hassleriana]
Length=836

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/800 (53%), Positives = 578/800 (72%), Gaps = 14/800 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GS+HYPR  P+MWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  42    LIINGKRELLYSGSVHYPRSTPDMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  102   NADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKEFKEHTER  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I++ MK  KLFA QGGPIIL QIENEYS+++     D     KYINWA+D+   + 
Sbjct  162   YVRTIIEKMKDEKLFASQGGPIILGQIENEYSAVQRAYKDD---GLKYINWASDLVHSMN  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  219   LGIPWVMCKQNDAPDPIINACNGRHCGDTFPGPNRPNKPSLWTENWTTQFRVFGDPPTQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL ++PK
Sbjct  279   SVEDIAFSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    ++
Sbjct  338   YGHLKHLHNALNLCKKPLLWGQPRSEKPGPDTEIRYYEQPGTKSCAAFLANNNTEVSVAV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+G  Y +P  S S+LPDCKT V+N+  IVSQH +R FV SK   +   ++ +F E++P
Sbjct  398   NFKGRNYIIPPRSISILPDCKTIVYNTAQIVSQHTSRNFVRSKKTNK-KFEFSVFSESVP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY L KD +DYAWY+T  +  ++DL+ +    P L + S+GHAL  
Sbjct  457   --KGLDGDSYIPVELYGLNKDKTDYAWYTTSFKVEKKDLTEKK---PTLRIASLGHALHV  511

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NG+++G  HG++++K+   +KPVDLK G N + +LGVLTG+P+SG+ M+ R+TGPR V
Sbjct  512   WMNGKYIGKAHGSHEEKSFVFQKPVDLKQGVNHLAMLGVLTGYPDSGSYMEHRYTGPRGV  571

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             ++ GL +GT+ +T  N W + VG+ GEKL + TEEG +KVKW+      P +TWYKTYFD
Sbjct  572   SLLGLNSGTVDLTEHNKWGNKVGMEGEKLGIHTEEGLKKVKWQKFYGNAPGLTWYKTYFD  631

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N VA+RM+ M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+F+KP  NL+
Sbjct  632   APESQNSVAIRMNGMGKGLIWVNGNGVGRYWMSFLSPLGEPTQTEYHIPRSFLKPTQNLL  691

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+ G  P SI+ V+VNRDT+CS +++ Y  +V+ W RK +E++ + + +  +  LK
Sbjct  692   VIFEEEPGVKPESIDFVIVNRDTVCSYIAEDYAPSVRHWARKKDEIQAITKGVHLTASLK  751

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + +++EKACLGK++C +PV K  FQ+
Sbjct  752   CSGAKKIVAVEFASFGNPTGTCGNFTLGTCNAPVSKQVIEKACLGKAECVIPVNKGTFQQ  811

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
               KD CP  V KTLAVQ KC
Sbjct  812   DKKDPCPKTV-KTLAVQVKC  830



>ref|XP_010432357.1| PREDICTED: beta-galactosidase 11-like [Camelina sativa]
Length=844

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/801 (54%), Positives = 577/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTY FWN+HEP QGQFNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYTFWNVHEPEQGQFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+PF  H ++
Sbjct  108   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  168   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINVCNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  285   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   FGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVSQH AR F+ SK A +    +++F ET+P
Sbjct  404   KFRGRDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSKKANKKS-DFKVFTETLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  + ++ DL  +G +   + V S+GHAL  
Sbjct  463   S--KLDGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLPKKG-VKTSVRVASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++GS HG++++K+   +KPV +K G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  520   WLNGEYLGSGHGSHEEKSFVFQKPVTIKAGENHLIMLGVLTGFPDSGSYMEHRYTGPRGV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T NS W + VG+ GE+L + TEEGS+KVKW+      P +TWY+TYFD
Sbjct  580   SILGLTSGTLDLTENSKWGNKVGMEGERLGVHTEEGSKKVKWQKFNGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N  A+RM+ M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK N +
Sbjct  640   APESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNHL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELIDFVIVNRDTVCSYIGENYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK+ C++PV KS F++
Sbjct  760   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKHCLGKAHCEIPVNKSTFEQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V K LAVQ KCG
Sbjct  820   DKKDSCKNVV-KMLAVQVKCG  839



>ref|XP_010447011.1| PREDICTED: beta-galactosidase 11 [Camelina sativa]
Length=844

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/801 (54%), Positives = 575/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTY FWN+HEP QGQFNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYTFWNVHEPEQGQFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+PF  H ++
Sbjct  108   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  168   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  285   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   FGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVSQH AR F+ SK A +    +++F ET+P
Sbjct  404   KFRGKDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSKKANK-KFDFKVFTETLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  + ++ DL  +G +   + V S+GHAL  
Sbjct  463   S--KLEGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLPKKG-VKTSVRVASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++GS HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  520   WLNGEYLGSGHGSHEEKSFVFQKPVTLKAGENHLIMLGVLTGFPDSGSYMEHRYTGPRGV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  S W + VG+ GE+L + TEEGS+KVKW+      P +TWY+TYFD
Sbjct  580   SILGLTSGTLDLTEASKWGNKVGMEGERLGVHTEEGSKKVKWEKFNGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N  A+RM+ M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK N +
Sbjct  640   APESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNHL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  ++ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELMDFVIVNRDTVCSYVGENYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK+ C +PV KS F++
Sbjct  760   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKHCLGKAHCAIPVNKSTFEQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V K LAVQ KCG
Sbjct  820   DKKDSCKNVV-KMLAVQVKCG  839



>ref|XP_010941319.1| PREDICTED: beta-galactosidase 11-like isoform X2 [Elaeis guineensis]
Length=826

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/806 (54%), Positives = 561/806 (70%), Gaps = 28/806 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GSIHYPR  PEMWPD++++AK GGLNVIQTYVFWN+HEPVQG FNF G
Sbjct  46    IMINGRRELFFSGSIHYPRSTPEMWPDLIQKAKRGGLNVIQTYVFWNVHEPVQGHFNFTG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK+I    +                 GFPYWLKE+P I FRT NEPF  HM+ 
Sbjct  106   RYDLVRFIKLIHKHKI-----------------GFPYWLKEIPGIVFRTDNEPFKYHMQN  148

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   I+DMMK  KLF PQGGPIILAQIENEY+ +E+    D     KY+ WAA++A+G  
Sbjct  149   FVTKIMDMMKSEKLFFPQGGPIILAQIENEYNMVEAAYRED---GLKYVQWAANLALGFN  205

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ  AP  VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGDPP+QR
Sbjct  206   AGIPWVMCKQKNAPGPVINACNGRNCGDTFTGPNSPTKPSIWTENWTAQYRVFGDPPSQR  265

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS+ RF +N NG+ + YYMY+GGTN+GR  AS+V TRYYDE PLDE+GL ++PK
Sbjct  266   SAEDIAYSVARFFSN-NGALVNYYMYHGGTNFGREGASYVMTRYYDEAPLDEYGLPKEPK  324

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HLRD H AL+LS++ L  G P++Q L    E   +E+ + K+C AFLTN N  T  ++
Sbjct  325   YGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSKVCVAFLTNTNPRTDATV  384

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG  Y+LP  S S+LPDCKT +FN+Q + +QHN+R F  +    ++D KW MFQE IP
Sbjct  385   NFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAGETNKND-KWHMFQERIP  443

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                N  I + +PLELY +TKDT+DY WY+TR    + DL  R DI PVL V S+GHA+ A
Sbjct  444   KFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPDIRPVLLVSSLGHAMHA  503

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG ++GS +G   +K+   +KP++LK G N I++LG+  GFP++GA ++ R  G    
Sbjct  504   FVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFPDNGAYLEHRLAGIHTA  563

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL ++ N W H VG+ GEKL +FTEEGS+KV+W    N   PVTWYK YFD 
Sbjct  564   AIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQWTEAKN-DKPVTWYKRYFDM  622

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PVAL M  M KG+ WVNG  IGRYWV++LSPLG+PSQ  YHIPR ++KPK+NL+V
Sbjct  623   PRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHIPREWLKPKDNLLV  682

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG P  I +V V RD IC+ V++++P  +KS+ R+  E++ +V+D++P   LKC 
Sbjct  683   IFEEHGGKPEGILIVTVKRDNICTVVTEFHPPTIKSFSREDNEIKTLVQDVKPRAYLKCD  742

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
             ++KV++ I FA++G+P GACGNF VG C  P A  +VEKACL K+ C +PV    +  G+
Sbjct  743   DNKVIRSIAFASFGNPTGACGNFTVGTCHSPQAASVVEKACLEKNSCVLPVSAQAY--GA  800

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
                CP     TL VQAKC  R  KDD
Sbjct  801   DPACPGTT-STLVVQAKCA-RKKKDD  824



>gb|KFK30139.1| hypothetical protein AALP_AA7G221900 [Arabis alpina]
Length=843

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/801 (53%), Positives = 576/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  47    LIVDGKRELLYSGSIHYPRSTPEMWPHIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   G+YVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RADLVKFIKLIHKNGLYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKEFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++D MK+  LFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  167   YVRTVLDKMKEENLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  224   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNRENKPSLWTENWTTQFRVFGDPPTQR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H+AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHSALNLCKKPLLWGQPRTEKPSKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVSQH +R F+ SK A +    +++F ET+P
Sbjct  403   KFRGKDYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSKKANK-KFDFKVFTETLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD SDY WY+T  +  +  L  +G    V  + S+GHAL  
Sbjct  462   S--KLEGDSYIPVELYGLTKDKSDYGWYTTSFKVQKNHLPKKGAKTTV-RIASLGHALHV  518

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  519   WLNGEYLGNGHGSHEEKSFVFQKPVTLKAGENHLVMLGVLTGFPDSGSYMEHRYTGPRSV  578

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T NS W + VG+ GE+L + TE+GS+KVKW+  +     +TWY+TYFD
Sbjct  579   SILGLSSGTLDLTENSKWGNKVGMEGERLGIHTEKGSKKVKWEKFSGKQSGLTWYQTYFD  638

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  639   APESVSAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNLL  698

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +VK W RK ++++ + +++  +  LK
Sbjct  699   VIFEEEPNVKPELIDFVIVNRDTVCSFVGENYTPSVKHWTRKQDQVQAITDNVSLTATLK  758

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + +++EKACLGK++C +PV KS FQ+
Sbjct  759   CSGTKKISAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKACLGKAECVIPVNKSTFQQ  818

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KCG
Sbjct  819   DKKDSCKNVV-KTLAVQVKCG  838



>ref|XP_009386767.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=769

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/775 (54%), Positives = 555/775 (72%), Gaps = 11/775 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++++A+ GGLNVIQTYVFWNIHEP+ GQFNF+G  DLV FIK++   GMYVTLR+G
Sbjct  1     MWPDIIQKAQHGGLNVIQTYVFWNIHEPLYGQFNFQGRYDLVGFIKLVQKNGMYVTLRLG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GGFP+WL+EV  I FRT NEPF +HM++FA  IV MMK  KLFA QGGPII
Sbjct  61    PFIQAEWNHGGFPFWLREVANITFRTDNEPFKHHMERFARTIVQMMKDEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L QIENEY+++        +   KYI WA +MA+GL   +PW+MCKQN+AP  VI+ CNG
Sbjct  121   LLQIENEYNNVARA----FEGGSKYIQWAGNMAVGLGAGVPWVMCKQNDAPGPVINACNG  176

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  +KPS+WTENWTAQYR FGDPP+QRSAE+IAYS+ RF + KNG+   Y
Sbjct  177   RNCGDTFTGPNHPSKPSLWTENWTAQYRVFGDPPSQRSAEDIAYSVARFFS-KNGTLTNY  235

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT A+F+ TRYYDE PLDE+G+ ++PKW HLRD H AL+L ++ L  GTP
Sbjct  236   YMYHGGTNFGRTGAAFMMTRYYDEAPLDEYGMEKEPKWGHLRDLHHALKLCRKGLLWGTP  295

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKTA  1262
             ++Q      E   +E     +C AFLTN N     ++ FRG +YYLP  S S+LPDCKT 
Sbjct  296   SVQAFDKGFEARLYEIPESHVCVAFLTNTNRKEDGTVSFRGEEYYLPRRSISILPDCKTV  355

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFNSQ + +QHNAR F  +K +   + +W+M  + IPT+ +  + +  PLEL  LTKDT+
Sbjct  356   VFNSQRVNAQHNARTFDVAKESSMKN-QWQMTSDLIPTLRHASVISKGPLELMNLTKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T  +    DL  R DI PVL V ++GHA+ AFVNG+++GS HG   +K+   +K
Sbjct  415   DYLWYTTSFKLDADDLPRRQDIRPVLQVSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             P+DL  G N I +LG+  G P+SGA ++ R  G   V IQGL AGTL ++ + W H VG+
Sbjct  475   PMDLNAGTNHIAILGLTVGLPDSGAYLEHRLAGVHTVVIQGLNAGTLDLSHSVWGHQVGL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
             +GE L +F+E+G   VKW+   +   PV WYK YFDAP G++PVAL M++M KG+VW+NG
Sbjct  535   TGETLGIFSEKGVNAVKWEEAKS-DTPVMWYKRYFDAPSGHDPVALEMNSMGKGLVWING  593

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
             +SIGRYW+++L+PLG+ SQ  YH+PR+F+KPK+NLMVVFEE GG P  I+++ V RD IC
Sbjct  594   ESIGRYWISYLNPLGKASQSVYHVPRSFLKPKDNLMVVFEEHGGKPEDIQIMTVKRDDIC  653

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             + VSD +P +V+SW R+  ++R V +D +P  RLKC   KV++ I+FA++G+P G CGNF
Sbjct  654   TVVSDLHPAHVRSWSRENSKIRSVDDDAKPEARLKCTGKKVIQSIDFASFGNPGGMCGNF  713

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
               G+C  P A  + EKACLGK  C +PV    +  G+   CP  +  TLAVQAKC
Sbjct  714   TTGSCHTPQAKAVAEKACLGKESCVLPVAPEAY--GADVGCPETM-ATLAVQAKC  765



>ref|NP_567973.1| beta-galactosidase 11 [Arabidopsis thaliana]
 sp|Q9SCV1.1|BGA11_ARATH RecName: Full=Beta-galactosidase 11; Short=Lactase 11; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64747.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86446.1| beta-galactosidase 11 [Arabidopsis thaliana]
Length=845

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/801 (53%), Positives = 575/801 (72%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPQQGKFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  108   RADLVKFIKLIQKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKQFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ +LFA QGGPIIL QIENEYS+++     D      YI WA+++   + 
Sbjct  168   YVRMILDKMKEERLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASNLVDSMK  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNRENKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  285   SVEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   YGHLKHLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKTCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +   S S+LPDCKT V+N+  IVSQH +R F+ SK A +    +++F ET+P
Sbjct  404   KFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSKKANK-KFDFKVFTETLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  +  +  L T+  +   + + S+GHAL A
Sbjct  463   S--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKGVKTFVRIASLGHALHA  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++GS HG++++K+   +K V LK G N + +LGVLTGFP+SG+ M+ R+TGPR +
Sbjct  521   WLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLVMLGVLTGFPDSGSYMEHRYTGPRGI  580

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + +G+ GEKL + TEEG +KV+WK  T   P +TWY+TYFD
Sbjct  581   SILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKKFTGKAPGLTWYQTYFD  640

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +   +RM  M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  641   APESVSAATIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNLL  700

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  ++  +VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  701   VIFEEEPNVKPELMDFAIVNRDTVCSYVGENYTPSVRHWTRKKDQVQAITDNVSLTATLK  760

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + +++EK CLGK++C +PV KS FQ+
Sbjct  761   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKHCLGKAECVIPVNKSTFQQ  820

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V K LAVQ KCG
Sbjct  821   DKKDSCKNVV-KMLAVQVKCG  840



>ref|XP_010437540.1| PREDICTED: beta-galactosidase 11-like [Camelina sativa]
Length=844

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/801 (54%), Positives = 574/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTY FWN+HEP QGQFNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYTFWNVHEPEQGQFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+PF  H ++
Sbjct  108   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  168   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  285   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   FGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVSQH AR F+ SK A +    +++F ET+P
Sbjct  404   KFRGRDYVIAPRSISILPDCKTVVYNTAQIVSQHTARNFMKSKKANK-KFDFKVFTETLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  + ++ DL  +G +   + V S+GHAL  
Sbjct  463   S--KLEGDSYIPVELYGLTKDKTDYGWYTTSFKVNKNDLPKKG-VKTSVRVASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++N E++GS HG++++K+   +K V LK G N + +LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  520   WLNREYLGSGHGSHEEKSFVFQKSVTLKAGENHLIMLGVLTGFPDSGSYMEHRYTGPRGV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T NS W + VG+ GE+L + TEEGS+KVKW+      P +TWY+TYFD
Sbjct  580   SILGLTSGTLDLTENSKWGNKVGMEGERLGVHTEEGSKKVKWEKFNGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N  A+RM+ M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK N +
Sbjct  640   APESLNAAAIRMNGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNHL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  ++ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELMDFVIVNRDTVCSYVGENYIPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK+ C +PV KS F++
Sbjct  760   CSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKHCLGKAHCAIPVNKSTFEQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V K LAVQ KCG
Sbjct  820   DKKDSCKNVV-KMLAVQVKCG  839



>ref|XP_009136326.1| PREDICTED: beta-galactosidase 13 [Brassica rapa]
Length=846

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/801 (53%), Positives = 577/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  P+MWP ++KRAK+GGLN IQTYVFWN HE  QG+FNF G
Sbjct  50    LIINGKRELLYSGSIHYPRSTPDMWPKIIKRAKQGGLNTIQTYVFWNFHELEQGKFNFSG  109

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+E+P I FRT N+PF  H ++
Sbjct  110   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREIPGIFFRTDNKPFKEHTER  169

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  +I+DMMK+ KLFAPQGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  170   YVRVILDMMKEEKLFAPQGGPIILGQIENEYSAVQRAYKND---GSNYIKWASKLVHSMN  226

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R +GDPP QR
Sbjct  227   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNREHKPSLWTENWTTQFRVYGDPPVQR  286

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  287   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  345

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+  H AL L K+ L  G    +K   + EI  +E    K+CAAFL NNNT     I
Sbjct  346   YGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTKVCAAFLANNNTESAEII  405

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +P  S S+LPDCKT V+++  IVS H AR F+ SK A +    +++F ET+P
Sbjct  406   KFRGKDYVIPPRSISILPDCKTVVYSTGEIVSHHTARNFMKSKKANK-KFDFKVFTETVP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY L KD SDY WY+T  +  + DL  +G   P + V S+GHAL A
Sbjct  465   --QELKGDSYVPVELYGLAKDESDYGWYTTNFKIDDSDLKKKGG-KPTVRVASLGHALHA  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++D+K+   +KP+ LK G+N +T+LGVLTGFP+SG+ ++ RFTGPR V
Sbjct  522   WLNGEYLGNGHGSHDEKSFVFQKPIALKEGDNHLTMLGVLTGFPDSGSYLEHRFTGPRSV  581

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G + +T  S W + VG+ GEKL + TE+G +KVKW+  +   P +TWY+TYFD
Sbjct  582   SISGLSSGPMDLTEKSKWGNKVGMEGEKLDIHTEKGLKKVKWEKFSGKAPGLTWYQTYFD  641

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +P A+RM+ M KG++WVNG+ +GRYW++FLSPLG+ +Q EYHIPR+F+KPK NL+
Sbjct  642   APESLSPAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGKSTQIEYHIPRSFLKPKKNLL  701

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+   +P  I+ V+VNRDT+CS + + Y  +V+ W RK + ++ + +D++ +  LK
Sbjct  702   VIFEEEPNVNPELIDFVIVNRDTVCSYIGEDYTPSVRHWARKNDNVQAITDDVQLTANLK  761

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G+CGNF  G+C  P   ++VEK CLGK++C +PV KS FQE
Sbjct  762   CSGTKKISAVEFASFGNPTGSCGNFTRGSCHAPVTKQVVEKYCLGKAECVIPVNKSTFQE  821

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP +V KTLAVQ KCG
Sbjct  822   DKKDSCPKVV-KTLAVQVKCG  841



>ref|XP_010468659.1| PREDICTED: beta-galactosidase 13-like [Camelina sativa]
Length=827

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/801 (51%), Positives = 565/801 (71%), Gaps = 36/801 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  55    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  114

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +DLVKFI++I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H ++
Sbjct  115   RSDLVKFIRLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTER  174

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++I+DMMKK KLFA QGGPIIL QIENEYS+++     D     KYI WA+ +   + 
Sbjct  175   YVKVILDMMKKEKLFASQGGPIILGQIENEYSAVQRAYKED---GLKYIKWASKLVHSMD  231

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW++CKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  232   LGIPWVVCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPTQR  291

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S                           GTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  292   SG--------------------------GTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  325

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P +++  N  EI  +E    K+CAAFL NNNT +  +I
Sbjct  326   YGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTKVCAAFLANNNTESAENI  385

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCKT V+N+  IVS H AR ++ SK A ++   +++F ET+P
Sbjct  386   KFKGKEYVIPPRSISILPDCKTVVYNTAEIVSHHTARNYMKSKKANKN-FDFKVFTETVP  444

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   +   +  P+ELY LTKD +DY WY+T  +  + DLS      P L + S+GHAL  
Sbjct  445   S--KIKGDSYVPVELYGLTKDETDYGWYTTSFKIDDSDLSKNKGGKPTLRIASLGHALHV  502

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KPV LK G N +++LGVLTGFP+SG+ M+ R+TGPR V
Sbjct  503   WLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLSMLGVLTGFPDSGSYMEHRYTGPRSV  562

Query  1734  TIQGLMAGTLVVTF-NSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G L +T  N W + VG+ GE+L +  EEG +KVKW+ ++   P +TWY+TYFD
Sbjct  563   SILGLSSGPLDLTEQNKWGNKVGMEGERLGIHAEEGLEKVKWQKLSGKEPGLTWYQTYFD  622

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FL PLGQP+Q EYHIPR+F+KPK NL+
Sbjct  623   APESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLPPLGQPTQIEYHIPRSFLKPKKNLL  682

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS + + Y  +V+ W RK ++++ + +D++ + +LK
Sbjct  683   VIFEEEANVKPELIDFVIVNRDTVCSFIGENYTPSVRHWTRKNDQVQAITDDVQLTAKLK  742

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G C+ P + ++VEK CLGK+QC +PV KS FQ+
Sbjct  743   CSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKYCLGKAQCAIPVNKSTFQQ  802

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP  V K LAVQ KCG
Sbjct  803   DKKDSCPK-VAKKLAVQVKCG  822



>ref|XP_010431800.1| PREDICTED: beta-galactosidase 14 [Camelina sativa]
Length=913

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/802 (53%), Positives = 578/802 (72%), Gaps = 16/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  PEMWP ++ +AK GGLN IQTYVFWN+HEP QG+++F G
Sbjct  64    LIINGKRELLFSGSVHYPRSTPEMWPSIIDKAKAGGLNTIQTYVFWNVHEPEQGKYDFSG  123

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEW+ GG PYWL+EVP++ FRT NEPF  H ++
Sbjct  124   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWSHGGLPYWLREVPEVYFRTDNEPFKEHTER  183

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPI+L QIENEY++++     +    ++YI WAA++   + 
Sbjct  184   YVRKILGMMKEEKLFASQGGPIVLGQIENEYNAVQLAYKEN---GERYIKWAANLVESMK  240

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  241   LGIPWVMCKQNDAPDNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  300

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G  ++PK
Sbjct  301   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGFEKEPK  359

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLR  H ALRL K+ LF G   +QKL  + E+   E    K+CAAFL+NNNT  T +I
Sbjct  360   YGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTKVCAAFLSNNNTRETNTI  419

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+    + LK+EMF E IP
Sbjct  420   KFNGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKTTSEGLKFEMFHENIP  479

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY+T I+  E DL  +     +L V S+GHAL+ 
Sbjct  480   S--RLGGDSLIPGELYYLTKDKTDYAWYTTSIKIEEDDLPNKKGSKTILRVASLGHALIV  537

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G+ HG+++ K+    KPV+LK G+N I++LGVLTG P+SG+ M+ R+ GPR V
Sbjct  538   YVNGEYAGNAHGSHEMKSFVFEKPVNLKTGDNHISILGVLTGLPDSGSYMEHRYAGPRAV  597

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GT  +T N+ W H  G+ GEK +++TEEGS+KV+W+       P+ WYKTYF+
Sbjct  598   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVQWEK-DGERKPLIWYKTYFE  656

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM--KPKNN  2084
              PEG N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FM  K K N
Sbjct  657   TPEGENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEPTQTEYHIPRSFMKEKKKKN  716

Query  2085  LMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G    +I+ VLVNRDTICS V + YP +VKSW+R+G ++    +D++    
Sbjct  717   MLVILEEEPGVKLDAIDFVLVNRDTICSYVREDYPVSVKSWKREGPKIVSRSKDMKLKAV  776

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP +K +  +EFA++GDP G CGNF +G CS   + ++VEK CLGK++C + V +  F
Sbjct  777   MKCPPEKQMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVVEKTCLGKNRCSIVVARETF  836

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
               G K  CP +V KTLAVQ KC
Sbjct  837   --GDKG-CPEIV-KTLAVQVKC  854



>ref|XP_010489252.1| PREDICTED: beta-galactosidase 13-like [Camelina sativa]
Length=835

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/802 (52%), Positives = 572/802 (71%), Gaps = 30/802 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  PEMWP+++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  55    LIINGNRELLYSGSIHYPRSTPEMWPNIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  114

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT NEPF  H +K
Sbjct  115   RSDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNEPFKEHTEK  174

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  +I+DMMKK  LFA QGGPIIL QIENEYS+++     D     KYI WA+ +   + 
Sbjct  175   YVRVILDMMKKENLFASQGGPIILGQIENEYSAVQRAYKED---GLKYIKWASKLVHSMD  231

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  232   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPTQR  291

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  292   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  350

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P +++  N  EI  +E    K+CAAFL NNNT +  +I
Sbjct  351   YGHLKHLHNALNLCKKALLWGQPRVERPSNETEIRYYEQPGTKVCAAFLANNNTESAENI  410

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNA-RRFVPSKLAGRDDLKWEMFQETI  1370
             KF+G +Y +P  S S+LPDCKT V+N+  +++   +  + +  K+ G   +         
Sbjct  411   KFKGKEYVIPPRSISILPDCKTIVYNTAEVMTNSKSCSKSIKEKIKGDSYV---------  461

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
                         P+ELY LTKD +DY WY+T  +  + DLS R    P L + S+GHAL 
Sbjct  462   ------------PVELYGLTKDETDYGWYTTSFKIDDSDLSKRKGGKPTLRIASLGHALH  509

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              ++NGE++G+ HG++++K+   +KPV LK G N + +LGVLTGFP+SG+ M+ R+TGPR 
Sbjct  510   VWLNGEYLGNGHGSHEEKSFVFQKPVSLKEGENHLAMLGVLTGFPDSGSYMEHRYTGPRS  569

Query  1731  VTIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
             V+I GL +G L +T  N W + VG+ GE+L +  EEG +KVKW+ ++   P +TWY+TYF
Sbjct  570   VSILGLSSGPLDLTEQNKWGNKVGMEGERLGIHAEEGLKKVKWQKLSGKEPGLTWYQTYF  629

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL
Sbjct  630   DAPESQSAAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQVEYHIPRSFLKPKKNL  689

Query  2088  MVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             +V+FEE+    P  I+ V++NRDT+CS + + Y  +V+ W RK ++++ + +D++ + +L
Sbjct  690   LVIFEEEPNVKPELIDFVIINRDTVCSFIGENYTPSVRHWTRKNDQVQAITDDVQLTAKL  749

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             KC   K +  +EFA++G+P+G CGNF +G C+ P + ++VEK CLGK+QC +PV KS FQ
Sbjct  750   KCSGTKKISAVEFASFGNPNGTCGNFTLGTCNAPVSKQVVEKYCLGKAQCAIPVNKSTFQ  809

Query  2445  EGSKDLCPNLVHKTLAVQAKCG  2510
             +  KD CP  V K LAVQ KCG
Sbjct  810   QDKKDSCPK-VAKKLAVQVKCG  830



>emb|CDX75479.1| BnaA01g02230D [Brassica napus]
Length=845

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/801 (53%), Positives = 568/801 (71%), Gaps = 10/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R++LF+GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  47    LIVDGKRELLFSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RADLVKFIKLIQKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKQFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI W + +   + 
Sbjct  167   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GVNYIKWGSKLVNSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPSMWTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSMWTENWTTQFRVFGDAPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    +++F E +P
Sbjct  403   KFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKQANKKKFDFKVFTEPLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY LTKD SDY WY+T  +  E  L  +      L + S+GHAL  
Sbjct  463   --KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLPKKKGAKTNLRIASLGHALHV  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++D+K+   +KPV LK G N + +LGVLTGFP+SG+ ++ R+TGPR V
Sbjct  521   WLNGEYLGNGHGSHDEKSFVFQKPVTLKAGENHLVMLGVLTGFPDSGSYLEHRYTGPRSV  580

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + VG+ GE+L + TE+G +KVKW+  +   P +TWY+TYFD
Sbjct  581   SILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWEKFSGKAPGITWYQTYFD  640

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  641   APESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  700

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V  W RK +E++ + +++  +  LK
Sbjct  701   VIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVGHWIRKQDEVKAITDNVSLTATLK  760

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK++C +PV KS FQ+
Sbjct  761   CSGNKKITAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEKHCLGKAECVIPVNKSTFQQ  820

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  821   DKKDSCKNVV-KTLAVQVKCA  840



>ref|XP_006826593.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
 gb|ERM93830.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
Length=850

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/805 (54%), Positives = 565/805 (70%), Gaps = 19/805 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++ F+GSIHYPR  P+MWPD++ +AKEGG+NVI TYVFWN HEPV+G+FNF+G
Sbjct  51    LIIDGRRELFFSGSIHYPRSTPDMWPDLIAKAKEGGINVISTYVFWNAHEPVEGKFNFKG  110

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               +LVKFIK+I   G+YV LR+GPF+EAEWN GGFPYWL+E P I FRT N+PF  +MK+
Sbjct  111   RYNLVKFIKLIQKQGLYVILRIGPFIEAEWNHGGFPYWLREKPGIIFRTDNQPFKYYMKR  170

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIES---DRPADIKIQKKYINWAADMAM  647
             +A+MIV+MM K +LFAPQGGPIIL QIENEY++++    +R AD      Y+ WA +MA+
Sbjct  171   YAKMIVNMMNKNELFAPQGGPIILTQIENEYNNVQQVFKERGAD------YVQWAGNMAL  224

Query  648   GLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPP  827
              L   +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQYR  GDPP
Sbjct  225   KLNTGVPWIMCKQKDAPGAVINTCNGRNCGDTFTGPNSPNKPSLWTENWTAQYRVLGDPP  284

Query  828   AQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYR  1007
             +QR AE++A+++ R+ + K+G+ + YYMY+GGTN+GRTT+SFVTTRYYDE PLDE+GL R
Sbjct  285   SQRPAEDLAFAVARWFS-KHGTLVNYYMYHGGTNFGRTTSSFVTTRYYDEAPLDEYGLVR  343

Query  1008  DPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TP  1184
             +PKW HLRD H AL+LS++ L  GT +   L +  E   ++N    +C+AFL NNNT   
Sbjct  344   EPKWGHLRDLHRALKLSRKALLWGTHSNYSLGHQLEARVYQNSEKNVCSAFLANNNTREA  403

Query  1185  TSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQE  1364
              +I F+   YYLP  S S+LPDCKT VFN++ + +QHNAR F   K   +  ++W+MF++
Sbjct  404   ATIYFQNVPYYLPPRSISILPDCKTVVFNTKKVNAQHNARTFHHVKDFSK-GMRWKMFKD  462

Query  1365  TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             +IP  ++ P++N   LE Y  TKDT+D+ WY+T I+    DL     I P+L V S GHA
Sbjct  463   SIPNTEDTPVQNSLLLEHYNATKDTTDFLWYTTNIDVGSNDLPLLNSIKPILQVASWGHA  522

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  FVN  +VGS HG++     SL KP+ LKPG N I+LL + TGFPNSG  M+ +  G 
Sbjct  523   VHGFVNDLYVGSSHGDHVQSPFSLNKPITLKPGKNKISLLSMTTGFPNSGGYMEHKIAGV  582

Query  1725  RDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT-NVHPPVTWYKT  1901
               V IQGLM GT  +  N W H VG+ GEKL+++    S+KVKW     + H P+ WYK 
Sbjct  583   SKVLIQGLMTGTQDLINNIWGHQVGLLGEKLEVYNPRSSKKVKWVDAKGHDHEPLIWYKR  642

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKN  2081
             +FDAP G++PVAL M +M KG +WVNG+SIGRYWV++L+PLG PSQ  YHIPR+F+KPK 
Sbjct  643   HFDAPAGSDPVALDMSSMGKGEIWVNGQSIGRYWVSYLTPLGLPSQSVYHIPRSFLKPKR  702

Query  2082  NLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE--DIRPS  2255
             NL+V+ EE GG+P  I L  V RD IC  VS+ +P  VK +ER   +++ +V   +++P 
Sbjct  703   NLLVILEETGGNPRRITLENVRRDIICGFVSENHPPKVKDFERSDSQIKALVHESELQPM  762

Query  2256  VRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKS  2435
             + L CP D V++ I+FA++G+P G C  F  G C    A  IVEKACLGK  C V    S
Sbjct  763   LNLHCPSDNVIQTIDFASFGNPIGICSAFATGTCHSAVAKDIVEKACLGKESCVVSALPS  822

Query  2436  LFQEGSKDLCPNLVHKTLAVQAKCG  2510
              F     DLCP  + KTLAVQA+CG
Sbjct  823   NF---GTDLCPGTI-KTLAVQARCG  843



>ref|XP_009107264.1| PREDICTED: beta-galactosidase 11 [Brassica rapa]
Length=845

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/801 (53%), Positives = 568/801 (71%), Gaps = 10/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R++LF+GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  47    LIVDGKRELLFSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RADLVKFIKLIQKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKQFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  MI+D MK+ KLFA QGGPIIL QIENEYS+++     D      YI W + +   + 
Sbjct  167   YVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWGSKLVDSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPSMWTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSMWTENWTTQFRVFGDAPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    +++F E +P
Sbjct  403   KFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKQANKKKFDFKVFTEPLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY LTKD SDY WY+T  +  E  L  +      L + S+GHAL  
Sbjct  463   --KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLPKKKGAKTNLRIASLGHALHV  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++D+K+   +KPV LK G N + +LGVLTGFP+SG+ ++ R+TGPR V
Sbjct  521   WLNGEYLGNGHGSHDEKSFVFQKPVTLKAGENHLVMLGVLTGFPDSGSYLEHRYTGPRSV  580

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + VG+ GE+L + TE+G +KVKW+  +   P +TWY+TYFD
Sbjct  581   SILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWEKFSGKAPGITWYQTYFD  640

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  641   APESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  700

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V  W RK +E++ + +++  +  LK
Sbjct  701   VIFEEEPNVKPELIDFVIVNRDTVCSFVGENYTPSVGHWIRKQDEVKAITDNVSLTATLK  760

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK++C +PV KS FQ+
Sbjct  761   CSGNKKIAAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEKHCLGKAECVIPVNKSTFQQ  820

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  821   DKKDSCKNVV-KTLAVQVKCA  840



>ref|XP_010690373.1| PREDICTED: beta-galactosidase 13-like [Beta vulgaris subsp. vulgaris]
Length=829

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/799 (53%), Positives = 572/799 (72%), Gaps = 10/799 (1%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R++L++GS+HYPR+P E W ++L + KEGGLNVIQTYVFWN+HEPV+GQ+NF G N
Sbjct  39    INGNRELLYSGSVHYPRVPVEEWENILDKCKEGGLNVIQTYVFWNVHEPVKGQYNFTGQN  98

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             D+V+FIK+IG+ GM+VTLRVGPF++AEWN GG+P+WL++   IA+RT N  F  HM+++ 
Sbjct  99    DIVRFIKLIGEKGMWVTLRVGPFVQAEWNNGGYPFWLRKELNIAYRTDNSVFKAHMERWV  158

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               I+ +MK+ +LF+ QGGPIIL+Q+ENEY +I           ++YI WAADMA+G    
Sbjct  159   TKIISLMKENELFSSQGGPIILSQVENEYDTIRE--AYRFGAAERYIRWAADMAVGQKTG  216

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ +AP +VI+ CNGR CGDTF GPN  NKPS+WTENWTAQ+R FGD P+QR+A
Sbjct  217   VPWLMCKQKDAPGEVINACNGRHCGDTFSGPNAPNKPSLWTENWTAQFRVFGDVPSQRAA  276

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E+ A+ + R+ + KNGS+  YYMYYGGTNY RT A+F TTRYYDE PLDE+GL R+PKW 
Sbjct  277   EDTAFGVARWFS-KNGSHTNYYMYYGGTNYERTAAAFSTTRYYDEAPLDEYGLKREPKWG  335

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKF  1199
             HLRD H +L LSK+ +  G   ++K   + E   +     KLCAAFL NN T  + ++KF
Sbjct  336   HLRDLHRSLALSKKAILAGRYGVEKFGPDLEARYYTKG--KLCAAFLWNNKTHSSGTVKF  393

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
             RG ++ LP  S S+LPDC+T VFN+  IVSQH+AR FV S+ A +  LKWE   E IPT 
Sbjct  394   RGIEHTLPPKSISILPDCRTVVFNTDYIVSQHSAREFVRSEKAHKG-LKWEKTHEHIPTK  452

Query  1380  DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFV  1559
              +   ++  P E +   +D SDY WY+TRIE    DL  R    PVL    +GHA+ AFV
Sbjct  453   FDRYARD--PQEQFHFGEDKSDYLWYTTRIELDNVDLPLRKSFQPVLWEKHLGHAVHAFV  510

Query  1560  NGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTI  1739
             NGEFVG+KHG + D   + + PV LK G N+IT+L  + G P+SG+ M+KR+TG +++ +
Sbjct  511   NGEFVGTKHGIHRDPGFTFQAPVRLKEGVNNITILSTVVGMPDSGSNMEKRWTGLKNLGL  570

Query  1740  QGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPE  1919
               L  G L ++FN W H +G+ GEKL+ FTEEG++K KW P       +TWYK YFDAPE
Sbjct  571   LSLGTGNLDLSFNGWHHKIGMEGEKLQYFTEEGAKKAKWTPAEGAGELLTWYKAYFDAPE  630

Query  1920  GNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVF  2099
             G+ P+A+RM+NM KGMVWVNGKSIGRYW +FLS   +PSQ EYHIPRAF+K K+NL+V+F
Sbjct  631   GDEPLAIRMENMTKGMVWVNGKSIGRYWSSFLSVKKEPSQKEYHIPRAFLKAKDNLLVIF  690

Query  2100  EEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPED  2279
             +E GG+  ++++  VNRD ICS V +  P +V SW+R   E    ++D+RP   L+CP++
Sbjct  691   DESGGNIDTVQIETVNRDIICSYVGEDMPPSVMSWKRDEGEFLAAIDDLRPKASLECPKN  750

Query  2280  KVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKD  2459
             KV+ ++EFA++G+P+G CG F++GNCS P    IVE+ CLGK +C +PV++ L  + +K 
Sbjct  751   KVISRVEFASFGNPNGVCGYFLLGNCSSPLTQNIVEQHCLGKERCTIPVDRKLLDKDNKK  810

Query  2460  LCPNLVHKTLAVQAKCGLR  2516
              C  +  KTLAVQ +C L+
Sbjct  811   -CAGVSSKTLAVQVRCSLK  828



>ref|XP_010548094.1| PREDICTED: beta-galactosidase 11 [Tarenaya hassleriana]
Length=838

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/801 (52%), Positives = 575/801 (72%), Gaps = 14/801 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GS+HYPR  P+MWP+++ RAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  44    LIINGKRELLYSGSVHYPRSTPDMWPNIIMRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  103

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  104   NADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKQFKEHTER  163

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I++ MK+ KLFA QGGPIIL QIENEYS+++     D      YINWAA++   + 
Sbjct  164   YVRTIIEKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GMNYINWAANLVDSMN  220

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR
Sbjct  221   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKEHKPSLWTENWTTQFRVFGDPPTQR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  281   SVEDIAFSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  339

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P   K   + EI  +E    K CAAFL NNNT +  ++
Sbjct  340   YGHLKQLHNALNLCKKALLWGQPRSMKPDQDTEIRYYEQPGTKACAAFLANNNTESAVAV  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+G  Y +P  S S+LPDCKT V+N+  I+SQH +R F+ SK A +   ++ +F E++P
Sbjct  400   NFKGRNYIVPPRSISILPDCKTVVYNTAQILSQHTSRNFIKSKKANK-KFEFNVFSESVP  458

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY L KD +DYAWY+T  +  + +L  +    P L + S+GHAL  
Sbjct  459   --KGLDGDSYIPVELYGLAKDKTDYAWYTTSFKVGKNELLNKK---PTLRIASLGHALHV  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NG+++G+ HG++++K+   +K V+LK G N + +LGVLTG+P+SG+ M+ R+TGPR V
Sbjct  514   WINGKYIGNAHGSHEEKSFVFQKAVNLKEGVNHLAMLGVLTGYPDSGSYMEHRYTGPRGV  573

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             ++ GL +GT+ +T  N W + VG+ GEKL + TEEG +KVKW+      P +TWY+TYFD
Sbjct  574   SLLGLRSGTVDLTEHNKWGNKVGMEGEKLGIHTEEGLKKVKWQKFDGNSPGMTWYQTYFD  633

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N VA+RM  M KG++WVNGK +GRYW++FLSP G+P+Q EYHIPR+F+KPK NL+
Sbjct  634   APESQNSVAIRMKGMGKGLIWVNGKGVGRYWMSFLSPQGEPTQTEYHIPRSFLKPKQNLL  693

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P SI+ V+VNRD +CS V + Y  +V+ W RK +EL+ +   +  +  LK
Sbjct  694   VIFEEEPDVKPESIDFVIVNRDKVCSYVGEDYSPSVRHWTRKKDELQAINNGVHLTASLK  753

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G+C+ P + +++EK CLGK++C++PV K  FQ+
Sbjct  754   CSGTKKITAVEFASFGNPTGTCGNFTLGSCNAPISKQVIEKYCLGKAECEIPVNKGEFQQ  813

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
             G KD CP +V KTLAVQ KCG
Sbjct  814   GRKDSCPKVV-KTLAVQVKCG  833



>ref|XP_010446366.1| PREDICTED: beta-galactosidase 14-like [Camelina sativa]
Length=889

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/802 (53%), Positives = 578/802 (72%), Gaps = 16/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  PEMWP ++ +AK GGLN IQTYVFWN+HEP QG+++F G
Sbjct  46    LIINGKRELLFSGSVHYPRSTPEMWPSIIDKAKAGGLNTIQTYVFWNVHEPEQGKYDFSG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEW+ GG PYWL+EVP+I FRT N+PF  H ++
Sbjct  106   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWSHGGLPYWLREVPEIYFRTDNKPFKEHTER  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPI+L QIENEY++++     +    ++YI WAA++   + 
Sbjct  166   YVRKILGMMKEEKLFASQGGPIVLGQIENEYNAVQLAYKEN---GERYIKWAANLVESMK  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  223   LGIPWVMCKQNDAPDNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G  ++PK
Sbjct  283   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGFEKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLR  H ALRL K+ LF G   +QKL  + E+   E    K+CAAFL+NNNT  T +I
Sbjct  342   YGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTKVCAAFLSNNNTRETNTI  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+    + LK+EMF E I 
Sbjct  402   KFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKTTSEGLKFEMFHENIA  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY+T I+    DL  +  +  +L V S+GHAL+ 
Sbjct  462   S--KLGGDSLIPGELYYLTKDKTDYAWYTTSIKIEADDLPDKKGLKTILRVASLGHALIV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G+ HG+++ K+    KP++LK G+N I++LGVLTG P+SG+ M+ R+ GPR V
Sbjct  520   YVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISILGVLTGLPDSGSYMEHRYAGPRAV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GT  +T N+ W H  G+ GEK +++TE+GS+KV+W+       P+TWYKTYF+
Sbjct  580   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQWEK-DGERKPLTWYKTYFE  638

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM--KPKNN  2084
              PEG N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FM  K K N
Sbjct  639   TPEGENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEPTQTEYHIPRSFMKEKKKKN  698

Query  2085  LMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G    +I+ VLVNRDTICS V + YP +VKSW+R+G ++    +D++    
Sbjct  699   MLVILEEEPGVKLEAIDFVLVNRDTICSFVGENYPVSVKSWKREGPKIVSRSKDMKLKAV  758

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP +K +  +EFA++GDP G CGNF +G CS   + ++VEK CLGK++C + V +  F
Sbjct  759   MKCPPEKQMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVVEKTCLGKNRCSIVVARETF  818

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
               G K+ C  +V KTLAVQ KC
Sbjct  819   --GGKE-CSEIV-KTLAVQVKC  836



>ref|XP_009121204.1| PREDICTED: beta-galactosidase 13-like [Brassica rapa]
Length=846

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/801 (52%), Positives = 575/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  P+MWP ++KRAK+GGLN IQTYVFWN+HEPVQG+FNF G
Sbjct  50    LIINGKRELLYSGSIHYPRSTPDMWPKIIKRAKQGGLNTIQTYVFWNVHEPVQGKFNFSG  109

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR GPF++AEWN GG PYWL+EVP I FRT N+PF  H ++
Sbjct  110   RADLVKFIKLIEKNGMYVTLRPGPFIQAEWNHGGLPYWLREVPGIFFRTDNKPFKEHTER  169

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             + ++I+D MK+ KLFA QGGPIIL QIENEYS++E     D      YI WAA +   + 
Sbjct  170   YVKVILDKMKEEKLFASQGGPIILGQIENEYSAVERAYKED---GVNYIKWAAKLVDSMN  226

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCK N AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPPA R
Sbjct  227   LGIPWVMCKHNSAPDPMINACNGRHCGDTFPGPNKKNKPSLWTENWTTQFRVFGDPPAHR  286

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL R+PK
Sbjct  287   SVEDIAYSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEREPK  345

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G    +K   + EI  +E    K+CAAFL NNNT    +I
Sbjct  346   YGHLKLLHNALNLCKKALLWGHSRTEKPGKDTEIRYYEQPGTKVCAAFLANNNTEAAETI  405

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G ++ +P  S S+LPDCKT V+++  ++SQH +R +V SK A +    +++F ET+P
Sbjct  406   KFKGKEHVIPPRSISILPDCKTVVYSTAEVISQHTSRNYVKSKKANK-KFDFKVFTETVP  464

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L  ++  P+ELY LT+D +DY WY+T  +  + DL  +G     L + S+GHAL  
Sbjct  465   --GELKGESFIPVELYGLTEDVTDYGWYTTNFKIDDNDLKKKGG-KTTLRIASLGHALHV  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +K V LK G N +T+LGVLTGFP+SG+ ++ R+TGPR V
Sbjct  522   WLNGEYLGNGHGSHEEKSFVFQKQVSLKEGENHLTMLGVLTGFPDSGSYLEHRYTGPRSV  581

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G L +T  N W + VG+ GEKL +  E+G +KVKW+  +   P +TWY+T FD
Sbjct  582   SILGLSSGPLDLTEKNKWGNKVGMEGEKLGIHAEKGLKKVKWQKFSGKAPGLTWYQTRFD  641

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  N VA+RM+ M KG++WVNG+ +GRYW++FLSPL  P+Q EYHIPR+F+KPK NL+
Sbjct  642   APESKNSVAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLKNPTQVEYHIPRSFLKPKKNLL  701

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V++NRDT+CS + + Y  +V+ W +K ++++ + +D+  +  LK
Sbjct  702   VIFEEEPNVKPELIDFVIINRDTVCSYIGENYTPSVRHWTKKNDKVQAIADDVFLTANLK  761

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P G CGNF +G+C+ P + +++EK CLGKS+C +PV KS FQ+
Sbjct  762   CSGTKKIAAVEFASFGNPTGTCGNFTLGSCNAPASKQVIEKYCLGKSECDIPVNKSTFQQ  821

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP +V K LAVQ KCG
Sbjct  822   DKKDSCPKVV-KMLAVQVKCG  841



>gb|KFK36758.1| hypothetical protein AALP_AA4G166000 [Arabis alpina]
Length=848

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/801 (52%), Positives = 574/801 (72%), Gaps = 12/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++K+AK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  52    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKKAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  111

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  112   RGDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNDQFKEHTER  171

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  +++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  172   YVRVVIDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GLNYIKWASKLVHSMN  228

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  229   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSLWTENWTTQFRVFGDPPTQR  288

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  289   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  347

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+  H AL L K+ L  G    +K  ++ EI  +E    K+CAAFL NNNT     I
Sbjct  348   YGHLKHLHNALNLCKKALLWGQSRTEKPSDDTEIRYYEQPGTKVCAAFLANNNTEAAEKI  407

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +P  S S+LPDCKT V+N+  IVS H AR F+ SK A +    +++F ET+P
Sbjct  408   KFKGKEYVIPPRSISILPDCKTVVYNTAEIVSHHTARNFMKSKKANK-KFDFKVFTETVP  466

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L  ++  P+ELY LTKD SDY WYST  +  + DL  +      L + S+GHAL  
Sbjct  467   --KELKGESYVPVELYGLTKDESDYGWYSTSFKIDDDDLKKK-GGKTTLRIASLGHALHV  523

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++++K+   +KP+ LK G N +T+LGVLTGFP+SG+ M+ R+TGPR +
Sbjct  524   WLNGEYLGNGHGSHEEKSFVFQKPISLKEGENHLTMLGVLTGFPDSGSYMEHRYTGPRSI  583

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T  S W + VG+ GEKL +  E+G  +VKW+  +   P +TWY+TYFD
Sbjct  584   SILGLSSGTLDLTEKSKWGNKVGMEGEKLGIHAEKGLNEVKWQKFSGKAPGLTWYQTYFD  643

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM+ M KG++WVNG+ +GRYW++FLSPLGQP+Q EYHIPR+F+KPK NL+
Sbjct  644   APESVSATAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQPTQVEYHIPRSFLKPKKNLL  703

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V++NRDT+CS + + Y  +V+ W RK ++++ + +D+  +  LK
Sbjct  704   VIFEEEPNVKPEKIDFVIINRDTVCSYIGEEYTPSVRHWTRKNDQIQAISDDVHLTANLK  763

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C   K +  +EFA++G+P+G CGNF +G+C+ P + +++EK CLGK+ C +PV KS FQ+
Sbjct  764   CSGTKKIAAVEFASFGNPNGTCGNFTLGSCNAPVSKQVIEKYCLGKAACVIPVNKSTFQQ  823

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD CP  V K LAVQ KCG
Sbjct  824   DKKDSCPK-VPKKLAVQVKCG  843



>ref|XP_004292170.1| PREDICTED: beta-galactosidase 13-like [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/779 (55%), Positives = 554/779 (71%), Gaps = 14/779 (2%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD+L++A+ GGLNVIQTYVFWNIHEP +GQ+NFEGN DLVKFI+MI D GMY TLRVG
Sbjct  1     MWPDILRKARRGGLNVIQTYVFWNIHEPEKGQWNFEGNYDLVKFIRMIQDNGMYATLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EVP + FR+ N P+  HM+++   I+ +MK  KLF+PQGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVPDVIFRSDNAPYKKHMEEYVTKIMKLMKDNKLFSPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY++I+    A  ++   Y+ WAA++A+G    +PW+MCKQ +AP  VI+TCNG
Sbjct  121   LAQIENEYNAIQL---AYRELGDSYVQWAANLAVGQNIGVPWVMCKQVDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  NKP++WTENWTAQYR FGDPP+QR AE+IA+S+ RF + K GS   Y
Sbjct  178   RHCGDTFVGPNKPNKPALWTENWTAQYRVFGDPPSQRPAEDIAFSVARFFS-KGGSLTNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A F TTRYYDE PLDE+   R+PKWSHL+D H ++ L K+ L  G P
Sbjct  237   YMYHGGTNFGRTSAVFTTTRYYDEAPLDEYAFQREPKWSHLKDLHKSINLCKKTLLTGIP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
               Q+L  + E+  +E    + CAAF+ NN+TT   ++ +RG  Y LP FS SVLPDCKT 
Sbjct  297   GTQRLGPDTEVRFYEKPGTE-CAAFIANNHTTLEATVNWRGQNYLLPPFSISVLPDCKTV  355

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFN+Q IVSQHNAR FV S       + WEM+ E + T++ +P+ N    ELY L KD +
Sbjct  356   VFNTQQIVSQHNARNFVTSA----KQMNWEMYLEPVATVEQVPVNNRELQELYGLLKDKT  411

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DYAWY+T IE    DL  +  I PV+ + S+GHA++ FVN E+ GS+HG + +K      
Sbjct  412   DYAWYTTSIELGPYDLPMKDTISPVVRIPSLGHAMLVFVNDEYAGSQHGTHAEKGFVFEA  471

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             PV +K G N I+LL +  G P+SGA M+ R+ GPR VTI GL  GT+ V+ N W H  G+
Sbjct  472   PVKMKKGTNHISLLCMTVGLPDSGAYMEHRYAGPRSVTILGLNTGTIDVSANGWGHRAGL  531

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
             +GEKL++FTE+G+QKV+W   T +   +TWYKT FDAP G +P A+RM  M KGM+WVNG
Sbjct  532   NGEKLQVFTEQGAQKVQWTKATGIGRALTWYKTTFDAPPGGDPCAIRMTGMGKGMIWVNG  591

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
              SIGR+W++FLSPLGQP+Q EYHIPRAF+KPK NL+VV EE+  DP  IE+V VNRDTIC
Sbjct  592   ISIGRHWMSFLSPLGQPTQTEYHIPRAFIKPK-NLLVVLEEEPSDPKDIEIVTVNRDTIC  650

Query  2163  SSVSDYYPGNVKSWERKGEELRQVV-EDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             S +   YPG+VK W+RK   L+    + ++ +  L CP+ K + KIEFA+YG+PDG+CG 
Sbjct  651   SLIGQDYPGHVKYWDRKAGILQHAPGKSLQATALLNCPDYKKISKIEFASYGNPDGSCGA  710

Query  2340  FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLR  2516
               +G C+ P + K+VE  CLGK  C VP++  LF +   D CP    K L +QA C  +
Sbjct  711   LTMGTCNAPESKKVVEDLCLGKMICTVPLDPKLFFKAG-DPCPG-TKKKLMIQALCSFK  767



>ref|XP_008347518.1| PREDICTED: beta-galactosidase 13-like [Malus domestica]
Length=769

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/775 (54%), Positives = 549/775 (71%), Gaps = 9/775 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD+L++AK+GGLNVIQTYVFWN+HEPV+G++NFEGN DLVKFI++I +  MYVTLRVG
Sbjct  1     MWPDLLRKAKQGGLNVIQTYVFWNLHEPVKGKWNFEGNADLVKFIRLIQENNMYVTLRVG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+E P I FR+ N  +  HM+ F   I+ MMK  KLFAPQGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREEPNIVFRSDNPTYKQHMEAFVVKIMKMMKDEKLFAPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQ+ENEY+ ++    A  ++   Y+ WAA MA+     +PWIMCKQ +AP  VI+TCNG
Sbjct  121   LAQVENEYTHVQR---AYRELGDSYVQWAAKMALAQNVGVPWIMCKQKDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  +KPS+WTENWTAQYR FGDPP+QRSAE+IA+S+ RF + K+G+   Y
Sbjct  178   RHCGDTFPGPNKPHKPSLWTENWTAQYRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT++ F TTRYYDE PLDE+GL R+PKW HL+D H AL L K+ L  G P
Sbjct  237   YMYHGGTNFGRTSSIFTTTRYYDEAPLDEYGLQREPKWGHLKDLHKALNLCKKSLLAGAP  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
              + KL    E   +E     +C AFL NN++   TS+ +RG +Y+LP  S S+LPDCKT 
Sbjct  297   GVLKLGKETEARFYEKPGTDICVAFLANNHSKLETSVTWRGQEYFLPPHSISILPDCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             VFNSQ IVSQ N R FV SK A +  L WEM  E IPT+  +P+   +P ELY L KD +
Sbjct  357   VFNSQQIVSQXNTRNFVRSKAAKK--LNWEMSPEPIPTVVQVPVNQKKPQELYHLLKDAT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY W++T ++    DL  +  I PV+ + S+GHA+  FVNGE++G++HG++ +K     K
Sbjct  415   DYGWFTTSLDLGPYDLPMKDSIRPVIRIPSLGHAMGVFVNGEYIGTEHGSHAEKGFVFEK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             PV  K G N I+LL +  G P+SGA M+ R+ GPR +T+ GL  GT+ ++ N W H VG+
Sbjct  475   PVTFKQGLNYISLLCMTVGLPDSGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGL  534

Query  1803  SGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNG  1982
             +GE L++FTE+G+QKV+W         +TWYKTYFDAPEG +PVA+RM  M KGMVWVNG
Sbjct  535   NGENLQVFTEKGAQKVQWTKAAGKGRALTWYKTYFDAPEGKDPVAIRMTGMGKGMVWVNG  594

Query  1983  KSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTIC  2162
              SIGR+W++FLSPLGQP+Q EYHIPR+F+KP  N +VV EEQ  DP  IE++ VNRDTIC
Sbjct  595   LSIGRHWMSFLSPLGQPTQAEYHIPRSFIKPGKNFLVVLEEQDADPKDIEILTVNRDTIC  654

Query  2163  SSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNF  2342
             S  S  +P +V ++ERKG + + V      + +LKCP  K +  +EFA++G P+G CG +
Sbjct  655   SMSSQMHPPHVNAFERKGGKFQIVAGISAATAQLKCPNYKKIVAVEFASFGTPEGVCGTY  714

Query  2343  IVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              +G+C  P   KIVE+ CLGK+ C VP +  LF +   D CP +  K LA+Q  C
Sbjct  715   AIGSCDAPGTKKIVEEKCLGKTACTVPSDPGLFFK--VDPCPTVKIKRLAIQVLC  767



>gb|KFK30461.1| hypothetical protein AALP_AA7G264100 [Arabis alpina]
Length=892

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/802 (52%), Positives = 578/802 (72%), Gaps = 17/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +L++GS+HYPR  P+MWP ++++A+ GGLN IQTYVFWN+HEP QG+++FEG
Sbjct  49    LIINGKRVLLYSGSVHYPRSTPDMWPHIIEKARIGGLNTIQTYVFWNVHEPEQGKWDFEG  108

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEWN GG PYWL+EVP + FRT NEPF  H ++
Sbjct  109   RFDLVKFIKVIHEKGLYVTLRLGPFIQAEWNHGGLPYWLREVPDVFFRTDNEPFKEHTER  168

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+  MK+ KLFA QGGPIIL QIENEY++++     +    ++YI WAAD+   L 
Sbjct  169   YVRKILGKMKEEKLFASQGGPIILGQIENEYNAVQLAYKEN---GERYIKWAADLVESLN  225

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  226   LGIPWVMCKQNDAPGNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  285

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G+ ++PK
Sbjct  286   TAEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGMEKEPK  344

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HL+  H AL L K+ L  G P  QKL  + E+  +E    K+CAAFL NNNT  + ++
Sbjct  345   YGHLKHLHRALALCKKALLWGHPRAQKLGPDTEVRYYEQPGTKVCAAFLANNNTRESNTV  404

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G  Y LP  S S+LPDCKT V+N+  IV+QH+ R +  S+   +  LK+E + E +P
Sbjct  405   KFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNYEKSEKTSK-GLKFETYSENVP  463

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY+T I+  E DL  +  +  +L + S+GHA++ 
Sbjct  464   S--KLDGDSLIPQELYYLTKDKTDYAWYTTSIKIDEDDLPDQKKVKTMLKIASLGHAVIV  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G++HG+++ K+    K ++LK G N I+LLGVLTG P+SG+ M+KR+ GPR V
Sbjct  522   YVNGEYQGNEHGSHEMKSFVFNKQLNLKIGENHISLLGVLTGLPDSGSYMEKRYAGPRSV  581

Query  1734  TIQGLMAGTLVVT-FNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             ++ GL +G   +T  N W H  G+ GEK +++TEEGS+KVKW+       P+TWYKTYF+
Sbjct  582   SLIGLKSGLQDLTEHNEWGHLAGLEGEKKEIYTEEGSKKVKWEK-DGERKPLTWYKTYFE  640

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM--KPKNN  2084
              PEG N VA+RM  M KG++WVNG+ +GRYW++FLSPLG+P+Q EYHIPR+FM  K K N
Sbjct  641   TPEGENTVAIRMKGMGKGLIWVNGQGVGRYWMSFLSPLGEPTQSEYHIPRSFMNEKKKKN  700

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G  P +I+ VLVNRD ICS V + YP +VKSW+R+G ++   ++D+R    
Sbjct  701   MLVILEEEPGVKPEAIDFVLVNRDRICSYVGEDYPASVKSWKREGTKIVSRIKDMRLKAT  760

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             ++CP +K +  +EFA++GDP G CGNF +G CS P + ++VEK CLGKS C + VE+  F
Sbjct  761   MRCPPEKQIVAVEFASFGDPTGTCGNFTMGKCSAPKSKEVVEKTCLGKSHCSIIVERDTF  820

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
               G K  C  +V KTLAVQ KC
Sbjct  821   --GDKG-CSEIV-KTLAVQVKC  838



>ref|XP_009419064.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/783 (54%), Positives = 555/783 (71%), Gaps = 13/783 (2%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++K++KEGGLNVIQTYVFWN HEP  G+FN+EG  DLVKFIK++   GMYVTLR+G
Sbjct  1     MWPDIIKKSKEGGLNVIQTYVFWNGHEPQYGKFNYEGRYDLVKFIKLVQKQGMYVTLRLG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EV  I FRT N+PF +HMK+FA MIV  MK  KLFA QGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVANITFRTDNKPFKDHMKRFATMIVKKMKDEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             LAQIENEY+++        +   +YI WA +MA+GL   +PW+MCKQN+ P +VI+ CNG
Sbjct  121   LAQIENEYNNVARA----FEGGARYIKWAGNMAVGLDTGVPWVMCKQNDPPGEVINACNG  176

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GP+   KPS+WTENWTAQYR FGDPP+QRSAE+IAYS+ RF + KNG+ + Y
Sbjct  177   RNCGDTFQGPDDRTKPSLWTENWTAQYRVFGDPPSQRSAEDIAYSVARFFS-KNGTLVNY  235

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT A+FV TRYYDE PLDE+GL ++PKW HLRD H AL+L  + L  G+P
Sbjct  236   YMYHGGTNFGRTGAAFVMTRYYDEAPLDEYGLPKEPKWGHLRDLHYALKLCSKALLKGSP  295

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
             ++Q   +  E   +E     +C AFLTN N     ++KFRGT+Y+LP  S S+LPDCKT 
Sbjct  296   SVQSFGSGFEARLYEIPEDNVCVAFLTNTNARRDGTVKFRGTEYFLPRRSISILPDCKTV  355

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+N+Q + SQHNAR F P+K   +++ KW+M+ E  P++ +  IK   P EL  +TKDT+
Sbjct  356   VYNNQMVNSQHNARTFNPAKEDSKNN-KWQMYVEQPPSVRDTSIKAKGPQELVNMTKDTT  414

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T     + DLS R DI PVL V  +GHA+ AFVNG+++GS HG   +K+   +K
Sbjct  415   DYLWYATSFNLEKDDLSMRHDIRPVLQVSHLGHAMHAFVNGKYIGSGHGTKIEKSFVFQK  474

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGV  1802
             P+DL+ G ND+ +LG+  G P+SGA ++ R +G   V +QGL AG+L ++ N W H V +
Sbjct  475   PMDLQAGTNDVAILGMTVGLPDSGAYLEHRLSGVHTVVVQGLNAGSLDLSQNVWGHKVAM  534

Query  1803  SGEKLKLFTEEGSQKVKWK-PVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
              GE+  ++ E+     KW+ P ++   P+TWYK YFDAP G +PVA+ + +M KG VWVN
Sbjct  535   EGERKAIYDEKKVDSFKWEDPKSD--SPITWYKRYFDAPNGKDPVAVDLKSMGKGQVWVN  592

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTI  2159
             G+SIGRYWV++LSPLG+PSQ  YH+PR+F+K K+NLMVVFEE+GG P  I ++ V RD I
Sbjct  593   GESIGRYWVSYLSPLGKPSQSIYHVPRSFLKSKDNLMVVFEERGGKPEDILIMTVKRDNI  652

Query  2160  CSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             CS VS+  P  V+SW  K  +++ VV D++P   L C  DKV++ I FA++G+P G CGN
Sbjct  653   CSFVSESNPPQVRSWAIKNSQIQSVVNDLKPDATLTCTGDKVIRSIVFASFGNPSGVCGN  712

Query  2340  FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRH  2519
             F VG+C    A  +VE+ACLGK+ C +PV  + +  G+   C      TLAVQAKC    
Sbjct  713   FTVGSCHARQAKSVVEQACLGKASCVLPVSAATY--GADAGCEGTT-ATLAVQAKCARAS  769

Query  2520  AKD  2528
              KD
Sbjct  770   QKD  772



>emb|CAB64750.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=887

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/802 (53%), Positives = 578/802 (72%), Gaps = 17/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++ F+GS+HYPR  P+MWP ++ +A+ GGLN IQTYVFWN+HEP QG+++F+G
Sbjct  48    LIINGKRELFFSGSVHYPRSTPDMWPSIIDKARIGGLNTIQTYVFWNVHEPEQGKYDFKG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEWN GG PYWL+EVP + FRT NEPF  H ++
Sbjct  108   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWNHGGLPYWLREVPDVYFRTNNEPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPIIL QIENEY++++     +    +KYI WAA++   + 
Sbjct  168   YVRKILGMMKEEKLFASQGGPIILGQIENEYNAVQLAYKEN---GEKYIKWAANLVESMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPGNLINACNGRHCGDTFPGPNRHDKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDEFGL + PK
Sbjct  285   TAEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEFGLEKAPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HL+  H ALRL K+ LF G    Q L  + E+  +E    K+CAAFL+NNNT  T +I
Sbjct  344   YGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTKVCAAFLSNNNTRDTNTI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+   +  LK+EMF E IP
Sbjct  404   KFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSEKTSK-GLKFEMFSENIP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             ++  L   +L P ELY LTKD +DYAWY+T ++  E D   +  +  +L V S+GHAL+ 
Sbjct  463   SL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKGLKTILRVASLGHALIV  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G  HG ++ K+    KPV+ K G+N I++LGVLTG P+SG+ M+ RF GPR +
Sbjct  521   YVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLPDSGSYMEHRFAGPRAI  580

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GT  +T N+ W H  G+ GEK +++TEEGS+KVKW+       P+TWYKTYF+
Sbjct  581   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKWEK-DGERKPLTWYKTYFE  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK--PKNN  2084
              PEG N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FMK   K N
Sbjct  640   TPEGVNAVAIRMKGMGKGLIWVNGIGVGRYWMSFLSPLGEPTQTEYHIPRSFMKGEKKKN  699

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G    SI+ VLVNRDTICS+V + YP +VKSW+R+G ++    +D+R    
Sbjct  700   MLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWKREGPKIVSRSKDMRLKAV  759

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             ++CP +K + +++FA++GDP G CGNF +G CS   + ++VEK CLG++ C + V +  F
Sbjct  760   MRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVEKECLGRNYCSIVVARETF  819

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
              +     CP +V KTLAVQ KC
Sbjct  820   GDKG---CPEIV-KTLAVQVKC  837



>emb|CDX69103.1| BnaC01g03500D [Brassica napus]
Length=844

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/801 (53%), Positives = 567/801 (71%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R++LF+GSIHYPR  PEMWP ++K AK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  47    LIVDGKRELLFSGSIHYPRSTPEMWPSIIKSAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RADLVKFIKLIQKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKQFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  M++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI W + +   + 
Sbjct  167   YVRMVLDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKED---GVNYIKWGSKLVDSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPSMWTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKDNKPSMWTENWTTQFRVFGDAPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEQPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG  Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    +++F E +P
Sbjct  403   KFRGRDYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKQANK-KFDFKVFTEPLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY LTKD SDY WY+T  +  E  L  +      L + S+GHAL  
Sbjct  462   --KKLEGNSYVPVELYGLTKDKSDYGWYTTSFKVHENHLLKKKGAKTNLRIASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++G+ HG++D+K+   +KPV LK G N + +LGVLTGFP+SG+ ++ R+TGPR V
Sbjct  520   WLNGEYLGNGHGSHDEKSFVFQKPVTLKTGENHLVMLGVLTGFPDSGSYLEHRYTGPRSV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GTL +T +S W + VG+ GE+L + TE+G +KVKW+  +   P +TWY+TYFD
Sbjct  580   SILGLSSGTLDLTESSKWGNKVGMEGERLGIQTEKGLKKVKWEKFSGKAPGITWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  640   APESESAAAIRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V  W RK +E++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPELIDFVIVNRDTVCSYVGENYTPSVGHWIRKQDEVKAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK++C +PV KS FQ+
Sbjct  760   CSGNKKIAAVEFASFGNPIGDCGNFTLGTCNAPVSKQVVEKHCLGKAECVIPVNKSTFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  820   DKKDSCKNVV-KTLAVQVKCA  839



>sp|Q9SCU8.2|BGA14_ARATH RecName: Full=Beta-galactosidase 14; Short=Lactase 14; Flags: 
Precursor [Arabidopsis thaliana]
Length=887

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/802 (53%), Positives = 577/802 (72%), Gaps = 17/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  P MWP ++ +A+ GGLN IQTYVFWN+HEP QG+++F+G
Sbjct  48    LIINGKRELLFSGSVHYPRSTPHMWPSIIDKARIGGLNTIQTYVFWNVHEPEQGKYDFKG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEWN GG PYWL+EVP + FRT NEPF  H ++
Sbjct  108   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWNHGGLPYWLREVPDVYFRTNNEPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPIIL QIENEY++++     +    +KYI WAA++   + 
Sbjct  168   YVRKILGMMKEEKLFASQGGPIILGQIENEYNAVQLAYKEN---GEKYIKWAANLVESMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPGNLINACNGRHCGDTFPGPNRHDKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDEFGL + PK
Sbjct  285   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEFGLEKAPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HL+  H ALRL K+ LF G    Q L  + E+  +E    K+CAAFL+NNNT  T +I
Sbjct  344   YGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTKVCAAFLSNNNTRDTNTI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+   +  LK+EMF E IP
Sbjct  404   KFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSEKTSK-GLKFEMFSENIP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             ++  L   +L P ELY LTKD +DYAWY+T ++  E D   +  +  +L V S+GHAL+ 
Sbjct  463   SL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKGLKTILRVASLGHALIV  520

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G  HG ++ K+    KPV+ K G+N I++LGVLTG P+SG+ M+ RF GPR +
Sbjct  521   YVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLPDSGSYMEHRFAGPRAI  580

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GT  +T N+ W H  G+ GEK +++TEEGS+KVKW+       P+TWYKTYF+
Sbjct  581   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKWEK-DGKRKPLTWYKTYFE  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK--PKNN  2084
              PEG N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FMK   K N
Sbjct  640   TPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPTQTEYHIPRSFMKGEKKKN  699

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G    SI+ VLVNRDTICS+V + YP +VKSW+R+G ++    +D+R    
Sbjct  700   MLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWKREGPKIVSRSKDMRLKAV  759

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             ++CP +K + +++FA++GDP G CGNF +G CS   + ++VEK CLG++ C + V +  F
Sbjct  760   MRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVEKECLGRNYCSIVVARETF  819

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
              +     CP +V KTLAVQ KC
Sbjct  820   GDKG---CPEIV-KTLAVQVKC  837



>ref|XP_010436953.1| PREDICTED: beta-galactosidase 14-like isoform X1 [Camelina sativa]
Length=890

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/802 (52%), Positives = 577/802 (72%), Gaps = 16/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  PEMWP ++ +AK GGLN IQTYVFWN+HEP QG+++F G
Sbjct  46    LIINGKRELLFSGSVHYPRSTPEMWPSIIDKAKAGGLNTIQTYVFWNVHEPEQGKYDFSG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEW+ GG PYWL+EVP++ FRT N+PF  H ++
Sbjct  106   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWSHGGLPYWLREVPEVYFRTDNKPFKEHTER  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPI+L QIENEY++++     +    ++YI WAA++   + 
Sbjct  166   YVRKILGMMKEEKLFASQGGPIVLGQIENEYNAVQLAYKEN---GERYIKWAANLVESMK  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  223   LGIPWVMCKQNDAPDNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G  ++PK
Sbjct  283   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGFEKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLR  H ALRL K+ LF G   +QKL  + E+   E    K+CAAFL+NNNT  T +I
Sbjct  342   YGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTKVCAAFLSNNNTRETNTI  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+      LK+EMF E I 
Sbjct  402   KFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKTTSKGLKFEMFHENIA  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY++ I+  E DL  +     +L V S+GHAL+ 
Sbjct  462   S--KLGGDSLIPGELYFLTKDKTDYAWYTSSIKIEEDDLPDKKGSKTILRVASLGHALIV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G+ HG+++ K+    KP++LK G+N I+++GVLTG P+SG+ M+ R+ GPR V
Sbjct  520   YVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISIMGVLTGLPDSGSYMEHRYAGPRAV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +GT  +T N+ W H  G+ GEK +++TE+GS+KV+W+       P+TWYKTYF+
Sbjct  580   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQWEK-DGERKPLTWYKTYFE  638

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM--KPKNN  2084
              PE  N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FM  K K N
Sbjct  639   TPEEENTVAIRMKGMGKGLIWVNGNGVGRYWMSFLSPLGEPTQTEYHIPRSFMKEKKKKN  698

Query  2085  LMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+ EE+ G    +I+ VLVNRDTICS V + YP +VKSW+R+G+++    +D++    
Sbjct  699   MLVILEEEPGVKLEAIDFVLVNRDTICSYVGENYPVSVKSWKREGQKIVSRSKDMKLRAV  758

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP +K +  +EFA++GDP G CGNF +G CS   + ++VEK CLGK++C + V +  F
Sbjct  759   MKCPPEKHMVAVEFASFGDPTGTCGNFTMGKCSASKSKEVVEKTCLGKNRCSIVVARETF  818

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
               G K+ C  +V KTLAVQ KC
Sbjct  819   --GGKE-CSEIV-KTLAVQVKC  836



>ref|XP_006285214.1| hypothetical protein CARUB_v10006573mg [Capsella rubella]
 gb|EOA18112.1| hypothetical protein CARUB_v10006573mg [Capsella rubella]
Length=846

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/802 (53%), Positives = 574/802 (72%), Gaps = 13/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  48    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+PF  H ++
Sbjct  108   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKPFKEHTER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  M++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  168   YVRMVLDKMKEEKLFAAQGGPIILGQIENEYSAVQRAYKQD---GLNYIKWASKLVDSMN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  225   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDPPTQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  285   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  344   YGHLKQLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKTCAAFLANNNTEAAETI  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +   S S+LPDCKT ++N+  IVSQH +R F+ SK A +     ++F ET+P
Sbjct  404   KFKGREYVIAPRSISILPDCKTVLYNTAQIVSQHTSRNFMKSKKANKKFAF-KVFSETLP  462

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD SDY WY+T  +  +  L  + ++   + + S+GHAL  
Sbjct  463   S--KLEGDSYIPVELYGLTKDRSDYGWYTTSFKVHKNHLPKK-EVKTFVRIASLGHALHV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGN-NDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             ++NGE++GS HG++++K+   +K V LK G+ N + +LGVLTGFP+SG+ M+ R+TGPR 
Sbjct  520   WLNGEYLGSGHGSHEEKSFVFQKQVTLKAGSENHLVMLGVLTGFPDSGSYMEHRYTGPRS  579

Query  1731  VTIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
             V+I GL +GTL +T  S W + VG+ GEKL + TEEG +KVKW+  T     +TWY+TYF
Sbjct  580   VSILGLTSGTLDLTETSKWGNKVGMEGEKLGIHTEEGLKKVKWQKFTGKAQGLTWYQTYF  639

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAPE  N  A+RM  M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR+F+KPK NL
Sbjct  640   DAPESLNAAAIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPRSFLKPKKNL  699

Query  2088  MVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             +V+FEE+    P  ++ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  L
Sbjct  700   LVIFEEEPNVKPELMDFVIVNRDTVCSYVGENYIPSVRHWTRKQDQVQAITDNVTLTATL  759

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             KC   + +  +EFA++G+P G CGNF +G C+ P + ++VEK CLGK+QC +PV KS F+
Sbjct  760   KCSGTRKIAAVEFASFGNPIGVCGNFTLGTCNAPISKQVVEKHCLGKAQCAIPVNKSTFE  819

Query  2445  EGSKDLCPNLVHKTLAVQAKCG  2510
             +  KD C ++V K LAVQ KCG
Sbjct  820   QDKKDSCKDVV-KMLAVQVKCG  840



>emb|CDX89744.1| BnaC03g46580D [Brassica napus]
Length=1086

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/803 (52%), Positives = 571/803 (71%), Gaps = 13/803 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GSIHYPR  P+MWP ++KRAK+GGLN IQTYVFWN HE  QG+FNF G
Sbjct  287   LIINGKRELLYSGSIHYPRSTPDMWPKIIKRAKQGGLNTIQTYVFWNFHELEQGKFNFSG  346

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+E+P I FRT N+PF  H ++
Sbjct  347   RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREIPGIFFRTDNKPFKEHTER  406

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +  +I+DMMK+ KLFAPQGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  407   YVRVILDMMKEEKLFAPQGGPIILGQIENEYSAVQRAYKND---GSNYIKWASKLVHSMN  463

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R +GDPP QR
Sbjct  464   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNRDHKPSLWTENWTTQFRVYGDPPVQR  523

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNGS++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  524   SVEDIAFSVARFFS-KNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  582

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             + HL+  H AL L K+ L  G    +K   + EI  +E    K+CAAFL NNNT     I
Sbjct  583   YGHLKHLHNALNLCKKALLWGQSRTEKPGKDTEIRYYEQPGTKVCAAFLANNNTESAEII  642

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFV--PSKLAGRDDLKWEMFQET  1367
             KFRG +Y +P  S S+LPDCKT V+++  IVS H AR ++             +++F ET
Sbjct  643   KFRGKEYVIPPRSISILPDCKTVVYSTGEIVSHHTARNYMKSKKANKANKKFDFKVFTET  702

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             +P    L   +  P+ELY L KD SDY WY+T  +  + D   +G   P + V S+GHAL
Sbjct  703   VP--QELKGDSYVPVELYGLAKDESDYGWYTTNFKIDDSDFKKKGG-KPTVRVASLGHAL  759

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
               ++NGE++G+ HG++D+K+   +KPV LK G+N +T+LGVLTGFP+SG+ ++ RFTGPR
Sbjct  760   HVWLNGEYLGNGHGSHDEKSFVFQKPVALKEGDNHLTMLGVLTGFPDSGSYLEHRFTGPR  819

Query  1728  DVTIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTY  1904
              V+I GL +G + +T  S W + VG+ GEKL + TE+G +KVKW+  +   P +TWY+TY
Sbjct  820   SVSISGLSSGPMDLTEKSKWGNKVGMEGEKLDIHTEKGLKKVKWEKFSGKAPGLTWYQTY  879

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNN  2084
             FDAPE  +P A+RM+ M KG++WVNG+ +GRYW++FLSPLGQ +Q EYHIPR+F+KPK N
Sbjct  880   FDAPESLSPAAIRMNGMGKGLIWVNGEGVGRYWMSFLSPLGQSTQIEYHIPRSFLKPKKN  939

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             L+V+FEE+    P  I+ V+VNRDT+CS + + +  +V+ W RK + ++ + +D++ +  
Sbjct  940   LLVIFEEEPNVKPELIDFVIVNRDTVCSYIGEEFTPSVRHWTRKNDNVQAITDDVQLTAN  999

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             LKC   K +  +EFA++G+PDG CGNF  G+C  P   ++VEK CLGK++C +PV KS F
Sbjct  1000  LKCSGTKKISAVEFASFGNPDGICGNFTRGSCHAPVTKQVVEKYCLGKAECVIPVNKSTF  1059

Query  2442  QEGSKDLCPNLVHKTLAVQAKCG  2510
             QE  KD CP +V KTLAVQ KCG
Sbjct  1060  QEDKKDSCPKVV-KTLAVQVKCG  1081


 Score =   259 bits (661),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 146/194 (75%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              I+G R++L++GSIHYPR  P+MWP ++KRAK+GGLN IQTYVFWN HE  QG+FNF G
Sbjct  50   LIINGKRELLYSGSIHYPRSTPDMWPKIIKRAKQGGLNTIQTYVFWNFHELEQGKFNFSG  109

Query  297  NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+E+P I FRT N+PF  H ++
Sbjct  110  RADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREIPGIFFRTDNKPFKEHTER  169

Query  477  FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
            +  +I+DMMK+ KLFAPQGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  170  YVRVILDMMKEEKLFAPQGGPIILGQIENEYSAVQRAYKND---GSNYIKWASKLVHSMN  226

Query  657  NEIPWIMCKQNEAP  698
              IPW+MCKQN+AP
Sbjct  227  LGIPWVMCKQNDAP  240



>emb|CDX72512.1| BnaC07g45340D [Brassica napus]
Length=844

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/801 (52%), Positives = 566/801 (71%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP +++RAK+GGLN IQTYVFWN+HE  QG+FNF G
Sbjct  47    LIIDGKRELLYSGSIHYPRSTPEMWPSIIERAKQGGLNTIQTYVFWNVHELEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RTDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKEFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  167   YVRTVLDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GINYIKWASKLVDSMK  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCK N+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKHNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDSPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNG+++ YYMY+GGTN+GR  A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGTHVNYYMYHGGTNFGRNGAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    + +F E +P
Sbjct  403   KFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKKANK-KFDFNVFTEPLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               + L   +  P+ELY LTKD +DY WY+T  + ++  L  +      + + S+GHAL A
Sbjct  462   --NKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKGAKTTVRIASLGHALHA  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             + NGE++G+ HG++D+K+   ++PV LK G N + +LGVLTGFP+SGA ++ R+TGPR V
Sbjct  520   WFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFPDSGAYLEHRYTGPRSV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G L +T +S W + VG+ GE+L + TEEG +KVKW+  T   P +TWY+TYFD
Sbjct  580   SILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEEGLKKVKWQKFTGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  640   APESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K + ++EFA++G+P G CGNF +G C+ P + +++EK CLGK +C +PV KS FQ+
Sbjct  760   CSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPVSKQVIEKHCLGKGECVIPVNKSTFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  820   DKKDSCKNVV-KTLAVQVKCA  839



>emb|CDY40650.1| BnaA03g53130D [Brassica napus]
Length=844

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/801 (52%), Positives = 566/801 (71%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP +++RAK+GGLN IQTYVFWN+HE  QG+FNF G
Sbjct  47    LIIDGKRELLYSGSIHYPRSTPEMWPSIIQRAKQGGLNTIQTYVFWNVHELEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RTDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKEFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  167   YVRTVLDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GINYIKWASKLVDSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCK N+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKHNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDSPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNG+++ YYMY+GGTN+GR  A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGTHVNYYMYHGGTNFGRNGAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    +++F E +P
Sbjct  403   KFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKKANK-KFDFKVFTEPLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY LTKD +DY WY+T  + ++  L  +      + + S+GHAL A
Sbjct  462   --HKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKGAKTTVRIASLGHALHA  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             + NGE++G+ HG++D+K+   ++PV LK G N + +LGVLTGFP+SGA ++ R+TGPR V
Sbjct  520   WFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFPDSGAYLEHRYTGPRSV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G L +T +S W + VG+ GE+L + TEEG +KVKW+  T   P +TWY+TYFD
Sbjct  580   SILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEEGLKKVKWQKFTGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  640   APESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K + ++EFA++G+P G CGNF +G C+ P + ++VEK CLGK +C +PV K+ FQ+
Sbjct  760   CSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPISKQVVEKHCLGKGECVIPVNKATFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  820   DKKDSCKNVV-KTLAVQVKCA  839



>ref|XP_009138336.1| PREDICTED: beta-galactosidase 11-like [Brassica rapa]
Length=844

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/801 (51%), Positives = 566/801 (71%), Gaps = 11/801 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP +++RAK+GGLN IQTYVFWN+HE  QG+FNF G
Sbjct  47    LIIDGKRELLYSGSIHYPRSTPEMWPSIIQRAKQGGLNTIQTYVFWNVHELEQGKFNFSG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  GG PYWL+EVP I FRT N+ F  H ++
Sbjct  107   RTDLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLREVPGIFFRTDNKEFKEHTER  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   ++D MK+ KLFA QGGPIIL QIENEYS+++     D      YI WA+ +   + 
Sbjct  167   YVRTVLDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQD---GINYIKWASKLVDSMN  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCK N+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGD P +R
Sbjct  224   LGIPWVMCKHNDAPDPMINACNGRHCGDTFPGPNKENKPSLWTENWTTQFRVFGDSPVKR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+S+ RF + KNG+++ YYMY+GGTN+GR  A +VTTRYYD+ PLDE+GL R+PK
Sbjct  284   SVEDIAFSVARFFS-KNGTHVNYYMYHGGTNFGRNGAHYVTTRYYDDAPLDEYGLEREPK  342

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  343   YGHLKHLHNALNLCKKPLLWGQPRTEKPGKDTEIRYYEEPGTKSCAAFLANNNTEAAETI  402

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KFRG +Y +   S S+LPDCKT V+N+  IVS H +R F+ SK A +    +++F E +P
Sbjct  403   KFRGKEYVIAPRSISILPDCKTVVYNTAQIVSHHTSRNFMKSKKANK-KFDFKVFTEPLP  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                 L   +  P+ELY LTKD +DY WY+T  + ++  L  +      + + S+GHAL A
Sbjct  462   --HKLKGDSYIPVELYGLTKDKTDYGWYTTSFKINKNQLPKKKGAKTTVRIASLGHALHA  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             + NGE++G+ HG++D+K+   ++PV LK G N + +LGVLTGFP+SGA ++ R+TGPR V
Sbjct  520   WFNGEYLGNGHGSHDEKSFVFQEPVTLKEGENHLVMLGVLTGFPDSGAYLEHRYTGPRSV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             +I GL +G L +T +S W + VG+ GE+L + TE+G +KVKW+  T   P +TWY+TYFD
Sbjct  580   SILGLSSGVLDLTESSKWGNKVGMEGERLGIHTEKGLKKVKWQKFTGKAPGLTWYQTYFD  639

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APE  +  A+RM  M KG++WVNG+ +GRYW++FL+PLGQ +Q EYHIPR+F+KPK NL+
Sbjct  640   APESESAAAVRMSGMGKGLIWVNGEGVGRYWMSFLNPLGQSTQIEYHIPRSFLKPKKNLL  699

Query  2091  VVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             V+FEE+    P  I+ V+VNRDT+CS V + Y  +V+ W RK ++++ + +++  +  LK
Sbjct  700   VIFEEEPNVKPEIIDFVIVNRDTVCSYVGEDYTPSVRHWTRKQDQVQAITDNVSLTATLK  759

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             C  +K + ++EFA++G+P G CGNF +G C+ P + +++EK CLGK +C +PV KS FQ+
Sbjct  760   CSGNKKISEVEFASFGNPIGTCGNFTLGTCNAPVSKQVIEKHCLGKGECVIPVNKSTFQQ  819

Query  2448  GSKDLCPNLVHKTLAVQAKCG  2510
               KD C N+V KTLAVQ KC 
Sbjct  820   DKKDSCKNVV-KTLAVQVKCA  839



>emb|CDX72747.1| BnaC07g47690D [Brassica napus]
Length=886

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/802 (52%), Positives = 577/802 (72%), Gaps = 18/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GS+HYPR  P+MWP ++++A+ G LN IQTYVFWN+HEP QG+++F+G
Sbjct  49    LIINGKRELLYSGSVHYPRSTPDMWPSIIEKARVGRLNTIQTYVFWNVHEPEQGKWDFKG  108

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVT+R+GPF++AEWN GG P WL+EVP + FRTYNEPF  H ++
Sbjct  109   RFDLVKFIKLIHEKGLYVTIRLGPFIQAEWNHGGLPVWLREVPDVYFRTYNEPFKEHTER  168

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ ++K+ KLFA QGGPIIL QIENEY+++   R A  +  ++YI WAA++   + 
Sbjct  169   YVRKILGILKEEKLFASQGGPIILGQIENEYNAV---RLAYKENGERYIKWAANLVESMN  225

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ+ AP  +I+ CNGR CGDTF GP   + PS+WTENWT Q+R FGDP   R
Sbjct  226   LGIPWVMCKQDNAPGNIINACNGRHCGDTFPGPKRPDMPSLWTENWTTQFRVFGDPTTNR  285

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              +E+IA+++ RF + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD  PLDE+G+ +DPK
Sbjct  286   RSEDIAFAVSRFFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDHAPLDEYGMEKDPK  344

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P  +KL  + E+  +E     +CAAFL NNNT  P ++
Sbjct  345   YGHLKHVHRALELCKKALLWGHPRFKKLGPDTEVRYYEQPGTNVCAAFLANNNTREPNTV  404

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G ++ LP  S S+LPDCKT V+N+  IV+QH+ R FV S+   +  LK++M+ E +P
Sbjct  405   KFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKNSK-GLKFDMYSENVP  463

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L    L P ELY LTKD +DYAWY+T I+  E DL  +  +  +L V S+GHA + 
Sbjct  464   S--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKGVKTILRVASLGHAAIV  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+VG+KHG+++ K+   +KPV LKPG+N I++LGVLTGFP+SG+ M+KRF GPR  
Sbjct  522   YVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFPDSGSYMEKRFAGPRGA  581

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYF  1907
             +I+GL +G   +T N+ W H  G+ GEK +++TE+GS+KVKW  V N    P+TWYKTYF
Sbjct  582   SIKGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--VKNGERKPLTWYKTYF  639

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPK-NN  2084
             + PEG N VA+RM+ M KG++WVNG  IGRYW++FLSP GQP+Q EYHIPR FMK K  N
Sbjct  640   ETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPTQSEYHIPRTFMKKKEKN  699

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+FEE+ G    +I+ VLVNRDTICS V + YP +VK W+R+G  +    +D+R    
Sbjct  700   MLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKRQGPNIVPRNKDMRLKSL  759

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP  K +  IEFA++GDP G CGNF +G CS   + ++VEK CLGKS+C + VE+  F
Sbjct  760   IKCPPGKQIVSIEFASFGDPTGTCGNFTMGKCSASKSKEVVEKKCLGKSRCSIVVERETF  819

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
             ++     C ++V KTLAVQ KC
Sbjct  820   EDKK---CQDIV-KTLAVQVKC  837



>ref|XP_009101935.1| PREDICTED: beta-galactosidase 14 [Brassica rapa]
Length=886

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/802 (52%), Positives = 576/802 (72%), Gaps = 18/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GS+HYPR  P+MWP ++++A+ G LN IQTYVFWN+HEP QG+++F+G
Sbjct  49    LIINGKRELLYSGSVHYPRSTPDMWPSIIEKARVGRLNTIQTYVFWNVHEPEQGKWDFKG  108

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVT+R+GPF++AEWN GG P WL+EVP + FRT NEPF  H ++
Sbjct  109   RFDLVKFIKLIHEKGLYVTIRLGPFIQAEWNHGGLPVWLREVPDVYFRTDNEPFKEHTER  168

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ ++K+ KLFA QGGPIIL QIENEY+++   R A  +  ++YI WAA++   + 
Sbjct  169   YVRKILGILKEEKLFASQGGPIILGQIENEYNAV---RLAYKENGERYIKWAANLVESMN  225

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ+ AP  +I+ CNGR CGDTF GP   + PS+WTENWT Q+R FGDP   R
Sbjct  226   LGIPWVMCKQDNAPGNIINACNGRHCGDTFPGPKRPDMPSLWTENWTTQFRVFGDPTTNR  285

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              +E+IA+++ RF + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD  PLDE+G+ +DPK
Sbjct  286   RSEDIAFAVSRFFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDHAPLDEYGMEKDPK  344

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P  QKL  + E+  +E     +CAAFL NNNT  P ++
Sbjct  345   YGHLKHVHRALELCKKALLWGHPRFQKLGPDTEVRYYEQPGTNVCAAFLANNNTREPNTV  404

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G ++ LP  S S+LPDCKT V+N+  IV+QH+ R FV S+ + +  LK++M+ E +P
Sbjct  405   KFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKSSK-GLKFDMYSENVP  463

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L    L P ELY LTKD +DYAWY+T I+  E DL  +  +  +L V S+GHA + 
Sbjct  464   S--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKGVKTILRVASLGHAAIV  521

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+VG+KHG+++ K+   +KPV LKPG+N I++LGVLTGFP+SG+ M+KRF GPR  
Sbjct  522   YVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFPDSGSYMEKRFAGPRGA  581

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYF  1907
             +I GL +G   +T N+ W H  G+ GEK +++TE+GS+KVKW  V N    P+TWYKTYF
Sbjct  582   SIIGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--VKNGERKPLTWYKTYF  639

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPK-NN  2084
             + PEG N VA+RM+ M KG++WVNG  IGRYW++FLSP GQP+Q EYHIPR FMK K  N
Sbjct  640   ETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPTQSEYHIPRTFMKKKEKN  699

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+FEE+ G    +I+ VLVNRDTICS V + YP +VK W+R+G  +    +D+R    
Sbjct  700   MLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKRQGPNIVPRNKDMRLKSL  759

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP  K +  +EFA++GDP G CGNF +G CS   + ++VEK CLGKS+C + VE+  F
Sbjct  760   IKCPPGKQIVSVEFASFGDPTGTCGNFTMGKCSASKSKEVVEKKCLGKSRCSIVVERETF  819

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
             ++     C ++V KTLAVQ KC
Sbjct  820   EDKK---CQDIV-KTLAVQVKC  837



>emb|CDY22419.1| BnaA06g37410D [Brassica napus]
Length=956

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/802 (52%), Positives = 576/802 (72%), Gaps = 18/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++L++GS+HYPR  P+MWP ++++A+ G LN IQTYVFWN+HEP QG+++F+G
Sbjct  119   LIINGKRELLYSGSVHYPRSTPDMWPSIIEKARVGRLNTIQTYVFWNVHEPEQGKWDFKG  178

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVT+R+GPF++AEWN GG P WL+EVP + FRT NEPF  H ++
Sbjct  179   RFDLVKFIKLIHEKGLYVTIRLGPFIQAEWNHGGLPVWLREVPDVYFRTDNEPFKEHTER  238

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ ++K+ KLFA QGGPIIL QIENEY+++   R A  +  ++YI WAA++   + 
Sbjct  239   YVRKILGILKEEKLFASQGGPIILGQIENEYNAV---RLAYKENGERYIKWAANLVESMN  295

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQ+ AP  +I+ CNGR CGDTF GP   + PS+WTENWT Q+R FGDP   R
Sbjct  296   LGIPWVMCKQDNAPGNIINACNGRHCGDTFPGPKRPDMPSLWTENWTTQFRVFGDPTTNR  355

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              +E+IA+++ RF + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD  PLDE+G+ +DPK
Sbjct  356   RSEDIAFAVSRFFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDHAPLDEYGMEKDPK  414

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+ L  G P  QKL  + E+  +E     +CAAFL NNNT  P ++
Sbjct  415   YGHLKHVHRALELCKKALLWGHPRFQKLGPDTEVRYYEQPGTNVCAAFLANNNTREPNTV  474

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G ++ LP  S S+LPDCKT V+N+  IV+QH+ R FV S+ + +  LK++M+ E +P
Sbjct  475   KFKGQKFVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKSSK-GLKFDMYSENVP  533

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L    L P ELY LTKD +DYAWY+T I+  E DL  +  +  +L V S+GHA + 
Sbjct  534   S--KLEGDTLIPGELYYLTKDKTDYAWYTTSIKIKEDDLPDKKGVKTILRVASLGHAAIV  591

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+VG+KHG+++ K+   +KPV LKPG+N I++LGVLTGFP+SG+ M+KRF GPR  
Sbjct  592   YVNGEYVGNKHGSHEMKSFVFKKPVKLKPGDNHISILGVLTGFPDSGSYMEKRFAGPRGA  651

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTYF  1907
             +I GL +G   +T N+ W H  G+ GEK +++TE+GS+KVKW  V N    P+TWYKTYF
Sbjct  652   SIIGLKSGERDLTENNHWGHLAGLEGEKKEVYTEQGSKKVKW--VKNGERKPLTWYKTYF  709

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPK-NN  2084
             + PEG N VA+RM+ M KG++WVNG  IGRYW++FLSP GQP+Q EYHIPR FMK K  N
Sbjct  710   ETPEGENTVAIRMNGMGKGLIWVNGIGIGRYWMSFLSPTGQPTQSEYHIPRTFMKKKEKN  769

Query  2085  LMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             ++V+FEE+ G    +I+ VLVNRDTICS V + YP +VK W+R+G  +    +D+R    
Sbjct  770   MLVIFEEEPGVKLEAIDFVLVNRDTICSFVEENYPASVKYWKRQGPNIVPRNKDMRLKSL  829

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             +KCP  K +  +EFA++GDP G CGNF +G CS   + ++VEK CLGKS+C + VE+  F
Sbjct  830   IKCPPGKQIVSVEFASFGDPTGTCGNFTMGKCSASKSKEVVEKKCLGKSRCSIVVERETF  889

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
             ++     C ++V KTLAVQ KC
Sbjct  890   EDKK---CQDIV-KTLAVQVKC  907



>ref|XP_010690372.1| PREDICTED: beta-galactosidase 14-like [Beta vulgaris subsp. vulgaris]
Length=835

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/799 (51%), Positives = 571/799 (71%), Gaps = 16/799 (2%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I G R+ LF+GS+HYPR+P E W D+L + KEGGLNVIQTY+FWN+HEPV+G+FNF G +
Sbjct  45    IHGNREFLFSGSVHYPRVPVEEWEDILDKCKEGGLNVIQTYIFWNVHEPVKGEFNFTGQS  104

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             D+V+F+K+I + GM+VTLRVGPF++ EWN GG+PYWL++ P I +RT N  FM   +++ 
Sbjct  105   DVVRFLKLIAERGMWVTLRVGPFVQGEWNNGGYPYWLRKEPNITYRTDNPTFMKSTERWV  164

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIES---DRPADIKIQKKYINWAADMAMGL  653
               +V +MK+ KL+A QGGPIIL+QIENEY  +     D  A+     +YINWA +MA+  
Sbjct  165   TKVVSLMKENKLYASQGGPIILSQIENEYDHVRGAFRDGAAE-----RYINWAGNMAVSQ  219

Query  654   YNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQ  833
                +PWIMC+Q +AP +VI+ CNGR CG+TF GPN   KPS+WTENWTAQ+R FGD P+Q
Sbjct  220   MTGVPWIMCEQKDAPGEVINACNGRHCGETFEGPNAPTKPSLWTENWTAQFRVFGDVPSQ  279

Query  834   RSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDP  1013
             RSAE+ A+++ R+ + KNGS+  YYMY+GGTNY RT A+F TTRYYDE PLDEFGL R P
Sbjct  280   RSAEDTAFAVARWFS-KNGSHTNYYMYHGGTNYARTAAAFTTTRYYDEAPLDEFGLIRGP  338

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTS  1190
             KW HLRD H A+ LSK+ +F G   ++K   + E   +E +  KLCAAFL NNNT    +
Sbjct  339   KWGHLRDLHRAITLSKKAIFKGRYGVEKFGPDLEARYYERK--KLCAAFLWNNNTHAKET  396

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             +KFRG Q+ LP  S S+LPDCKT VFNS  +V+QH++R FV S++A ++ L WE   ET 
Sbjct  397   VKFRGKQFTLPPKSISILPDCKTVVFNSDCMVAQHSSREFVRSEIANKN-LNWEKTTETF  455

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P+  +  + +  PLE +   +D +DY WY T +E    DL  R  + PVL +Y +GH+L 
Sbjct  456   PSKGD--VYSRMPLEQFHTAEDRTDYMWYKTSVELDSVDLPFRKSLQPVLQLYHLGHSLQ  513

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNG ++GS HG +   + + + PV LK G N+I++L    G P+SG+ M++R+TG + 
Sbjct  514   AFVNGHYIGSSHGFHRAPSFTFQSPVKLKEGVNNISILSNTMGMPDSGSYMERRWTGLKF  573

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             + IQGL  G L ++ N W H++G+ GEKL+ FTEEG+QK KW P       +TWYK +FD
Sbjct  574   LEIQGLGTGELDLSSNGWHHTIGLKGEKLQYFTEEGAQKAKWTPAKGAGDYLTWYKAHFD  633

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             APEG++P+A+R++NM KG+VWVNG+SIGRYW +FL+    PSQ EYH+PR+++KPK+N +
Sbjct  634   APEGDDPIAIRLENMTKGVVWVNGRSIGRYWSSFLTIRNAPSQSEYHVPRSYLKPKDNFL  693

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+F+E GG+  ++++  VNRD ICS +S+  P +V SW+R   ++R V E+ +    L+C
Sbjct  694   VIFDEAGGNIDTVQIETVNRDVICSLISEDMPPSVMSWKRDAHDIRAVAEEPKTEATLRC  753

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P++KV+ ++EFA++G+P G CG F++G C+ PN+ KIVE+ CLGK  C +PV++ LF +G
Sbjct  754   PKNKVISRVEFASFGNPYGVCGFFLLGTCNSPNSQKIVEQLCLGKESCSIPVDRDLFDKG  813

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
              K+ CP L  K LAVQ +C
Sbjct  814   -KNNCPELPIKGLAVQLRC  831



>emb|CAN73625.1| hypothetical protein VITISV_026637 [Vitis vinifera]
Length=767

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/798 (52%), Positives = 552/798 (69%), Gaps = 74/798 (9%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G R++LF+GSIHYPR  PE                                FNFEG
Sbjct  39    LIVNGRRELLFSGSIHYPRSTPE--------------------------------FNFEG  66

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             N DLVKFIK+IGD G+Y TLR+GPF+EAEWN GGFPYWL+EVP I FR+YNEPF  HM+K
Sbjct  67    NYDLVKFIKLIGDYGLYATLRIGPFIEAEWNHGGFPYWLREVPDIIFRSYNEPFKYHMEK  126

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             ++ MI++MMK+AKLFAPQGGPIILAQIENEY+SI+    A  ++  +Y+ WA  MA+GL 
Sbjct  127   YSRMIIEMMKEAKLFAPQGGPIILAQIENEYNSIQL---AYKELGVQYVQWAGKMAVGLG  183

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QR
Sbjct  184   AGVPWIMCKQKDAPDPVINTCNGRHCGDTFTGPNRPNKPSLWTENWTAQYRVFGDPPSQR  243

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE++A+S+ RF + KNG+   YYMY+GGTN+GRT +SFVTTRYYDE PLDE+GL R+PK
Sbjct  244   AAEDLAFSVARFIS-KNGTLANYYMYHGGTNFGRTGSSFVTTRYYDEAPLDEYGLQREPK  302

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H+ALRL K+ LF G+P ++KL  ++E+  +E     +CAAFLTNN++    ++
Sbjct  303   WGHLKDLHSALRLCKKALFTGSPGVEKLGKDKEVRFYEKPGTHICAAFLTNNHSREAATL  362

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +Y+LP  S S+LPDCKT V+N+Q +V+QHNAR FV SK+A + +LKWEM QE IP
Sbjct  363   TFRGEEYFLPPHSISILPDCKTVVYNTQRVVAQHNARNFVKSKIANK-NLKWEMSQEPIP  421

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
              + ++ I    P+ELY   KD SDYAW+ T IE S  DL  + DI+PVL + ++GHA++A
Sbjct  422   VMTDMKILTKSPMELYXFLKDRSDYAWFVTSIELSNYDLPMKKDIIPVLQISNLGHAMLA  481

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG F+GS HG+N +K    RKPV  + G N +          +  A+ D   TG   V
Sbjct  482   FVNGNFIGSAHGSNVEKNFVFRKPVKFQ-GRNKL----------HCPAVYDSGTTGIHSV  530

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I GL  GTL +T N W   VGV+GE +K +T+ GS +V+W       P +TWYKTYFD 
Sbjct  531   QILGLNTGTLDITNNGWGQQVGVNGEHVKAYTQGGSHRVQWTAAKGKGPAMTWYKTYFDM  590

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             PEGN+PV LRM +MAKG    NG                    EYH+PRA++KP +NL+V
Sbjct  591   PEGNDPVILRMTSMAKG----NGL-------------------EYHVPRAWLKPSDNLLV  627

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE GG+P  IE  LVNRDTICS V++Y+P +VKSW+R   ++R VV++++P   LKCP
Sbjct  628   IFEETGGNPEEIEXELVNRDTICSIVTEYHPPHVKSWQRHDSKIRAVVDEVKPKGHLKCP  687

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               KV+ K++FA++G+P GACG+F +GNC+ PN+ K+VE+ C GK+ C++P+E  +F  G+
Sbjct  688   NYKVIVKVDFASFGNPLGACGDFEMGNCTAPNSKKVVEQHCXGKTTCEIPMEAGIFX-GN  746

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                C ++  KTLAVQ +C
Sbjct  747   SGACSDIT-KTLAVQVRC  763



>gb|EYU40437.1| hypothetical protein MIMGU_mgv1a002461mg [Erythranthe guttata]
Length=671

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/676 (59%), Positives = 520/676 (77%), Gaps = 9/676 (1%)
 Frame = +3

Query  486   MIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEI  665
             M++++MKK KLFA QGGPII+AQIENEY+++++   A  +  K Y+ WAADMA+GLY+ I
Sbjct  1     MVINLMKKEKLFADQGGPIIMAQIENEYNNVQA---AYREAGKHYVKWAADMAVGLYSGI  57

Query  666   PWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAE  845
             PW+MCKQ +AP  VI TCNGRQCGDTF GPNG NKPS+WTENWTAQYR FGD P+QR AE
Sbjct  58    PWVMCKQKDAPQTVISTCNGRQCGDTFPGPNGPNKPSLWTENWTAQYRVFGDSPSQRPAE  117

Query  846   NIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSH  1025
             ++A+S+ RF   +NG+   YYMY+GGTN+GRT++SFVTTRYYDE PLDEFGL R+PK+ H
Sbjct  118   DLAFSVARFFT-RNGTLNNYYMYHGGTNFGRTSSSFVTTRYYDEAPLDEFGLKREPKFGH  176

Query  1026  LRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKFR  1202
             LRD H ALRLSK+PL  GT  +QK+  + EI T+E    K+C AFLTNNNT  P +I+FR
Sbjct  177   LRDLHRALRLSKKPLLWGTQNVQKISKDLEITTYEKPGTKICVAFLTNNNTKEPGTIQFR  236

Query  1203  GTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTID  1382
             G  YY+P  S S+LPDCKT V+N+Q +V+QH++R FV SK A     KWEM++E IPT +
Sbjct  237   GVDYYMPPKSISILPDCKTVVYNTQRVVAQHSSRNFVASKKAKIH--KWEMYKENIPTFN  294

Query  1383  NLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVN  1562
             +L +K+  P ELY LT+DTSDYAWYSTRI   ++DL  R DILPVL + S+GH L+AFVN
Sbjct  295   DLGVKSKSPKELYRLTRDTSDYAWYSTRINMEKQDLPMRADILPVLQIASLGHGLMAFVN  354

Query  1563  GEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQ  1742
             GE++G +HG+N +K+L  +KPV+LKPG NDI+LL +  GFPNSGA M++RF GPR ++++
Sbjct  355   GEYIGFEHGSNIEKSLVFKKPVNLKPGVNDISLLAMTVGFPNSGAYMERRFAGPRAISLE  414

Query  1743  GLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEG  1922
             GLM+G L +T N WS  VGV+GEK +L+TEEGS+KVKW P       VTWYK YF+APEG
Sbjct  415   GLMSGNLDITKNHWSQEVGVNGEKTELYTEEGSKKVKWVPSNGKPSAVTWYKAYFNAPEG  474

Query  1923  NNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFE  2102
             N+PVA+RM +MAKGM+W+NG +IGRYWV++LSPLG+P+Q EYHIPR+F+K K NL+VVFE
Sbjct  475   NDPVAIRMTSMAKGMIWINGNNIGRYWVSYLSPLGKPTQEEYHIPRSFLKAKRNLVVVFE  534

Query  2103  EQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDK  2282
             E GG P  IE+V+VNRDTICS +S+++P ++K+WERK    R +V+ ++ S +L C ++K
Sbjct  535   ETGGVPEKIEVVIVNRDTICSVISEFHPPHIKTWERKDNVFRAIVDPVK-SAQLSCSDNK  593

Query  2283  VVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDL  2462
             V+  ++F ++GD +GACG F  G C  P A K+VEK C+GK+ C VP E+ +  +   D 
Sbjct  594   VIANVDFVSFGDVEGACGAFSPGKCDSPKARKLVEKMCMGKNTCTVPFEREVLVDAGNDS  653

Query  2463  CPNLVHKTLAVQAKCG  2510
             CP+ V KTLA+Q  C 
Sbjct  654   CPD-VAKTLAIQVACA  668



>dbj|BAK07425.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=841

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/808 (51%), Positives = 552/808 (68%), Gaps = 13/808 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR P   WPD++ RAKEGGLNVI++YVFWNIHEP  G +NFEG
Sbjct  43    LMIDGRREIFFSGSIHYPRSPFHEWPDLIARAKEGGLNVIESYVFWNIHEPEMGVYNFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D++KF K+I +  M+  +R+GPF++AEWN GG PYWL+EVP I FRT NEP+   M+K
Sbjct  103   RYDMIKFFKLIQEHEMFAMVRIGPFVQAEWNHGGLPYWLREVPDIVFRTDNEPYKKLMQK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  ++V+ +K AKLFA QGGPIILAQIENEY  +E+   A  +   +YI+WAA MA+   
Sbjct  163   FVTLVVNKLKDAKLFASQGGPIILAQIENEYQHMEA---AFKENGTRYIDWAAKMAISTS  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP +VI TCNGR CGDT+ GP   NKP +WTENWTAQYR FGDPP+QR
Sbjct  220   TGVPWIMCKQTKAPAEVIPTCNGRHCGDTWPGPTDKNKPLLWTENWTAQYRVFGDPPSQR  279

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+++ RF +   GS + YYMY+GGTN+GRT ASFV  RYYDE PLDEFG+Y++PK
Sbjct  280   SAEDIAFAVARFFS-VGGSMVNYYMYHGGTNFGRTGASFVMPRYYDEAPLDEFGMYKEPK  338

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HLRD H ALRL K+ L  G P+ Q L    E   FE    K+C AFL+N+NT    ++
Sbjct  339   WGHLRDLHHALRLCKKALLRGNPSTQPLGKLYEARLFEIPEQKVCVAFLSNHNTKEDGTV  398

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQE--T  1367
              FRG QY++P  S S+L DCKT VF++Q++ +QHN R F  +    ++++ WEM+ E   
Sbjct  399   TFRGQQYFVPRRSVSILADCKTVVFSTQHVNAQHNQRTFHLTDQTLQNNV-WEMYTEGDK  457

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             +PT      ++ +PLE Y +TKD +DY WY+T  +    DL  R DI PVL+  S GHA+
Sbjct  458   VPTYKFTTDRSEKPLEAYNMTKDKTDYLWYTTSFKLEAEDLPFRQDIKPVLEASSHGHAM  517

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
             VAFVNG+ VG+ HG   +KA SL KP++++ G N +++L    G  +SGA ++ R  G  
Sbjct  518   VAFVNGKLVGAAHGTKMNKAFSLEKPIEVRAGINHVSILSSTLGLQDSGAYLEHRQAGVH  577

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
              VTIQGL  GTL ++ N W H VG+ GE+ +   ++G + V+WKP      P+TWY+  F
Sbjct  578   SVTIQGLNTGTLDLSSNGWGHIVGLDGERKQAHMDKGGE-VQWKPAV-FDLPLTWYRRRF  635

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D P G +PV + ++ M KG+++VNG+ +GRYW ++   LG+PSQ  YH+PR F+KP  N+
Sbjct  636   DMPSGEDPVVIDLNPMGKGILFVNGEGLGRYWSSYKHALGRPSQYLYHVPRCFLKPTGNV  695

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             + +FEE+GG P +I ++ V RD ICS +S+  PG+V+SWERK  +L  V +D++P   L 
Sbjct  696   LTIFEEEGGRPDAIMILTVKRDNICSFISEKNPGHVRSWERKDSQLTVVADDLKPRAVLT  755

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CPE K ++++ FA+YG+P G CGN+ VGNC  P A ++VEKAC+GK  C + V   ++  
Sbjct  756   CPEKKTIQQVVFASYGNPLGICGNYTVGNCHTPKAKEVVEKACVGKKSCVLAVSHEVY--  813

Query  2448  GSKDLCPNLVHKTLAVQAKCGLRHAKDD  2531
             G    CP     TLAVQAKC  R    D
Sbjct  814   GGDLNCPGTT-ATLAVQAKCSKRQTTAD  840



>ref|XP_002445734.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
 gb|EES15229.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
Length=844

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/802 (50%), Positives = 548/802 (68%), Gaps = 11/802 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R+I F+GSIHYPR PP+MWP+++ +AKEGGLN I+TYVFWNIHEP +GQFNFEG
Sbjct  45    LMVDGRREIFFSGSIHYPRSPPDMWPELIAKAKEGGLNTIETYVFWNIHEPEKGQFNFEG  104

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKF K+I +  M+  +R+GPF++AEWN GG PYWL+E+P I FRT NEP+  HM+ 
Sbjct  105   RYDMVKFFKLIQEHDMFAMVRLGPFIQAEWNHGGLPYWLREIPDIVFRTNNEPYKMHMET  164

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F ++++  +K A LFA QGGPIILAQIENEY  +E+   A  +   KYI+WAA MA+G  
Sbjct  165   FVKIVIKRLKDANLFASQGGPIILAQIENEYQHLEA---AFKEEGTKYIHWAAQMAIGTN  221

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ +AP  VI TCNGR CGDT+ GP     P +WTENWTAQYR FGDPP+QR
Sbjct  222   IGIPWIMCKQTKAPGDVIPTCNGRNCGDTWPGPMNKTMPLLWTENWTAQYRVFGDPPSQR  281

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+++ RF +   G+   YYMY+GGTN+GRT A+FV  +YYDE PLDEFGLY++PK
Sbjct  282   SAEDIAFAVARFFS-VGGTMTNYYMYHGGTNFGRTAAAFVMPKYYDEAPLDEFGLYKEPK  340

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H AL+L K+ L  G P+ +KL    E   FE    K+C AFL+N+NT    ++
Sbjct  341   WGHLRDLHLALKLCKKALLWGKPSTEKLGKQLEARVFEIPEQKVCVAFLSNHNTKDDVTL  400

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMF-QETI  1370
              FRG  Y++P  S S+L DCKT VF +Q++ +QHN R F  +    ++++ W+MF +E +
Sbjct  401   TFRGQPYFVPRHSISILADCKTVVFGTQHVNAQHNQRTFHFADQTNQNNV-WQMFDEEKV  459

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  +  +LY LTKD +DY WY++  +    D+  R DI  V++V S GHA V
Sbjct  460   PKYKQAKIRTRKAADLYNLTKDKTDYVWYTSSFKLEPDDMPIRRDIKTVVEVNSHGHASV  519

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN +F G  HG   +KA +L KP++LK G N + +L    G  +SGA ++ R  G   
Sbjct  520   AFVNNKFAGCGHGTKMNKAFTLEKPMELKKGVNHVAVLASSMGMMDSGAYLEHRLAGVDR  579

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL AGTL +T N W H VG+ GE+ +++TE+G   V WKP  N   P+TWYK +FD
Sbjct  580   VQITGLNAGTLDLTNNGWGHIVGLVGEQKEIYTEKGMASVTWKPAVN-DKPLTWYKRHFD  638

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +P+ L M  M KGM++VNG+ IGRYW+++   LG+PSQ  YHIPR+F++PK+N++
Sbjct  639   MPSGEDPIVLDMSTMGKGMMYVNGQGIGRYWMSYKHALGRPSQQLYHIPRSFLRPKDNVL  698

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE+ G P +I ++ V RD IC+ +S+  P ++KSWERK  ++    +D++    L C
Sbjct  699   VLFEEEFGRPDAIMILTVKRDNICTYISERNPAHIKSWERKDSQITATADDLKARATLTC  758

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P  K+++++ FA+YG+P G CGN+ +G+C  P A ++VEK+CLGK  C +PV   ++  G
Sbjct  759   PPKKLIQQVVFASYGNPVGICGNYTIGSCHTPRAKEVVEKSCLGKRTCTLPVSADVY--G  816

Query  2451  SKDLCPNLVHKTLAVQAKCGLR  2516
                 CP     TLAVQAKC  R
Sbjct  817   GDVNCPGTT-ATLAVQAKCSKR  837



>ref|NP_195571.2| beta-galactosidase 14 [Arabidopsis thaliana]
 gb|AEE86951.1| beta-galactosidase 14 [Arabidopsis thaliana]
Length=988

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/779 (53%), Positives = 561/779 (72%), Gaps = 17/779 (2%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++ +A+ GGLN IQTYVFWN+HEP QG+++F+G  DLVKFIK+I + G+YVTLR+G
Sbjct  1     MWPSIIDKARIGGLNTIQTYVFWNVHEPEQGKYDFKGRFDLVKFIKLIHEKGLYVTLRLG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EVP + FRT NEPF  H +++   I+ MMK+ KLFA QGGPII
Sbjct  61    PFIQAEWNHGGLPYWLREVPDVYFRTNNEPFKEHTERYVRKILGMMKEEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L QIENEY++++    A  +  +KYI WAA++   +   IPW+MCKQN+AP  +I+ CNG
Sbjct  121   LGQIENEYNAVQL---AYKENGEKYIKWAANLVESMNLGIPWVMCKQNDAPGNLINACNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR+ E+IA+S+ R+ + KNGS++ Y
Sbjct  178   RHCGDTFPGPNRHDKPSLWTENWTTQFRVFGDPPTQRTVEDIAFSVARYFS-KNGSHVNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A FVTTRYYD+ PLDEFGL + PK+ HL+  H ALRL K+ LF G  
Sbjct  237   YMYHGGTNFGRTSAHFVTTRYYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQL  296

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKTA  1262
               Q L  + E+  +E    K+CAAFL+NNNT  T +IKF+G  Y LP  S S+LPDCKT 
Sbjct  297   RAQTLGPDTEVRYYEQPGTKVCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKTV  356

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+N+  IV+QH+ R FV S+   +  LK+EMF E IP++  L   +L P ELY LTKD +
Sbjct  357   VYNTAQIVAQHSWRDFVKSEKTSK-GLKFEMFSENIPSL--LDGDSLIPGELYYLTKDKT  413

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DYAWY+T ++  E D   +  +  +L V S+GHAL+ +VNGE+ G  HG ++ K+    K
Sbjct  414   DYAWYTTSVKIDEDDFPDQKGLKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFAK  473

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNS-WSHSVG  1799
             PV+ K G+N I++LGVLTG P+SG+ M+ RF GPR ++I GL +GT  +T N+ W H  G
Sbjct  474   PVNFKTGDNRISILGVLTGLPDSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLAG  533

Query  1800  VSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
             + GEK +++TEEGS+KVKW+       P+TWYKTYF+ PEG N VA+RM  M KG++WVN
Sbjct  534   LEGEKKEVYTEEGSKKVKWEK-DGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWVN  592

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK--PKNNLMVVFEEQGG-DPSSIELVLVNR  2150
             G  +GRYW++FLSPLG+P+Q EYHIPR+FMK   K N++V+ EE+ G    SI+ VLVNR
Sbjct  593   GIGVGRYWMSFLSPLGEPTQTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVNR  652

Query  2151  DTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGA  2330
             DTICS+V + YP +VKSW+R+G ++    +D+R    ++CP +K + +++FA++GDP G 
Sbjct  653   DTICSNVGEDYPVSVKSWKREGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTGT  712

Query  2331  CGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             CGNF +G CS   + ++VEK CLG++ C + V +  F +     CP +V KTLAVQ KC
Sbjct  713   CGNFTMGKCSASKSKEVVEKECLGRNYCSIVVARETFGDKG---CPEIV-KTLAVQVKC  767



>ref|XP_008663872.1| PREDICTED: uncharacterized protein LOC100194296 isoform X1 [Zea 
mays]
 gb|ACL54349.1| unknown [Zea mays]
 tpg|DAA48743.1| TPA: beta-galactosidase [Zea mays]
Length=850

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/804 (50%), Positives = 546/804 (68%), Gaps = 13/804 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
                DG R+I  +GSIHYPR PP+MWP+++ +AKEGGLN I+TYVFWNIHEP +G+FNFEG
Sbjct  50    LMFDGHREIFLSGSIHYPRSPPDMWPELIAKAKEGGLNTIETYVFWNIHEPEKGEFNFEG  109

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND+V+F ++I +  MY  +R+GPF++AEWN GG PYWL+E+P I FRT NEP+  HM+ 
Sbjct  110   QNDVVRFFQLIQEHDMYAMVRLGPFIQAEWNHGGLPYWLREIPDIVFRTNNEPYKMHMET  169

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F ++I+  +K A LFA QGGPIILAQIENEY  +E+   A      KYINWAA MA+   
Sbjct  170   FVKIIIKRLKDANLFASQGGPIILAQIENEYQHMEA---AFKDEGTKYINWAAKMAISTN  226

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ +AP  VI TCNGR CGDT+ GP   + P +WTENWTAQYR FGDPP+QR
Sbjct  227   IGIPWIMCKQTKAPSDVIPTCNGRNCGDTWPGPTNKSMPLLWTENWTAQYRVFGDPPSQR  286

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+++ RF +   G+   YYMY+GGTN+GRT+A+FV  +YYDE PLDEFGLY++PK
Sbjct  287   SAEDIAFAVARFFS-VGGTLANYYMYHGGTNFGRTSAAFVMPKYYDEAPLDEFGLYKEPK  345

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H AL+L K+ L  GTP+ +KL    E   FE    K+C AFL+N+NT    ++
Sbjct  346   WGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQKVCVAFLSNHNTKDDATM  405

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQ-ETI  1370
              FRG  Y++P  S SVL DC+T VF +Q++ +QHN R F  +    ++++ WEMF  E +
Sbjct  406   TFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFADQTAQNNV-WEMFDGENV  464

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  +  +LY LTKD +DY WY++  +    D+  R DI  VL+V S GHA V
Sbjct  465   PKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRSDIKTVLEVNSHGHASV  524

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN +FVG  HG   +KA +L KP+DLK G N + +L    G  +SGA M+ R  G   
Sbjct  525   AFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGMTDSGAYMEHRLAGVDR  584

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL AGTL +T N W H VG+ GE+ +++T++G   V WKP  N   P+TWYK +FD
Sbjct  585   VQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKPAMN-DRPLTWYKRHFD  643

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +PV L M  M KGM++VNG+ IGRYW+++   LG+PSQ  YH+PR+F++ K+N++
Sbjct  644   MPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPSQQLYHVPRSFLRQKDNML  703

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEEL--RQVVEDIRPSVRL  2264
             V+FEE+ G P +I ++ V RD IC+ +S+  P ++ SWERK  ++  +   +D+R    L
Sbjct  704   VLFEEEFGRPDAIMILTVKRDNICTFISERNPAHIMSWERKDSQITAKANADDLRARAAL  763

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
              CP  K+++++ FA+YG+P G CGN+ VG+C  P A ++VEKACLGK  C +PV   ++ 
Sbjct  764   ACPPKKLIQQVVFASYGNPAGICGNYTVGSCHTPRAKEVVEKACLGKRVCTLPVAADVY-  822

Query  2445  EGSKDLCPNLVHKTLAVQAKCGLR  2516
              G    C      TLAVQAKC  R
Sbjct  823   -GGDANCSGTT-ATLAVQAKCSKR  844



>emb|CDY31414.1| BnaA07g03490D [Brassica napus]
Length=780

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/783 (52%), Positives = 556/783 (71%), Gaps = 21/783 (3%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++KRAK+GGLN IQTYVFWN+HEP    FNF G  DLVKFIK+I   GMYVTLR G
Sbjct  1     MWPKIIKRAKQGGLNTIQTYVFWNVHEP----FNFSGRADLVKFIKLIEKNGMYVTLRPG  56

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF++AEWN GG PYWL+EVP I FRT N+PF  H +++ ++I+D MK+ KLFA QGGPII
Sbjct  57    PFIQAEWNHGGLPYWLREVPGIFFRTDNKPFKEHTERYVKVILDKMKEEKLFASQGGPII  116

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L QIENEYS++E     D      YI WAA +   +   IPW+MCKQN AP  +I+ CNG
Sbjct  117   LGQIENEYSAVERAYKED---GVNYIKWAAKLVDSMNLGIPWVMCKQNNAPDPMINACNG  173

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF GPN  NKPS+WTENWT Q+R FGDPPA RS E+IAYS+ RF + KNGS++ Y
Sbjct  174   RHCGDTFPGPNKKNKPSLWTENWTTQFRVFGDPPAHRSVEDIAYSVARFFS-KNGSHVNY  232

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GRT+A +VTTRYYD+ PLDEFGL R+PK+ HL+  H AL L K+ L  G  
Sbjct  233   YMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEREPKYGHLKLLHNALNLCKKALLWGHS  292

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKTA  1262
               +K   + EI  +E    K+CAAFL NNNT    +IKF+G +Y +P  S S+LPDCKT 
Sbjct  293   RTEKPGKDTEIRYYEQPGTKVCAAFLANNNTEAAETIKFKGKEYVIPPRSISILPDCKTV  352

Query  1263  VFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
             V+++  ++SQH +R +V SK A +    +++F ET+P+   L  ++  P+ELY LT+D +
Sbjct  353   VYSTAEVISQHTSRNYVKSKKANKK-FDFKLFTETVPS--ELKGESFIPVELYGLTEDVT  409

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+T  +  + DL  +G     L + S+GHAL  ++NGE++G+ HG++++K+   +K
Sbjct  410   DYGWYTTNFKTDDNDLKKKGG-KTTLRIASLGHALHVWLNGEYLGNGHGSHEEKSFVFQK  468

Query  1623  PVDLKPGNNDITLLGVLTGFP-----NSGALMDKRFTGPRDVTIQGLMAGTLVVT-FNSW  1784
              V LK G N +T+LGVLTGFP     +SG+ ++ R+TGPR V+I GL +G L +T  N W
Sbjct  469   QVSLKEGENHLTMLGVLTGFPVRNIDDSGSYLEHRYTGPRSVSILGLSSGPLDLTEKNKW  528

Query  1785  SHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKG  1964
              + VG+ GEKL +  E+G +KVKW+  +   P +TWY+T FDAPE  + VA+RM+ M KG
Sbjct  529   GNKVGMEGEKLGIHAEKGLKKVKWQKFSAKAPGLTWYQTRFDAPESKSSVAIRMNGMGKG  588

Query  1965  MVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGG-DPSSIELVL  2141
             ++WVNG+ +GRYW++FLSPL  P+Q EYHIPR+F+KPK NL+V+FEE+    P  I+ V+
Sbjct  589   LIWVNGEGVGRYWMSFLSPLKNPTQVEYHIPRSFLKPKKNLLVIFEEEPNVKPELIDFVI  648

Query  2142  VNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDP  2321
             +NRDT+CS + + Y  +V+ W +K ++++ + +D+  +  LKC   K +  +EFA++G+P
Sbjct  649   INRDTVCSYIGENYTPSVRHWTKKNDKVQAITDDVFLTANLKCSGTKKIAAVEFASFGNP  708

Query  2322  DGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQA  2501
             +G CGNF +G+C+ P + +++EK CLGKS+C +PV KS FQ+  KD CP +V K LAVQ 
Sbjct  709   NGTCGNFTLGSCNAPASKQVIEKYCLGKSECDIPVNKSTFQQDKKDSCPKVV-KMLAVQV  767

Query  2502  KCG  2510
             KCG
Sbjct  768   KCG  770



>ref|XP_008677698.1| PREDICTED: uncharacterized protein LOC100384558 isoform X1 [Zea 
mays]
 gb|AFW65679.1| hypothetical protein ZEAMMB73_601729 [Zea mays]
Length=846

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/802 (50%), Positives = 547/802 (68%), Gaps = 11/802 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR PP+MWP+++ +AKEGGLN I+TY+FWNIHEP +GQF+FEG
Sbjct  48    LIIDGRREIFFSGSIHYPRSPPDMWPELIAKAKEGGLNTIETYIFWNIHEPEKGQFDFEG  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+F K+I +  MY  +R+GPF++AEWN GG PYWL+E+P I FRT NEP+  HM+ 
Sbjct  108   RYDIVRFFKLIQEHNMYAMVRLGPFIQAEWNHGGLPYWLREIPDIVFRTNNEPYKMHMET  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F ++I+  +K A LFA QGGPIILAQIENEY  +E+    D     KYI WAA+MA+   
Sbjct  168   FVKIIIKRLKDANLFASQGGPIILAQIENEYQHLEAAFKND---GTKYIKWAANMAISTN  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ +AP  VI TCNGR CGDT+ GP   + P +WTENWTAQYR FGDPP+QR
Sbjct  225   VGIPWIMCKQTKAPSDVIPTCNGRNCGDTWPGPMNKSMPLLWTENWTAQYRVFGDPPSQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+++ RF +   G+   YYMY+GGTN+GRT+A+FV  +YYDE PLDEFGLY++PK
Sbjct  285   SAEDIAFAVARFFS-VGGTMTNYYMYHGGTNFGRTSAAFVMPKYYDEAPLDEFGLYKEPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H AL+L K+ L  G  + +KL    E   FE    K+C AFL+N+NT    ++
Sbjct  344   WGHLRDLHLALKLCKKALLWGKTSTEKLGKQFEARVFEIPEQKVCVAFLSNHNTKDDVTL  403

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMF-QETI  1370
              FRG  Y++P  S S+L DCKT VF +Q++ +QHN R F  +    ++++ W+MF +E +
Sbjct  404   TFRGQSYFVPRHSISILADCKTVVFGTQHVNAQHNQRTFHFADQTTQNNV-WQMFDEEKV  462

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  +  +LY LTKD +DY WY++  +    D+  R DI  VL+V S GHA V
Sbjct  463   PKYKQSKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRRDIKTVLEVNSHGHASV  522

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN +FVG  HG   +KA +L KP+DLK G N + +L    G  +SGA ++ R  G   
Sbjct  523   AFVNTKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASTMGMMDSGAYLEHRLAGVDR  582

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I+GL AGTL +T N W H VG+ GE+ +++T++G   V WKP  N   P+TWYK +FD
Sbjct  583   VQIKGLNAGTLDLTNNGWGHIVGLVGEQKQIYTDKGMGSVTWKPAVN-DRPLTWYKRHFD  641

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +P+ L M  M KG+++VNG+ IGRYW+++   LG+PSQ  YHIPR+F++ K+N++
Sbjct  642   MPSGEDPIVLDMSTMGKGLMFVNGQGIGRYWISYKHALGRPSQQLYHIPRSFLRQKDNVL  701

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE+ G P +I ++ V RD IC+ +S+  P ++KSWERK  ++     D++P   L C
Sbjct  702   VLFEEEFGRPDAIMILTVKRDNICTFISERNPAHIKSWERKDSQITVTAADLKPRATLTC  761

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
                K+++++ FA+YG+P G CGN+ +G+C  P A ++VEKACLGK  C +PV   ++  G
Sbjct  762   SPKKLIQQVVFASYGNPMGICGNYTIGSCHTPRAKELVEKACLGKRICTLPVSADVY--G  819

Query  2451  SKDLCPNLVHKTLAVQAKCGLR  2516
                 CP     TLAVQAKC  R
Sbjct  820   GDVNCPGTT-ATLAVQAKCSKR  840



>ref|XP_004974148.1| PREDICTED: beta-galactosidase 11-like [Setaria italica]
Length=852

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/803 (50%), Positives = 544/803 (68%), Gaps = 12/803 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR PP+MWPD++ +AKEGGLNVI++YVFWNIHEP +G  NFEG
Sbjct  49    LMIDGRREIFFSGSIHYPRSPPDMWPDLIVKAKEGGLNVIESYVFWNIHEPEKGVLNFEG  108

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKF KMI +  MY  +R+GPF++AEWN GG PYWL+EVP I FRT NEPF   M+K
Sbjct  109   RYDMVKFFKMIQEHDMYAIVRIGPFIQAEWNHGGLPYWLREVPDIVFRTNNEPFKMLMEK  168

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  +IV  +K A LFA QGGPIILAQIENEY  +E+    +     KYINWAA MA    
Sbjct  169   FVNLIVKKLKDANLFASQGGPIILAQIENEYQHLEAVFKEE---GTKYINWAAKMAQATN  225

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQ +AP +VI TCNGR CGDT+ GP     P +WTENWTAQYR FGDPP+QR
Sbjct  226   TGVPWFMCKQTKAPGEVIPTCNGRNCGDTWPGPTNKTMPLLWTENWTAQYRVFGDPPSQR  285

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE++A+++ RF +   G+   YYMY+GGTN+GRT A+FV  +YYDE PLDEFGLY++PK
Sbjct  286   SAEDLAFAVARFFS-VGGTMTNYYMYHGGTNFGRTAAAFVMPKYYDEAPLDEFGLYKEPK  344

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H ALRL K+ L  GTP++QKL    E   FE +   +C AFL+N+NT    ++
Sbjct  345   WGHLRDLHQALRLCKKALLWGTPSVQKLGKQFEARVFELKEQNVCVAFLSNHNTKDDVTM  404

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMF-QETI  1370
              FRG  Y++P  S S+L DCKT VF++Q++ +QHN R F  ++   ++++ W+MF +E +
Sbjct  405   TFRGQPYFVPRHSISILADCKTVVFSTQHVNAQHNQRTFHFTEQTVQNNV-WQMFDEEKV  463

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  +  ELY LTKD +DY WY++  +    D+  R D+ PVL+V S GHA V
Sbjct  464   PKYKQAKIRTRKAQELYNLTKDKTDYVWYTSSFKLEADDMPFRRDVRPVLEVNSHGHASV  523

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN  FVG  HG   +KA  L+KP++LK G N + +L    G  +SGA ++ R  G   
Sbjct  524   AFVNNVFVGCGHGTKMNKAFLLQKPMNLKMGVNHVAVLSSTLGMMDSGAYLEHREAGIDR  583

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL AGTL +T N W H +G+ GE+ +++TE+G   V WKP      P+TWYK +FD
Sbjct  584   VQILGLNAGTLDLTNNGWGHIIGLVGEQKEIYTEKGMGSVTWKPAVK-DKPLTWYKRHFD  642

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +PV L +  M KGM++VNG+ IGRYW+++   LG+PSQ  YH+PR+F++ KNN++
Sbjct  643   MPSGEDPVVLDLSPMGKGMMYVNGEGIGRYWISYKHALGRPSQQLYHVPRSFLREKNNVL  702

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELR-QVVEDIRPSVRLK  2267
             V+FEE+GG P +I ++ V RD IC+ +S+  P ++KSW+R   ++  +   D++P   L 
Sbjct  703   VLFEEEGGHPDAIMILTVKRDNICTFISEKNPAHIKSWQRTDSQITAKGGGDLKPKATLS  762

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  KV++++ FA++G+P G CGN+  G+C  P A ++ EKACLG+  C +PV   ++  
Sbjct  763   CPLKKVIQQVVFASFGNPQGICGNYTAGSCHTPRAKEVAEKACLGQRTCTLPVAADVY--  820

Query  2448  GSKDLCPNLVHKTLAVQAKCGLR  2516
             G    CP     TLAVQ KC  R
Sbjct  821   GGDLNCPGTT-ATLAVQVKCSKR  842



>ref|NP_001154292.1| beta-galactosidase 14 [Arabidopsis thaliana]
 gb|AEE86952.1| beta-galactosidase 14 [Arabidopsis thaliana]
Length=1052

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/780 (53%), Positives = 557/780 (71%), Gaps = 21/780 (3%)
 Frame = +3

Query  183   EMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRV  362
              MWP ++ +A+ GGLN IQTYVFWN+HEP QG+++F+G  DLVKFIK+I + G+YVTLR+
Sbjct  68    HMWPSIIDKARIGGLNTIQTYVFWNVHEPEQGKYDFKGRFDLVKFIKLIHEKGLYVTLRL  127

Query  363   GPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPI  542
             GPF++AEWN GG PYWL+EVP + FRT NEPF  H +++   I+ MMK+ KLFA QGGPI
Sbjct  128   GPFIQAEWNHGGLPYWLREVPDVYFRTNNEPFKEHTERYVRKILGMMKEEKLFASQGGPI  187

Query  543   ILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCN  722
             IL QIENEY++++    A  +  +KYI WAA++   +   IPW+MCKQN+AP  +I+ CN
Sbjct  188   ILGQIENEYNAVQL---AYKENGEKYIKWAANLVESMNLGIPWVMCKQNDAPGNLINACN  244

Query  723   GRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylg  902
             GR CGDTF GPN  +KPS+WTENWT Q+R FGDPP QR+ E+IA+S+ R+ + KNGS++ 
Sbjct  245   GRHCGDTFPGPNRHDKPSLWTENWTTQFRVFGDPPTQRTVEDIAFSVARYFS-KNGSHVN  303

Query  903   yymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGT  1082
             YYMY+GGTN+GRT+A FVTTRYYD+ PLDEFGL + PK+ HL+  H ALRL K+ LF G 
Sbjct  304   YYMYHGGTNFGRTSAHFVTTRYYDDAPLDEFGLEKAPKYGHLKHVHRALRLCKKALFWGQ  363

Query  1083  PTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKT  1259
                Q L  + E+  +E    K+CAAFL+NNNT  T +IKF+G  Y LP  S S+LPDCKT
Sbjct  364   LRAQTLGPDTEVRYYEQPGTKVCAAFLSNNNTRDTNTIKFKGQDYVLPSRSISILPDCKT  423

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
              V+N+  IV+QH+ R FV S+   +  LK+EMF E IP++  L   +L P ELY LTKD 
Sbjct  424   VVYNTAQIVAQHSWRDFVKSEKTSK-GLKFEMFSENIPSL--LDGDSLIPGELYYLTKDK  480

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             +DYA     ++  E D   +  +  +L V S+GHAL+ +VNGE+ G  HG ++ K+    
Sbjct  481   TDYAC----VKIDEDDFPDQKGLKTILRVASLGHALIVYVNGEYAGKAHGRHEMKSFEFA  536

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNS-WSHSV  1796
             KPV+ K G+N I++LGVLTG P+SG+ M+ RF GPR ++I GL +GT  +T N+ W H  
Sbjct  537   KPVNFKTGDNRISILGVLTGLPDSGSYMEHRFAGPRAISIIGLKSGTRDLTENNEWGHLA  596

Query  1797  GVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWV  1976
             G+ GEK +++TEEGS+KVKW+       P+TWYKTYF+ PEG N VA+RM  M KG++WV
Sbjct  597   GLEGEKKEVYTEEGSKKVKWEK-DGKRKPLTWYKTYFETPEGVNAVAIRMKAMGKGLIWV  655

Query  1977  NGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK--PKNNLMVVFEEQGG-DPSSIELVLVN  2147
             NG  +GRYW++FLSPLG+P+Q EYHIPR+FMK   K N++V+ EE+ G    SI+ VLVN
Sbjct  656   NGIGVGRYWMSFLSPLGEPTQTEYHIPRSFMKGEKKKNMLVILEEEPGVKLESIDFVLVN  715

Query  2148  RDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDG  2327
             RDTICS+V + YP +VKSW+R+G ++    +D+R    ++CP +K + +++FA++GDP G
Sbjct  716   RDTICSNVGEDYPVSVKSWKREGPKIVSRSKDMRLKAVMRCPPEKQMVEVQFASFGDPTG  775

Query  2328  ACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              CGNF +G CS   + ++VEK CLG++ C + V +  F +     CP +V KTLAVQ KC
Sbjct  776   TCGNFTMGKCSASKSKEVVEKECLGRNYCSIVVARETFGDKG---CPEIV-KTLAVQVKC  831



>gb|EMS61528.1| Beta-galactosidase 11 [Triticum urartu]
Length=867

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/832 (49%), Positives = 549/832 (66%), Gaps = 41/832 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG RDI F+GSIHYPR P   WPD++ RAKEGGLNVI++YVFWN+HEP  G +NFEG
Sbjct  41    LMVDGQRDIFFSGSIHYPRSPFHEWPDLIARAKEGGLNVIESYVFWNVHEPEMGVYNFEG  100

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D++KF K+I +  MY  +R+GPF++AEWN GG PYWL+EVP I FRT NEPF   M+K
Sbjct  101   RYDMIKFFKLIQEHEMYAMVRIGPFVQAEWNHGGLPYWLREVPDIIFRTDNEPFKKLMQK  160

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  ++V+ +K+AKLFA QGGPIILAQIENEY  +E+   A  +   +YI WAA MA+   
Sbjct  161   FVTLVVNKLKEAKLFASQGGPIILAQIENEYQHMEA---AFKENGTRYIEWAAKMAISTD  217

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI TCNGR CGDT+ GP   NKP +WTENWTAQYR FGDPP+QR
Sbjct  218   IGVPWIMCKQTKAPADVIPTCNGRHCGDTWPGPVDKNKPLLWTENWTAQYRVFGDPPSQR  277

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFG------  998
             SAE+IA+++ RF +   GS + YYMY+GGTN+GRT ASFV  RYYDE PLDEFG      
Sbjct  278   SAEDIAFAVARFFS-VGGSMVNYYMYHGGTNFGRTGASFVMPRYYDEAPLDEFGKAETDE  336

Query  999   ----------------------LYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQ  1112
                                   ++++PKW HL+D H ALRL K  L  GTP+ Q L    
Sbjct  337   SSQTLNMLNYVDSWMNVLVGPGMFKEPKWGHLKDLHHALRLCKNALLFGTPSTQPLGKLY  396

Query  1113  EIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVS  1289
             E   FE    K+C AFL+N+NT    ++ FRG +Y++P  S S+L DCKT VF++Q + +
Sbjct  397   EARVFEIPEQKVCVAFLSNHNTKEDGTVTFRGQKYFVPRRSVSILGDCKTVVFSTQYVNA  456

Query  1290  QHNARRFVPSKLAGRDDLKWEMFQE--TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYST  1463
             QHN R F  +    ++++ WEM+ E   +PT      ++ +PLE Y +TKD +DY WY+T
Sbjct  457   QHNQRTFHFTDQTVQNNV-WEMYTEGDQVPTYKFSTDRSEKPLEAYNMTKDKTDYLWYTT  515

Query  1464  RIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPG  1643
                    DL +R DI PVL+  S GHA+VAFVN + VG  HG   +KA SL KP+D+K G
Sbjct  516   SFLLDPEDLPSRLDIKPVLEASSHGHAMVAFVNKKLVGCGHGTKMNKAFSLEKPIDVKVG  575

Query  1644  NNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKL  1823
              N I++L    G  +SG+ +++R  G   VTIQGL  GTL +T N W H VG+ GE+ + 
Sbjct  576   INHISILSSTLGLQDSGSYLERRQAGVHSVTIQGLNTGTLDLTSNGWGHIVGLDGERKQA  635

Query  1824  FTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYW  2003
             FTE+G + V+W+P      P+TWY+  FD P G +PV + M+ M KG+++VNG+ +GRYW
Sbjct  636   FTEKGGE-VQWQPAV-FDKPLTWYRRRFDMPSGEDPVVIDMNPMGKGILFVNGEGLGRYW  693

Query  2004  VAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYY  2183
              ++   LG+PSQ  YH+PR F+KP  N++ +FEE+GG P +I ++ V RD ICS +S+  
Sbjct  694   SSYKHALGRPSQYLYHVPRCFLKPTGNVLTIFEEEGGRPDAIMILTVKRDNICSFISETN  753

Query  2184  PGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSF  2363
             PG+V+SWE K  +L  V +D++P   L CPE K+++++ FA+YG+P G CGN+  GNC  
Sbjct  754   PGHVRSWETKDSQLTMVADDLKPRAVLTCPEKKMIQQVVFASYGNPLGICGNYTFGNCHT  813

Query  2364  PNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRH  2519
             P A +IVEKAC+GK  C + V   ++  G    CP     TLAVQAKC  R 
Sbjct  814   PKAKEIVEKACVGKRSCVLAVSHEVY--GGDLNCPGTT-ATLAVQAKCSKRQ  862



>ref|XP_010690706.1| PREDICTED: beta-galactosidase 14-like [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/803 (51%), Positives = 554/803 (69%), Gaps = 49/803 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
              FI+  R+++F+GSIHYPR P  MW D+L +AKEGGLN IQTYVFWN+HEP +GQ+NF  
Sbjct  48    LFINDKRELIFSGSIHYPRAPVAMWEDLLDKAKEGGLNAIQTYVFWNVHEPTKGQYNFTD  107

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             +NDLVKFIK++G+ GM+  LRVGPF++AEWN GG PYWL+E P I +RT N  +  +M++
Sbjct  108   SNDLVKFIKLVGEKGMWAILRVGPFIQAEWNHGGLPYWLREEPNITYRTDNPAYKVNMER  167

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V++M+  KL+APQGGPII++QIENEY  +   R A     ++YI WA  MA+GL 
Sbjct  168   WVTKVVNLMRDNKLYAPQGGPIIMSQIENEYDHV---RDAFNDAAERYIKWAGTMAVGLK  224

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
              ++PWIMCK  +AP +VI+ CNGR CGDTF GPN   KPS+WTENWTAQYR FGD P+QR
Sbjct  225   TDVPWIMCKSKDAPSEVINACNGRHCGDTFKGPNTPGKPSLWTENWTAQYRVFGDAPSQR  284

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE+IA+S+ R+   KNGS++ YYMYYGGTNYGRT ASFVTTRYYDE P+DEFGL RDPK
Sbjct  285   AAEDIAFSVARWFG-KNGSHVNYYMYYGGTNYGRTAASFVTTRYYDEAPIDEFGLVRDPK  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HL+  H A+ L+K+P+  GT  IQK   + E   +E  +  LCAAFL NN+T  T ++
Sbjct  344   WGHLKHLHQAILLAKKPILEGTYRIQKNGADFEANFYEKGD--LCAAFLWNNHTHETKTM  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +FRG ++ +P  S S+LPDCKT V+N+  +VSQH+AR FV S+ A   +LKWE   ET+P
Sbjct  402   RFRGKEHQVPPRSISILPDCKTLVYNTDYMVSQHSAREFVRSEKA-HANLKWEKTTETLP  460

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   I +  P E Y  TKD SDY WY T I+    DL  +    PVL V S+GHAL+A
Sbjct  461   GPGK-GIFSREPKEQYVTTKDQSDYLWYRTSIDLDSSDLPFKKSFRPVLQVLSLGHALLA  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+VG+ HG   +        V LK G N+I++LG   G P+SG+ M++R+TG R V
Sbjct  520   YVNGEYVGTAHGVKREYNFPFSVAVRLKEGLNNISVLGCTVGMPDSGSYMERRYTGIRTV  579

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              + GL  G L ++FN W H+                                    YFD 
Sbjct  580   ELLGLGTGNLDISFNGWHHTA-----------------------------------YFDE  604

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G+ P++LRM NM KGM+W+NG+S+GRYW ++LS + +PSQ EYH+PR+F+K K+NL+V
Sbjct  605   PDGDGPLSLRMLNMTKGMMWINGQSLGRYWSSYLSVIEEPSQDEYHLPRSFLKSKDNLLV  664

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR--LK  2267
             +F+E GGD +++++  VNRD+ICS + + +P +V SW+RKG E+  V E   P V+  LK
Sbjct  665   IFDEAGGDINTVQIETVNRDSICSIIDEDWPADVWSWKRKGNEI--VPEGDTPQVKASLK  722

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP+DKV+ ++EFA++G+P G CG +++GNC+ PN+ KIVE+ CLGK  C +PV++ LF +
Sbjct  723   CPKDKVINRVEFASFGNPIGVCGFYLLGNCTSPNSVKIVEQNCLGKESCTIPVDRKLFDK  782

Query  2448  GSKDLCPNLVHKTLAVQAKCGLR  2516
               KD C N+  KTLAVQ +CG +
Sbjct  783   -DKDPCSNINPKTLAVQLRCGRK  804



>ref|XP_006660363.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like, partial 
[Oryza brachyantha]
Length=829

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/802 (50%), Positives = 534/802 (67%), Gaps = 15/802 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR PP+ WPD++ +AKEGGLNVI TYVFWN HEP  G +NFEG
Sbjct  34    LIIDGRREIFFSGSIHYPRSPPDAWPDLISKAKEGGLNVITTYVFWNGHEPEPGVYNFEG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKF K+I +  MY  +R+GPF++AEWN GG PYWL+EVP I FRT NEPF  HMK+
Sbjct  94    RYDLVKFFKLIQENEMYGIVRIGPFVQAEWNHGGLPYWLREVPDIIFRTDNEPFKKHMKE  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  +IV+ +K AKLFA QGGPIIL+QIENEY  +E    A  +    YINWAA MA    
Sbjct  154   FVTLIVNKLKDAKLFASQGGPIILSQIENEYQHLEV---AFKENGTSYINWAAKMATATD  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP +VI TCNGR CGDT+ GP   NKP +WTENWTAQYR FGDPP+QR
Sbjct  211   TGVPWIMCKQTKAPGEVIPTCNGRHCGDTWPGPTDKNKPLLWTENWTAQYRVFGDPPSQR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF +   G+   YYMY+GGTN GRT A+FV  RYYDE PLDEFGLY++PK
Sbjct  271   SAEDIAFSVARFFS-VGGTMANYYMYHGGTNLGRTGAAFVMPRYYDEAPLDEFGLYKEPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HL+D H ALRL K+ L  G P+ Q L    E   FE    K+C AFL+N+NT    ++
Sbjct  330   WGHLKDLHHALRLCKKALLWGNPSSQPLGKLYEARVFEIAEKKVCVAFLSNHNTKEDGTV  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQE-TI  1370
              FRG +Y++   S S+L DCKT VF++Q++ SQHN R F  +    +++  WEMF E  I
Sbjct  390   TFRGQKYFVARRSVSILADCKTVVFSTQHVNSQHNQRTFHFADQTVQNN-AWEMFAEGKI  448

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  RPLE Y LTKD +DY WY+T       D+  R DI PVL+V S GHA+ 
Sbjct  449   PRYKQTTIRTQRPLEQYNLTKDKTDYLWYATSFRLEADDMPFRKDIRPVLEVSSHGHAVA  508

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN  FVG  HG   +KA ++   ++LK G N I +L    G  +SGA ++ R  G   
Sbjct  509   AFVNDVFVGVGHGTKINKAFTMEVVMELKVGVNHIAILSTTLGMMDSGAYLEHRQAGVHT  568

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTIQGL  GTL +T N W H V ++GE+ +++TE+G   V WKP  +    +TWY+ +FD
Sbjct  569   VTIQGLNTGTLDLTTNGWGHLVALNGERRQVYTEQGMGTVAWKPGKSAQ-SLTWYRRHFD  627

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP G++PV + +  M KG ++VNG+S+GRYWV++   LG+PSQ  Y++PR  ++P  N++
Sbjct  628   APSGDDPVVIDLTPMGKGNLYVNGESLGRYWVSYRHALGKPSQYLYNVPRLLLRPTGNVL  687

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             ++FEE+GG P +I ++ V RD IC+ +S+  P +V++WERK  +L  V  D RP   L C
Sbjct  688   MLFEEEGGRPDAIMILTVKRDNICTFISEKNPAHVRTWERKDSQLTAVAGDGRPQAVLSC  747

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P  K +++I FA+YG+P G CGN+  G+C  P + ++VEKAC+GK  C + V   ++  G
Sbjct  748   PPKKTIRQIVFASYGNPLGICGNYTFGSCHAPRSKEVVEKACVGKKTCSLTVAHDVYGGG  807

Query  2451  SKDLCPNLVHKTLAVQAKCGLR  2516
             ++            VQAKC  R
Sbjct  808   AQ-------RPRTXVQAKCSKR  822



>gb|EMT25927.1| Beta-galactosidase 11 [Aegilops tauschii]
Length=868

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/832 (49%), Positives = 548/832 (66%), Gaps = 41/832 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG RD+ F+GSIHYPR P   WPD++ RAKEGGLNVI++YVFWN+HEP  G +NFEG
Sbjct  42    LMVDGQRDLFFSGSIHYPRSPFHEWPDLIARAKEGGLNVIESYVFWNVHEPEMGVYNFEG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D++KF K+I +  MY  +R+GPF++AEWN GG PYWL+EVP I FRT NEPF   M+K
Sbjct  102   RYDMIKFFKLIQEHEMYAMVRIGPFVQAEWNHGGLPYWLREVPDIIFRTDNEPFKKLMQK  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  ++V+ +K+AKLFA QGGPIILAQIENEY  +E+   A  +   +YI WAA MA+   
Sbjct  162   FVTLVVNKLKEAKLFASQGGPIILAQIENEYQHMEA---AFKENGTRYIEWAAKMAISTG  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VI TCNGR CGDT+ GP   NKP +WTENWTAQYR FGDPP+QR
Sbjct  219   TGVPWIMCKQTKAPADVIPTCNGRHCGDTWPGPVDKNKPLLWTENWTAQYRVFGDPPSQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFG------  998
             SAE+IA+++ RF +   GS + YYMY+GGTN+GRT ASFV  RYYDE PLDEFG      
Sbjct  279   SAEDIAFAVARFFS-VGGSMVNYYMYHGGTNFGRTGASFVMPRYYDEAPLDEFGKAETDE  337

Query  999   ----------------------LYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQ  1112
                                   ++++PKW HL+D H ALRL K  L  GTP+ Q L    
Sbjct  338   SSQTLNMLNYVDLWMNGLVGPGMFKEPKWGHLKDLHHALRLCKNALLFGTPSTQPLGKLY  397

Query  1113  EIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVS  1289
             E   FE    K+C AFL+N+NT    ++ FRG  Y++P  S S+L DCKT VF++Q + +
Sbjct  398   EARVFEIPEQKVCVAFLSNHNTKEDGTVTFRGQNYFVPRRSVSILGDCKTVVFSTQYVNA  457

Query  1290  QHNARRFVPSKLAGRDDLKWEMFQE--TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYST  1463
             QHN R F  +    ++++ WEM+ E   +PT      ++ +PLE Y +TKD +DY WY+T
Sbjct  458   QHNQRTFHFTDQTVQNNV-WEMYTEGDKVPTYKFSTDRSEKPLEAYNMTKDKTDYLWYTT  516

Query  1464  RIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPG  1643
                    DL +R DI PVL+  S GHA+VAFVN + VG  HG   +KA SL KP+++K G
Sbjct  517   SFLLDPEDLPSRLDIKPVLEASSHGHAMVAFVNKKLVGCGHGTKMNKAFSLEKPIEVKVG  576

Query  1644  NNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKL  1823
              N I++L    G  +SG+ +++R  G   VTIQGL  GTL +T N W H VG+ GE+ + 
Sbjct  577   INHISILSSTLGLQDSGSYLERRQAGVHSVTIQGLNTGTLDLTSNGWGHIVGLEGERKQA  636

Query  1824  FTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYW  2003
             FT++G + V+W+P      P+TWY+  FD P G +PV + M+ M KG+++VNG+ +GRYW
Sbjct  637   FTDKGGE-VQWQPAV-FDKPLTWYRRRFDMPTGEDPVVIDMNPMGKGILFVNGEGLGRYW  694

Query  2004  VAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYY  2183
              ++   LG+PSQ  YH+PR F+KP  N++ +FEE+GG P +I ++ V RD ICS +S+  
Sbjct  695   SSYKHALGRPSQYLYHVPRCFLKPTGNVLTIFEEEGGRPDAIMILTVKRDNICSFISETN  754

Query  2184  PGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSF  2363
             PG+V+SWE K  +L  V +D++P   L CPE K+++++ FA+YG+P G CGN+  GNC  
Sbjct  755   PGHVRSWETKDSQLTMVADDLKPRAVLTCPEKKMIQQVVFASYGNPLGICGNYTFGNCHT  814

Query  2364  PNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRH  2519
             P A +IVEKAC+GK  C + V   ++  G    CP     TLAVQAKC  R 
Sbjct  815   PKAKEIVEKACVGKRSCVLAVSHEVY--GGDLNCPGTT-ATLAVQAKCSKRQ  863



>ref|NP_001062440.1| Os08g0549200 [Oryza sativa Japonica Group]
 sp|Q6ZJJ0.1|BGA11_ORYSJ RecName: Full=Beta-galactosidase 11; AltName: Full=Lactase 115; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD08952.1| putative glycosyl hydrolase family 35 (beta-galactosidase) [Oryza 
sativa Japonica Group]
 dbj|BAF24354.1| Os08g0549200 [Oryza sativa Japonica Group]
Length=848

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/809 (49%), Positives = 539/809 (67%), Gaps = 18/809 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR PP+ WPD++ +AKEGGLNVI++YVFWN HEP QG +NFEG
Sbjct  40    LIIDGHREIFFSGSIHYPRSPPDTWPDLISKAKEGGLNVIESYVFWNGHEPEQGVYNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+KF K+I +  MY  +R+GPF++AEWN GG PYWL+E+P I FRT NEPF  +MK+
Sbjct  100   RYDLIKFFKLIQEKEMYAIVRIGPFVQAEWNHGGLPYWLREIPDIIFRTNNEPFKKYMKQ  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  +IV+ +K+AKLFA QGGPIILAQIENEY  +E    A  +   KYINWAA MA+   
Sbjct  160   FVTLIVNKLKEAKLFASQGGPIILAQIENEYQHLEV---AFKEAGTKYINWAAKMAIATN  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP +VI TCNGR CGDT+ GP    KP +WTENWTAQYR FGDPP+QR
Sbjct  217   TGVPWIMCKQTKAPGEVIPTCNGRHCGDTWPGPADKKKPLLWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF +   G+   YYMY+GGTN+GR  A+FV  RYYDE PLDEFGLY++PK
Sbjct  277   SAEDIAFSVARFFS-VGGTMANYYMYHGGTNFGRNGAAFVMPRYYDEAPLDEFGLYKEPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HLRD H ALR  K+ L  G P++Q L    E   FE +   +C AFL+N+NT    ++
Sbjct  336   WGHLRDLHHALRHCKKALLWGNPSVQPLGKLYEARVFEMKEKNVCVAFLSNHNTKEDGTV  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMF-QETI  1370
              FRG +Y++   S S+L DCKT VF++Q++ SQHN R F  +    +D++ WEM+ +E I
Sbjct  396   TFRGQKYFVARRSISILADCKTVVFSTQHVNSQHNQRTFHFADQTVQDNV-WEMYSEEKI  454

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  RPLE Y  TKD +DY WY+T       DL  R ++ PVL+V S GHA+V
Sbjct  455   PRYSKTSIRTQRPLEQYNQTKDKTDYLWYTTSFRLETDDLPYRKEVKPVLEVSSHGHAIV  514

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN  FVG  HG   +KA ++ K +DLK G N + +L    G  +SG+ ++ R  G   
Sbjct  515   AFVNDAFVGCGHGTKINKAFTMEKAMDLKVGVNHVAILSSTLGLMDSGSYLEHRMAGVYT  574

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTI+GL  GTL +T N W H VG+ GE+ ++ +E+G   V WKP  + + P+TWY+  FD
Sbjct  575   VTIRGLNTGTLDLTTNGWGHVVGLDGERRRVHSEQGMGAVAWKPGKD-NQPLTWYRRRFD  633

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +PV + +  M KG ++VNG+ +GRYWV++   LG+PSQ  YH+PR+ ++PK N +
Sbjct  634   PPSGTDPVVIDLTPMGKGFLFVNGEGLGRYWVSYHHALGKPSQYLYHVPRSLLRPKGNTL  693

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVK-SWERKGEELR------QVVEDIR  2249
             + FEE+GG P +I ++ V RD IC+ +++  P +V+ SWE K  + +           ++
Sbjct  694   MFFEEEGGKPDAIMILTVKRDNICTFMTEKNPAHVRWSWESKDSQPKAVAGAGAGAGGLK  753

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P+  L CP  K ++ + FA+YG+P G CGN+ VG+C  P   ++VEKAC+G+  C + V 
Sbjct  754   PTAVLSCPTKKTIQSVVFASYGNPLGICGNYTVGSCHAPRTKEVVEKACIGRKTCSLVVS  813

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKCGLR  2516
               ++  G    CP     TLAVQAKC  R
Sbjct  814   SEVY--GGDVHCPGTT-GTLAVQAKCSKR  839



>ref|XP_009396587.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=739

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/738 (52%), Positives = 511/738 (69%), Gaps = 11/738 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP+++  AK GGLNVIQTYVFWN+HEPVQGQ+NF+G  D+V+FIK+I   GMY TLR+G
Sbjct  1     MWPEIIASAKHGGLNVIQTYVFWNLHEPVQGQYNFQGKYDVVRFIKLIEKKGMYATLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             P++EAEWN+GGFPYWLKEV  I+FRT N PF  HMK+F E +V +MK  KLFA QGGPII
Sbjct  61    PYIEAEWNYGGFPYWLKEVQNISFRTDNPPFKYHMKRFVEKVVSLMKDEKLFASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L+Q+ENEY+++     A      +Y+ WA +MA+ L   +PW+MCK+  AP  VI+ CNG
Sbjct  121   LSQVENEYNNVAH---AYKDAGLRYVRWAGNMAVDLKTGVPWVMCKEKSAPGPVINACNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
             R CGDTF  PN   KP +WTENWTAQYR FGDPP+QRSAE++AYS+ RF + KNG+ + Y
Sbjct  178   RNCGDTFEVPNNSTKPFLWTENWTAQYRVFGDPPSQRSAEDLAYSVARFFS-KNGTLVNY  236

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GR+ +SF  TRYYDE PLDEFGL+++PK+ HL D H ALRL  + L  G  
Sbjct  237   YMYHGGTNFGRSGSSFAMTRYYDEAPLDEFGLHKEPKYGHLSDLHHALRLCSKALLWGVS  296

Query  1086  TIQKLP-NNQEIITFENQNLKLCAAFLTNNN-TTPTSIKFRGTQYYLPGFSTSVLPDCKT  1259
             ++Q    +  E   +EN  +K CAAFL+N+N     ++ F+GT YYLP  S S+LPDCKT
Sbjct  297   SVQTFDIDGFEATVYENPGMKACAAFLSNSNRKIEGTVNFKGTDYYLPRRSISILPDCKT  356

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
               FN+Q ++SQHNAR F  +K +  ++ +W+M ++ IP   +  +++   LEL+ +TKDT
Sbjct  357   VAFNTQKVISQHNARTFHVAKESSMNN-QWQMHKDHIPRFRDTRVRSRSTLELFNMTKDT  415

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDY WY+T     + DL  R DI PVL V ++GHA+ AFVNG   GS HG N +K+    
Sbjct  416   SDYLWYTTSFRLEDDDLPRRHDIRPVLLVSNLGHAMHAFVNGRHAGSGHGTNIEKSFVFH  475

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             +P+ L  G N +T+L +  G PNSG+ ++ R  G   V IQGL  GTL ++ N W H VG
Sbjct  476   QPIALGAGINHVTILCMTIGLPNSGSYLEHRIAGVHTVVIQGLNTGTLDLSQNGWGHQVG  535

Query  1800  VSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVN  1979
             + GEKL +F E+G   V W    N   P+TWYK YFDAP GN+PVAL + +M+KGMVW+N
Sbjct  536   LVGEKLGIFNEKGVNNVNWTQAQN-DMPITWYKRYFDAPSGNDPVALDLTSMSKGMVWIN  594

Query  1980  GKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTI  2159
             G+SIGRYWV++L+PL +PSQ  YH+PR+ +KPK+NLMVVFEE  G P  I ++ V RD I
Sbjct  595   GESIGRYWVSYLNPLQKPSQSVYHVPRSLLKPKDNLMVVFEEHRGKPEGIVMMTVKRDNI  654

Query  2160  CSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
             C+ VS+ +PG   S  R+  +L  V     P  RLKC   KV+  I FA++G+P+G CGN
Sbjct  655   CTFVSELFPGQASSSLRESSKLGTVEH---PEARLKCTGKKVIHSIAFASFGNPEGLCGN  711

Query  2340  FIVGNCSFPNANKIVEKA  2393
             +  G+C  P    +VEK 
Sbjct  712   YSRGSCHAPQTKAVVEKV  729



>gb|EEE69115.1| hypothetical protein OsJ_28192 [Oryza sativa Japonica Group]
Length=848

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/809 (49%), Positives = 537/809 (66%), Gaps = 18/809 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R+I F+GSIHYPR PP+ WPD++ +AKEGGLNVI++YVFWN HEP QG +NFEG
Sbjct  40    LIIDGHREIFFSGSIHYPRSPPDTWPDLISKAKEGGLNVIESYVFWNGHEPEQGVYNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+KF K+I +  MY  +R+GPF++AEWN GG PYWL+E+P I FRT NEPF  +MK+
Sbjct  100   RYDLIKFFKLIQEKEMYAIVRIGPFVQAEWNHGGLPYWLREIPDIIFRTNNEPFKKYMKQ  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F  +IV+ +K+AKLFA QGGPIILAQIENEY  +E    A  +   KYINWAA MA+   
Sbjct  160   FVTLIVNKLKEAKLFASQGGPIILAQIENEYQHLEV---AFKEAGTKYINWAAKMAIATN  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP +VI TCNGR CGDT+ GP    KP +WTENWTAQYR FGDPP+QR
Sbjct  217   TGVPWIMCKQTKAPGEVIPTCNGRHCGDTWPGPADKKKPLLWTENWTAQYRVFGDPPSQR  276

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+S+ RF +   G+   YYMY+GGTN+GR  A+FV  RYYDE P DEFGLY++PK
Sbjct  277   SAEDIAFSVARFFS-VGGTMANYYMYHGGTNFGRNGAAFVMPRYYDEAPFDEFGLYKEPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HLRD H ALR  K+ L  G P++Q L    E   FE +   +C AFL+N+NT    ++
Sbjct  336   WGHLRDLHHALRHCKKALLWGNPSVQPLGKLYEARVFEMKEKNVCVAFLSNHNTKEDGTV  395

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMF-QETI  1370
              FRG +Y++   S S+L DCKT VF++Q++ SQHN R F  +    +D++ WEM+ +E I
Sbjct  396   TFRGQKYFVARRSISILADCKTVVFSTQHVNSQHNQRTFHFADQTVQDNV-WEMYSEEKI  454

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  RPLE Y  TKD +DY WY+T       DL  R ++ PVL+V S GHA+V
Sbjct  455   PRYSKTSIRTQRPLEQYNQTKDKTDYLWYTTSFRLETDDLPYRKEVKPVLEVSSHGHAIV  514

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN  FVG  HG   +KA ++ K +DLK G N + +L    G  +SG+ ++ R  G   
Sbjct  515   AFVNDAFVGCGHGTKINKAFTMEKAMDLKVGVNHVAILSSTLGLMDSGSYLEHRMAGVYT  574

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTI+GL  GTL +T N W H VG+ GE+ ++ +E+G   V WKP  + + P+TWY+  FD
Sbjct  575   VTIRGLNTGTLDLTTNGWGHVVGLDGERRRVHSEQGMGAVAWKPGKD-NQPLTWYRRRFD  633

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
              P G +PV + +  M KG ++VNG+ +GRYWV++   LG+PSQ  YH+PR+ ++PK N +
Sbjct  634   PPSGTDPVVIDLTPMGKGFLFVNGEGLGRYWVSYHHALGKPSQYLYHVPRSLLRPKGNTL  693

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVK-SWERKGEELR------QVVEDIR  2249
             + FEE+GG P +I ++ V RD IC+ +++  P +V+ SWE K  + +            +
Sbjct  694   MFFEEEGGKPDAIMILTVKRDNICTFMTEKNPAHVRWSWESKDSQPKAVAGAGAGAGGFK  753

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P+  L CP  K ++ + FA+YG+P G CGN+ VG+C  P   ++VEKAC+G+  C + V 
Sbjct  754   PTAVLSCPTKKTIQSVVFASYGNPLGICGNYTVGSCHAPRTKEVVEKACIGRKTCSLVVS  813

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKCGLR  2516
               ++  G    CP     TLAVQAKC  R
Sbjct  814   SEVY--GGDVHCPGTT-GTLAVQAKCSKR  839



>ref|XP_004959631.1| PREDICTED: beta-galactosidase 12-like [Setaria italica]
Length=838

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/798 (49%), Positives = 525/798 (66%), Gaps = 11/798 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMWP +++RAKEGGLN I+TYVFWN HEP  G++NFEG
Sbjct  44    LMIDGKRDLFFSGAIHYPRSPPEMWPKLIERAKEGGLNTIETYVFWNAHEPEPGKYNFEG  103

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+K+IKMI D GMY  +R+GPF++AEWN GG PYWL+E+  I FR  NE F   M+K
Sbjct  104   RLDLIKYIKMIQDHGMYAIVRIGPFIQAEWNHGGLPYWLREIGHIIFRANNEAFKKEMEK  163

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A+LFA QGGPIIL QIENEY +I+ D   +     KY+ WAA MA+   
Sbjct  164   FVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHKTE---GDKYLEWAAQMALSTQ  220

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  +KP +WTENWTAQ+R +GD  A R
Sbjct  221   TGVPWIMCKQSSAPGEVIPTCNGRHCGDTWTLLDK-DKPMLWTENWTAQFRAYGDQLAMR  279

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K GS + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+ ++PK
Sbjct  280   SAEDIAYAVLRFFA-KGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPK  338

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  +R  ++    G  + +KL +  E  TFE     LC +FL+NNNT    ++
Sbjct  339   FGHLRDLHNVIRSYQKAFLTGEHSSEKLGHGYEAHTFELPEDNLCLSFLSNNNTGEDGTV  398

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L  CK  V+N++ +  QH+ R F  S++  ++   WEM+ E IP
Sbjct  399   TFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSEVTSKNK-SWEMYSEQIP  457

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++   PLE Y  TKD SDY WY+T       DL  RGDI PVL V S  H++V 
Sbjct  458   KFHKTKVRTKEPLEQYNQTKDASDYLWYTTSFRLESDDLPFRGDIRPVLQVKSTAHSMVG  517

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVGS  G+   K     KPVDLK G N ITLL    G  +SG  + +   G ++ 
Sbjct  518   FANDAFVGSGRGSKQVKGFMFEKPVDLKVGVNHITLLSSAMGMKDSGGELAEVKGGIQEC  577

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H   + GE  ++++E+G  KV+WKP  N   P TWYK YFD 
Sbjct  578   LIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGMGKVQWKPAQN-DQPATWYKRYFDE  636

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M+KGM++VNG+ IGRYWV++ +  G PSQ  YHIPR F+K K+NL+V
Sbjct  637   PDGDDPVVLDMSSMSKGMIYVNGEGIGRYWVSYRTLDGTPSQALYHIPRPFLKSKDNLLV  696

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ P  +K+W+  G++++ + ED      L CP
Sbjct  697   VFEEEMGKPDGILVQTVTRDDICVLLSEHNPAQIKTWDTDGDKIKLIAEDHSTRGTLSCP  756

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K ++++ FA++G+P+G CGNF VG C  PNA ++VEK CLGK  C +PVE +L+  G+
Sbjct  757   PKKTIQEVVFASFGNPEGMCGNFTVGTCHTPNAKQVVEKECLGKPSCVLPVEHTLY--GA  814

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                CP+    TL VQ +C
Sbjct  815   DINCPSTT-ATLGVQVRC  831



>ref|XP_006660050.1| PREDICTED: beta-galactosidase 12-like [Oryza brachyantha]
Length=838

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/803 (48%), Positives = 533/803 (66%), Gaps = 13/803 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMW  ++K+AK GGLN I+TYVFWN HEP  G++NF G
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEMWDRLIKQAKLGGLNTIETYVFWNGHEPEPGKYNFGG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               +L+KF+K+I D  MY  +R+GPF++AEWN GG PYWL+E+  I FR  NEPF   M+K
Sbjct  103   RFNLIKFLKLIKDNDMYAIIRIGPFIQAEWNHGGLPYWLREIGHIIFRANNEPFKREMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K  ++FAPQGGPIIL+QIENEY +I+ DR   I    KY+ WAA+MA+   
Sbjct  163   FVRFIVQKLKDEEMFAPQGGPIILSQIENEYGNIKKDR---IIEGDKYLEWAAEMAVSTG  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+RTFGD  AQR
Sbjct  220   IGIPWIMCKQSTAPGEVIPTCNGRHCGDTWTLRD-TNKPRLWTENWTAQFRTFGDQLAQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K G+ + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+ ++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGTLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H+ +R  ++    G  + + L +  E   FE    KLC AFL+NNNT    ++
Sbjct  338   FGHLRDLHSVIRSYQKAFLWGKQSFEILGHGYEAHNFELPEEKLCLAFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L DCKT V+N++ +  QH+ R F  S  + ++++ WEM+ E IP
Sbjct  398   VFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTSDESTKNNV-WEMYSEAIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++   P+E Y  TKDTSDY WY+T       DL  R DI PV+ V S  HA++ 
Sbjct  457   KYHKTKLRTKEPMEQYNQTKDTSDYLWYTTSFRLESDDLPFRRDIRPVIQVKSTAHAMIG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG+  G+  DK+    KP+DL+ G N I +L    G  +SG  + +   G +D 
Sbjct  517   FANDAFVGTGRGSKRDKSFVFEKPMDLRIGVNHIAMLSSSMGMKDSGGELVEVKGGIQDC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +QGL  GTL +  N W H   + GE  +++TE+G  K +WKP  N   P+TWYK YFD 
Sbjct  577   VVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAKFQWKPADN-DLPITWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M+KGM++VNG+ +GRYW +F +  GQPSQ  YHIPRA++KPK NL+V
Sbjct  636   PDGDDPVVLDMSSMSKGMMFVNGEGLGRYWTSFRTLAGQPSQSVYHIPRAYLKPKGNLLV  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGE--ELRQVVEDIRPSVRLK  2267
             +FEE+ G P  I +  V RD IC  +S++ P  +K+WE  G   +++ + ED      L 
Sbjct  696   IFEEELGKPGGILVQTVRRDDICVFISEHNPAQIKTWESDGAGGQIKLIAEDHSTRGTLA  755

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP D+ ++++ FA++G+P+GACGNF  G C  P+A  IVEK CLGK  C +PV  +++  
Sbjct  756   CPPDRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKECLGKDSCVLPVVHTVY--  813

Query  2448  GSKDLCPNLVHKTLAVQAKCGLR  2516
             G+   CP     TLAVQA+C ++
Sbjct  814   GADINCPATT-ATLAVQARCKVK  835



>emb|CAA17766.1| beta-galactosidase-like protein [Arabidopsis thaliana]
 emb|CAB80218.1| beta-galactosidase-like protein [Arabidopsis thaliana]
Length=831

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/811 (48%), Positives = 542/811 (67%), Gaps = 58/811 (7%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++L++GSIHYPR  PEMWP ++KRAK+GGLN IQTYVFWN+HEP QG+FNF G
Sbjct  61    LIIDGKRELLYSGSIHYPRSTPEMWPSIIKRAKQGGLNTIQTYVFWNVHEPQQGKFNFSG  120

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I   GMYVTLR+GPF++AEW  G    +  +    A+R            
Sbjct  121   RADLVKFIKLIQKNGMYVTLRLGPFIQAEWTHGYITRYDHKNIAGAYR------------  168

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
                                      +IENEYS+++     D      YI WA+++   + 
Sbjct  169   -------------------------KIENEYSAVQRAYKQD---GLNYIKWASNLVDSMK  200

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  NKPS+WTENWT Q+R FGDPP QR
Sbjct  201   LGIPWVMCKQNDAPDPMINACNGRHCGDTFPGPNRENKPSLWTENWTTQFRVFGDPPTQR  260

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAYS+ RF + KNG+++ YYMY+GGTN+GRT+A +VTTRYYD+ PLDE+GL ++PK
Sbjct  261   SVEDIAYSVARFFS-KNGTHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEYGLEKEPK  319

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H AL L K+PL  G P  +K   + EI  +E    K CAAFL NNNT    +I
Sbjct  320   YGHLKHLHNALNLCKKPLLWGQPKTEKPGKDTEIRYYEQPGTKTCAAFLANNNTEAAETI  379

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF+G +Y +   S S+LPDCKT V+N+  IVSQH +R F+ SK A +    +++F ET+P
Sbjct  380   KFKGREYVIAPRSISILPDCKTVVYNTAQIVSQHTSRNFMKSKKANK-KFDFKVFTETLP  438

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +  P+ELY LTKD +DY WY+T  +  +  L T+  +   + + S+GHAL A
Sbjct  439   S--KLEGNSYIPVELYGLTKDKTDYGWYTTSFKVHKNHLPTKKGVKTFVRIASLGHALHA  496

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NGE++GS HG++++K+   +K V LK G N + +LGVLTGFP+SG+ M+ R+TGPR +
Sbjct  497   WLNGEYLGSGHGSHEEKSFVFQKQVTLKAGENHLVMLGVLTGFPDSGSYMEHRYTGPRGI  556

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWY-----  1895
             +I GL +GTL +T +S W + +G+ GEKL + TEEG +KV+WK  T   P +TWY     
Sbjct  557   SILGLTSGTLDLTESSKWGNKIGMEGEKLGIHTEEGLKKVEWKKFTGKAPGLTWYQKFSK  616

Query  1896  -----KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPR  2060
                  +TYFDAPE  +   +RM  M KG++WVNG+ +GRYW +FLSPLGQP+Q EYHIPR
Sbjct  617   ECETLQTYFDAPESVSAATIRMHGMGKGLIWVNGEGVGRYWQSFLSPLGQPTQIEYHIPR  676

Query  2061  AFMKPKNNLMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVV  2237
             +F+KPK NL+V+FEE+    P  ++  +VNRDT+CS V + Y  +V+ W RK ++++ + 
Sbjct  677   SFLKPKKNLLVIFEEEPNVKPELMDFAIVNRDTVCSYVGENYTPSVRHWTRKKDQVQAIT  736

Query  2238  EDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCK  2417
             +++  +  LKC   K +  +EFA++G+P G CGNF +G C+ P + +++EK CLGK++C 
Sbjct  737   DNVSLTATLKCSGTKKIAAVEFASFGNPIGVCGNFTLGTCNAPVSKQVIEKHCLGKAECV  796

Query  2418  VPVEKSLFQEGSKDLCPNLVHKTLAVQAKCG  2510
             +PV KS FQ+  KD C N+V K LAVQ KCG
Sbjct  797   IPVNKSTFQQDKKDSCKNVV-KMLAVQVKCG  826



>ref|XP_008668408.1| PREDICTED: uncharacterized protein LOC100383352 isoform X1 [Zea 
mays]
Length=837

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/799 (48%), Positives = 523/799 (65%), Gaps = 11/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMWP +++RAKEGGLN I+TY+FWN HEP  G++NFEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEMWPKLIERAKEGGLNTIETYIFWNAHEPEPGKYNFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+K++KMI +  MY  +R+GPF++AEWN GG PYWL+E+  I FR  N+P+   M+K
Sbjct  103   RFDLIKYLKMIQEHDMYAIVRIGPFIQAEWNHGGLPYWLREIDHIIFRANNDPYKKEMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A+LFA QGGPIIL QIENEY +I+ D   D     KY+ WAA MA+   
Sbjct  163   FVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHATD---GDKYLEWAAQMALSTQ  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWT Q+R +GD  A R
Sbjct  220   TGVPWIMCKQSSAPGEVIPTCNGRHCGDTWTLRDK-NKPMLWTENWTQQFRAYGDQVAMR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K GS + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+Y++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMYKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  +R  ++    G  + + L +  E   FE    KLC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIRSYQKAFLWGQHSSEILGHGYEAHIFELPEEKLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L  CK  V+N++ +  QH+ R F  S +  +++ +WEMF ETIP
Sbjct  398   IFRGDKHYVPSRSVSILAGCKNVVYNTKRVFVQHSERSFHTSDVTSKNN-QWEMFSETIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                +  ++   PLE Y  TKD +DY WY+T       DL  R DI PVL V S  HA++ 
Sbjct  457   KYRDTKVRTKEPLEQYNQTKDDTDYLWYTTSFRLESDDLPFRNDIRPVLQVKSSAHAMMG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG   GN   K     KPVDLK G N + LL    G  +SG  + +   G ++ 
Sbjct  517   FANDAFVGCARGNKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMKDSGGELAEVKGGIQEC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H   + GE  ++++E+G  KV+WKP  N     TWYK YFD 
Sbjct  577   LIQGLNTGTLDLQVNGWGHKAALEGEYKEIYSEKGLGKVQWKPAEN-DRAATWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M+KGM++VNG+ +GRYWV++ +  G PSQ  YHIPR F+K K+NL+V
Sbjct  636   PDGDDPVVLDMSSMSKGMIFVNGEGVGRYWVSYRTLAGTPSQAVYHIPRPFLKSKDNLLV  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+ G P  I +  V RD IC  +S++ PG +K+W+  G++++ + ED      L CP
Sbjct  696   IFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGDKIKLIAEDHSRRGTLTCP  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
              +K ++++ FA++G+PDG CGNF VG C  PNA +IVEK CLGK  C +PV+ +++    
Sbjct  756   PEKTIQEVVFASFGNPDGMCGNFTVGTCHTPNAKQIVEKECLGKPSCMLPVDHTVY---G  812

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D+       TL VQ +CG
Sbjct  813   ADINCQSTTATLGVQVRCG  831



>ref|XP_003576777.1| PREDICTED: beta-galactosidase 12-like [Brachypodium distachyon]
Length=835

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/806 (48%), Positives = 522/806 (65%), Gaps = 11/806 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMWP +L RAK+GGLN I+TYVFWN HEP  G++NFEG
Sbjct  40    LMIDGKRDLFFSGAIHYPRSPPEMWPKLLDRAKDGGLNTIETYVFWNAHEPEPGKYNFEG  99

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+KF+K+I D  MY  +R+GPF++AEWN GG PYWL+E+P I FR  NEP+   M+K
Sbjct  100   RCDLIKFLKLIQDNDMYAVIRIGPFIQAEWNHGGLPYWLREIPHIIFRANNEPYKKEMEK  159

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A +FA QGGPIILAQIENEY +I+ D   D     KY+ WAA+MA+   
Sbjct  160   FVRFIVQKLKDADMFASQGGPIILAQIENEYGNIKKDHITD---GDKYLEWAAEMALSTN  216

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ  AP  VI TCNGR CGDT+   +  NKP +WTENWTAQ+R FGD  A R
Sbjct  217   IGIPWIMCKQTTAPGVVIPTCNGRHCGDTWTLRDK-NKPRLWTENWTAQFRAFGDQAAVR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS++RF A K G+ + YYMYYGGTN+GRT AS+V T YYDE P+DE+GL ++PK
Sbjct  276   SAEDIAYSVLRFFA-KGGTLVNYYMYYGGTNFGRTGASYVLTGYYDEAPIDEYGLNKEPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   +   +G  + + L +  E   +E     LC AF++NNNT    ++
Sbjct  335   FGHLRDLHKLIKSYHKAFLVGKQSFELLGHGYEAHNYELPEENLCLAFISNNNTGEDGTV  394

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +YY+P  S S+L DC   V+N++ +  QH+ R F  +  + ++++ WEM+ E IP
Sbjct  395   MFRGKKYYIPSRSVSILADCNHVVYNTKRVFVQHSERSFHTADESTKNNV-WEMYSEPIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++   PLE Y LTKD SDY WY+T       DL  R DI PV+ V S  HA++ 
Sbjct  454   RYKVTSVRTKEPLEQYNLTKDKSDYLWYTTSFRLEADDLPFRRDIRPVVQVKSSAHAMMG  513

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVN  F GS  G+  DK     KP+DL+ G N + LL    G  +SG  + +   G +D 
Sbjct  514   FVNDAFAGSGRGSKKDKGFLFEKPIDLRIGINHLALLSSSMGMKDSGGELVEVKGGIQDC  573

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H + + GE  +++TE+G   VKWKP  N H  VTWY+ YFD 
Sbjct  574   MIQGLNTGTLDLQGNGWGHKINLDGEDKEIYTEKGMGTVKWKPAENGH-AVTWYRRYFDE  632

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M+KGM++VNG+ +GRYW ++ +  G PSQ  YHIPR F+K K NL+V
Sbjct  633   PDGDDPVVLDMSSMSKGMIFVNGEGVGRYWTSYKTIAGLPSQSLYHIPRPFLKSKKNLLV  692

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ P  VK+W+  G +++ + ED      L CP
Sbjct  693   VFEEEIGKPEGILIQTVRRDDICFLMSEHNPAQVKTWDADGGQIKLIAEDHSSRGILTCP  752

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K ++++ FA++G+P+GACGNF  G C  PNA + V K CLGK  C +P+  +L+  G+
Sbjct  753   HKKTIEEVVFASFGNPEGACGNFTAGTCHTPNAKEFVAKECLGKKSCVLPLIHTLY--GA  810

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
                CP     TLAVQ +C  +  KDD
Sbjct  811   DINCPTTT-ATLAVQVRCHRKGKKDD  835



>emb|CAB37515.1| galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80523.1| galactosidase like protein [Arabidopsis thaliana]
Length=1036

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/748 (53%), Positives = 535/748 (72%), Gaps = 17/748 (2%)
 Frame = +3

Query  279   QFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPF  458
             Q++F+G  DLVKFIK+I + G+YVTLR+GPF++AEWN GG PYWL+EVP + FRT NEPF
Sbjct  80    QYDFKGRFDLVKFIKLIHEKGLYVTLRLGPFIQAEWNHGGLPYWLREVPDVYFRTNNEPF  139

Query  459   MNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAAD  638
               H +++   I+ MMK+ KLFA QGGPIIL QIENEY++++    A  +  +KYI WAA+
Sbjct  140   KEHTERYVRKILGMMKEEKLFASQGGPIILGQIENEYNAVQL---AYKENGEKYIKWAAN  196

Query  639   MAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFG  818
             +   +   IPW+MCKQN+AP  +I+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FG
Sbjct  197   LVESMNLGIPWVMCKQNDAPGNLINACNGRHCGDTFPGPNRHDKPSLWTENWTTQFRVFG  256

Query  819   DPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFG  998
             DPP QR+ E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDEFG
Sbjct  257   DPPTQRTVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEFG  315

Query  999   LYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT  1178
             L + PK+ HL+  H ALRL K+ LF G    Q L  + E+  +E    K+CAAFL+NNNT
Sbjct  316   LEKAPKYGHLKHVHRALRLCKKALFWGQLRAQTLGPDTEVRYYEQPGTKVCAAFLSNNNT  375

Query  1179  TPT-SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEM  1355
               T +IKF+G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+   +  LK+EM
Sbjct  376   RDTNTIKFKGQDYVLPSRSISILPDCKTVVYNTAQIVAQHSWRDFVKSEKTSK-GLKFEM  434

Query  1356  FQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSM  1535
             F E IP++  L   +L P ELY LTKD +DYAWY+T ++  E D   +  +  +L V S+
Sbjct  435   FSENIPSL--LDGDSLIPGELYYLTKDKTDYAWYTTSVKIDEDDFPDQKGLKTILRVASL  492

Query  1536  GHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRF  1715
             GHAL+ +VNGE+ G  HG ++ K+    KPV+ K G+N I++LGVLTG P+SG+ M+ RF
Sbjct  493   GHALIVYVNGEYAGKAHGRHEMKSFEFAKPVNFKTGDNRISILGVLTGLPDSGSYMEHRF  552

Query  1716  TGPRDVTIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTW  1892
              GPR ++I GL +GT  +T N+ W H  G+ GEK +++TEEGS+KVKW+       P+TW
Sbjct  553   AGPRAISIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEEGSKKVKWEK-DGKRKPLTW  611

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK  2072
             YKTYF+ PEG N VA+RM  M KG++WVNG  +GRYW++FLSPLG+P+Q EYHIPR+FMK
Sbjct  612   YKTYFETPEGVNAVAIRMKAMGKGLIWVNGIGVGRYWMSFLSPLGEPTQTEYHIPRSFMK  671

Query  2073  --PKNNLMVVFEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVED  2243
                K N++V+ EE+ G    SI+ VLVNRDTICS+V + YP +VKSW+R+G ++    +D
Sbjct  672   GEKKKNMLVILEEEPGVKLESIDFVLVNRDTICSNVGEDYPVSVKSWKREGPKIVSRSKD  731

Query  2244  IRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVP  2423
             +R    ++CP +K + +++FA++GDP G CGNF +G CS   + ++VEK CLG++ C + 
Sbjct  732   MRLKAVMRCPPEKQMVEVQFASFGDPTGTCGNFTMGKCSASKSKEVVEKECLGRNYCSIV  791

Query  2424  VEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             V +  F +     CP +V KTLAVQ KC
Sbjct  792   VARETFGDKG---CPEIV-KTLAVQVKC  815



>ref|XP_008653570.1| PREDICTED: beta-galactosidase 12-like [Zea mays]
 tpg|DAA64335.1| TPA: hypothetical protein ZEAMMB73_578897 [Zea mays]
Length=837

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/799 (47%), Positives = 523/799 (65%), Gaps = 11/799 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPE+WP +++RAKEGGLN I+TY+FWN HEP  G++NFEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEVWPKLIERAKEGGLNTIETYIFWNAHEPEPGKYNFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+K++KMI +  MY  +R+GPF++AEWN GG PYWL+E+  I FR  N+P+   M+K
Sbjct  103   RFDLIKYLKMIQEHDMYAIVRIGPFIQAEWNHGGLPYWLREIDHIIFRANNDPYKKEMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A+LFA QGGPIIL QIENEY +I+ D   D     KY+ WAA MA+   
Sbjct  163   FVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHATD---GDKYLEWAAQMALSTQ  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWT Q+R +GD  A R
Sbjct  220   TGVPWIMCKQSSAPGEVIPTCNGRHCGDTWTLRDK-NKPMLWTENWTQQFRAYGDQVAMR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K GS + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+Y++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMYKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  +R  ++   LG  + + L +  E   FE     LC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIRSYQKAFLLGKHSSEILGHGYEAHIFELPEENLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L  CK  V+N++ +  QHN R +  S++  +++ +WEM+ E IP
Sbjct  398   IFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHNERSYHTSEVTSKNN-QWEMYSEKIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                +  ++   PLE +  TKD SDY WY+T       DL  R DI PVL V S  H+++ 
Sbjct  457   KYRDTKVRMKEPLEQFNQTKDASDYLWYTTSFRLESDDLPFRNDIRPVLQVKSSAHSMMG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG   G+   K     KPVDLK G N + LL    G  +SG  + +  +G ++ 
Sbjct  517   FANDAFVGCARGSKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMKDSGGELAEVKSGIQEC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H   + GE  ++++E+G  KV+WKP  N     TWYK YFD 
Sbjct  577   LIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGVGKVQWKPAENGR-AATWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M KGM++VNG+ +GRYWV++ +  G PSQ  YHIPR F+K K+NL+V
Sbjct  636   PDGDDPVVLDMSSMDKGMIFVNGEGVGRYWVSYRTLAGTPSQALYHIPRPFLKSKDNLLV  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ PG +K+W+  G++++ + ED      L CP
Sbjct  696   VFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGDKIKLIAEDHSRRGTLMCP  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
              +K ++++ FA++G+P+G CGNF VG C  PNA +IVEK CLGK  C +PV+ +++    
Sbjct  756   PEKTIQEVVFASFGNPEGMCGNFTVGTCHTPNAKQIVEKECLGKPSCMLPVDHTVY---G  812

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D+       TL VQ +CG
Sbjct  813   ADINCQSTTATLGVQVRCG  831



>gb|EEE70132.1| hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
Length=838

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/804 (47%), Positives = 529/804 (66%), Gaps = 11/804 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMW  ++K AK GGLN I+TYVFWN HEP  G++ FEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEMWDKLVKTAKMGGLNTIETYVFWNGHEPEPGKYYFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL++F+ +I D  MY  +R+GPF++AEWN GG PYWL+E+  I FR  NEPF   M+K
Sbjct  103   RFDLIRFLNVIKDNDMYAIVRIGPFIQAEWNHGGLPYWLREIGHIIFRANNEPFKREMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A++FAPQGGPIIL+QIENEY +I+ DR  +     KY+ WAA+MA+   
Sbjct  163   FVRFIVQKLKDAEMFAPQGGPIILSQIENEYGNIKKDRKVE---GDKYLEWAAEMAISTG  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+RTFGD  AQR
Sbjct  220   IGVPWVMCKQSIAPGEVIPTCNGRHCGDTWTLLDK-NKPRLWTENWTAQFRTFGDQLAQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K G+ + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+ ++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGTLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   +    G  + + L +  E   +E    KLC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDKLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L DCKT V+N++ +  QH+ R F  +    ++++ WEM+ E IP
Sbjct  398   VFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTDETSKNNV-WEMYSEAIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++  +PLE Y  TKDTSDY WY+T       DL  R DI PV+ + S  HA++ 
Sbjct  457   KFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRDIRPVIQIKSTAHAMIG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG+  G+  +K+    KP+DL+ G N I +L    G  +SG  + +   G +D 
Sbjct  517   FANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMKDSGGELVEVKGGIQDC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +QGL  GTL +  N W H   + GE  +++TE+G  + +WKP  N   P+TWYK YFD 
Sbjct  577   VVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAQFQWKPAEN-DLPITWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++P+ + M +M+KGM++VNG+ IGRYW +F++  G PSQ  YHIPRAF+KPK NL++
Sbjct  636   PDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQSVYHIPRAFLKPKGNLLI  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+ G P  I +  V RD IC  +S++ P  +K+WE  G +++ + ED      L CP
Sbjct  696   IFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGGQIKLIAEDTSTRGTLNCP  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + ++++ FA++G+P+GACGNF  G C  P+A  IVEK CLGK  C +PV  +++  G+
Sbjct  756   PKRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKECLGKESCVLPVVNTVY--GA  813

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAK  2525
                CP     TLAVQ +C +  A+
Sbjct  814   DINCPATT-ATLAVQVRCKVSGAQ  836



>emb|CAG30731.1| beta-galactosidase precursor [Triticum monococcum]
Length=839

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/806 (48%), Positives = 519/806 (64%), Gaps = 14/806 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R++ F+G+IHYPR P +MWP +LK AKEGGLN I+TYVFWN HEP  G+FNFEG
Sbjct  45    LMIDGRRELFFSGAIHYPRSPTQMWPKLLKTAKEGGLNTIETYVFWNAHEPEPGKFNFEG  104

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND++KF+K+I   GMY  +R+GPF++ EWN G  PYWL+E+P I FR  NEP+   M+K
Sbjct  105   RNDMIKFLKLIQSFGMYAIVRIGPFIQGEWNHGALPYWLREIPHIIFRANNEPYKREMEK  164

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV M+K   LFA QGG +ILAQIENEY +I+ D    I    KY+ WAA+MA+   
Sbjct  165   FVRFIVQMLKDENLFASQGGNVILAQIENEYGNIKKDH---ITEGDKYLEWAAEMAISTN  221

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP  VI TCNGR CGDT+   +  NKP +WTENWTAQ+R FG+  AQR
Sbjct  222   IGVPWIMCKQSTAPGVVIPTCNGRHCGDTWIMKD-ENKPHLWTENWTAQFRAFGNDLAQR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS++RF A K G+ + YYMYYGGTN+GRT AS+V T YYDEGP+DE+G+ + PK
Sbjct  281   SAEDIAYSVLRFFA-KGGTLVNYYMYYGGTNFGRTGASYVLTGYYDEGPIDEYGMPKAPK  339

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   R    G  + + L    E   FE    KLC AF++NNNT    ++
Sbjct  340   YGHLRDLHNVIKSYSRAFLEGKQSFELLGQGYEARNFEIPEEKLCLAFISNNNTGEDGTV  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +YY+P  S S+L DCK  V+N++ +  QH+ R F  ++ A ++++ WEMF E IP
Sbjct  400   IFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHKAEKATKNNV-WEMFSELIP  458

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   I+N  PLE Y  TKD SDY WY+T       DL  RGDI PV+ V S  HA+V 
Sbjct  459   RYKQTTIRNKEPLEQYNQTKDQSDYLWYTTSFRLEADDLPIRGDIRPVIAVKSTAHAMVG  518

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVN  F G+ HG+  +K  +   P+ L+ G N + LL    G  +SG  + +   G +D 
Sbjct  519   FVNDAFAGNGHGSKKEKFFTFETPISLRLGVNHLALLSSSMGMKDSGGELVELKGGIQDC  578

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TIQGL  GTL +  N W H   + GE  +++TE+G   VKW P  +    VTWYK YFD 
Sbjct  579   TIQGLNTGTLDLQINGWGHKAKLEGEVKEIYTEKGMGAVKWVPAVSGQ-AVTWYKRYFDE  637

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M KGM++VNG+ +GRYW ++ +P    SQ  YHIPR F+K KNNL+V
Sbjct  638   PDGDDPVVLDMTSMCKGMIFVNGEGMGRYWTSYKTPGKVASQAVYHIPRTFLKSKNNLLV  697

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ P  +K W+  G +++ + ED      L CP
Sbjct  698   VFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKPWDEHGGQIKLIAEDHNTRGFLNCP  757

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K+++++ FA++G+P G+C NF VG C  PNA +IVEK CLGK  C +PV  + +  G+
Sbjct  758   PKKIIQEVVFASFGNPVGSCANFTVGTCHTPNAKEIVEKECLGKKGCVLPVLHTFY--GA  815

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAKDD  2531
                CP     TLAVQ +C   H K D
Sbjct  816   DINCPTTT-ATLAVQVRC---HKKGD  837



>ref|XP_007041849.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
 gb|EOX97680.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
Length=692

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/618 (60%), Positives = 465/618 (75%), Gaps = 9/618 (1%)
 Frame = +3

Query  120   FIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGN  299
              I+G R++LF+GSIHYPR  P+ WPD+L +AK GGLNVIQTYVFWNIHEP++GQ+NFEG 
Sbjct  53    IINGKRELLFSGSIHYPRSTPDTWPDLLTKAKYGGLNVIQTYVFWNIHEPIEGQYNFEGQ  112

Query  300   NDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKF  479
              DLVKFIK+IG+  MY TLRVGPF++AEWN GG PYWL+EV  I FR+ NEPF ++MKKF
Sbjct  113   YDLVKFIKLIGEHKMYATLRVGPFIQAEWNHGGLPYWLREVRNITFRSDNEPFKHYMKKF  172

Query  480   AEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYN  659
               MI+DMMKK KLFA QGGPI+L+QIENEY++I+    A  ++   Y+ WA  MA+GL  
Sbjct  173   VTMIIDMMKKEKLFASQGGPIVLSQIENEYNTIQL---AFRELGDSYVQWAGKMAVGLNT  229

Query  660   EIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRS  839
             E+PWIMCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QRS
Sbjct  230   EVPWIMCKQRDAPDPIINTCNGRHCGDTFTGPNRRNKPSLWTENWTAQYRVFGDPPSQRS  289

Query  840   AENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKW  1019
             AE++AYS+ RF + KNGS + YYMY+GGTNYGRT+A+F TTRYYDE PLDE+GL RDPKW
Sbjct  290   AEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAPLDEYGLQRDPKW  348

Query  1020  SHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIK  1196
              HL+D H AL L K+ L  G+PT+QKL  +QE+ T++     LCAAFL NN+T    +  
Sbjct  349   GHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFLANNDTQNAQTFH  408

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FRG QY LP  S S+LPDCKT V+N+Q I +QHN R FV S  A + +  W+M++E +PT
Sbjct  409   FRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSATANK-NFNWQMYKEYVPT  467

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                L      P+ELY LTKDT+DYAWY+T IE   RDL  + +I PVL V S+GH L+AF
Sbjct  468   --QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPVLRVASLGHGLLAF  525

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNGE++G  HG+  +K+   +KPV LK G N ITLLG L G P+SGA M+ RF GPR +T
Sbjct  526   VNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGAYMEHRFAGPRSIT  585

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             I GL  GTL ++ N W H VG++GEK K++TE+GS KV+W+ ++   P +TWYK YFD P
Sbjct  586   ILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSE-SPALTWYKGYFDTP  644

Query  1917  EGNNPVALRMDNMAKGMV  1970
             EGNNPVA+RM  M KGM+
Sbjct  645   EGNNPVAIRMTGMGKGML  662



>sp|Q0IZZ8.2|BGA12_ORYSJ RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=911

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/795 (47%), Positives = 524/795 (66%), Gaps = 11/795 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMW  ++K AK GGLN I+TYVFWN HEP  G++ FEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEMWDKLVKTAKMGGLNTIETYVFWNGHEPEPGKYYFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL++F+ +I D  MY  +R+GPF++AEWN GG PYWL+E+  I FR  NEPF   M+K
Sbjct  103   RFDLIRFLNVIKDNDMYAIVRIGPFIQAEWNHGGLPYWLREIGHIIFRANNEPFKREMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A++FAPQGGPIIL+QIENEY +I+ DR  +     KY+ WAA+MA+   
Sbjct  163   FVRFIVQKLKDAEMFAPQGGPIILSQIENEYGNIKKDRKVE---GDKYLEWAAEMAISTG  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+RTFGD  AQR
Sbjct  220   IGVPWVMCKQSIAPGEVIPTCNGRHCGDTWTLLDK-NKPRLWTENWTAQFRTFGDQLAQR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K G+ + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+ ++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGTLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   +    G  + + L +  E   +E    KLC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDKLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L DCKT V+N++ +  QH+ R F  +    ++++ WEM+ E IP
Sbjct  398   VFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTDETSKNNV-WEMYSEAIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++  +PLE Y  TKDTSDY WY+T       DL  R DI PV+ + S  HA++ 
Sbjct  457   KFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRDIRPVIQIKSTAHAMIG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG+  G+  +K+    KP+DL+ G N I +L    G  +SG  + +   G +D 
Sbjct  517   FANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMKDSGGELVEVKGGIQDC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +QGL  GTL +  N W H   + GE  +++TE+G  + +WKP  N   P+TWYK YFD 
Sbjct  577   VVQGLNTGTLDLQGNGWGHKARLEGEDKEIYTEKGMAQFQWKPAEN-DLPITWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++P+ + M +M+KGM++VNG+ IGRYW +F++  G PSQ  YHIPRAF+KPK NL++
Sbjct  636   PDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQSVYHIPRAFLKPKGNLLI  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+ G P  I +  V RD IC  +S++ P  +K+WE  G +++ + ED      L CP
Sbjct  696   IFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGGQIKLIAEDTSTRGTLNCP  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + ++++ FA++G+P+GACGNF  G C  P+A  IVEK CLGK  C +PV  +++  G+
Sbjct  756   PKRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAIVEKECLGKESCVLPVVNTVY--GA  813

Query  2454  KDLCPNLVHKTLAVQ  2498
                CP     TLAVQ
Sbjct  814   DINCPATT-ATLAVQ  827



>ref|XP_010235388.1| PREDICTED: beta-galactosidase 11-like [Brachypodium distachyon]
Length=821

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/757 (51%), Positives = 509/757 (67%), Gaps = 14/757 (2%)
 Frame = +3

Query  276   GQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEP  455
              Q+NFEG  D++KF K++ +  M+  +R+GPF++AEWN GG PYWL+EVP I FRT NEP
Sbjct  73    AQYNFEGRYDMIKFFKLVQEHEMFAMVRIGPFVQAEWNHGGLPYWLREVPDIIFRTNNEP  132

Query  456   FMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAA  635
             F  HM+KF  MIV+ +K AKLFA QGGPIILAQIENEY  +E+   A  +    YI+WAA
Sbjct  133   FKKHMQKFVTMIVNKLKDAKLFASQGGPIILAQIENEYQHLEA---AFKENGTTYIHWAA  189

Query  636   DMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTF  815
              MA  L   +PWIMCKQ +AP +VI TCNGR CGDT+ GP   NKP +WTENWTAQYR F
Sbjct  190   KMASDLNIGVPWIMCKQTKAPGEVIPTCNGRHCGDTWPGPTDKNKPLLWTENWTAQYRVF  249

Query  816   GDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEF  995
             GDPP+QRSAE+IA+++ RF +   G+ + YYMY+GGTN+GRT ASFV  RYYDE PLDEF
Sbjct  250   GDPPSQRSAEDIAFAVARFYS-VGGTMVNYYMYHGGTNFGRTGASFVMPRYYDEAPLDEF  308

Query  996   GLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN  1175
             GLY++PKW HLRD H ALRL K+ +  G P+ Q L    E   FE    K+C AFL+N+N
Sbjct  309   GLYKEPKWGHLRDLHHALRLCKKAILWGNPSNQPLGKLYEARLFEIPEQKICVAFLSNHN  368

Query  1176  TTPT-SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWE  1352
             T    ++ FRG QY++P  S S+L DCKT VF++Q++ SQHN R F  S    + ++ WE
Sbjct  369   TKEDGTVTFRGQQYFVPRRSVSILADCKTVVFSTQHVNSQHNQRTFHFSDQTVQGNV-WE  427

Query  1353  MFQET--IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDV  1526
             M+ E+  +PT     I+  +PLE Y LTKD +DY WY+T  +    DL  R DI PVL+V
Sbjct  428   MYTESDKVPTYKFTNIRTQKPLEAYNLTKDKTDYVWYTTSFKLEAEDLPFRKDIWPVLEV  487

Query  1527  YSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMD  1706
              S GHA+VAFVNG++VG+ HG   +KA ++ KP++++ G N +++L    G  +SG  ++
Sbjct  488   SSHGHAMVAFVNGKYVGAGHGTKINKAFTMEKPIEVRTGINHVSILSTTLGMQDSGVYLE  547

Query  1707  KRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPV  1886
              R  G   VTIQGL  GTL +T N W H VG+ GE+    TE+G   V+W P      P+
Sbjct  548   HRQAGIDGVTIQGLNTGTLDLTSNGWGHLVGLEGERRNAHTEKGGDGVQWVPAV-FDRPL  606

Query  1887  TWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAF  2066
             TWY+  FD P G++PV + M  M KG+++VNG+ +GRYW ++   LG+PSQ  YH+PR F
Sbjct  607   TWYRRRFDIPTGDDPVVIDMSPMGKGVLYVNGEGLGRYWSSYKHALGRPSQYLYHVPRCF  666

Query  2067  MKPKNNLMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE-  2240
             +KP  N+M +FEE+ GG P  I ++ V RD ICS +S+  P +VKSWERK   L+ V + 
Sbjct  667   LKPTGNVMTIFEEEGGGQPDGIMILTVKRDNICSFISEKNPAHVKSWERKDSHLKSVADA  726

Query  2241  DIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKV  2420
             D++P   L CPE K+++++ FA+YG+P G CGN+ VGNC  P A +IVEKAC+GK  C +
Sbjct  727   DLKPQAVLSCPEKKLIQQVVFASYGNPLGICGNYTVGNCHAPKAKEIVEKACVGKKSCVL  786

Query  2421  PVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRHAKDD  2531
              V   ++  G+   CP     TLAVQAKC  R    D
Sbjct  787   QVSHEVY--GADLNCPGST-GTLAVQAKCSKRQKAAD  820



>emb|CAG30724.1| putative beta-galactosidase precursor [Hordeum vulgare]
Length=833

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/798 (48%), Positives = 511/798 (64%), Gaps = 15/798 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PP+MW  +LK AK+GGLN I+TYVFWN HEP  G++NFEG
Sbjct  42    LLIDGKRDLFFSGAIHYPRSPPDMWHKLLKTAKDGGLNTIETYVFWNAHEPEPGKYNFEG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              NDL+KF+K+I    MY  +R+GPF++AEWN GG PYWL+E+P I FR  NEP+   M+K
Sbjct  102   RNDLIKFLKLIQSHDMYALVRIGPFIQAEWNHGGLPYWLREIPHIIFRANNEPYKKEMEK  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A++FA QGGP+ILAQIENEY +I+ D    I    KY+ WAA MA+   
Sbjct  162   FVRFIVQKLKDAEMFASQGGPVILAQIENEYGNIKKDH---IVEGDKYLEWAAQMAISTN  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+R FGD  A R
Sbjct  219   TGVPWIMCKQSTAPGEVIPTCNGRHCGDTWTLKDK-NKPRLWTENWTAQFRAFGDQLALR  277

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAYS++RF A        Y  YYGGTN+GRT AS+V T YYDEGP+DE  + + PK
Sbjct  278   SAEDIAYSVLRFFAKGGTLVNYYMQYYGGTNFGRTGASYVLTGYYDEGPVDEC-MPKAPK  336

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   R    G  + + L +  E   FE    KLC AF++NNNT    ++
Sbjct  337   YGHLRDLHNLIKSYSRAFLEGKQSFELLAHGYEAHNFEIPEEKLCLAFISNNNTGEDGTV  396

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG +YY+P  S S+L DCK  V+N++ +  QH+ R F  ++   + +  WEM+ E IP
Sbjct  397   NFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHTAQKLAKSN-AWEMYSEPIP  455

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   I+N  P+E Y LTKD SDY  +  R+E    DL  RGDI PV+ V S  HAL+ 
Sbjct  456   RYKLTSIRNKEPMEQYNLTKDDSDYLCF--RLEAD--DLPFRGDIRPVVQVKSTSHALMG  511

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVN  F G+  G+  +K      P++L+ G N + LL    G  +SG  + +   G +D 
Sbjct  512   FVNDAFAGNGRGSKKEKGFMFETPINLRIGINHLALLSSSMGMKDSGGELVEVKGGIQDC  571

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
             TIQGL  GTL +  N W H V + GE  +++TE+G   VKW P T     VTWYK YFD 
Sbjct  572   TIQGLNTGTLDLQVNGWGHKVKLEGEVKEIYTEKGMGAVKWVPATTGR-AVTWYKRYFDE  630

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G +PV L M +M KGM++VNG+ +GRYW ++ +  G PSQ  YHIPR F+KPKNNL+V
Sbjct  631   PDGEDPVVLDMTSMGKGMIFVNGEGMGRYWPSYRTVGGVPSQAMYHIPRPFLKPKNNLLV  690

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+ G P  I +  V RD IC  +S++ P  +K+W++ G +++ + ED      LKCP
Sbjct  691   IFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKTWDKDGGQIKLIAEDHSTRGILKCP  750

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               K ++++ FA++G+P+G+C NF  G C  PNA  IV K CLGK  C +PV  +++  G+
Sbjct  751   PKKTIQEVVFASFGNPEGSCANFTAGTCHTPNAKDIVAKECLGKKSCVLPVLHTVY--GA  808

Query  2454  KDLCPNLVHKTLAVQAKC  2507
                CP     TLAVQ +C
Sbjct  809   DINCPTTT-ATLAVQVRC  825



>ref|XP_006473025.1| PREDICTED: beta-galactosidase 16-like [Citrus sinensis]
Length=822

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/809 (48%), Positives = 524/809 (65%), Gaps = 36/809 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MWP ++ +AKEGGL+V+QT VFWN+HEP  GQF+F G
Sbjct  37    LIINGHRKILFSGSIHYPRSTPQMWPRLIAKAKEGGLDVVQTLVFWNLHEPQPGQFDFSG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GPF+E EW +GG P+WL +VP I FR+ NEPF  HMK+
Sbjct  97    RRDLVRFIKEVQAQGLYVCLRIGPFIEGEWGYGGLPFWLHDVPGIVFRSDNEPFKFHMKR  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A MIV+MMK A+L+A QGGPIIL+QIENEY  +E    + ++    Y+ WAA +A+ L 
Sbjct  157   YATMIVNMMKSARLYASQGGPIILSQIENEYGMVEH---SFLEKGPPYVRWAAKLAVDLQ  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGRQCG+TF GPN  +KP++WTENWT+ Y+ +GD    R
Sbjct  214   TGVPWVMCKQDDAPDPVINACNGRQCGETFAGPNSPDKPAIWTENWTSFYQVYGDEARIR  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY +  F     GSY+ YYMY+GGTN+GRT +++V T YYD+ PLDE+GL R PK
Sbjct  274   SAEDIAYHVALFIVKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAPLDEYGLLRQPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN----NNTTP  1184
             W HL++ H+A++L  +P+  G          QE   F  Q    CAAFL N    NN T 
Sbjct  334   WGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIF--QGSSECAAFLVNKDKRNNAT-  390

Query  1185  TSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL----KWE  1352
               + F    Y LP  S S+LPDCKT  FN+  + +Q+  R      +  R  L    +WE
Sbjct  391   --VYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTR-----SMEQRQKLDSVEQWE  443

Query  1353  MFQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYS  1532
              ++E IPT D   ++    LE    TKD SDY WY+ R +    +  +      VL V S
Sbjct  444   EYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSNSES------VLKVSS  497

Query  1533  MGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKR  1712
             +GH L+AF+NGEFVGS HG + DK+ +L K V L  G N+++LL V+ G P+SGA +++R
Sbjct  498   LGHVLLAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERR  557

Query  1713  FTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVT  1889
               G R+V+IQG        +F SW + VG+ GEKL++FT+ GS+ V W    ++ H P+T
Sbjct  558   VAGLRNVSIQGAKELKDFSSF-SWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLT  616

Query  1890  WYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM  2069
             WYKT FDAP G++PVA+ + +M KG  WVNG+SIGRYWV+FL+P G PSQ  YHIPR+F+
Sbjct  617   WYKTVFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFL  676

Query  2070  KPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI-  2246
             KP  NL+V+ EE+ G P  I +  V+  T+C  VSD +   V SW  + +   +  + I 
Sbjct  677   KPTGNLLVLLEEENGYPPGISIDTVSVTTLCGHVSDSHLPPVISWRSQNQRTLKTHKRIP  736

Query  2247  --RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKV  2420
               RP V+++CP  + + KI FA+YG+P+G C N+ +G+C   N+  IVEKACLGK  C V
Sbjct  737   GRRPKVQIRCPSGRKISKILFASYGNPNGNCENYAIGSCHSSNSRAIVEKACLGKRSCTV  796

Query  2421  PVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             PV    F     D CP  + K L V A+C
Sbjct  797   PVWTEKFY---GDPCPG-IPKALLVDAQC  821



>ref|XP_006434246.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
 gb|ESR47486.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
Length=821

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/809 (48%), Positives = 521/809 (64%), Gaps = 36/809 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MWP ++ +AKEGGL+V+QT VFWN+HEP  GQF+F G
Sbjct  36    LIINGHRKILFSGSIHYPRSTPQMWPRLIAKAKEGGLDVVQTLVFWNLHEPQPGQFDFSG  95

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GPF+E EW +GG P+WL +VP I FR+ NEPF  HMK+
Sbjct  96    RRDLVRFIKEVQAQGLYVCLRIGPFIEGEWGYGGLPFWLHDVPGIVFRSDNEPFKFHMKR  155

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A MIV+MMK A+L+A QGGPIIL+QIENEY  +E    + ++    Y+ WAA +A+ L 
Sbjct  156   YATMIVNMMKAARLYASQGGPIILSQIENEYGMVEH---SFLEKGPPYVRWAAKLAVDLQ  212

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGRQCG+TF GPN  +KP++WTENWT+ Y+ +GD    R
Sbjct  213   TGVPWVMCKQDDAPDPVINACNGRQCGETFAGPNSPDKPAIWTENWTSFYQVYGDEARIR  272

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY +  F A   GSY+ YYMY+GGTN+GRT +++V T YYD+ PLDE+GL R PK
Sbjct  273   SAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAPLDEYGLLRQPK  332

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN----NNTTP  1184
             W HL++ H+A++L  +P+  G          QE   F  Q    CAAFL N    NN T 
Sbjct  333   WGHLKELHSAVKLCLKPMLSGVLVSMNFSTLQEAFIF--QGSSECAAFLVNKDKRNNAT-  389

Query  1185  TSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL----KWE  1352
               + F    Y LP  S S+LPDCKT  FN+  + +Q+  R      +  R  L    +WE
Sbjct  390   --VYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTR-----SMEQRQKLDSVEQWE  442

Query  1353  MFQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYS  1532
              ++E IPT D   ++    LE    TKD SDY WY+ R +    D  +      VL V S
Sbjct  443   EYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSDSES------VLKVSS  496

Query  1533  MGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKR  1712
             +GH L AF+NGEFVGS HG + DK+ +L K V L  G N+++LL V+ G P+SGA +++R
Sbjct  497   LGHVLHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERR  556

Query  1713  FTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVT  1889
               G R+V+IQG        +F SW + VG+ GEKL++FT+ GS+ V W    ++ H P+T
Sbjct  557   VAGLRNVSIQGAKELKDFSSF-SWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLT  615

Query  1890  WYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFM  2069
             WYKT FDAP G++PVA+ +  M KG  WVNG+SIGRYWV+FL+P G PSQ  YHIPR+F+
Sbjct  616   WYKTVFDAPTGSDPVAINLIPMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFL  675

Query  2070  KPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI-  2246
             KP  NL+V+ EE+ G P  I +  V+   IC  VSD +   V SW  + +   +  + I 
Sbjct  676   KPTGNLLVLLEEENGYPPGISIDTVSVTKICGHVSDSHLPPVISWRSQNQRTLKTHKKIP  735

Query  2247  --RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKV  2420
               RP V+++CP  + +  I FA+YG+P+G C N+ +G+C   N+  +VEKACLGK  C V
Sbjct  736   GRRPKVQIRCPSGRKISTILFASYGNPNGNCDNYAIGSCHSSNSRAVVEKACLGKRSCTV  795

Query  2421  PVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             PV    F     D CP  + K L V A+C
Sbjct  796   PVWTEKFY---GDPCPG-IPKALLVDAQC  820



>gb|KDO80552.1| hypothetical protein CISIN_1g003612mg [Citrus sinensis]
Length=807

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/805 (48%), Positives = 518/805 (64%), Gaps = 43/805 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MWP ++ +AKEGGL+V+QT VFWN+HEP  GQF+F G
Sbjct  37    LIINGHRKILFSGSIHYPRSTPQMWPRLIAKAKEGGLDVVQTLVFWNLHEPQPGQFDFSG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GPF+E EW +GG P+WL +VP I FR+ NEPF  HMK+
Sbjct  97    RRDLVRFIKEVQAQGLYVCLRIGPFIEGEWGYGGLPFWLHDVPGIVFRSDNEPFKFHMKR  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A MIV+MMK A+L+A QGGPIIL+QIENEY  +E    + ++    Y+ WAA +A+ L 
Sbjct  157   YATMIVNMMKAARLYASQGGPIILSQIENEYGMVEH---SFLEKGPPYVRWAAKLAVDLQ  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGRQCG+TF GPN  +KP++WTENWT+ Y+ +GD    R
Sbjct  214   TGVPWVMCKQDDAPDPVINACNGRQCGETFAGPNSPDKPAIWTENWTSFYQVYGDEARIR  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY +  F A   GSY+ YYMY+GGTN+GRT +++V T YYD+ PLDE+GL R PK
Sbjct  274   SAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAPLDEYGLLRQPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN----NNTTP  1184
             W HL++ H+A++L  +P+  G          QE   F  Q    CAAFL N    NN T 
Sbjct  334   WGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIF--QGSSECAAFLVNKDKRNNAT-  390

Query  1185  TSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQE  1364
               + F    Y LP  S S+LPDCKT  FN+  + S                  +WE ++E
Sbjct  391   --VYFSNLMYELPPLSISILPDCKTVAFNTAKLDSVE----------------QWEEYKE  432

Query  1365  TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
              IPT D   ++    LE    TKD SDY WY+ R +    D  +      VL V S+GH 
Sbjct  433   AIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSDSES------VLKVSSLGHV  486

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             L AF+NGEFVGS HG + DK+ +L K V L  G N+++LL V+ G P+SGA +++R  G 
Sbjct  487   LHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERRVAGL  546

Query  1725  RDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKT  1901
             R+V+IQG        +F SW + VG+ GEKL++FT+ GS+ V W    ++ H P+TWYKT
Sbjct  547   RNVSIQGAKELKDFSSF-SWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLTWYKT  605

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKN  2081
              FDAP G++PVA+ + +M KG  WVNG+SIGRYWV+FL+P G PSQ  YHIPR+F+KP  
Sbjct  606   VFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFLKPTG  665

Query  2082  NLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI---RP  2252
             NL+V+ EE+ G P  I +  V+  T+C  VSD +   V SW  + +   +  + I   RP
Sbjct  666   NLLVLLEEENGYPPGISIDTVSVTTLCGHVSDSHLPPVISWRSQNQRTLKTHKRIPGRRP  725

Query  2253  SVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEK  2432
              V+++CP  + + KI FA+YG+P+G C N+ +G+C   N+  IVEKACLGK  C VPV  
Sbjct  726   KVQIRCPSGRKISKILFASYGNPNGNCENYAIGSCHSSNSRAIVEKACLGKRSCTVPVWT  785

Query  2433  SLFQEGSKDLCPNLVHKTLAVQAKC  2507
               F     D CP  + K L V A+C
Sbjct  786   EKFY---GDPCPG-IPKALLVDAQC  806



>tpg|DAA64336.1| TPA: hypothetical protein ZEAMMB73_578897 [Zea mays]
Length=822

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/799 (46%), Positives = 512/799 (64%), Gaps = 26/799 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPE+WP +++RAKEGGLN I+TY+FWN HEP  G++NFEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEVWPKLIERAKEGGLNTIETYIFWNAHEPEPGKYNFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL+K++KMI +  MY  +R+GPF++AEWN GG PYWL+E+  I FR  N+P+   M+K
Sbjct  103   RFDLIKYLKMIQEHDMYAIVRIGPFIQAEWNHGGLPYWLREIDHIIFRANNDPYKKEMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV  +K A+LFA QGGPIIL QIENEY +I+ D   D     KY+ WAA MA+   
Sbjct  163   FVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHATD---GDKYLEWAAQMALSTQ  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWT Q+R +GD  A R
Sbjct  220   TGVPWIMCKQSSAPGEVIPTCNGRHCGDTWTLRDK-NKPMLWTENWTQQFRAYGDQVAMR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K GS + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+Y++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMYKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  +R  ++   LG  + + L +  E   FE     LC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIRSYQKAFLLGKHSSEILGHGYEAHIFELPEENLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L  CK  V+N++ +  QHN R +  S++  +++ +WEM+ E IP
Sbjct  398   IFRGEKHYVPSRSVSILAGCKNVVYNTKRVFVQHNERSYHTSEVTSKNN-QWEMYSEKIP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                +  ++   PLE +  TKD SDY WY+T       DL  R DI PVL V S  H+++ 
Sbjct  457   KYRDTKVRMKEPLEQFNQTKDASDYLWYTTSFRLESDDLPFRNDIRPVLQVKSSAHSMMG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG   G+   K     KPVDLK G N + LL    G  +SG  + +  +G ++ 
Sbjct  517   FANDAFVGCARGSKQVKGFMFEKPVDLKVGVNHVVLLSSTMGMKDSGGELAEVKSGIQEC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H   + GE  ++++E+G  KV+WKP  N     TWYK YFD 
Sbjct  577   LIQGLNTGTLDLQVNGWGHKAALEGEDKEIYSEKGVGKVQWKPAENGR-AATWYKRYFDE  635

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++PV L M +M KGM++VNG+ +GRYWV++ +  G PSQ  YHIPR F+K K+NL+V
Sbjct  636   PDGDDPVVLDMSSMDKGMIFVNGEGVGRYWVSYRTLAGTPSQALYHIPRPFLKSKDNLLV  695

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ PG +K+W+  G++++ + ED      L CP
Sbjct  696   VFEEEMGKPDGILVQTVTRDDICLFISEHNPGQIKTWDTDGDKIKLIAEDHSRRGTLMCP  755

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
              +K ++++ FA++G+P+G CGNF                 CLGK  C +PV+ +++    
Sbjct  756   PEKTIQEVVFASFGNPEGMCGNFT---------------ECLGKPSCMLPVDHTVY---G  797

Query  2454  KDLCPNLVHKTLAVQAKCG  2510
              D+       TL VQ +CG
Sbjct  798   ADINCQSTTATLGVQVRCG  816



>ref|XP_002460584.1| hypothetical protein SORBIDRAFT_02g031260 [Sorghum bicolor]
 gb|EER97105.1| hypothetical protein SORBIDRAFT_02g031260 [Sorghum bicolor]
Length=803

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/798 (46%), Positives = 505/798 (63%), Gaps = 45/798 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPE+WP +L RAKEGGLN I+TY+FWN HEP  G++NFEG
Sbjct  43    LLIDGKRDLFFSGAIHYPRSPPEVWPKLLDRAKEGGLNTIETYIFWNAHEPEPGKYNFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKF+KMI + GMY  +R+GPF++AEWN GG PYWL+E+  I FR  N+P+   M+K
Sbjct  103   RLDLVKFLKMIQEHGMYAIVRIGPFIQAEWNHGGLPYWLREIDHIIFRANNDPYKKEMEK  162

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V  +K A+LFA QGGP+IL QIENEY +I+ D   +     KY+ WAA MA+   
Sbjct  163   WTRFVVQKLKDAELFASQGGPVILTQIENEYGNIKKDHKIE---GDKYLEWAAQMALSTQ  219

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWT Q+R +GD  A R
Sbjct  220   TGVPWIMCKQSSAPGEVIPTCNGRHCGDTWTLRDK-NKPMLWTENWTQQFRAYGDQLAMR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K GS + YYMY+GGTN+GRT+AS+V T YYDE PLDE+G+Y++PK
Sbjct  279   SAEDIAYAVLRFFA-KGGSMVNYYMYHGGTNFGRTSASYVLTGYYDEAPLDEYGMYKEPK  337

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  +R  ++    G  + + L +  E   FE     LC +FL+NNNT    ++
Sbjct  338   FGHLRDLHNVIRSYQKAFLSGKHSSEILGHGYEAQIFELPEENLCLSFLSNNNTGEDGTV  397

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L  CK  V+N++ +  QH+ R +  S++  +++ +WEM+ E +P
Sbjct  398   IFRGVKHYVPSRSVSILAGCKDVVYNTKRVFVQHSERSYHTSEVTSKNN-QWEMYSEMVP  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                +  I+   PLE Y  TKD SDY WY+T       DL  RGDI PVL V S  H+++ 
Sbjct  457   KYKDTKIRTKEPLEQYNQTKDASDYLWYTTSFRLESDDLPFRGDIRPVLQVKSSAHSMIG  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVGS  GN   K     KPVDLK G N + LL    G  +SG  + +   G ++ 
Sbjct  517   FANDAFVGSARGNKQVKGFMFEKPVDLKAGVNHVVLLSSTMGMKDSGGELAEVKGGIQEC  576

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQGL  GTL +  N W H                                   K YFD 
Sbjct  577   LIQGLNTGTLDLQVNGWGH-----------------------------------KRYFDE  601

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++P+ L M +M+KGM++VNG+ IGRYWV+F +  G PSQ  YHIPR F+KPK+NL+V
Sbjct  602   PDGDDPIVLDMSSMSKGMIFVNGEGIGRYWVSFRTLAGTPSQAVYHIPRPFLKPKDNLLV  661

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             VFEE+ G P  I +  V RD IC  +S++ PG +K+W+  G +++ + ED      L CP
Sbjct  662   VFEEEMGKPDGILVQTVTRDDICLLISEHNPGQIKTWDTDGVKIKLIAEDHSVRGTLMCP  721

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
              +K+++++ FA++G+PDG CGNF VG C  PNA +IVEK CLGK  C +PV+ +++    
Sbjct  722   PEKIIQEVVFASFGNPDGMCGNFTVGTCHTPNAKQIVEKECLGKPSCMLPVDHTVY---G  778

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D+       TL VQ +C
Sbjct  779   ADINCQSTTGTLGVQVRC  796



>ref|XP_004149808.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=801

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/799 (47%), Positives = 521/799 (65%), Gaps = 23/799 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G   +LF+GSIHYPR  P+MWP ++ +AKEGG++VIQTYVFWN+HEP QG + F G
Sbjct  23    LIVNGEHKLLFSGSIHYPRSTPDMWPSLIAKAKEGGIDVIQTYVFWNLHEPQQGTYEFSG  82

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+F+K I   G+Y  LR+GPF+EAEW++GG P+WL +V  I +R+ NEPF  HM+ 
Sbjct  83    RRDIVRFVKEIQAQGLYACLRIGPFIEAEWSYGGLPFWLHDVLGIVYRSDNEPFKLHMQN  142

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK   L+A QGGPIIL+QIENEY+ +E+   A  +    Y+ WAA MA+ L 
Sbjct  143   FTTKIVNMMKSEGLYASQGGPIILSQIENEYTLVEA---AFGEKGPPYVQWAAKMAVSLQ  199

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQN+AP  VI+TCNG +CG+TF GPN  NKPS+WTENWT+ Y+T+G+ P  R
Sbjct  200   TGVPWSMCKQNDAPDPVINTCNGMRCGETFTGPNSPNKPSIWTENWTSFYQTYGEEPYIR  259

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE IA+ +  F A KNG+Y+ YYMY+GGTN+GR+ ++F+ T YYD+ PLDE+GL R+PK
Sbjct  260   SAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQSPLDEYGLTREPK  319

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L   PL  GT +   L  + E I F+ ++ + CAAFL N     +++ 
Sbjct  320   WGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFKTESNE-CAAFLVNRGAIDSNVL  378

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F+   Y LP  S S+LPDCK   FN++ +  QHN R  +   +   D L+WE F+E IP 
Sbjct  379   FQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMM--AVQKFDLLEWEEFKEPIPN  436

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             ID+  ++    LE    TKD SDY WY+ R++    D          L+V S  HAL AF
Sbjct  437   IDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDSPDSQQ------TLEVDSRAHALHAF  490

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG++ GS HG   +K  SL K + L+ G N+I+LL V+ G P+SGA ++ R  G R V 
Sbjct  491   VNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLPDSGAFLETRVAGLRRVG  550

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             IQG        +   W + VG+SGE+ ++F + GS  V+W  + N   P+TWYKT FDAP
Sbjct  551   IQGED-----FSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKTQFDAP  605

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
              G++P+AL + +M KG VWVNG+ IGRYWV+FL+P G+PSQ  Y++PR+F+KP +N +V+
Sbjct  606   PGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKPTDNQLVI  665

Query  2097  FEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW-ERKGEELRQVVEDI-RPSVRLKC  2270
              EE+ G+P  I L  V     C  VS+ +   V SW   K +++R+V     RP V+L C
Sbjct  666   LEEETGNPVEISLDSVLITKTCGQVSESHYPLVASWMGAKKQKVRRVKNRTRRPKVQLSC  725

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P  K +  I FA++G P G C ++ +G C  PN+  IVE ACLG+++C +P+    F+  
Sbjct  726   PSKKKISNILFASFGTPSGDCQSYAIGLCHSPNSRAIVEHACLGRAKCSIPISNLNFR--  783

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
               D CP+ V KTL V A+C
Sbjct  784   -GDPCPH-VTKTLLVDAQC  800



>ref|XP_010428819.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=819

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/806 (47%), Positives = 509/806 (63%), Gaps = 29/806 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++++AK GGL+VI TYVFWNIHEP QGQF+F G
Sbjct  33    LIIDGKHKILFSGSIHYTRSTPQMWPSLIEKAKSGGLDVIDTYVFWNIHEPQQGQFDFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK I   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  93    RRDIVKFIKEIQAHGLYVCLRIGPFIQGEWSYGGLPFWLHNVKGIVFRTDNEPFKYHMKR  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK  KL+A QGGPIIL+QIENEY  I      D    K Y+ WAA+MA+ L 
Sbjct  153   YAQMIVKLMKSEKLYASQGGPIILSQIENEYGMIARAFRQD---GKSYVKWAAEMAVELE  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGR+CG+TF GPN  NKP++WTENWT+ Y+T+GD P  R
Sbjct  210   TGVPWVMCKQDDAPDPVINACNGRKCGETFQGPNSPNKPAIWTENWTSFYQTYGDEPLIR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YY Y+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  270   SAEDIAFQVALFIA-KNGSFVNYYTYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L ++PL  G  T   L   Q    F  +   LCAA L N +    +++
Sbjct  329   WGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALLVNQDDCEATVQ  387

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FR + Y L   S SVL DCK   FN+  + +Q++ R   P +      + WE F ET+P+
Sbjct  388   FRNSSYLLSPKSISVLQDCKNVAFNTAKVNAQYSTRTREPRQKLSSPHM-WEEFTETVPS  446

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  I++   LE    T+DTSDY W +TR +  E   S       VL V  +GH L  F
Sbjct  447   FSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQPEGAQS-------VLKVNHLGHVLHGF  499

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG+F+GS HG        L K V L  G N+I LL V+ G PNSGA +++R  G R V 
Sbjct  500   VNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVGSRSVK  559

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G   + FN  SW + VG+ GEK  ++TE G+ KV+WK   +    P+TWYK  F
Sbjct  560   I---WNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWKKYRDSKSQPLTWYKASF  616

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D P+G +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP +NL
Sbjct  617   DTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGNPSQIWYHIPRSFLKPSSNL  676

Query  2088  MVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE-----DIR  2249
             +V+ EE+  G+P  + +  V+   +C  VS  +P  V S  RKG   ++        D R
Sbjct  677   LVILEEEREGNPLGVTIDTVSVTEVCGHVSSSHPSPVISQRRKGHNRKKQRHLKHQYDKR  736

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P V+L+CP  + + K+ FA++G P+G C ++ VG+C  P +  +++KACL KS+C VPV 
Sbjct  737   PKVQLQCPNGRKISKVMFASFGTPNGNCWSYSVGSCHSPKSLAVIQKACLNKSKCSVPVW  796

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                F     D CP  V K+L V A+C
Sbjct  797   SKTF---GGDSCPQAV-KSLLVHAQC  818



>ref|XP_006390092.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
 gb|ESQ27378.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
Length=818

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/806 (47%), Positives = 517/806 (64%), Gaps = 29/806 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  P+MWP ++ +AK GG++VI TYVFWNIHEP QGQF+F G
Sbjct  32    LIIDGQHKILFSGSIHYPRSTPQMWPSLIAKAKSGGIDVIDTYVFWNIHEPQQGQFDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK I   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  92    RRDIVRFIKEIQAQGLYVCLRIGPFIQGEWSYGGLPFWLHNVKGIVFRTDNEPFKYHMKR  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK   L+A QGGPIIL+QIENEY  +      +    K Y+ WAA+MA+ L 
Sbjct  152   YAQMIVQLMKSENLYASQGGPIILSQIENEYGMVARAFRLE---GKSYVKWAANMAVELE  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +I+ CNGRQCG+TF GPN  NKP++WTENWT+ Y+T+G+ P  R
Sbjct  209   TGVPWVMCKQDDAPDPLINACNGRQCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FVT+ YYD+ PLDE+GL R PK
Sbjct  269   SAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVTSSYYDQAPLDEYGLLRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L +RPL  G  T   +   Q    F  +N  LCAA L N +   ++++
Sbjct  328   WGHLKELHAAIKLCERPLLSGLRTAIPIGKLQTAFVF-GKNADLCAALLVNQDKNDSTVQ  386

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F  + Y L   S SVLPDCK   FN+  + +Q+N RR  P +      + WE+F ET+P+
Sbjct  387   FLDSSYLLSPNSISVLPDCKNVAFNTAKVNAQYNTRRREPRQNLSSSHM-WEVFTETVPS  445

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  I++   LE    T+DTSDY W   R + SE   S       +L V  +GH L AF
Sbjct  446   YSETSIRSESLLEHLNTTQDTSDYLWQIFRFQQSEPAAS-------ILKVNHIGHVLHAF  498

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG  +GS HG    +   L K V L  G N I LL V+ G PNSGA +++R  G R V 
Sbjct  499   VNGRLIGSMHGAFKAQKFLLEKNVSLINGTNSIALLSVMVGLPNSGAHLERRVGGSRSVK  558

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G   + FN  +W + VG+ GE++ ++T+ G+ KVKWK   + +  P+TWYK  F
Sbjct  559   IWN---GKYALYFNKYAWGYQVGLHGEQVHVYTDNGAAKVKWKQYRDYNSQPLTWYKASF  615

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D PEG +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KPK+N 
Sbjct  616   DTPEGKDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGSPSQIWYHIPRSFLKPKSNS  675

Query  2088  MVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEEL-----RQVVEDIR  2249
             +V+FEE+  G+P  I +  V+   +C  VS+ YP  V  W+RK  +      R+   D+R
Sbjct  676   LVIFEEEREGNPLGITIDTVSVTEVCGHVSNSYPPPVIFWKRKSHKRNEHRHRKHRYDMR  735

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P V+L+C   + + K+ FA++G P+G C ++ VG C  P +  +++KACL KS+C VPV 
Sbjct  736   PKVQLQCSNGRKISKVLFASFGTPNGNCWSYSVGKCHSPKSLAVIQKACLSKSRCSVPVW  795

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                F     D CP+ V K+L V A+C
Sbjct  796   SKTF---GGDSCPHSV-KSLLVHAQC  817



>ref|XP_002889142.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65401.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/806 (47%), Positives = 517/806 (64%), Gaps = 29/806 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GG++VI TYVFWNIHEP QGQF+F G
Sbjct  32    LIIDGQHKILFSGSIHYTRSTPQMWPSLIAKAKSGGIDVIDTYVFWNIHEPQQGQFDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK +   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  92    RRDIVKFIKEVKAHGLYVCLRIGPFIQGEWSYGGLPFWLHNVQGIVFRTDNEPFKYHMKR  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK   L+A QGGPIIL+QIENEY  +      D    K Y+ WAA +A+ L 
Sbjct  152   YAQMIVKLMKSENLYASQGGPIILSQIENEYGMVARAFRQD---GKSYVKWAAKLAVELD  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +++ CNGRQCG+TF GPN  NKP++WTENWT+ Y+T+G+ P  R
Sbjct  209   TGVPWVMCKQDDAPDPLVNACNGRQCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  269   SAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L + PL  G  T   L   Q    F  +   LCAA L N +    +++
Sbjct  328   WGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAALLVNQDKCDCTVQ  386

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FR + Y L   S SVLPDCK   FN+  + +Q+N R   P +      + WE F ET+P+
Sbjct  387   FRNSSYRLSPKSISVLPDCKNVAFNTAKVNAQYNTRTRKPRQNLSSPHM-WEKFTETVPS  445

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  I++   LE    T+DTSDY W +TR E SE   S       VL V  +GH L AF
Sbjct  446   FSETSIRSESLLEHMNTTQDTSDYLWQTTRFEQSEGAPS-------VLKVNHLGHVLHAF  498

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VN  F+GS HG     +  L K + L  G N++ LL V+ G PNSGA +++R  G R V 
Sbjct  499   VNERFIGSMHGTFKAHSFLLEKNMSLNNGTNNMALLSVMVGLPNSGAHLERRVVGSRSVN  558

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G+  + FN  SW + VG+ GEK  ++TE+G++KV+WK   +    P+TWYK  F
Sbjct  559   IWN---GSYQLFFNNYSWGYQVGLKGEKYHVYTEDGAKKVQWKQYRDSKSQPLTWYKASF  615

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D PEG +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP +NL
Sbjct  616   DTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFYTSKGNPSQIWYHIPRSFLKPNSNL  675

Query  2088  MVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGE---ELRQV--VEDIR  2249
             +V+ EE+  G P  I +  V+   +C  VS+ +P  V S  +KG    E R +    D +
Sbjct  676   LVILEEEREGYPLGITIDTVSVTEVCGHVSNTHPHPVISPRKKGHNRNEQRHLKYRYDRK  735

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P V+L+CP  + + K+ FA +G+P+G+CG++ VG+C  PN+  +V+KACL KS+C VPV 
Sbjct  736   PKVQLQCPTGRKISKVLFATFGNPNGSCGSYSVGSCHSPNSLAVVQKACLRKSRCSVPVW  795

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                F     DLCP  V K+L V+A+C
Sbjct  796   SKTF---GGDLCPQTV-KSLLVRAQC  817



>ref|XP_007041848.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
 gb|EOX97679.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
Length=666

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/594 (60%), Positives = 446/594 (75%), Gaps = 9/594 (2%)
 Frame = +3

Query  120   FIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGN  299
              I+G R++LF+GSIHYPR  P+ WPD+L +AK GGLNVIQTYVFWNIHEP++GQ+NFEG 
Sbjct  53    IINGKRELLFSGSIHYPRSTPDTWPDLLTKAKYGGLNVIQTYVFWNIHEPIEGQYNFEGQ  112

Query  300   NDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKF  479
              DLVKFIK+IG+  MY TLRVGPF++AEWN GG PYWL+EV  I FR+ NEPF ++MKKF
Sbjct  113   YDLVKFIKLIGEHKMYATLRVGPFIQAEWNHGGLPYWLREVRNITFRSDNEPFKHYMKKF  172

Query  480   AEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYN  659
               MI+DMMKK KLFA QGGPI+L+QIENEY++I+    A  ++   Y+ WA  MA+GL  
Sbjct  173   VTMIIDMMKKEKLFASQGGPIVLSQIENEYNTIQL---AFRELGDSYVQWAGKMAVGLNT  229

Query  660   EIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRS  839
             E+PWIMCKQ +AP  +I+TCNGR CGDTF GPN  NKPS+WTENWTAQYR FGDPP+QRS
Sbjct  230   EVPWIMCKQRDAPDPIINTCNGRHCGDTFTGPNRRNKPSLWTENWTAQYRVFGDPPSQRS  289

Query  840   AENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKW  1019
             AE++AYS+ RF + KNGS + YYMY+GGTNYGRT+A+F TTRYYDE PLDE+GL RDPKW
Sbjct  290   AEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAPLDEYGLQRDPKW  348

Query  1020  SHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSIK  1196
              HL+D H AL L K+ L  G+PT+QKL  +QE+ T++     LCAAFL NN+T    +  
Sbjct  349   GHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFLANNDTQNAQTFH  408

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FRG QY LP  S S+LPDCKT V+N+Q I +QHN R FV S  A + +  W+M++E +PT
Sbjct  409   FRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRSATANK-NFNWQMYKEYVPT  467

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                L      P+ELY LTKDT+DYAWY+T IE   RDL  + +I PVL V S+GH L+AF
Sbjct  468   --QLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPVLRVASLGHGLLAF  525

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNGE++G  HG+  +K+   +KPV LK G N ITLLG L G P+SGA M+ RF GPR +T
Sbjct  526   VNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGAYMEHRFAGPRSIT  585

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYK  1898
             I GL  GTL ++ N W H VG++GEK K++TE+GS KV+W+ ++   P +TWYK
Sbjct  586   ILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSE-SPALTWYK  638



>ref|XP_010419240.1| PREDICTED: beta-galactosidase 16 [Camelina sativa]
Length=801

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/806 (47%), Positives = 508/806 (63%), Gaps = 29/806 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GGL+VI TYVFWNIHEP QGQF+F G
Sbjct  15    LIIDGKHKILFSGSIHYTRSTPQMWPSLIAKAKSGGLDVIDTYVFWNIHEPQQGQFDFSG  74

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK +   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  75    RRDIVKFIKEVQAHGLYVCLRIGPFIQGEWSYGGLPFWLHNVKGIVFRTDNEPFKYHMKR  134

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK  KL+A QGGPIIL+QIENEY  I      D    K Y+ WAA+MA+ L 
Sbjct  135   YAQMIVKLMKSEKLYASQGGPIILSQIENEYGMIARAFRQD---GKSYVKWAAEMAVELE  191

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGR+CG+TF GPN  NKP++WTENWT+ Y+T+G+ P  R
Sbjct  192   TGVPWVMCKQDDAPDTVINACNGRKCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIR  251

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  252   SAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  310

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L ++PL  G  T   L   Q    F  +   LCAA L N +    +++
Sbjct  311   WGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALLVNQDECEATVQ  369

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FR + Y L   S SVLPDCK   FN+  + +Q++ R   P +      + WE F E +P+
Sbjct  370   FRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTREPRQKLSSSHM-WEEFTENVPS  428

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  I +   LE    T+DTSDY W +TR +  E   S       VL V  +GH L  F
Sbjct  429   FSETLILSESLLEHMNTTQDTSDYLWQTTRFQQPEGAQS-------VLKVNHLGHVLHGF  481

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG+F+GS HG        L K V L  G N+I LL V+ G PNSGA +++R  G R V 
Sbjct  482   VNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRAVGSRSVK  541

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G   + FN  SW + VG+ GEK  ++TE G+ KV+W+   +    P+TWYK  F
Sbjct  542   I---WNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWRKYRDSKSQPLTWYKAAF  598

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D PEG +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP +NL
Sbjct  599   DTPEGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGNPSQIWYHIPRSFLKPSSNL  658

Query  2088  MVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE-----DIR  2249
             +V+ EE+  G+P  + +  V+   +C  VS  +P  V S  R G   ++        D R
Sbjct  659   LVILEEEREGNPLGVTIDTVSVTEVCGHVSSSHPSPVISQRRTGHNRKKQRHLKHQYDKR  718

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P V+L+CP  + + K+ FA++G P+G C ++ VG+C  P +  +++KACL KS+C VPV 
Sbjct  719   PKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSCHSPKSLAVIQKACLNKSRCSVPVW  778

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                F     D CP+ V K+L V A+C
Sbjct  779   SKTF---GGDSCPHAV-KSLLVHAQC  800



>ref|NP_177866.2| beta-galactosidase 16 [Arabidopsis thaliana]
 sp|Q8GX69.2|BGA16_ARATH RecName: Full=Beta-galactosidase 16; Short=Lactase 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE35975.1| beta-galactosidase 16 [Arabidopsis thaliana]
Length=815

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/807 (47%), Positives = 518/807 (64%), Gaps = 34/807 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GG++V+ TYVFWN+HEP QGQF+F G
Sbjct  32    LIIDGEHKILFSGSIHYTRSTPQMWPSLIAKAKSGGIDVVDTYVFWNVHEPQQGQFDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + D+VKFIK + + G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  92    SRDIVKFIKEVKNHGLYVCLRIGPFIQGEWSYGGLPFWLHNVQGIVFRTDNEPFKYHMKR  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK   L+A QGGPIIL+QIENEY  +     A  +  K Y+ W A +A+ L 
Sbjct  152   YAKMIVKLMKSENLYASQGGPIILSQIENEYGMVGR---AFRQEGKSYVKWTAKLAVELD  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +++ CNGRQCG+TF GPN  NKP++WTENWT+ Y+T+G+ P  R
Sbjct  209   TGVPWVMCKQDDAPDPLVNACNGRQCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  269   SAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L + PL  G  T   L   Q    F  +   LCAA L N +   ++++
Sbjct  328   WGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAILVNQDKCESTVQ  386

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK----WEMFQE  1364
             FR + Y L   S SVLPDCK   FN+  + +Q+N R         R +L     WE F E
Sbjct  387   FRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTR-----TRKARQNLSSPQMWEEFTE  441

Query  1365  TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             T+P+     I++   LE    T+DTSDY W +TR + SE   S       VL V  +GHA
Sbjct  442   TVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAPS-------VLKVNHLGHA  494

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             L AFVNG F+GS HG        L K + L  G N++ LL V+ G PNSGA +++R  G 
Sbjct  495   LHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVGS  554

Query  1725  RDVTIQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWY  1895
             R V I     G   + FN  SW + VG+ GEK  ++TE+GS KV+WK   +    P+TWY
Sbjct  555   RSVKIWN---GRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWY  611

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKP  2075
             K  FD PEG +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP
Sbjct  612   KASFDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKP  671

Query  2076  KNNLMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVV--EDI  2246
              +NL+V+ EE+  G+P  I +  V+   +C  VS+  P  V S  +KG   + +    D 
Sbjct  672   NSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVISPRKKGLNRKNLTYRYDR  731

Query  2247  RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPV  2426
             +P V+L+CP  + + KI FA++G P+G+CG++ +G+C  PN+  +V+KACL KS+C VPV
Sbjct  732   KPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSLAVVQKACLKKSRCSVPV  791

Query  2427  EKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                 F     D CP+ V K+L V+A+C
Sbjct  792   WSKTF---GGDSCPHTV-KSLLVRAQC  814



>ref|XP_006472815.1| PREDICTED: beta-galactosidase 16-like isoform X1 [Citrus sinensis]
Length=823

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/800 (46%), Positives = 517/800 (65%), Gaps = 24/800 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MWP ++ +AKEGGL+VIQTYVFWN+HEP +GQ++F G
Sbjct  44    LIINGHRKILFSGSIHYPRSTPQMWPSLIAKAKEGGLDVIQTYVFWNLHEPQKGQYDFSG  103

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND+++FIK I   G+YV LR+GPF+E+EW +GG P WL +V  I FR+ N+P+  +M++
Sbjct  104   RNDIIRFIKEIQSQGLYVCLRIGPFIESEWTYGGLPIWLHDVAGIVFRSDNKPYKYYMQR  163

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK  KL+A QGGPIIL+QIENEY +IE   PA  +    Y+ WAA MA+  +
Sbjct  164   FVTKIVNMMKSEKLYASQGGPIILSQIENEYQTIE---PAFHEKGPPYVLWAAKMAVDFH  220

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN  NKPS+WTE+WT+ Y+ +G  P  R
Sbjct  221   TGVPWVMCKQDDAPGPVINACNGMRCGETFKGPNSPNKPSIWTEDWTSFYQVWGGKPYIR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA++IA+ +  F A KNGSY+ YYMY+GGTN+GRT A+F+ T YYD+ PLDE+GL R+PK
Sbjct  281   SAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAPLDEYGLVREPK  339

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL++ HAA++L  RPL  GT  +  L   QE   FE  +  +CAAFL NN+     ++
Sbjct  340   WGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFEETS-GVCAAFLVNNDERKAVTV  398

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FR   Y LP  S S+LPDCKT  FN++ + +Q+N +R   S L    D KWE ++E I 
Sbjct  399   LFRNISYELPRKSISILPDCKTVAFNTERVSTQYN-KRSKTSNLKFDSDEKWEEYREAIL  457

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               DN  ++    L+  +  KD SDY WY+ R  ++  +          LDV S GH L A
Sbjct  458   NFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQA------PLDVQSHGHILHA  511

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+ GS HG++D+ + +LR  V L+ G ND  LL V  G P+SGA ++++  G   V
Sbjct  512   FVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLPDSGAFLERKVAGVHRV  571

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +Q         T  SW + VG+ GEKL++++  G  KV W  + +    +TWYKT F A
Sbjct  572   RVQ-----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYKTTFRA  626

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+P+AL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YH+PR F+KP  NL+V
Sbjct  627   PAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQTRYHVPRGFLKPTGNLLV  686

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI--RPSVRLK  2267
             + EE+ G+P  I +  +    +C  V++ +   + SW R  +     ++    +P+V+  
Sbjct  687   LLEEENGNPLGITVDTIAIRKVCGHVTNSHLPPLSSWLRHRQRGDTDIKKFGKKPTVQPS  746

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  K + KI FA++G+PDG C  + VG+C   ++  +VE+AC+GKS+C +P+    F  
Sbjct  747   CPLGKKISKIVFASFGNPDGDCERYAVGSCHSSHSQGVVERACMGKSRCSIPLSSRYF--  804

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
                D CP  +HK L V A+C
Sbjct  805   -GGDPCPG-IHKALLVDAQC  822



>ref|XP_010471934.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=820

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/806 (47%), Positives = 507/806 (63%), Gaps = 29/806 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GGL+VI TYVFWNIHEP QGQF+F G
Sbjct  34    LIIDGKHKILFSGSIHYTRSTPQMWPSLIAKAKSGGLDVIDTYVFWNIHEPQQGQFDFGG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK I   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  +MK+
Sbjct  94    RRDIVKFIKEIQAHGLYVCLRIGPFIQGEWSYGGLPFWLHNVKGIVFRTDNEPFKYYMKR  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK  KL+A QGGPIIL+QIENEY  I      D    K Y+ WAA+MA+ L 
Sbjct  154   YAQMIVKLMKSEKLYASQGGPIILSQIENEYGMIARAFRQD---GKSYVKWAAEMAVELE  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGR+CG+TF GPN  NKP++WTENWT+ Y+T+GD P  R
Sbjct  211   TGVPWVMCKQDDAPDPVINACNGRKCGETFKGPNSPNKPAIWTENWTSFYQTYGDEPLIR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  271   SAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L ++PL  G  T   L   Q    F  +   LCAA L N +    +++
Sbjct  330   WGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALLVNQDECEATVQ  388

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FR + Y L   S SVLPDCK   FN+  + +Q++ R   P +      + WE F ET+P+
Sbjct  389   FRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTREPRQKLSSPHM-WEEFTETVPS  447

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  I++   LE    T+DTSDY W +TR +  E   S       VL V  +GH L  F
Sbjct  448   FSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQPEGAQS-------VLKVNHLGHVLHGF  500

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG+F+GS HG        L K V L  G N+I LL V+ G PNSGA +++R  G R V 
Sbjct  501   VNGKFIGSMHGTYKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVGSRSVK  560

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G   + FN  SW + VG+ GEK  ++TE G+ KV+WK   +    P+TWYK  F
Sbjct  561   I---WNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWKKYRDSKSQPLTWYKVSF  617

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D P+G +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP +NL
Sbjct  618   DTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTFKGNPSQIWYHIPRSFLKPSSNL  677

Query  2088  MVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE-----DIR  2249
             +V+ EE+  G P  + +  V+   +C  VS  +P  V S  RK    ++        D R
Sbjct  678   LVILEEEREGKPLGVTIDTVSVTEVCGHVSSSHPSPVISQRRKSHNRKKHRHLKHQYDRR  737

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVE  2429
             P V+L+CP  + + K+ FA++G P+G C ++ VG+   P +  ++EKACL KS+C VPV 
Sbjct  738   PKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSRHSPKSLAVIEKACLNKSRCSVPVW  797

Query  2430  KSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                F     D CP  V K+L V A+C
Sbjct  798   SKTF---GGDACPQAV-KSLLVHAQC  819



>ref|XP_008466742.1| PREDICTED: beta-galactosidase 16 isoform X2 [Cucumis melo]
Length=821

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/799 (46%), Positives = 512/799 (64%), Gaps = 22/799 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G   +LF+GSIHYPR  P+MWP ++ +AKEGG++VIQTYVFWN+HEP QG + F G
Sbjct  42    LIVNGEHKLLFSGSIHYPRSTPDMWPSLIAKAKEGGIDVIQTYVFWNLHEPQQGTYEFSG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+F+K I   G+Y  LR+GPF+EAEW++GG P+WL +VP I +R+ NEPF  HM+ 
Sbjct  102   RRDIVQFVKEIQAQGLYACLRIGPFIEAEWSYGGLPFWLHDVPGIVYRSDNEPFKLHMQN  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK   L+A QGGPIIL+QIENEY+ +E+   A  +    Y+ WAA MA+ L 
Sbjct  162   FTTKIVNMMKSEGLYASQGGPIILSQIENEYTLVEA---AFGEKGPPYVQWAAKMAVSLQ  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQN+AP  VI+TCNG +CG+TF GPN   KPS+WTENWT+ Y+T+G+ P  R
Sbjct  219   TGVPWSMCKQNDAPDPVINTCNGMRCGETFTGPNSPTKPSIWTENWTSFYQTYGEEPYIR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE IA+ +  F A KNG+Y+ YYMY+GGTN+GR+ ++F+ T YYD+GPLDE+GL R+PK
Sbjct  279   SAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQGPLDEYGLTREPK  338

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L   PL  GT     L  + E I F+ ++ + CAAFL N     T + 
Sbjct  339   WGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFKTESDE-CAAFLVNRGAIDTDVL  397

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F+   Y LP  S S+LPDCK   FN++ +  Q N R  +  +     + +WE F+E IP 
Sbjct  398   FQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTVQKFDSSE-EWEEFKEPIPN  456

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
              ++  ++  + LE    TKD SDY WY+ R++    D           +V S  HAL AF
Sbjct  457   FEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDSPDSQQ------TFEVDSRAHALHAF  510

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG++ GS HG   +K  SL   + L+ G N+I+LL V+ G P+SGA ++ R  G R V 
Sbjct  511   VNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGLPDSGAFLETRVAGLRRVG  570

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             IQG        +   W + VG+SGE+ ++F + GS  V+W  + N   P+TWYKT FDAP
Sbjct  571   IQGED-----FSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKTRFDAP  625

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
              G++P+AL + +M KG  WVNG+ IGRYWV+FL+P G+PSQ  Y++PR+F+KP +N +V+
Sbjct  626   PGDDPIALNLGSMGKGAAWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKPTDNQLVI  685

Query  2097  FEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW-ERKGEELRQVVEDI-RPSVRLKC  2270
              EE+ G+P  I L  V     C  VS+ +   V SW   K +++R       RP V+L C
Sbjct  686   LEEETGNPVEISLDSVLITKTCGQVSESHYPLVASWMGAKKQKVRSAKNRTRRPKVQLSC  745

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P  K +  I FA++G P G C ++ +G C  PN+  IVE ACLG+ +C +P+    FQ  
Sbjct  746   PSKKKISNILFASFGTPSGDCQSYAIGMCHSPNSRPIVEHACLGRVKCSIPISSLNFQ--  803

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
               D CP+ V KTL V A+C
Sbjct  804   -GDPCPH-VTKTLLVDAQC  820



>ref|XP_006434247.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
 gb|ESR47487.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
Length=802

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/800 (46%), Positives = 516/800 (65%), Gaps = 33/800 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MWP ++ +AKEGGL+VIQTYVFWN+HEP +GQ++F G
Sbjct  32    LIINGHRKILFSGSIHYPRSTPQMWPSLIAKAKEGGLDVIQTYVFWNLHEPQKGQYDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND+++FIK I   G+YV LR+GPF+E+EW +GG P WL +V  I FR+ N+P+      
Sbjct  92    RNDIIRFIKEIQSQGLYVCLRIGPFIESEWTYGGLPIWLHDVAGIVFRSDNKPY------  145

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
                 IV+MMK  KL+A QGGPIIL+QIENEY +IE   PA  +    Y+ WAA MA+ L+
Sbjct  146   ---KIVNMMKSEKLYASQGGPIILSQIENEYQTIE---PAFHEKGPPYVLWAAKMAVDLH  199

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN  NKPS+WTE+WT+ Y+ +G  P  R
Sbjct  200   TGVPWVMCKQDDAPGPVINACNGMRCGETFKGPNSPNKPSIWTEDWTSFYQVWGGKPYIR  259

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA++IA+ +  F A KNGSY+ YYMY+GGTN+GRT A+F+ T YYD+ PLDE+GL R+PK
Sbjct  260   SAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAPLDEYGLVREPK  318

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL++ HAA++L  RPL  GT  +  L   QE   FE +   +CAAFL NN+     ++
Sbjct  319   WGHLKELHAAIKLCSRPLLTGTQNVIPLGQLQEAYVFE-ETSGVCAAFLVNNDERKAVTV  377

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FR   Y LP  S S+LPDCKT  FN++ + +Q+N +R   S L    D KWE ++E IP
Sbjct  378   LFRNISYELPRKSISILPDCKTVAFNTERVSTQYN-KRSKTSNLKFDSDEKWEEYREAIP  436

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               DN  ++    L+  +  KD SDY WY+ R  ++  +          LDV S GH L A
Sbjct  437   NFDNTLLRAEGLLDQISAAKDASDYLWYTFRFHYNSSNAQA------PLDVQSHGHILHA  490

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNGE+ GS HG++D+ + +LR  V L+ G +D  LL V  G P+SGA ++++  G   V
Sbjct  491   FVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTSDGALLSVTVGLPDSGAFLERKVAGVHRV  550

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +Q         T  SW + VG+ GEKL++++  G  KV W  + +    +TWYKT F A
Sbjct  551   RVQ-----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYKTTFRA  605

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+P+AL + +M KG  WVNG+SIGRYWV+F +  G PSQ +YH+PRAF+KP  NL+V
Sbjct  606   PAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQTQYHVPRAFLKPTGNLLV  665

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI--RPSVRLK  2267
             + EE+ G+P  I +  +    +C  V++ +   + SW R  +     ++    +P+V+L 
Sbjct  666   LLEEENGNPLGITVDTIAITKVCGHVTNSHLPPLSSWLRHRQRGDTDIKKFGKKPTVQLS  725

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  K + KI FA++G+PDG C  +  G+C   ++  +VE+AC+GKS+C +P+    F  
Sbjct  726   CPLGKKISKIVFASFGNPDGDCERYAGGSCHSSHSQGVVERACIGKSRCSIPLLSRYF--  783

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
                D CP  +HK L V A+C
Sbjct  784   -GGDPCPG-IHKALLVDAQC  801



>dbj|BAC43014.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64909.1| At1g77410 [Arabidopsis thaliana]
Length=820

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/785 (47%), Positives = 505/785 (64%), Gaps = 30/785 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GG++V+ TYVFWN+HEP QGQF+F G
Sbjct  32    LIIDGEHKILFSGSIHYTRSTPQMWPSLIAKAKSGGIDVVDTYVFWNVHEPQQGQFDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + D+VKFIK + + G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  92    SRDIVKFIKEVKNHGLYVCLRIGPFIQGEWSYGGLPFWLHNVQGIVFRTDNEPFKYHMKR  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK   L+A QGGPIIL+QIENEY  +     A  +  K Y+ W A +A+ L 
Sbjct  152   YAKMIVKLMKSENLYASQGGPIILSQIENEYGMVGR---AFRQEGKSYVKWTAKLAVELD  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +++ CNGRQCG+TF GPN  NKP++WTENWT+ Y+T+G+ P  R
Sbjct  209   TGVPWVMCKQDDAPDPLVNACNGRQCGETFKGPNSPNKPAIWTENWTSFYQTYGEEPLIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  269   SAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L + PL  G  T   L   Q    F  +   LCAA L N +   ++++
Sbjct  328   WGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAILVNQDKCESTVQ  386

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK----WEMFQE  1364
             FR + Y L   S SVLPDCK   FN+  + +Q+N R         R +L     WE F E
Sbjct  387   FRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTR-----TRKARQNLSSPQMWEEFTE  441

Query  1365  TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             T+P+     I++   LE    T+DTSDY W +TR + SE   S       VL V  +GHA
Sbjct  442   TVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAPS-------VLKVNHLGHA  494

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             L AFVNG F+GS HG        L K + L  G N++ LL V+ G PNSGA +++R  G 
Sbjct  495   LHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVGS  554

Query  1725  RDVTIQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWY  1895
             R V I     G   + FN  SW + VG+ GEK  ++TE+GS KV+WK   +    P+TWY
Sbjct  555   RSVKIWN---GRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWY  611

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKP  2075
             K  FD PEG +PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+KP
Sbjct  612   KASFDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKP  671

Query  2076  KNNLMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVV--EDI  2246
              +NL+V+ EE+  G+P  I +  V+   +C  VS+  P  V S  +KG   + +    D 
Sbjct  672   NSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVISPRKKGLNRKNLTYRYDR  731

Query  2247  RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPV  2426
             +P V+L+CP  + + KI FA++G P+G+CG++ +G+C  PN+  +V+KACL KS+C VPV
Sbjct  732   KPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSLAVVQKACLKKSRCSVPV  791

Query  2427  EKSLF  2441
                 F
Sbjct  792   WSKTF  796



>gb|EEC84965.1| hypothetical protein OsI_32205 [Oryza sativa Indica Group]
Length=807

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/804 (44%), Positives = 506/804 (63%), Gaps = 42/804 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG RD+ F+G+IHYPR PPEMW  ++K AK GGLN I+TYVFWN HEP  G++ FEG
Sbjct  43    LMIDGKRDLFFSGAIHYPRSPPEMWDKLVKTAKMGGLNTIETYVFWNGHEPEPGKYYFEG  102

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DL++F+ +I D  MY  +R+GPF++AEWN GG PYWL+E+  I FR  NEPF      
Sbjct  103   RFDLIRFLNVIKDNDMYAIVRIGPFIQAEWNHGGLPYWLREIGHIIFRANNEPF------  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
                                      +IENEY +I+ DR  +     KY+ WAA+MA+   
Sbjct  157   -------------------------KIENEYGNIKKDRKVE---GDKYLEWAAEMAISTG  188

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+RTFGD  AQR
Sbjct  189   IGVPWVMCKQSIAPGEVIPTCNGRHCGDTWTLLDK-NKPRLWTENWTAQFRTFGDQLAQR  247

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY+++RF A K G+ + YYMY+GGTN+GRT AS+V T YYDE P+DE+G+ ++PK
Sbjct  248   SAEDIAYAVLRFFA-KGGTLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPK  306

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLRD H  ++   +    G  + + L +  E   +E    KLC +FL+NNNT    ++
Sbjct  307   FGHLRDLHNVIKSYHKAFLWGKQSFEILGHGYEAHNYELPEDKLCLSFLSNNNTGEDGTV  366

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FRG ++Y+P  S S+L DCKT V+N++ +  QH+ R F  +    ++++ WEM+ E IP
Sbjct  367   VFRGEKFYVPSRSVSILADCKTVVYNTKRVFVQHSERSFHTTDETSKNNV-WEMYSEAIP  425

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
                   ++  +PLE Y  TKDTSDY WY+T       DL  R DI PV+ + S  HA++ 
Sbjct  426   KFRKTKVRTKQPLEQYNQTKDTSDYLWYTTSFRLESDDLPFRRDIRPVIQIKSTAHAMIG  485

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             F N  FVG+  G+  +K+    KP+DL+ G N I +L    G  +SG  + +   G +D 
Sbjct  486   FANDAFVGTGRGSKREKSFVFEKPMDLRVGINHIAMLSSSMGMKDSGGELVEVKGGIQDC  545

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              +QGL  GTL +  N   H   + GE  +++TE+G  + +WKP  N   P+TWYK YFD 
Sbjct  546   VVQGLNTGTLDLQGNGRGHKARLEGEDKEIYTEKGMAQFQWKPAEN-DLPITWYKRYFDE  604

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P+G++P+ + M +M+KGM++VNG+ IGRYW +F++  G PSQ  YHIPRAF+KPK NL++
Sbjct  605   PDGDDPIVVDMSSMSKGMIYVNGEGIGRYWTSFITLAGHPSQSVYHIPRAFLKPKGNLLI  664

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             +FEE+ G P  I +  V RD IC  +S++ P  +K+WE  G +++ + ED      L CP
Sbjct  665   IFEEELGKPGGILIQTVRRDDICVFISEHNPAQIKTWESDGGQIKLIAEDTSTRGTLNCP  724

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + ++++ FA++G+P+GACGNF  G C  P+A  +VEK CLGK  C +PV  +++  G+
Sbjct  725   PQRTIQEVVFASFGNPEGACGNFTAGTCHTPDAKAVVEKECLGKESCVLPVVNTVY--GA  782

Query  2454  KDLCPNLVHKTLAVQAKCGLRHAK  2525
                CP     TLAVQ +C +  A+
Sbjct  783   DINCPATT-ATLAVQVRCKVSGAQ  805



>ref|XP_008338663.1| PREDICTED: beta-galactosidase 16 isoform X1 [Malus domestica]
Length=813

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/803 (46%), Positives = 523/803 (65%), Gaps = 30/803 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +LF+GSIHYPR  PEMWP ++ +AKEGG++VIQTYVFWNIHE  QG+F+F G
Sbjct  34    LIINGERKVLFSGSIHYPRSTPEMWPSLIAKAKEGGIDVIQTYVFWNIHERQQGKFDFSG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND++ FIK + + G+YVTLR+GPF+E+EW +GG P WL+++P I +R+ NEPF   M+K
Sbjct  94    RNDIISFIKEVQNQGLYVTLRIGPFIESEWTYGGLPIWLRDIPGIVYRSDNEPFKIEMEK  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   IV MMK  KL+A  GGPIIL+QIENEY  IE   PA  +    Y+ WAA MA+GL 
Sbjct  154   WTTRIVYMMKSEKLYASLGGPIILSQIENEYKMIE---PAFHERGPPYVRWAAAMAVGLQ  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQ++AP  VI+TCNG +CG+TF GPN  NKP++WTENWT+QY+ +GD P  R
Sbjct  211   TGVPWXMCKQDDAPDPVINTCNGMKCGETFTGPNSPNKPALWTENWTSQYQVYGDKPLLR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY +  F A   GSY+ YYMY+GGTN+GR+ ++FV T YYDE PLDE+G  R PK
Sbjct  271   SAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVITSYYDEAPLDEYGSVRQPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L+  PL  G  T   L   Q+   F+ ++ + CAAFL N      S+ 
Sbjct  331   WGHLKELHAAVKLASNPLLSGGHTNVSLGELQDAYVFQVKSGE-CAAFLVNKGPKDASVV  389

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETIP  1373
             F+ + Y LP  S S+LPDCKT  FN+  + +Q + R + V  K    +  +WE ++E IP
Sbjct  390   FQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVTQKFDSTE--RWEEYKEAIP  447

Query  1374  TIDNLPIK-NLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
               DN   + N  P +L+T TKD SDY WY+  +   ++D +T+      L V S GH L 
Sbjct  448   NFDNXXSRANTLPEQLFT-TKDESDYLWYTISL---KQDSNTQSK----LXVQSRGHVLH  499

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNG FVGS HG + ++  SL + V L  G N ++ L  + G P+SGA +++R  G R 
Sbjct  500   AFVNGVFVGSAHGRHRNEXFSLEQTVILNKGVNSLSFLSAMVGLPDSGAYLERRVGGLRK  559

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYF  1907
             V I         ++ NSW + VG+SGEKL+++T+ G  KV+W  + ++ + P+ W+KT+F
Sbjct  560   VLIX-----ERDLSKNSWGYXVGLSGEKLEIYTDAGXSKVEWNKLGSSANQPLKWFKTHF  614

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAP GN+P+AL + +M KG  +VNG+SIGRYWV F +P G+PSQ  YH+PRAF+KP  NL
Sbjct  615   DAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVLFQTPEGKPSQTWYHVPRAFLKPTGNL  674

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW---ERKGEELRQVVEDIRPSV  2258
             +V+ EE+ GDP  + L  ++   +C  VS+ +   V  W   + + +   +   D RP V
Sbjct  675   LVLLEEENGDPLKVSLDKISVAQVCGXVSETHLPPVVKWLGLKTQNQNNTRKNRDRRPKV  734

Query  2259  RLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSL  2438
             +L CP  + + K+ FA++G+P G C N+  G+C    +  IVE+ C+GK +C + + K+ 
Sbjct  735   QLSCPPKRNISKVLFASFGNPSGDCQNYSTGSCHSSISTAIVEQVCIGKRRCSILLSKNR  794

Query  2439  FQEGSKDLCPNLVHKTLAVQAKC  2507
             F     D CP  + KTL V A+C
Sbjct  795   F----GDPCPG-ISKTLLVDAQC  812



>ref|XP_010269108.1| PREDICTED: beta-galactosidase 16-like [Nelumbo nucifera]
Length=771

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/793 (47%), Positives = 508/793 (64%), Gaps = 27/793 (3%)
 Frame = +3

Query  141   ILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFI  320
             +LF+GSIHYPR  PEMWP ++ +AKEGGL+VIQTYVFW+ HEP  GQ+NFEG  DLV+FI
Sbjct  1     MLFSGSIHYPRSTPEMWPSLISKAKEGGLDVIQTYVFWSQHEPQPGQYNFEGRYDLVRFI  60

Query  321   KMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDM  500
             K I   G+Y TLR+GP++EAEW++GG P+WL +VP I +R+ NEPF  +M+ F   IV++
Sbjct  61    KEIQAQGLYATLRIGPYIEAEWSYGGLPFWLHDVPGIIYRSDNEPFKCYMQNFTTKIVNL  120

Query  501   MKKAKLFAPQGGPIILAQIENEYSSIESD----RPADIKIQKKYINWAADMAMGLYNEIP  668
             MK+ KL+A QGGPIIL+QIENEY ++E       PA       Y+ WAA MA+GL   +P
Sbjct  121   MKEEKLYASQGGPIILSQIENEYKNVEGSFHEKGPA-------YVRWAAQMAVGLQTGVP  173

Query  669   WIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAEN  848
             W+MCKQ++AP  VI+ CNG  CG TF GPN  NKPS+WTENWT+ ++ FG  P  RSAE+
Sbjct  174   WVMCKQDDAPDPVINACNGMMCGQTFAGPNSPNKPSIWTENWTSFFQVFGGKPYIRSAED  233

Query  849   IAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHL  1028
             IA+ +  F A K GSY+ YYMY+GGTN+GRT +++VTT YYD+ PLDE+GL R PKW HL
Sbjct  234   IAFHVALFIAAKKGSYINYYMYHGGTNFGRTGSAYVTTSYYDQAPLDEYGLVRQPKWGHL  293

Query  1029  RDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFRGT  1208
             ++ H+A++L   PL  GT T   L N QE   F+ ++ + C+AFL NN+     + F+  
Sbjct  294   KELHSAIKLCTEPLLWGTHTNFSLGNLQEAHIFQGESGE-CSAFLVNNDAVIAKVNFQNL  352

Query  1209  QYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNL  1388
              Y LP  S S LPDCK  VFN++ + +Q++AR    S+     D +W+ F+E IP  +  
Sbjct  353   SYELPQQSISTLPDCKNVVFNTRKVSTQYSARSTELSQKFDSSD-QWKEFREVIPKFEET  411

Query  1389  PIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGE  1568
              I     L+    TKD SDY WY+    FS ++ S+  D   +L V S+GH + AF+N  
Sbjct  412   SITADMLLDHMDATKDVSDYLWYT----FSFQNNSS--DDQSLLQVDSLGHVVHAFLNKT  465

Query  1569  FVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGL  1748
             ++GS HG+  +   SL   + L  G  D++LL V+ G PNSGA ++ R  G R V IQG+
Sbjct  466   YIGSAHGSYKNPGSSLNISISLSNGMTDVSLLSVMVGLPNSGAYLEHRVAGLRGVKIQGI  525

Query  1749  MAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNN  1928
               G+   +   W + VG+ GEK + + EE S +V+W  +    PP+TWYKT FDAP G++
Sbjct  526   GNGSQDFSKYQWGYQVGLVGEKFRAYNEESSSEVQWNNLGTYKPPLTWYKTTFDAPAGDD  585

Query  1929  PVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQ  2108
             PV L +  M+KG VWVNG+SIGRYWV+F +  G PSQ  YH+PR+F+KP  NL+V+ EE 
Sbjct  586   PVVLNLSTMSKGEVWVNGQSIGRYWVSFHTDGGVPSQALYHVPRSFIKPSGNLLVLLEEF  645

Query  2109  GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVV  2288
             GGDP  I L  V    +C  VS+ +   V SW       +      R SV+++CP  +++
Sbjct  646   GGDPLHITLDTVTISKVCGHVSESHLPPVASWGGG----QHKTHHKRRSVQIECPHGRII  701

Query  2289  KKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCP  2468
              KI FA++G+P G C ++ +G+C   N+  +VEKACLG+  C +P     F     D C 
Sbjct  702   SKILFASFGNPSGDCKSYAIGSCHSSNSKAVVEKACLGRRHCSIPQSIKAF---GGDPCS  758

Query  2469  NLVHKTLAVQAKC  2507
                 K L V AKC
Sbjct  759   G-TPKALLVDAKC  770



>ref|XP_006301847.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
 gb|EOA34745.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
Length=821

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/807 (47%), Positives = 504/807 (62%), Gaps = 30/807 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GGL+VI TYVFWNIHEP QG F+F G
Sbjct  34    LIIDGKHKILFSGSIHYTRSTPQMWPSLIAKAKSGGLDVIDTYVFWNIHEPQQGHFDFSG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK +   G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  94    RRDIVKFIKYVHAQGLYVCLRIGPFIQGEWSYGGLPFWLHNVKGIVFRTDNEPFKFHMKR  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK  KL+A QGGPIIL+QIENEY  +     A  +  K Y+ WAA+MA+ L 
Sbjct  154   YAQMIVKLMKSEKLYASQGGPIILSQIENEYGMVAR---AFRQEGKSYVKWAAEMAVELE  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGRQCG+TF GPN +NKP++WTENWT+ Y+T+G+ P  R
Sbjct  211   TGVPWVMCKQDDAPDPVINACNGRQCGETFKGPNSLNKPAIWTENWTSFYQTYGEEPLMR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A +NGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  271   SAEDIAFQVALFIA-RNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L + PL  G  T   L        F  +   LC+A L N +   ++++
Sbjct  330   WGHLKELHAAVKLCEEPLLSGLQTTIPLGKLLTAFVF-GKKANLCSALLVNQDKCDSTVQ  388

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F  + Y L   S SVLPDCK   FN+  + +Q+N R   P +      + WE F ETIP+
Sbjct  389   FHNSSYILSPKSISVLPDCKNVAFNTAKVNAQYNTRTREPRQNLSSPHM-WEEFTETIPS  447

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  +++   LE    T+DTSDY W +TR    E  LS       VL V  +GH L AF
Sbjct  448   FSETSVRSEFFLEHMNTTQDTSDYLWQTTRFHQPEEALS-------VLKVNHLGHVLHAF  500

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG F+GS HG        L K V L  G N+I LL V+ G PNSGA +++R  G R   
Sbjct  501   VNGRFIGSMHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVGTRGAK  560

Query  1737  IQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWYKTYF  1907
             I     G   + FN  SW + VG+ GEK   +TE G+ KV+WK   +    P+TWYK  F
Sbjct  561   IWN---GKHTLYFNNYSWGYQVGLQGEKFHAYTENGAAKVQWKQYRDSKSQPLTWYKASF  617

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKP-KNN  2084
             D PEG + VAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  YHIPR+F+K   +N
Sbjct  618   DTPEGTDSVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKRNSSN  677

Query  2085  LMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVE-----DI  2246
             L+V+ EE+  G+P  I +  V+   +CS VS  +P  V S  RKG    +        D 
Sbjct  678   LLVILEEEREGNPLGITIDTVSVTNVCSHVSSSHPPPVISQRRKGHNRNKRRHLNHQYDR  737

Query  2247  RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPV  2426
             RP V+L+CP  + + K+ FA++G P+G C ++ VG+C  P +  ++ KACL KS+C V V
Sbjct  738   RPKVQLQCPNGRKISKVLFASFGTPNGNCWSYSVGSCHSPKSLAVIHKACLNKSKCSVSV  797

Query  2427  EKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                 F     D CP+ V K+L V A+C
Sbjct  798   WSKTF---GVDSCPHAV-KSLLVHAQC  820



>ref|XP_002302225.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE81498.2| beta-galactosidase family protein [Populus trichocarpa]
Length=816

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/802 (45%), Positives = 518/802 (65%), Gaps = 22/802 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G   I+F+GSIHYPR  P+MWP ++ +A+ GGL+ I TYVFWN+HEP QGQ++F G
Sbjct  33    LVINGKHKIIFSGSIHYPRSTPQMWPYLISKARAGGLDAIDTYVFWNLHEPQQGQYDFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GPF+E+EW +GG P+WL +VP I FR+ N+PF  HM++
Sbjct  93    RKDLVRFIKEVHAQGLYVCLRIGPFIESEWTYGGLPFWLHDVPGIVFRSDNKPFKYHMER  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV M+K  KL+A QGGPIIL+QIENEY ++E+   A  +    Y+ WAA MA+GL+
Sbjct  153   YAKMIVKMLKAEKLYASQGGPIILSQIENEYGNVEA---AFHEKGPPYVKWAAKMAVGLH  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN   KP++WTENWT+ Y+T+G     R
Sbjct  210   TGVPWVMCKQDDAPDPVINACNGLRCGETFSGPNSPRKPAIWTENWTSVYQTYGKETRSR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+    F A K GS++ YYMY+GGTN+GRT A +V T YYD+ PLDE+GL R PK
Sbjct  270   SAEDIAFHAALFIA-KGGSFVNYYMYHGGTNFGRTAAEYVPTSYYDQAPLDEYGLLRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
               HL++ HAA++L ++PL         L   QE   FE +N   CAAFL N++  +  ++
Sbjct  329   HGHLKELHAAIKLCRKPLLSRKWINFSLGQLQEAFAFE-RNSDECAAFLVNHDGRSNATV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL-KWEMFQETI  1370
              F+G+ Y LP  S S+LP CKT  FN+  + +Q+  R  + ++    D + +W+ ++E I
Sbjct  388   HFKGSSYKLPPKSISILPHCKTVAFNTAQVSTQYGTR--LATRRHKFDSIEQWKEYKEYI  445

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P+ D   ++    LE    TKD+SDY WY+ R   +  +  +      VL V S+GH L 
Sbjct  446   PSFDKSSLRANTLLEHMNTTKDSSDYLWYTFRFHQNSSNAHS------VLTVNSLGHNLH  499

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGEF+GS HG++D+K+ +L++ + LK G N ++LL V+TG P++GA +++R  G R 
Sbjct  500   AFVNGEFIGSAHGSHDNKSFTLQRSLPLKRGTNYVSLLSVMTGLPDAGAYLERRVAGLRR  559

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTIQ         T+  W + VG+SGE ++L     S K  W    +   P+TWYK+ FD
Sbjct  560   VTIQRQHELHDFTTY-LWGYKVGLSGENIQLHRNNASVKAYWSRYASSSRPLTWYKSIFD  618

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+PVAL + +M KG  WVNG+SIGRYWV+FL   G P Q   HIPR+F+KP  NL+
Sbjct  619   APAGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDGNPYQTWNHIPRSFLKPSGNLL  678

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGE--ELRQVVEDIRPSVRL  2264
             V+ EE+ G+P  I L  ++   +C  VS  +P  V SW+ + +    R+     RP V+L
Sbjct  679   VILEEERGNPLGISLGTMSITKVCGHVSISHPPPVISWQGENQINGTRKRKYGRRPKVQL  738

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             +CP  + +  + F+++G P G C  + +G+C   N+   VEKACLGK +C +PV    F+
Sbjct  739   RCPRGRKISSVLFSSFGTPSGDCEAYAIGSCHASNSRATVEKACLGKERCSIPVSSKNFK  798

Query  2445  EGSKDLCPNLVHKTLAVQAKCG  2510
                 D CP +  K+L V AKC 
Sbjct  799   ---GDPCPGIA-KSLLVDAKCA  816



>ref|XP_007019136.1| Beta-galactosidase isoform 1 [Theobroma cacao]
 gb|EOY16361.1| Beta-galactosidase isoform 1 [Theobroma cacao]
Length=817

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/802 (46%), Positives = 514/802 (64%), Gaps = 22/802 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  P+MW  ++ +AK GGL+VI+T VFWN+HEP  GQF+F G
Sbjct  32    LIIDGQHKILFSGSIHYPRSTPQMWSSLIAKAKAGGLDVIETLVFWNLHEPQPGQFDFSG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK I   G+Y  +R+GPF++ EW++GG P+WL ++P I +R+ NEPF   M+K
Sbjct  92    RRDIVRFIKEIQAQGLYACIRIGPFIQGEWSYGGLPFWLHDIPGIVYRSDNEPFKYQMQK  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MM+   L+A QGGPIIL+QIENEY  +++   A  +    Y+ WAA+MA+GL 
Sbjct  152   FVSKIVSMMRAENLYASQGGPIILSQIENEYGMVQA---AFREKGPTYLRWAAEMAVGLQ  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGR+CG+TF GPN  NKP++WTENWT+ Y+ +GD    R
Sbjct  209   TGVPWVMCKQDDAPDPVINACNGRRCGETFAGPNSPNKPAIWTENWTSFYQVYGDDVDIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A K  SY+ YYMY+GGTN+GR  A+++ T YYD+ PLDE+GL+R PK
Sbjct  269   SAEDIAFHVALFIAKKG-SYVNYYMYHGGTNFGRNAAAYMLTGYYDQAPLDEYGLFRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTP-TSI  1193
             W HL++ HAA++L  +PL  G  T   L  +Q+   +   ++  CAAFL NN+T     +
Sbjct  328   WGHLKELHAAIKLCSKPLISGVYTTMALGRSQQAFVYRGNSVD-CAAFLVNNDTRKNVGV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F  + Y LP  S S+LPDCKT  FN+  + +Q+N R  V ++       KWE F+E IP
Sbjct  387   TFLNSFYELPPKSISILPDCKTEAFNTAKVSTQYNTRA-VETRQKLDSIEKWEEFKEAIP  445

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             T +   ++    LE    TKDTSDY WY+ R    + D S   D   VL+V S  H L A
Sbjct  446   TFEKTSLRANILLEHMNTTKDTSDYLWYTFRF---QNDFS---DAQYVLNVTSSAHVLHA  499

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG  VG  HG+   K  +L + V L  G N I+LL  + G P+SGA +++R  G   V
Sbjct  500   FVNGASVGFTHGSYKTKTPNLERKVTLSNGTNHISLLSGMVGLPDSGAYLERRVAGVSRV  559

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFD  1910
              I+G        ++ SW + VG+ GEKL+++T+ GS K++W    ++ H  +TWYKT FD
Sbjct  560   IIKGEHEIKDFTSY-SWGYQVGLLGEKLQVYTDFGSSKIQWNTYGSSTHRTLTWYKTLFD  618

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP G +PVAL +++M KG  WVNG+SIGRYWV+FL+P G PSQ  Y++PR+F+KP NNL+
Sbjct  619   APVGKDPVALNLESMGKGEAWVNGQSIGRYWVSFLTPKGSPSQTWYNVPRSFLKPTNNLL  678

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE---RKGEELRQVVEDIRPSVR  2261
             V+ EEQ G P  I +  ++   +C  VSD +   V SW    +  E+  +     RP V+
Sbjct  679   VILEEQNGYPLGISVDTISITKVCGHVSDSHLPPVISWRGQNKTEEKNHEKHHGRRPKVQ  738

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             L+CP  + +  I F++YG+P G CG++ +G+C   N+  IVE+ACLGK  C +PV    F
Sbjct  739   LRCPPGRNISSILFSSYGNPSGDCGSYAIGSCHSSNSLAIVEEACLGKRICSIPVWSQKF  798

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
              +   D CP  + KTL V A+C
Sbjct  799   GD---DPCPG-IQKTLLVDAQC  816



>ref|XP_010243519.1| PREDICTED: beta-galactosidase 16 [Nelumbo nucifera]
Length=813

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/800 (46%), Positives = 512/800 (64%), Gaps = 22/800 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R ILF+GSIHYPR  P+MWP ++ +AKEGGL+VIQTYVFWN HEP  GQ+ F+G
Sbjct  32    LIIDGQRKILFSGSIHYPRSTPKMWPSLISKAKEGGLDVIQTYVFWNQHEPQPGQYYFQG  91

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK I   G+YVTLR+GPF+EAEW +GG P+WL ++P I +R+ NEPF  +M+ 
Sbjct  92    RYDLVRFIKEIQARGLYVTLRIGPFIEAEWTYGGLPFWLHDIPGIVYRSDNEPFKYYMQN  151

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK  KL+A QGGPIIL+QIENEY ++E    A  +    Y+ WAA MA+GL 
Sbjct  152   FTTKIVELMKSEKLYASQGGPIILSQIENEYRNVER---AFHEKGPPYVLWAAKMAVGLQ  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI++CNG +CG+TF GPN  NKPS+WTENWT+ Y+ FG  P  R
Sbjct  209   TGVPWVMCKQDDAPDPVINSCNGMRCGETFAGPNSPNKPSIWTENWTSFYQVFGGEPYIR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A K GSY+ YYMY+GGTN+GR ++++ TT YYD+ PLDE+GL R PK
Sbjct  269   SAEDIAFHVALFVAAKKGSYVNYYMYHGGTNFGRVSSAYATTSYYDQAPLDEYGLTRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             W HL++ HAA++L    L  GT     L   QE   F+ ++   CAAFL NN+   TS +
Sbjct  329   WGHLKELHAAIKLCSEQLLTGTYNNFSLGQLQEAHVFQGKS-GGCAAFLVNNDIRNTSTV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARR-FVPSKLAGRDDLKWEMFQETI  1370
              F+ + + LP  S S+LPDCK  +FN+  + SQ++AR  ++  KL   +  +W+ F E I
Sbjct  388   YFQNSSFVLPQKSISILPDCKNVIFNTAKVSSQYSARSTWLNQKLESSE--QWKEFSEVI  445

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P   +   K    LE    TKD SDY WY+      +++ S +G++   L VYS+GH + 
Sbjct  446   PNFSDTSEKETTLLEHMGTTKDASDYLWYTFSF---QQNSSAKGNM---LQVYSLGHVIH  499

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN  + GS HG++++   SL   + L  G N+I+LL V+ G P+SGA +++R  G R 
Sbjct  500   AFVNRIYAGSAHGSHENPGSSLNISISLNYGVNNISLLSVMVGLPDSGAYLERRVAGLRR  559

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVH-PPVTWYKTYF  1907
             V IQG        +   W + VG+SGEKLK + ++G  K++W  +T  H  P+TWYKT F
Sbjct  560   VRIQGTGKWLQDFSKYQWGYQVGLSGEKLKTYGDQGLAKIQWNNLTISHQQPLTWYKTTF  619

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAP GN+PV L + +M KG  WVNG+SIGRYWV+F      PSQ  YH+PR+F+K   NL
Sbjct  620   DAPIGNDPVVLNLSSMGKGEAWVNGQSIGRYWVSFYPDKADPSQTLYHVPRSFIKNSGNL  679

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +V+FEE GG+P  + L  +    +C  V + +   V SW  +     Q     +P V+L+
Sbjct  680   LVLFEEFGGNPLKVTLETITISKVCGHVLESHLPPVVSWLGR---QNQTHPRRKPKVQLE  736

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  + + KI FA++G+P G C ++  G C   N+  +VEKACLGK  C +P+    F  
Sbjct  737   CPHGRTISKILFASFGNPSGDCKSYAFGRCHSSNSRAVVEKACLGKRHCSLPLSTKRF--  794

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
                D C +   K L V A+C
Sbjct  795   -GGDPCSD-TPKALLVDAEC  812



>ref|XP_004171523.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=756

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/776 (47%), Positives = 505/776 (65%), Gaps = 23/776 (3%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++ +AKEGG++VIQTYVFWN+HEP QG + F G  D+V+F+K I   G+Y  LR+G
Sbjct  1     MWPSLIAKAKEGGIDVIQTYVFWNLHEPQQGTYEFSGRRDIVRFVKEIQAQGLYACLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF+EAEW++GG P+WL +V  I +R+ NEPF  HM+ F   IV+MMK   L+A QGGPII
Sbjct  61    PFIEAEWSYGGLPFWLHDVLGIVYRSDNEPFKLHMQNFTTKIVNMMKSEGLYASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L+QIENEY+ +E+   A  +    Y+ WAA MA+ L   +PW MCKQN+AP  VI+TCNG
Sbjct  121   LSQIENEYTLVEA---AFGEKGPPYVQWAAKMAVSLQTGVPWSMCKQNDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
              +CG+TF GPN  NKPS+WTENWT+ Y+T+G+ P  RSAE IA+ +  F A KNG+Y+ Y
Sbjct  178   MRCGETFTGPNSPNKPSIWTENWTSFYQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNY  237

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GR+ ++F+ T YYD+ PLDE+GL R+PKW HL++ HAA++L   PL  GT 
Sbjct  238   YMYHGGTNFGRSASAFMITGYYDQSPLDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTK  297

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAV  1265
             +   L  + E I F+ ++ + CAAFL N     +++ F+   Y LP  S S+LPDCK   
Sbjct  298   SNFSLGQSVEAIVFKTESNE-CAAFLVNRGAIDSNVLFQNVTYELPLGSISILPDCKNVA  356

Query  1266  FNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTSD  1445
             FN++ +  QHN R  +   +   D L+WE F+E IP ID+  ++    LE    TKD SD
Sbjct  357   FNTRRVSVQHNTRSMM--AVQKFDLLEWEEFKEPIPNIDDTELRANELLEHMGTTKDRSD  414

Query  1446  YAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKP  1625
             Y WY+ R++    D          L+V S  HAL AFVNG++ GS HG   +K  SL K 
Sbjct  415   YLWYTFRVQQDSPDSQQ------TLEVDSRAHALHAFVNGDYAGSAHGIYKEKGFSLAKN  468

Query  1626  VDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVS  1805
             + L+ G N+I+LL V+ G P+SGA ++ R  G R V IQG        +   W + VG+S
Sbjct  469   ITLRNGINNISLLSVMVGLPDSGAFLETRVAGLRRVGIQGED-----FSEQHWGYKVGLS  523

Query  1806  GEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGK  1985
             GE+ ++F + GS  V+W  + N   P+TWYKT FDAP G++P+AL + +M KG VWVNG+
Sbjct  524   GEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKTQFDAPPGDDPIALNLGSMGKGAVWVNGR  583

Query  1986  SIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICS  2165
              IGRYWV+FL+P G+PSQ  Y++PR+F+KP +N +V+ EE+ G+P  I L  V     C 
Sbjct  584   GIGRYWVSFLTPKGEPSQKWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLITKTCG  643

Query  2166  SVSDYYPGNVKSW-ERKGEELRQVVEDI-RPSVRLKCPEDKVVKKIEFANYGDPDGACGN  2339
              VS+ +   V SW   K +++R+V     RP V+L CP  K +  I FA++G P G C +
Sbjct  644   QVSESHYPLVASWMGAKKQKVRRVKNRTRRPKVQLSCPSKKKISNILFASFGTPSGDCQS  703

Query  2340  FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             + +G C  PN+  IVE ACLG+++C +P+    F+    D CP+ V KTL V A+C
Sbjct  704   YAIGLCHSPNSRAIVEHACLGRAKCSIPISNLNFR---GDPCPH-VTKTLLVDAQC  755



>ref|XP_011027489.1| PREDICTED: beta-galactosidase 16 [Populus euphratica]
Length=816

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/802 (45%), Positives = 515/802 (64%), Gaps = 22/802 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G   I+F+GSIHYPR  P+MWP ++ +A+ GGL+ I TYVFWN+HEP QGQ +F G
Sbjct  33    LVINGKHKIIFSGSIHYPRSTPQMWPYLISKARAGGLDAIDTYVFWNLHEPQQGQHDFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GPF+E EW +GG P+WL +VP I FR+ N+PF  HM++
Sbjct  93    RKDLVRFIKEVHAQGLYVCLRIGPFIEGEWTYGGLPFWLHDVPGIVFRSDNKPFKYHMER  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV M+K  KL+A QGGPIIL+QIENEY ++E+   A  +    Y+ WAA MA+GL+
Sbjct  153   YAKMIVKMLKAEKLYASQGGPIILSQIENEYGNVEA---AFHEKGPPYVKWAAKMAVGLH  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN   KP++WTENWT+ Y+T+G     R
Sbjct  210   TGVPWVMCKQDDAPDPVINACNGLRCGETFSGPNSPRKPAIWTENWTSVYQTYGKETRSR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+    F A K GS++ YYMY+GGTN+GRT A +V T YYD+ PLDE+GL R PK
Sbjct  270   SAEDIAFHAALFIA-KGGSFVNYYMYHGGTNFGRTAAEYVPTSYYDQAPLDEYGLLRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
               HL++ HAA++L ++PL         L   QE   FE +N   CAAFL N++  +  ++
Sbjct  329   HGHLKELHAAIKLCRKPLLSRKWINFSLGQLQEAFAFE-RNSDNCAAFLVNHDGRSNATV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL-KWEMFQETI  1370
              F+G+ Y LP  S S+LPDCKT  FN+  + +Q+  R  + ++    D + +W+ ++E I
Sbjct  388   HFKGSSYELPPKSISILPDCKTVAFNTAQVSTQYGTR--LATRRHKFDSIEQWKEYKEYI  445

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P+ D   ++    LE    TKD+SDY WY+ R   +  D  +      VL V S+GH L 
Sbjct  446   PSFDKSSLRADMLLEHMNTTKDSSDYLWYTFRFHQNSSDAHS------VLTVNSLGHNLH  499

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVNGEF+GS HG++D+K+  L++ + LK G N ++LL V+TG P++GA +++R  G R 
Sbjct  500   AFVNGEFIGSAHGSHDNKSFILQRILPLKRGTNYVSLLSVMTGLPDAGAYLERRVAGLRR  559

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTIQ         ++  W + VG+SGE ++L     S K  W    +   P++WYK+ FD
Sbjct  560   VTIQRQHELHDFTSY-LWGYKVGLSGENIQLHRNNASVKAYWSRYASSSQPLSWYKSIFD  618

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+PVAL + +M KG  WVNG+SIGRYWV+FL   G P Q   HIPR+F+KP  NL+
Sbjct  619   APVGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDGNPYQTWNHIPRSFLKPSGNLL  678

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGE--ELRQVVEDIRPSVRL  2264
             V+ EE+ G+P  I L  ++   +C  VS  +P  V SW+ + +    R+     RP V+L
Sbjct  679   VILEEERGNPLGISLGTMSITKVCGHVSVSHPPPVISWQGENQINGTRKRKYGRRPKVQL  738

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             +CP  + +  + F+++G P G C    +G+C   N+   VEKACLGK +C +PV    F+
Sbjct  739   RCPRGRKISSVLFSSFGTPSGDCETHAIGSCHASNSRATVEKACLGKERCSIPVSTKNFK  798

Query  2445  EGSKDLCPNLVHKTLAVQAKCG  2510
                 D CP +  K+L V AKC 
Sbjct  799   ---GDPCPGIA-KSLMVDAKCA  816



>gb|EYU31765.1| hypothetical protein MIMGU_mgv1a018569mg [Erythranthe guttata]
Length=817

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/801 (46%), Positives = 512/801 (64%), Gaps = 21/801 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +LF+GSIHYPR  P+MW  ++ ++K+GGL+ I TYVFWN+HEP  GQ++F G
Sbjct  33    LIINGQRKLLFSGSIHYPRSTPDMWHSLISKSKQGGLDAIDTYVFWNLHEPEPGQYDFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK +   G+YV LR+GPF+EAEW++GG P+WL +VP I FR+ NEPF  +M+ 
Sbjct  93    RRDIVRFIKEVQAQGLYVCLRIGPFIEAEWSYGGLPFWLHDVPGIVFRSDNEPFKYYMQN  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK  KLFA QGGPIIL+QIENEY ++E    A  +    Y+ WAA MA GL 
Sbjct  153   FTTKIVNMMKSEKLFASQGGPIILSQIENEYQNVEK---AFHETGPPYVRWAASMAAGLE  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +C +TF GPN  NKP++WTENWT  Y  +G+    R
Sbjct  210   TGVPWVMCKQDDAPDPVINACNGMRCAETFVGPNSPNKPAIWTENWTHFYDIYGNITKIR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAY +  F    NGS++ YYMY+GGTN+GR  ++F+ T YYD+ PLDE+GL R PK
Sbjct  270   SPEDIAYQVALFIVKMNGSFINYYMYHGGTNFGRNASAFIITSYYDQAPLDEYGLIRQPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSI  1193
             W HL++ HAA++L    L  G  +   L   QE   +  +N + CAAFL N +     +I
Sbjct  330   WGHLQELHAAVKLCSETLLNGVQSNFSLGVLQEAYVYTRENGE-CAAFLLNRDGEHGANI  388

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +FR   Y LP  S S+LPDCKT  FN+  + +Q   R   P+    + D+ WE + E IP
Sbjct  389   QFRNRTYQLPPKSISILPDCKTVAFNTAKVSTQFGTRTRQPAVKLDKADI-WEKWNEIIP  447

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               DN  I++   LE    TKD+SDY WY      +E   S        + V S GH L A
Sbjct  448   VFDNTSIRSNLLLEQMNTTKDSSDYLWYIASYNQTEESKSE-------ITVNSRGHLLRA  500

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG  +GS HG   ++  +++  + L  G NDI+LL V+ G P+SGA M++R +G + V
Sbjct  501   FVNGVQIGSGHGFFRNQGFTVKTTIPLTSGVNDISLLSVMVGLPDSGAHMERRASGLQSV  560

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFD  1910
             +IQ        +T +SW + VG+ GEKL+L+TEEG+ K  W  + ++   P+TWYK+ FD
Sbjct  561   SIQENKVFK-NLTISSWGYQVGLLGEKLQLYTEEGTNKAVWCDINSSSSQPLTWYKSKFD  619

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP G++P+AL + +M KG  WVNG+SIGRYW++FL+P G PSQ  YH+PR+F+KPK+NL+
Sbjct  620   APGGSDPLALNLGSMGKGEAWVNGQSIGRYWISFLNPDGSPSQIWYHVPRSFLKPKDNLL  679

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERK--GEELRQVVEDIRPSVRL  2264
             V+FEE+GG+P+ I +  V+   +C  ++D  P  + SW+R+       ++  + RP + L
Sbjct  680   VLFEEEGGNPTGISVDTVSITKVCGHITDSNPPPLISWKRETLSRNKSEIHHERRPKIHL  739

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
              CP  K + KI FA++G P G C ++ +G C   N+  IVEKACLGK +C VP     F 
Sbjct  740   HCPPKKYISKILFASFGSPFGDCESYSLGKCHSTNSTAIVEKACLGKKKCSVPWSNKRF-  798

Query  2445  EGSKDLCPNLVHKTLAVQAKC  2507
                 D CP  + K L ++A+C
Sbjct  799   --GGDPCPG-IRKNLLIEAQC  816



>ref|XP_011003960.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=818

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/801 (45%), Positives = 500/801 (62%), Gaps = 21/801 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R I+F+GSIHYPR  PEMWP ++ +AKEGGL+ I+TYVFWN HEP  G ++F G
Sbjct  34    LIINGQRKIVFSGSIHYPRSTPEMWPSLIAKAKEGGLDAIETYVFWNAHEPQPGHYDFSG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +D+V+FIK +   G+Y  LR+GPF+++EW++GG P+WL ++P I FR+ NEPF  HM+ 
Sbjct  94    GHDIVRFIKEVQAQGLYACLRIGPFIQSEWSYGGLPFWLHDIPGIVFRSDNEPFKVHMQN  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   +V MMK   L+A QGGPIIL+QIENEY +++    A  +    Y+ WAA MA GL 
Sbjct  154   FTAKVVSMMKSENLYASQGGPIILSQIENEYGTVQK---AYGQEGLAYVQWAAQMAEGLQ  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQN AP  VI++CNG +CG TF GPN  NKPS+WTENWT +YR +G+    R
Sbjct  211   TGVPWVMCKQNNAPGHVINSCNGMKCGQTFVGPNSPNKPSIWTENWTTRYRVYGEDAPIR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F   KNGS++ YYMY+GGTN+GRT ++FVTT YYD+ PLDE+GL   PK
Sbjct  271   SAEDIAFHVTLFIVAKNGSFVNYYMYHGGTNFGRTASAFVTTSYYDQAPLDEYGLTTQPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL++ HAA++L   PL  G      L   Q+   F N     CAAFL NN++    S+
Sbjct  331   WGHLKELHAAIQLCSTPLLSGVQVNFYLGPQQQAYIF-NAVSGECAAFLINNDSRNAASV  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FR   Y LP  S S+LPDCK   FN+  + +Q+ AR     ++    D+ W+ F E IP
Sbjct  390   PFRNASYDLPPMSISILPDCKNVAFNTAKVSTQYTARTMGRGEVLDAADM-WQEFTEAIP  448

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D+   ++   LE    TKD+SDY WY+ R++    D  T      +LDV S+GHAL A
Sbjct  449   NFDSTSTRSETLLEQMNTTKDSSDYLWYTLRLQHESSDTQT------ILDVSSLGHALHA  502

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VGS  G++ +        V L  G N+++LL V+ G P+SGA ++ R  G R V
Sbjct  503   FVNGQAVGSVQGSHKNPRFKFETSVSLSKGINNVSLLSVMVGMPDSGAFLENRAAGLRTV  562

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I+         T +SW + +G+ GE  +++TE+GS +V+WK  +    P+TWYKT  DA
Sbjct  563   MIRDKQDNN-DFTNDSWGYQIGLQGETSQIYTEQGSSQVRWKKFSVAGNPLTWYKTRVDA  621

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P G+ PVAL + +M KG  WVNG+SIGRYW ++ +P G  +Q  Y++PR+F+KP  NL+V
Sbjct  622   PPGDVPVALNLASMGKGEAWVNGRSIGRYWPSYRTPNGS-AQTWYNVPRSFLKPAGNLLV  680

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQ--VVEDIRPSVRLK  2267
             + EE+GG+P  + L  V+   +C  V+  +   V SW    +  +    V   RP V+L 
Sbjct  681   LQEEKGGNPLQVSLDTVSISQVCGHVTASHLAPVSSWTEHNQRYKNPAKVSGRRPKVQLA  740

Query  2268  CPEDKVVKKIEFANYGDPDGACGN-FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             CP    + +I FA+YG P G C N   VG C   N+  +VE+ACLGK +C +PV +  F 
Sbjct  741   CPSKSKISRISFASYGTPLGNCRNSLAVGTCHSQNSKAVVEEACLGKMKCSIPVSERRF-  799

Query  2445  EGSKDLCPNLVHKTLAVQAKC  2507
                 D CP    K+L V A+C
Sbjct  800   --GGDPCPAKA-KSLMVVAEC  817



>ref|XP_008466741.1| PREDICTED: beta-galactosidase 16 isoform X1 [Cucumis melo]
Length=850

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/828 (44%), Positives = 512/828 (62%), Gaps = 51/828 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++G   +LF+GSIHYPR  P+MWP ++ +AKEGG++VIQTYVFWN+HEP QG + F G
Sbjct  42    LIVNGEHKLLFSGSIHYPRSTPDMWPSLIAKAKEGGIDVIQTYVFWNLHEPQQGTYEFSG  101

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+F+K I   G+Y  LR+GPF+EAEW++GG P+WL +VP I +R+ NEPF  HM+ 
Sbjct  102   RRDIVQFVKEIQAQGLYACLRIGPFIEAEWSYGGLPFWLHDVPGIVYRSDNEPFKLHMQN  161

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK   L+A QGGPIIL+QIENEY+ +E+   A  +    Y+ WAA MA+ L 
Sbjct  162   FTTKIVNMMKSEGLYASQGGPIILSQIENEYTLVEA---AFGEKGPPYVQWAAKMAVSLQ  218

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQN+AP  VI+TCNG +CG+TF GPN   KPS+WTENWT+ Y+T+G+ P  R
Sbjct  219   TGVPWSMCKQNDAPDPVINTCNGMRCGETFTGPNSPTKPSIWTENWTSFYQTYGEEPYIR  278

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE IA+ +  F A KNG+Y+ YYMY+GGTN+GR+ ++F+ T YYD+GPLDE+GL R+PK
Sbjct  279   SAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQGPLDEYGLTREPK  338

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L   PL  GT     L  + E I F+ ++ + CAAFL N     T + 
Sbjct  339   WGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFKTESDE-CAAFLVNRGAIDTDVL  397

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F+   Y LP  S S+LPDCK   FN++ +  Q N R  +  +     + +WE F+E IP 
Sbjct  398   FQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTVQKFDSSE-EWEEFKEPIPN  456

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
              ++  ++  + LE    TKD SDY WY+ R++    D           +V S  HAL AF
Sbjct  457   FEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDSPDSQQ------TFEVDSRAHALHAF  510

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG++ GS HG   +K  SL   + L+ G N+I+LL V+ G P+SGA ++ R  G R V 
Sbjct  511   VNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGLPDSGAFLETRVAGLRRVG  570

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYK------  1898
             IQG        +   W + VG+SGE+ ++F + GS  V+W  + N   P+TWYK      
Sbjct  571   IQGED-----FSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKVLPIIN  625

Query  1899  -----------------------TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVA  2009
                                    T FDAP G++P+AL + +M KG  WVNG+ IGRYWV+
Sbjct  626   SNYLEFKCSRTDLCYCHSLLIGQTRFDAPPGDDPIALNLGSMGKGAAWVNGRGIGRYWVS  685

Query  2010  FLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPG  2189
             FL+P G+PSQ  Y++PR+F+KP +N +V+ EE+ G+P  I L  V     C  VS+ +  
Sbjct  686   FLTPKGEPSQKWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLITKTCGQVSESHYP  745

Query  2190  NVKSW-ERKGEELRQVVEDI-RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSF  2363
              V SW   K +++R       RP V+L CP  K +  I FA++G P G C ++ +G C  
Sbjct  746   LVASWMGAKKQKVRSAKNRTRRPKVQLSCPSKKKISNILFASFGTPSGDCQSYAIGMCHS  805

Query  2364  PNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             PN+  IVE ACLG+ +C +P+    FQ    D CP+ V KTL V A+C
Sbjct  806   PNSRPIVEHACLGRVKCSIPISSLNFQ---GDPCPH-VTKTLLVDAQC  849



>ref|XP_009385110.1| PREDICTED: beta-galactosidase 7 [Musa acuminata subsp. malaccensis]
Length=808

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/822 (45%), Positives = 513/822 (62%), Gaps = 54/822 (7%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEM---------------------WPDVLKRAKEGGLNV  233
               I+GTR +LF+GSIHYPR  PE+                     WP ++ +AKEGGL+V
Sbjct  15    LMINGTRRLLFSGSIHYPRSTPEVLFHRVLHLPSVSPLSFAPLNKWPYLIAKAKEGGLDV  74

Query  234   IQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWL  413
             IQTYVFWN+HEP+QGQ++F G  +LV+FIK +   G+YV+LR+GPF+++EW +GG P+WL
Sbjct  75    IQTYVFWNVHEPIQGQYDFRGRFNLVRFIKQVQAGGLYVSLRIGPFIQSEWKYGGLPFWL  134

Query  414   KEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRP  593
              +VP I FR+ NE F  HM+K+   IVDMMK  +LFA QGGPII+ QIENEY ++E+   
Sbjct  135   HDVPGIVFRSDNEAFKFHMQKYVTKIVDMMKSERLFASQGGPIIITQIENEYENVEA---  191

Query  594   ADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKP  773
             A  +    Y+ WAA MA+GL   +PW+MCKQ++AP  VI+TCNG +CG+TF GPN   KP
Sbjct  192   AFAERGPSYVRWAASMAVGLGTGVPWMMCKQSDAPDPVINTCNGMKCGETFLGPNSPKKP  251

Query  774   SMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASF  953
             S+WTENWT +Y+ +G+ P  RSAE+IA+++  F A KNGS++ YYMY+GGTN+G++ +S+
Sbjct  252   SLWTENWTQRYQVYGEDPRPRSAEDIAFAVALFIAKKNGSFVNYYMYHGGTNFGKSASSY  311

Query  954   VTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFEN  1133
             VTT YYD+ PLDE+GL   P W HLR+ HA ++L +  L  G  T   L   QE   F  
Sbjct  312   VTTSYYDQAPLDEYGLIWLPTWGHLRELHAVIKLCQEALLWGRYTYYSLAKLQEAHLFRT  371

Query  1134  QNLKLCAAFLTN-NNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRF  1310
              + K CAAFL N + +   ++ F    Y LP  S S+LPDCK  VFN+  + +++  R  
Sbjct  372   NSGK-CAAFLVNYDKSLVANLHFLDAIYELPAKSISILPDCKKTVFNTAKVSARYGERTA  430

Query  1311  VPSKLAGRDDLKWEMFQE--TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSER  1484
              P +   R   +WE   E   I    +L  K L  LE  + TKD +DY WY+T    S++
Sbjct  431   EPVQYLNRSQ-QWEASAEESNIAGKASLVAKGL--LEQMSTTKDVTDYLWYTTSYNHSQQ  487

Query  1485  DLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLL  1664
             D    G I   L V S+ H L  FVN E +G+ HG N  +     KP+ +K G N+I+LL
Sbjct  488   D----GQI--TLHVDSLAHVLHVFVNDELLGTVHGKNHGELPVFDKPIPVKGGQNNISLL  541

Query  1665  GVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQ  1844
              V+ G P+SGA ++KRF G +   IQG    +  +T   W + VG+ GEK+ ++TEEGS+
Sbjct  542   SVMVGLPDSGAYLEKRFAGIQHARIQGTGNLSRDLTHELWRYQVGLRGEKVLIYTEEGSK  601

Query  1845  KVKWKPVTN-VHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP  2021
             +  W PV +  + P+ WYKT FDAP G +PVAL + NM KG VW+NG+SIGRYW +F +P
Sbjct  602   QAVWNPVVSFANKPLIWYKTRFDAPRGTDPVALNLANMGKGEVWINGESIGRYWASFKAP  661

Query  2022  LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKS  2201
              G+PSQ  YH+PR+F+ P NNL+V+FEE GGDP SI +  ++   +C  V++ Y  +V S
Sbjct  662   SGKPSQSLYHVPRSFLNPSNNLLVLFEEMGGDPRSITVDTISVARVCGHVAESYYPSVFS  721

Query  2202  WERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKI  2381
                         E   P VRL C   + +  I FA++G P G C +  +G C    +  +
Sbjct  722   ------------ESKHPYVRLGCQRGRSISSIGFASFGTPVGNCKSHAMGGCHSVASRAV  769

Query  2382  VEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              EKACLGK +C +PV  S F+    D CP +  K+L V A+C
Sbjct  770   AEKACLGKEKCSIPVTTSRFR---GDPCPGIT-KSLLVVAEC  807



>ref|XP_008219605.1| PREDICTED: beta-galactosidase 16 [Prunus mume]
Length=814

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/802 (45%), Positives = 506/802 (63%), Gaps = 28/802 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  PEMWP +L +AKEGG++VIQTYVFWN+HEP QG+F+F G
Sbjct  35    LIIDGQHKILFSGSIHYPRSTPEMWPSLLAKAKEGGIDVIQTYVFWNLHEPRQGKFDFSG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D++ FI  +   G+YV LR+GPF+E+EW++GG P WL+++P I FR+ NEPF   M+K
Sbjct  95    RQDIISFITEVQKQGLYVCLRIGPFIESEWSYGGLPIWLRDIPDIVFRSDNEPFKTEMEK  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   +V MMK   L+A QGGPIIL+QIENEY  +E   PA  +    Y+ WAA MA+G  
Sbjct  155   FTTKMVAMMKAENLYASQGGPIILSQIENEYKMVE---PAFHERGPPYVRWAAAMAVGQQ  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI++CNG  CG+TF GPN  NKPS+WTENWT+QY+ +G  P  R
Sbjct  212   IGVPWVMCKQDDAPDPVINSCNGMNCGETFAGPNSPNKPSLWTENWTSQYQVYGGEPYIR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE IAY +  F A K GSY+ YYMY+GGT++GRT + FV T YYDE PLDE+G  R PK
Sbjct  272   SAEEIAYQVALFIAKKRGSYVNYYMYHGGTHFGRTASPFVVTSYYDEAPLDEYGSIRQPK  331

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L+   L  G  T   L   Q+   F+  + + CAAFL N      ++ 
Sbjct  332   WGHLKELHAAVKLASSALLSGEQTSIPLGQLQDAYVFKVLSGE-CAAFLVNKGPKHATVL  390

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETIP  1373
             F+ + Y LP  S S+LPDCK   FN+  + +QH  R + V  K    ++  WE ++E IP
Sbjct  391   FQESSYQLPPKSISILPDCKKVAFNTAKVSAQHATRSWQVAQKFDSAEN--WEEYKEAIP  448

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               +   ++     E  ++TKD SDY WY+   ++     ST       L V S GH L A
Sbjct  449   NFEKTTLRASTLPEQISITKDESDYLWYTFSFQYDSDAQST-------LSVKSHGHVLHA  501

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG F GS HG + +++ SL + V L  G N I+LL  + G P++GA ++++  G  +V
Sbjct  502   FVNGVFTGSAHGRHRNESFSLEQTVTLSKGINYISLLSAMVGLPDNGAYLERKVGGLHEV  561

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFD  1910
              ++         + +SW + VG+ GEKL++ ++ G  KV+W  + ++ H P+TWYK  FD
Sbjct  562   RVE-----DQDFSKSSWGYQVGLDGEKLQIHSDSGPSKVQWSKLGSSDHQPLTWYKILFD  616

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP G++ +AL + +M KG  WVNG+SIGR+WV+F +P G+PSQ  Y++PR+F+KP  NL+
Sbjct  617   APAGHDSIALNLGSMGKGEAWVNGQSIGRFWVSFQTPKGKPSQTWYNVPRSFLKPTGNLL  676

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW---ERKGEELRQVVEDIRPSVR  2261
             V+ EE+ GDP  I L  V+   +C  VS+ +   V  W   + + +   +     RP ++
Sbjct  677   VLLEEENGDPLGISLDKVSVTQVCGHVSETHLPPVSKWLVQKTQNKNNTKTKLGRRPKIQ  736

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             L CP  K + K+ F+++G+P G C  +  G+C   N+  IVE+ACLGK +C +PV    F
Sbjct  737   LSCPPKKSISKVLFSSFGNPSGDCKTYATGSCHSSNSKAIVEQACLGKRRCSIPVSLQKF  796

Query  2442  QEGSKDLCPNLVHKTLAVQAKC  2507
                  D CP+ + KTL V A+C
Sbjct  797   ----GDPCPS-ISKTLLVDAQC  813



>ref|XP_004292712.1| PREDICTED: beta-galactosidase 16-like [Fragaria vesca subsp. 
vesca]
Length=813

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/803 (44%), Positives = 514/803 (64%), Gaps = 28/803 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  P+MWP ++ +AKEGG++VIQTYVFWN+HEP +GQF F G
Sbjct  34    LIIDGQHKILFSGSIHYPRSTPQMWPSLIAKAKEGGIDVIQTYVFWNLHEPQKGQFVFNG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +D+V F+K +   G+YV LR+GPF+E+EW +GGFP WL+ +P I FR+ NEP+   M++
Sbjct  94    RSDIVAFMKEVHRQGLYVCLRIGPFIESEWTYGGFPVWLRNIPGIVFRSDNEPYKAEMQR  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IVD+MK  +L+A QGGPIIL+QIENEY ++ES   A  +    Y+ WAA MA G  
Sbjct  154   FTAKIVDLMKSNELYASQGGPIILSQIENEYKNVES---AFHERGPPYVLWAASMAEGFQ  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN  NKP++WTE+WT+QY+ +GD P  R
Sbjct  211   TGVPWVMCKQDDAPGAVINACNGMKCGETFAGPNAPNKPAIWTEDWTSQYQVYGDEPYLR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE+IAY +  F A   GSY+ YYMY+GGTN+GRT + FVTT YYDE PLDE+G+  +PK
Sbjct  271   RAEDIAYHVALFIAKNKGSYVNYYMYHGGTNFGRTASEFVTTSYYDEAPLDEYGMPNEPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             +SHL++ HAA++LS  PL  G  T+  L  +Q    ++ ++ + CAAFL NN +    ++
Sbjct  331   YSHLKELHAAVKLSISPLLAGEQTVVNLGQSQTAYVYKVKSGE-CAAFLVNNGSKDAIVQ  389

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F+ + Y L   S S+LPDCK+  FN+  + +QH  R + P++        W+ + E IPT
Sbjct  390   FQNSPYQLYPKSISILPDCKSVAFNTGKVSAQHATRSWTPTQKFDSHQ-NWQEYNEPIPT  448

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
              DN  ++    ++    T D SDY WY+   +    +  +       L+V + GH L +F
Sbjct  449   YDNTSLRQNIIVDQMRTTNDLSDYLWYTFSFQHDSPNPES------TLNVQTHGHVLHSF  502

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG  VGS HG + +   +L   V+L  G N ++LL  + G P++GA +++R  G   V 
Sbjct  503   VNGVLVGSGHGVHRNAGFALESKVNLNKGINHVSLLSAMVGLPDNGAYLERRDYGLHSVK  562

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             I G    T      +W + VG+SGE L+++T+  + KV+W  +++   P+TWYKT FDAP
Sbjct  563   IDGKDFSTY-----AWGYQVGLSGENLQIYTD--TSKVQWHRLSSTKHPMTWYKTLFDAP  615

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
              GN+PVAL + +M KG VW+NG+SIGRYWV+F +P G PSQ  YH+PR+F+KP  NL+V+
Sbjct  616   AGNDPVALNLGSMGKGEVWINGQSIGRYWVSFHTPKGTPSQTWYHVPRSFLKPTGNLLVL  675

Query  2097  FEEQGG-DPSSIELVLVNRDTICSSVSDYYPGNVKSW--ERKGEELRQVVED--IRPSVR  2261
              EE+ G DP  I L  ++   +C+ VS+ +   V +W  +R    L    ++   +P+ +
Sbjct  676   IEEETGVDPVKISLDRISVAKVCALVSETHLHPVSTWMYQRTSGNLNNTRQNPGRKPTAK  735

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             L+CP +  + KI +A+YG+P G C  +  G+C   ++  +V+KACLGK +C V V    F
Sbjct  736   LRCPPNSYISKILYASYGNPSGDCKTYAAGSCHSEDSTAVVQKACLGKRRCSVSVSSEKF  795

Query  2442  QEGSKDLCPNLVHKTLAVQAKCG  2510
                  D CP  + KTL V A+C 
Sbjct  796   ----GDPCPR-ISKTLLVDAQCA  813



>ref|XP_010664184.1| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
Length=817

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/831 (45%), Positives = 519/831 (62%), Gaps = 34/831 (4%)
 Frame = +3

Query  60    LRAWWWVTMARR*RMIVDL-----------FFIDGTRDILFAGSIHYPRMPPEMWPDVLK  206
             +  WWW   A     +  +             I+G R ILF+GSIHYPR  PEMWP ++ 
Sbjct  5     MGCWWWWWFAVLSSAVASVCGGEVTYDGRSLIINGQRKILFSGSIHYPRSTPEMWPSLIS  64

Query  207   RAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEW  386
             +AK+GG++VI+TYVFWN HEP  GQ++F G  D+V+FI+ +   G+Y  LR+GPF++AEW
Sbjct  65    QAKQGGIDVIETYVFWNQHEPKPGQYDFSGRRDIVRFIREVQAQGLYACLRIGPFIQAEW  124

Query  387   NFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENE  566
             N+GGFP+WL +VP I +RT NEPF  +M+ F   IV++MK   L+A QGGPIIL QIENE
Sbjct  125   NYGGFPFWLHDVPGIVYRTDNEPFKFYMRNFTTKIVEIMKSENLYASQGGPIILQQIENE  184

Query  567   YSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTF  746
             Y ++E++     +  K+Y+ WAA+MA+GL   +PW+MCKQ++AP  VI++CNGR CG+TF
Sbjct  185   YKTVEANFG---EAGKRYVLWAANMAVGLETGVPWVMCKQDDAPDPVINSCNGRLCGETF  241

Query  747   HGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggt  926
              GPN  NKP++WTENWT+ Y  FG+    R  E+IA+ +  F A  NGS++ YYMY+GGT
Sbjct  242   AGPNSPNKPAIWTENWTSSYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGT  301

Query  927   nygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPN  1106
             N+GRT +++V T YYDE PLDE+GL + P W HL++ HAA++L    L  G  +   L  
Sbjct  302   NFGRTASAYVQTAYYDEAPLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGT  361

Query  1107  N-QEIITFENQNLKLCAAFLTNNNT-TPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQN  1280
               QE   F  Q+ K CAAFL NN++ T  ++ F+ T Y LP  S S+LPDCK   FN+  
Sbjct  362   KLQEAYVFRGQSGK-CAAFLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAK  420

Query  1281  IVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYS  1460
             I +Q N R  + +        +WE ++E+I   D+   +    LE    TKD SDY WY+
Sbjct  421   ISTQQNTRS-IQTVTKFNSTEQWEEYKESILNFDDTSSRANTLLEHMNTTKDASDYLWYT  479

Query  1461  TRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKP  1640
              R      +  +      VL   S  HAL AF+NG   GS+HG++ + + SL   V  + 
Sbjct  480   FRYNNDPSNGQS------VLSTNSRAHALHAFINGRHTGSQHGSSSNLSFSLDNTVSFRA  533

Query  1641  GNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLV-VTFNSWSHSVGVSGEKL  1817
             G N+++LL V+ G P+SGA +++R  G R V IQ    G+L   T N W + VG+ GEKL
Sbjct  534   GINNVSLLSVMVGLPDSGAYLERRVAGLRRVRIQS--NGSLKDFTNNPWGYQVGLLGEKL  591

Query  1818  KLFTEEGSQKVKW-KPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIG  1994
             +++T+ GSQKV+W K  ++    +TWYKT FDAP GN PVAL + +M KG VWVNG+SIG
Sbjct  592   QIYTDVGSQKVQWSKFGSSTSGLLTWYKTVFDAPAGNEPVALNLVSMRKGEVWVNGQSIG  651

Query  1995  RYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVS  2174
             RYWV+FL+P G+PSQ  YHIPR+F+KP  NL+V+ EE+ G P  I +  V+   IC  VS
Sbjct  652   RYWVSFLTPSGKPSQIWYHIPRSFLKPTGNLLVLLEEETGHPVGISIGKVSIPKICGHVS  711

Query  2175  DYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGN  2354
             + +   V S  R   +  +     RP V+L+CP ++ + +I FA++G P G C ++ VG+
Sbjct  712   ESHLPPVIS--RVIYKKHENHHGRRPKVQLRCPSNRNISRILFASFGTPSGDCQSYAVGS  769

Query  2355  CSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             C   N+   VEKACLGK  C VP+    F     D CP    K L V  +C
Sbjct  770   CHSSNSRSNVEKACLGKGMCSVPLSYKRF---GGDPCPG-TPKALLVDVQC  816



>ref|XP_011069386.1| PREDICTED: beta-galactosidase 16 [Sesamum indicum]
Length=810

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/799 (45%), Positives = 500/799 (63%), Gaps = 21/799 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R +LF+GSIHYPR  P MWP ++ +AK GGL+ I TYVFWN+HEP  GQ++F G
Sbjct  30    LIVDGQRKLLFSGSIHYPRSTPHMWPSLISKAKAGGLDAIDTYVFWNLHEPQPGQYDFSG  89

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK +   G+YV LR+GPF+E+EW++GG P+WL +VP I FR+ NEPF  +M+ 
Sbjct  90    RRDIVRFIKEVEAQGLYVCLRIGPFIESEWSYGGLPFWLHDVPDIVFRSDNEPFKFYMQN  149

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IVDMMK  +L+A QGGPI+L+QIENEY ++E    A       Y++WAA MA+GL 
Sbjct  150   FTTKIVDMMKSERLYASQGGPILLSQIENEYQNVEK---AFHDKGPPYVHWAAAMAVGLE  206

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN  NKP++WTENWT  Y  +G+    R
Sbjct  207   TGVPWVMCKQDDAPDPVINACNGMRCGETFVGPNSPNKPAIWTENWTHFYDIYGNKTKIR  266

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA++IAY +  F    NGSY+ YYMY+GGTN+GR  +SFV T YYD+ PLDE+GL R PK
Sbjct  267   SAQDIAYQVALFIVKMNGSYINYYMYHGGTNFGRMASSFVITSYYDQAPLDEYGLTRQPK  326

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSI  1193
             W HL++ HAA++L    L  G  +   L   QE   +   N + CAAFL N +      +
Sbjct  327   WGHLKELHAAVKLCSDTLLYGQQSNFSLGALQEAYVYSRDN-RECAAFLFNMDKVNDAEV  385

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK-WEMFQETI  1370
             +F    + LP  S S+LPDC    FN+  + +Q + R     K  G D  + W+ + E I
Sbjct  386   QFLNRTFQLPAKSISILPDCTNVAFNTAKVSTQMSTRS--TQKAVGLDSPEIWKEWNEAI  443

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P  D+  +++   LE    TKD SDY WY+T  + SE       D   V+ V S GH L 
Sbjct  444   PAFDDSLLRSDSLLEQMNTTKDASDYLWYTTSYQQSE-------DSQSVITVNSRGHVLH  496

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              FVNG  VGS HG   +++ +L   V L  G N+I+LL  + G P+SGA +++R  G   
Sbjct  497   TFVNGALVGSAHGAFRNQSFTLETTVPLNSGLNNISLLSNMVGLPDSGAFLERRAAGLHT  556

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTIQ       +  + SW + VG+ GE+L+  TEEGS   +W    +   P+TWYK+ FD
Sbjct  557   VTIQENQVVKNLTNY-SWGYQVGLLGERLQFHTEEGSSHAQWLNFNSSSQPLTWYKSKFD  615

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+PVAL + +M KG  W+NG+SIGRYW++F +P G PSQ  YHIPR+F+KP +NL+
Sbjct  616   APGGNDPVALNLGSMGKGEAWINGESIGRYWISFHTPDGSPSQIWYHIPRSFLKPTDNLL  675

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+FEE+ G+P  I + +V+   +C  VSD  P  V SW R+     +     RP V+L+C
Sbjct  676   VLFEEEIGNPLGISVDIVSISKVCGHVSDSNPPPVVSWRREMPSHNK-HHGRRPKVQLRC  734

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P ++ + KI FA++G P G C ++ VG+C   N+  +VEKACLGK  C +P     F   
Sbjct  735   PSERNISKILFASFGSPSGDCKSYAVGSCHSTNSMAVVEKACLGKKMCSIPWSNKKF---  791

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
               D CP  + K L ++A+C
Sbjct  792   GGDPCPG-IPKRLLIEAEC  809



>ref|XP_004961993.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Setaria italica]
Length=822

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/803 (46%), Positives = 508/803 (63%), Gaps = 32/803 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++GTR +LF+G +HYPR  PEMWP ++ +AKEGGL+VIQTYVFWN+HEPVQGQ+NFEG
Sbjct  47    LVLNGTRRMLFSGEMHYPRSTPEMWPRLIAKAKEGGLDVIQTYVFWNVHEPVQGQYNFEG  106

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK I   G+YV+LR+GPF+EAEW +GGFP+WL +VP I FR+ NEPF  HM++
Sbjct  107   RYDLVKFIKEIQAQGLYVSLRIGPFIEAEWKYGGFPFWLHDVPNITFRSDNEPFKQHMQR  166

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MMK   L+ PQGGPII +QIENEY  +E   PA     ++Y+ WAA MA+ L 
Sbjct  167   FVTDIVSMMKHEGLYYPQGGPIITSQIENEYQMVE---PAFGSSGQRYVRWAAAMAVNLQ  223

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW MCKQN+AP  VI+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G+    R
Sbjct  224   TGVPWTMCKQNDAPDPVINTCNGLICGETFVGPNSANKPALWTENWTSRYLIYGNDTKLR  283

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+++  F A KNGSY+ YYMY+GGTN+GR ++S+VTT YYD  PLDE+GL   P 
Sbjct  284   SPEDIAFAVALFIARKNGSYMSYYMYHGGTNFGRFSSSYVTTNYYDGAPLDEYGLIWQPT  343

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             W HLR+ H A++ S  PL  GT +   L   QE   FE ++   C AFL N +    S +
Sbjct  344   WGHLRELHTAVKQSSEPLLFGTYSNFSLGQEQEAHIFETES--QCVAFLVNFDQHQISEV  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK-WEMFQETI  1370
              FR     L   S S+L DCK  VF +  + +QH +R     ++    D+  W+ F+E I
Sbjct  402   VFRNISLQLAPKSISILSDCKRVVFETAKVNAQHGSR--TAEEVQSFSDINTWKAFKEPI  459

Query  1371  PT-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             P  +        +  +  + TKD +DY WY    E++  D       L +++V S  H L
Sbjct  460   PQDVSKAMYTGNQLFDHLSTTKDETDYLWYIVGYEYTPSDDGQ----LVLINVESRAHIL  515

Query  1548  VAFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
              AFVN  +VG  HG++D  A + L   + L  G N+I+LL  + G P+SGA M++R  G 
Sbjct  516   HAFVNNAYVGRIHGSHDGPASIILSTNISLNEGPNNISLLSAMVGSPDSGAHMERRVFGI  575

Query  1725  RDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV-HPPVTWYKT  1901
             R V+IQ       ++    W + VG+ GE+  ++T+EGS+ V+W  + N+ + P+ WYKT
Sbjct  576   RKVSIQQGQEPEHLLDNELWGNQVGLFGERNHIYTQEGSKSVEWTTINNLAYSPLIWYKT  635

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKN  2081
              F  P GN+ +AL + +M KG VW+NG+SIGRYWV+F +P G PSQ  YHIPR F+ P++
Sbjct  636   TFPTPAGNDAIALNLTSMGKGEVWINGESIGRYWVSFKAPSGNPSQSLYHIPRQFLNPQD  695

Query  2082  NLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVR  2261
             N++V+FEE GGDP  I +  V+   +CS+V++    +++S            +D  P+V 
Sbjct  696   NILVLFEEMGGDPQQITVNTVSVTRVCSNVNELSAPSLQS------------QDNEPAVN  743

Query  2262  LKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLF  2441
             L C E K +  IEFA+YG+P G C N+  G+C   +++ +V++ACLGKS C +PV    F
Sbjct  744   LWCQEGKQISAIEFASYGNPVGDCTNYGSGSCHAGSSDSVVKQACLGKSGCSIPVTTDKF  803

Query  2442  QEGSKDLCPNLVHKTLAVQAKCG  2510
                  D CP  + K+L V A CG
Sbjct  804   ---GGDPCPG-IQKSLVVVASCG  822



>ref|XP_002521778.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF40588.1| beta-galactosidase, putative [Ricinus communis]
Length=828

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/813 (45%), Positives = 501/813 (62%), Gaps = 32/813 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R +LF+GSIHYPR  PEMW  ++ +AKEGGL+VI TYVFWN+HEP  GQ++F G
Sbjct  31    LIVDGQRKLLFSGSIHYPRSTPEMWQSLIAKAKEGGLDVIDTYVFWNLHEPQPGQYDFSG  90

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK +   G+YV LR+GPF++ EW++GG P+WL ++P I FR+ NEPF   M+ 
Sbjct  91    RRDIVRFIKEVQAQGLYVCLRIGPFIQGEWSYGGLPFWLHDIPGIVFRSDNEPFKVQMQG  150

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MM+  KL+  QGGPIIL+QIENEY ++E    A  +    Y+ WAA MA+GL 
Sbjct  151   FTTKIVTMMQSEKLYVSQGGPIILSQIENEYGTVEE---AYHEKGPAYVKWAAQMAVGLN  207

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQN+AP  VI+ CNG +C +TF GPN  NKP++WTENWT +Y   G+    R
Sbjct  208   TGVPWVMCKQNDAPDPVINACNGLRCAETFVGPNSPNKPAIWTENWTTRYVITGENIRIR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IA+ + +F   K GS++ YYMY+GGTN+GRT ++FV T YYD+ P+DE+GL R PK
Sbjct  268   SVEDIAFQVTQFIVAKKGSFVNYYMYHGGTNFGRTASAFVPTSYYDQAPIDEYGLIRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             W HL++ HAA++L   PL  G      L   Q+   F   + + CAAFL NN+T  T S+
Sbjct  328   WGHLKEMHAAIKLCLTPLLSGGQVTISLGQQQQAFVFTGLSGE-CAAFLLNNDTANTASV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +FR   Y LP  S S+LPDCKT  FN+  + +Q+  R    SKL   +D KW  +QE I 
Sbjct  387   QFRNASYDLPPNSISILPDCKTVAFNTAKVSTQYTTRSMTRSKLLDGED-KWVQYQEAIV  445

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D   +K+   LE  + TKD SDY WY+ R +          D   VL+V S+GH L A
Sbjct  446   NFDETSVKSEAILEQMSTTKDASDYLWYTFRFQ------QESSDTQAVLNVRSLGHVLHA  499

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VG   G++ +   +L+  V L  G N+++LL V+ G P+SGA M++R  G R V
Sbjct  500   FVNGQAVGYAQGSHKNPQFTLQSTVSLSEGVNNVSLLSVMVGMPDSGAYMERRAAGLRKV  559

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT-NVHPPVTWYKTYFD  1910
              IQ    G    T  SW + VG+ GEKL++FT++GS +V+W   + N   P+TWYKT FD
Sbjct  560   KIQE-KEGNKEFTNYSWGYQVGLLGEKLQIFTDQGSSQVQWANFSKNALNPLTWYKTLFD  618

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPS-------------QGEYH  2051
             AP  + PVAL + +M KG  WVNG+SIGRYW ++ +  G                   Y+
Sbjct  619   APLEDAPVALNLGSMGKGEAWVNGQSIGRYWPSYRASDGSSQIWYAYFNTGAIFRAVRYN  678

Query  2052  IPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQ  2231
             +PR+F+KPK NL+VV EE GG+P  I +   +   ICS V+  +   V SW ++      
Sbjct  679   VPRSFLKPKGNLLVVLEESGGNPLQISVDTASISKICSHVTASHLPLVSSWSKRTNTDNN  738

Query  2232  VVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGN-FIVGNCSFPNANKIVEKACLGKS  2408
                  RP V+L CP +  +  I FA+YG P+G CG+ + VG C   ++  IV+KACLG+ 
Sbjct  739   NSLQARPRVKLDCPSNTKISNILFASYGTPEGTCGDAYAVGMCHSSSSEAIVQKACLGQM  798

Query  2409  QCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +C +PV    F     D C +   K+L V A+C
Sbjct  799   RCSIPVSSKYF---GGDPC-SANEKSLLVVAEC  827



>ref|XP_007019138.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY16363.1| Beta-galactosidase [Theobroma cacao]
Length=805

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/799 (45%), Positives = 497/799 (62%), Gaps = 27/799 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   +LF+GSIHYPR  PEMWP ++ +AK+GG++VIQTYVFWN+HE  QGQ++F G
Sbjct  31    LIIDGQHKVLFSGSIHYPRSTPEMWPSLIAKAKQGGIDVIQTYVFWNLHESQQGQYDFSG  90

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+FIK +   G+YV LR+GPF+++EW +GG P+WL +VP I FR+ N PF  HM+K
Sbjct  91    RRDIVRFIKDVQAHGLYVCLRIGPFIQSEWTYGGLPFWLHDVPGIVFRSDNGPFKYHMQK  150

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   +V+MMK  +L+A QGGPIIL+QIENEY  IES  P +     +Y++WAA MA+GL 
Sbjct  151   WVTKVVNMMKSERLYASQGGPIILSQIENEYQRIESAFPDEKG--SRYVHWAAGMAVGLK  208

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMC Q +AP  VI+ CNG QCG  F GPN  NKPSMWTENWT+  + +G     R
Sbjct  209   TGVPWIMCSQQDAPDPVINACNGFQCGVKFEGPNSPNKPSMWTENWTSFLQRYGQEVFLR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA +IA+ +  F A KNGSY+ YYMY+GGTN+GRT A+++ T YYD+ PLDE+GL R P 
Sbjct  269   SATDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAYIITSYYDQAPLDEYGLIRQPL  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSI  1193
             W HL++ HAA+RL  +PL  G          Q+   F+ ++   CAAFL N +NTT   +
Sbjct  328   WGHLKELHAAIRLCTKPLLSGAYETYSSGKLQDAYVFKGKSSGDCAAFLVNSDNTTNARV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETI  1370
             +F+   + LP  S S+LPDCK   FN+  + +Q+N R   V  K       +WE ++E I
Sbjct  388   RFQNVSFELPPMSISILPDCKNVAFNTAKVSTQYNTRSMTVRHKFDSTG--RWEEYKEPI  445

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             PT     ++    L+  + TKDTSD+ WY+   +          D   VL V S  H L 
Sbjct  446   PTFSKTKLRAKNLLDHMSTTKDTSDHLWYTLSFQLDS-------DAQAVLSVTSDAHVLH  498

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             +FVNG + G  +G    K   L   V L  G N+I+LL V+ GFP+SGA ++ +  G + 
Sbjct  499   SFVNGAYTGYAYGGK--KNFELNNTVHLNNGTNNISLLSVMVGFPDSGAYLEHKTAGIQS  556

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             VTIQ             W + VG+SGE  ++FTE GS KV+W     +H  +TWYKT FD
Sbjct  557   VTIQNEDLNNY-----QWGYQVGLSGESSRIFTEHGSNKVQWNRFHGIHHRLTWYKTLFD  611

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+P+AL + +M KG VWVNG+SIGRYWV+  +P  +PSQ  Y+IPR F+KP  NL+
Sbjct  612   APGGNDPLALNLGSMGKGEVWVNGQSIGRYWVSLHTPELRPSQTWYNIPRPFLKPTGNLL  671

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+ EE+ GDP  I L  ++   +C  VS+ +   V   +      + +    RP V+L C
Sbjct  672   VLLEEEYGDPLRITLGSISISKVCGHVSESHLPPVMQSQSGVNYNKDLAR--RPKVQLHC  729

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P ++ + +I FA++G P G C N+ +GNC   ++  IVEKACLGK +C + +    F   
Sbjct  730   PPERNISRILFASFGTPSGDCNNYAIGNCHLSSSRAIVEKACLGKKKCSIRLPDQAF---  786

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
              +D CP  + KTL + A+C
Sbjct  787   GRDPCPG-IPKTLLIDAQC  804



>ref|XP_006351205.1| PREDICTED: beta-galactosidase 16-like [Solanum tuberosum]
Length=813

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/800 (44%), Positives = 496/800 (62%), Gaps = 26/800 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R +LF+GSIHYPR  P+MWP ++ +AK+GG++VI+TYVFWN+HEP  GQ++F G
Sbjct  36    LIIDGQRKMLFSGSIHYPRSTPDMWPSLISKAKQGGIDVIETYVFWNLHEPQPGQYDFSG  95

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V FIK I   G+Y  LR+GP++EAEW +GGFP+WL +VP I +R+ NEPF  +M+ 
Sbjct  96    RRDIVAFIKQIQAQGLYACLRIGPYIEAEWTYGGFPFWLHDVPGIVYRSDNEPFKFYMQN  155

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK   L+A QGGPIIL+QIENEY + E            Y+ WAA MA+ L 
Sbjct  156   FTTKIVNLMKSEGLYASQGGPIILSQIENEYQNKEKSFGEK---GPPYVLWAAKMAVELE  212

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ++AP  +I+TCNGR CG+TF GPN  NKPS+WTENWT+ Y+ +G+    R
Sbjct  213   TGVPWIMCKQDDAPDPIINTCNGRACGETFKGPNSPNKPSIWTENWTSFYQVYGENAKYR  272

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE +AY +  F A KNG+Y+ YYMY+GGTN+GR+ A F+ T YYD+ PLDE+GL   PK
Sbjct  273   SAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMITGYYDQAPLDEYGLISQPK  332

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT--PTS  1190
             W H ++ HAA++L    +    PT+  L   QE   +   +   C+A L N + +    +
Sbjct  333   WGHFKELHAAVKLCSENILSTFPTMHSLGPLQEAYVYGEDSGTKCSALLVNTDHSNRNVT  392

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL-KWEMFQET  1367
             ++FR   Y LP  S S+L DCKT VFN+  + +Q N R   P+ +   D   KWE F E 
Sbjct  393   VQFRNLTYQLPPKSISILHDCKTVVFNTAKVSTQFNTR--TPTTVFKFDRAEKWEQFHEI  450

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             IP  D   +++   LE    TKD SDY WY+T +E    +   +      L V S+GH L
Sbjct  451   IPRFDATTLRSQTLLEQTNTTKDVSDYLWYTTSLEQESEEQQVK------LSVKSLGHVL  504

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
              AFVNG  VG  HG     +  +   + L  G N+I+ L    G PNSGA +++R  G  
Sbjct  505   HAFVNGHLVGYGHGQFRKTSFLVESTISLNKGKNEISFLSATIGLPNSGAFLERRSLGVH  564

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYF  1907
              V IQ    G    T  SW + VG+ GEKL++++ E ++ V W  + +    +TWYK+ F
Sbjct  565   SVMIQNDNRGLKNFTDFSWGYQVGLLGEKLQIYSSERTKSVNWSKLGSSKLQLTWYKSIF  624

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             DAP+G++PV L + +M KG  WVNG+SIGR+W++F +P G PSQ  Y++PR+F+KPK+N+
Sbjct  625   DAPKGDDPVTLNLGSMGKGEAWVNGQSIGRFWLSFHTPQGVPSQTWYNVPRSFLKPKDNV  684

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +V+FEE+ G+P  I +  ++   +C  V++  P  + SW + G         IRP V+L 
Sbjct  685   LVLFEEEIGNPLGITIDTISITKVCGHVTNSNPPPLNSWRKHGR--------IRPKVQLS  736

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CP  + + KI FA++G+P G C ++ +G C   N+  IVEKACLGKS+C +      F  
Sbjct  737   CPPRRKISKILFASFGNPIGDCDDYDIGLCHSSNSKAIVEKACLGKSKCTIAHSSKKF--  794

Query  2448  GSKDLCPNLVHKTLAVQAKC  2507
                D CP  + K+L V  +C
Sbjct  795   -GGDPCPG-ISKSLLVDVQC  812



>ref|XP_002284529.2| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
 emb|CBI18991.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/799 (45%), Positives = 505/799 (63%), Gaps = 19/799 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +LF+GSIHYPR  PEMWP ++ +AKEGG++VI+TY FWN HEP QGQ++F G
Sbjct  39    LIINGQRRLLFSGSIHYPRSTPEMWPSLISKAKEGGIDVIETYAFWNQHEPKQGQYDFSG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKF K +   G+Y  LR+GPF+E+EWN+GG P+WL +VP I +R+ NEPF  +M+ 
Sbjct  99    RLDIVKFFKEVQAQGLYACLRIGPFIESEWNYGGLPFWLHDVPGIIYRSDNEPFKFYMQN  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK   L+A QGGPIIL+QIENEY ++E+   A  +    Y+ WAA MA+ L 
Sbjct  159   FTTKIVNLMKSENLYASQGGPIILSQIENEYKNVEA---AFHEKGPPYVRWAAKMAVDLQ  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNG +CG+TF GPN  NKP++WTENWT+ Y  +G+    R
Sbjct  216   TGVPWVMCKQDDAPDPVINACNGMKCGETFAGPNKPNKPAIWTENWTSVYEVYGEDKRGR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +AE++A+ +  F A KNGS++ YYMY+GGTN+GRT++S+V T YYD+ PLDE+GL R PK
Sbjct  276   AAEDLAFQVALFIAKKNGSFINYYMYHGGTNFGRTSSSYVLTAYYDQAPLDEYGLIRQPK  335

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTP-TSI  1193
             W HL++ HA ++L    L  G      L   QE   F+  + + CAAFL NN+     ++
Sbjct  336   WGHLKELHAVIKLCSDTLLHGVQYNYSLGQLQEAYLFKRPSGQ-CAAFLVNNDKRRNVTV  394

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+ T Y L   S S+LPDCK   FN+  + +Q N R  V ++       +W  ++E IP
Sbjct  395   LFQNTNYELAANSISILPDCKKIAFNTAKVSTQFNTRS-VQTRATFGSTKQWSEYREGIP  453

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +    P+K    LE    TKD SDY WY+ R       +    +  PVL V S+ H L A
Sbjct  454   SFGGTPLKASMLLEHMGTTKDASDYLWYTLRF------IQNSSNAQPVLRVDSLAHVLHA  507

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+++ S HG++ + + SL   V L  G N I+LL V+ G P++G  ++ +  G R V
Sbjct  508   FVNGKYIASAHGSHQNGSFSLVNKVPLNSGLNRISLLSVMVGLPDAGPYLEHKVAGIRRV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFD  1910
              IQ     +   + + W + VG+ GEK +++T  GSQKV+W  + ++   P+TWYKT FD
Sbjct  568   EIQD-GGDSKDFSKHPWGYQVGLMGEKSQIYTSPGSQKVQWHGLGSHGRGPLTWYKTLFD  626

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+PV L   +M KG  WVNG+SIGRYWV++L+P G+PSQ  Y++PRAF+ PK NL+
Sbjct  627   APPGNDPVVLFFGSMGKGEAWVNGQSIGRYWVSYLTPSGEPSQTWYNVPRAFLNPKGNLL  686

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             VV EE+ GDP  I +  V+   +C  V+D +P  + SW    ++  +      P V+L+C
Sbjct  687   VVQEEESGDPLKISIGTVSVTNVCGHVTDSHPPPIISWTTS-DDGNESHHGKIPKVQLRC  745

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P    + KI FA++G P G C ++ +G+C  PN+  + EKACLGK+ C +P     F + 
Sbjct  746   PPSSNISKITFASFGTPVGGCESYAIGSCHSPNSLAVAEKACLGKNMCSIPHSLKSFGD-  804

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
               D CP    K L V A+C
Sbjct  805   --DPCPG-TPKALLVAAQC  820



>emb|CBI18990.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/837 (44%), Positives = 519/837 (62%), Gaps = 46/837 (5%)
 Frame = +3

Query  60    LRAWWWVTMARR*RMIVDL-----------FFIDGTRDILFAGSIHYPRMPPEMWPDVLK  206
             +  WWW   A     +  +             I+G R ILF+GSIHYPR  PEMWP ++ 
Sbjct  5     MGCWWWWWFAVLSSAVASVCGGEVTYDGRSLIINGQRKILFSGSIHYPRSTPEMWPSLIS  64

Query  207   RAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEW  386
             +AK+GG++VI+TYVFWN HEP  GQ++F G  D+V+FI+ +   G+Y  LR+GPF++AEW
Sbjct  65    QAKQGGIDVIETYVFWNQHEPKPGQYDFSGRRDIVRFIREVQAQGLYACLRIGPFIQAEW  124

Query  387   NFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENE  566
             N+GGFP+WL +VP I +RT NEPF  +M+ F   IV++MK   L+A QGGPIIL QIENE
Sbjct  125   NYGGFPFWLHDVPGIVYRTDNEPFKFYMRNFTTKIVEIMKSENLYASQGGPIILQQIENE  184

Query  567   YSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTF  746
             Y ++E++     +  K+Y+ WAA+MA+GL   +PW+MCKQ++AP  VI++CNGR CG+TF
Sbjct  185   YKTVEANFG---EAGKRYVLWAANMAVGLETGVPWVMCKQDDAPDPVINSCNGRLCGETF  241

Query  747   HGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggt  926
              GPN  NKP++WTENWT+ Y  FG+    R  E+IA+ +  F A  NGS++ YYMY+GGT
Sbjct  242   AGPNSPNKPAIWTENWTSSYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGT  301

Query  927   nygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPN  1106
             N+GRT +++V T YYDE PLDE+GL + P W HL++ HAA++L    L  G  +   L  
Sbjct  302   NFGRTASAYVQTAYYDEAPLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGT  361

Query  1107  N-QEIITFENQNLKLCAAFLTNNNT-TPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQ-  1277
               QE   F  Q+ K CAAFL NN++ T  ++ F+ T Y LP  S S+LPDCK   FN+  
Sbjct  362   KLQEAYVFRGQSGK-CAAFLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAK  420

Query  1278  -----NIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTS  1442
                   ++S     +F  ++       +WE ++E+I   D+   +    LE    TKD S
Sbjct  421   ASFRPGLISIQTVTKFNSTE-------QWEEYKESILNFDDTSSRANTLLEHMNTTKDAS  473

Query  1443  DYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRK  1622
             DY WY+ R      +  +      VL   S  HAL AF+NG   GS+HG++ + + SL  
Sbjct  474   DYLWYTFRYNNDPSNGQS------VLSTNSRAHALHAFINGRHTGSQHGSSSNLSFSLDN  527

Query  1623  PVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLV-VTFNSWSHSVG  1799
              V  + G N+++LL V+ G P+SGA +++R  G R V IQ    G+L   T N W + VG
Sbjct  528   TVSFRAGINNVSLLSVMVGLPDSGAYLERRVAGLRRVRIQS--NGSLKDFTNNPWGYQVG  585

Query  1800  VSGEKLKLFTEEGSQKVKW-KPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWV  1976
             + GEKL+++T+ GSQKV+W K  ++    +TWYKT FDAP GN PVAL + +M KG VWV
Sbjct  586   LLGEKLQIYTDVGSQKVQWSKFGSSTSGLLTWYKTVFDAPAGNEPVALNLVSMRKGEVWV  645

Query  1977  NGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDT  2156
             NG+SIGRYWV+FL+P G+PSQ  YHIPR+F+KP  NL+V+ EE+ G P  I +  V+   
Sbjct  646   NGQSIGRYWVSFLTPSGKPSQIWYHIPRSFLKPTGNLLVLLEEETGHPVGISIGKVSIPK  705

Query  2157  ICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACG  2336
             IC  VS+ +   V S  R   +  +     RP V+L+CP ++ + +I FA++G P G C 
Sbjct  706   ICGHVSESHLPPVIS--RVIYKKHENHHGRRPKVQLRCPSNRNISRILFASFGTPSGDCQ  763

Query  2337  NFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             ++ VG+C   N+   VEKACLGK  C VP+    F     D CP    K L V  +C
Sbjct  764   SYAVGSCHSSNSRSNVEKACLGKGMCSVPLSYKRF---GGDPCPG-TPKALLVDVQC  816



>dbj|BAK06282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=846

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/744 (47%), Positives = 476/744 (64%), Gaps = 11/744 (1%)
 Frame = +3

Query  279   QFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPF  458
             Q  FEG NDL+KF+K+I    MY  +R+GPF++AEWN GG PYWL+E+P I FR  NEP+
Sbjct  105   QVQFEGRNDLIKFLKLIQSHDMYALVRIGPFIQAEWNHGGLPYWLREIPHIIFRANNEPY  164

Query  459   MNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAAD  638
                M+KF   IV  +K A++FA QGGP+ILAQIENEY +I+ D    I    KY+ WAA 
Sbjct  165   KKEMEKFVRFIVQKLKDAEMFASQGGPVILAQIENEYGNIKKDH---IVEGDKYLEWAAQ  221

Query  639   MAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFG  818
             MA+     +PWIMCKQ+ AP +VI TCNGR CGDT+   +  NKP +WTENWTAQ+R FG
Sbjct  222   MAISTNTGVPWIMCKQSTAPGEVIPTCNGRHCGDTWTLKDK-NKPRLWTENWTAQFRAFG  280

Query  819   DPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFG  998
             D  A RSAE+IAYS++RF A K G+ + YYMYYGGTN+GRT AS+V T YYDEGP+DE+G
Sbjct  281   DQLALRSAEDIAYSVLRFFA-KGGTLVNYYMYYGGTNFGRTGASYVLTGYYDEGPVDEYG  339

Query  999   LYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT  1178
             + + PK+ HLRD H  ++   R    G  + + L +  E   FE    KLC AF++NNNT
Sbjct  340   MPKAPKYGHLRDLHNLIKSYSRAFLEGKQSFELLAHGYEAHNFEIPEEKLCLAFISNNNT  399

Query  1179  TPT-SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEM  1355
                 ++ FRG +YY+P  S S+L DCK  V+N++ +  QH+ R F  ++   + +  WEM
Sbjct  400   GEDGTVNFRGDKYYIPSRSVSILADCKHVVYNTKRVFVQHSERSFHTAQKLAKSN-AWEM  458

Query  1356  FQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSM  1535
             + E IP      I+N  P+E Y LTKD SDY WY+T       DL  RGDI PV+ V S 
Sbjct  459   YSEPIPRYKLTSIRNKEPMEQYNLTKDDSDYLWYTTSFRLEADDLPFRGDIRPVVQVKST  518

Query  1536  GHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRF  1715
              HAL+ FVN  F G+  G+  +K      P++L+ G N + LL    G  +SG  + +  
Sbjct  519   SHALMGFVNDAFAGNGRGSKKEKGFMFETPINLRIGINHLALLSSSMGMKDSGGELVEVK  578

Query  1716  TGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWY  1895
              G +D TIQGL  GTL +  N W H V + GE  +++TE+G   VKW P T     VTWY
Sbjct  579   GGIQDCTIQGLNTGTLDLQVNGWGHKVKLEGEVKEIYTEKGMGAVKWVPATTGRA-VTWY  637

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKP  2075
             K YFD P+G +PV L M +M KGM++VNG+ +GRYW ++ +  G PSQ  YHIPR F+KP
Sbjct  638   KRYFDEPDGEDPVVLDMTSMGKGMIFVNGEGMGRYWPSYRTVGGVPSQAMYHIPRPFLKP  697

Query  2076  KNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPS  2255
             KNNL+V+FEE+ G P  I +  V RD IC  +S++ P  +K+W++ G +++ + ED    
Sbjct  698   KNNLLVIFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKTWDKDGGQIKVIAEDHSTR  757

Query  2256  VRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKS  2435
               LKCP  K ++++ FA++G+P+G+C NF  G+C  PNA  IV K CLGK  C +PV  +
Sbjct  758   GILKCPPKKTIQEVVFASFGNPEGSCANFTAGSCHTPNAKDIVAKECLGKKSCVLPVLHT  817

Query  2436  LFQEGSKDLCPNLVHKTLAVQAKC  2507
             ++  G+   CP     TLAVQ +C
Sbjct  818   VY--GADINCPTTT-ATLAVQVRC  838



>ref|XP_010233215.1| PREDICTED: beta-galactosidase 7 [Brachypodium distachyon]
Length=824

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/801 (46%), Positives = 510/801 (64%), Gaps = 34/801 (4%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             ++GTR ILF+G +HY R  PEMWP ++ +A++GG++VIQTYVFWN+HEPVQG++NFEG  
Sbjct  51    LNGTRRILFSGEMHYTRSTPEMWPKIIAKARKGGIDVIQTYVFWNVHEPVQGKYNFEGRY  110

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             ++VKFI+ I   G+YV+LR+GPF+EAEW +GGFP+WL EVP I FRT NEPF  HM+ F 
Sbjct  111   NIVKFIREIQAQGLYVSLRIGPFIEAEWKYGGFPFWLHEVPNITFRTDNEPFKQHMQGFV  170

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               +V+MMK   L+ PQGGPII++QIENEY  +E   PA      +Y+ WAA +A+GL   
Sbjct  171   THMVNMMKNEGLYYPQGGPIIISQIENEYQMVE---PAFGPGGPRYVQWAASLAVGLQTG  227

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQN+AP  +I+TCNG  CG+TF GPN  NKP++WTENWT +Y  +G+    RS 
Sbjct  228   VPWMMCKQNDAPDPIINTCNGLICGETFVGPNSPNKPALWTENWTTRYPIYGNDTKLRST  287

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
              +I +++  F A K GS++ YYMY+GGTN+GR  +S+VTT YYD  PLDE+GL   P W 
Sbjct  288   GDITFAVALFIARKGGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAPLDEYGLIWQPTWG  347

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN--NNTTPTSIK  1196
             HL++ HAA++LS  PL  GT +   L  +QE   FE + LK C AFL N   +  PT I 
Sbjct  348   HLKELHAAVKLSSEPLLYGTYSNFSLGEDQEAHVFETK-LK-CVAFLVNFDKHQRPTVI-  404

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETIP  1373
             FR     L   S S+L DC+T VF +  + +QH +R   V   L   D   W+ F+E+IP
Sbjct  405   FRNISLQLAPKSISILSDCRTVVFETGKVNAQHGSRTAEVVQSL--NDTHTWKAFKESIP  462

Query  1374  T-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
               I        +  E  + TKD +DY WY    E+   D S     L +L+V S  H L 
Sbjct  463   QDISKAAYTGKQLFEHLSTTKDETDYLWYIASYEYRPSDDSH----LVLLNVESQAHILH  518

Query  1551  AFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
             AFVNGEFVGS HG++  +  + L   + LK G N I+LL V+ G P+SGA M++R  G  
Sbjct  519   AFVNGEFVGSVHGSHGARGYIILNMTISLKEGQNTISLLNVMVGSPDSGAHMERRSFGIH  578

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV-HPPVTWYKTY  1904
              V+IQ       ++    W + VG+ GE  +++T+EGS  V+W  V N+ + P+TWY+T 
Sbjct  579   KVSIQQGQHALHLLNNELWGYQVGLFGEGNRIYTQEGSHSVEWTDVNNLTYLPLTWYQTT  638

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNN  2084
             F  P GN+ V L + +M KG VW+NG+SIGRYWV+F +P GQPSQ  YHIP+ F+K  +N
Sbjct  639   FATPMGNDAVTLNLTSMGKGEVWINGESIGRYWVSFKTPSGQPSQSLYHIPQHFLKNTDN  698

Query  2085  LMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             L+V+ EE GG+P  I +  V+  T+CSSV++     V+S   +G++         P VRL
Sbjct  699   LLVLVEEMGGNPLQITVNTVSITTVCSSVNELSAPPVQS---QGKD---------PEVRL  746

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             +C + K +  +EFA+YG+P G C  F +G+C   ++  +V++AC+GK  C +PV    F 
Sbjct  747   RCQKGKHISAVEFASYGNPAGDCRTFTIGSCHAESSESVVKQACIGKRSCSIPVGPGSF-  805

Query  2445  EGSKDLCPNLVHKTLAVQAKC  2507
                 D CP  + K+L V A C
Sbjct  806   --GGDPCPG-IQKSLLVVAHC  823



>ref|XP_009376872.1| PREDICTED: beta-galactosidase 16 [Pyrus x bretschneideri]
Length=757

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/780 (46%), Positives = 505/780 (65%), Gaps = 30/780 (4%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++ +AKEGG++VIQTYVFWN+HE  QG+F+F G ND++ FIK + + G+YVTLR+G
Sbjct  1     MWPSLIAKAKEGGIDVIQTYVFWNLHERQQGKFDFSGRNDIISFIKEVQNQGLYVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF+E+EW +GG P WL+++P I +R+ NEPF   M+K+   IV MMK  KL+A QGGPII
Sbjct  61    PFIESEWTYGGLPIWLRDIPGIVYRSDNEPFKIEMEKWTTRIVTMMKSEKLYASQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L+QIENEY  IE   PA  +    Y+ WAA MA+GL   +PW+MCKQ++AP  VI+TCNG
Sbjct  121   LSQIENEYKMIE---PAFHERGPLYVRWAAAMAVGLQTGVPWVMCKQDDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
              +CG+TF GPN  NKP++WTENWT+QY+ +GD P  RSAE+IAY +  F A   GSY+ Y
Sbjct  178   MKCGETFTGPNSPNKPALWTENWTSQYQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNY  237

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GR+ ++FV T YYDE PLDE+G  R PKW HL++ HAA++L+   L  G  
Sbjct  238   YMYHGGTNFGRSASAFVITSYYDEAPLDEYGSVRQPKWGHLKELHAAVKLASNSLLSGDQ  297

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAV  1265
             T   L   Q+   F+ ++ + CAAFL N      S+ F+ + Y LP  S S+LPDCKT  
Sbjct  298   TNVSLGELQDAYVFQVKSGE-CAAFLVNKGPKDASVVFQNSPYQLPRKSISILPDCKTVA  356

Query  1266  FNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETIPTIDN-LPIKNLRPLELYTLTKDT  1439
             FN+  + +Q + R + V  K    +  +WE ++E IP  DN +   N  P +L+T TKD 
Sbjct  357   FNTAKVNAQQSTRSWQVTQKFDSTE--RWEEYKEAIPNFDNTVSRANTLPEQLFT-TKDE  413

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDY WY+  ++    + S        L V S GH L A VNG FVGS HG + +++ SL 
Sbjct  414   SDYLWYTISLKQDSNNESK-------LVVQSRGHVLHALVNGVFVGSAHGRHRNESFSLE  466

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             + V L  G N ++ L  + G P+SGA +++R  G R V IQ        ++ NSW + VG
Sbjct  467   QTVTLNKGVNSLSFLSAMVGLPDSGAYLERRVGGLRKVLIQ-----ERDLSKNSWGYQVG  521

Query  1800  VSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWV  1976
             +SGEKL+++T+ GS KV+W  + +  +  + W+KT+FDAP GN+P+AL + +M KG  +V
Sbjct  522   LSGEKLEIYTDAGSSKVQWNKLGSTANQRLKWFKTHFDAPAGNDPIALNLGSMGKGEAFV  581

Query  1977  NGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDT  2156
             NG+SIGRYWV+F +P G+PSQ  YH+PRAF+KP +NL+V+ EE+ GDP  + L  ++   
Sbjct  582   NGQSIGRYWVSFQTPEGKPSQTWYHVPRAFLKPTSNLLVLLEEENGDPLKVSLDKISVAQ  641

Query  2157  ICSSVSDYYPGNVKSW---ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDG  2327
             +C  VS+ +   V  W   +   +   +   D RP V+L CP  + + K+ FA++G+P G
Sbjct  642   VCGHVSETHLPPVVKWLGLKTHNQNNTRKYRDRRPKVQLSCPPKRNISKVLFASFGNPSG  701

Query  2328  ACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              C N+  G+C    +  IVE+ C+GK +C + + K+ F     D CP  + KTL V A+C
Sbjct  702   DCQNYSTGSCHSSISTAIVEQVCIGKRRCSILLSKNRF----GDPCPG-ISKTLLVDAQC  756



>ref|XP_008783343.1| PREDICTED: beta-galactosidase 7-like [Phoenix dactylifera]
Length=751

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/779 (47%), Positives = 507/779 (65%), Gaps = 34/779 (4%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++ +AK+GGL+VIQTYVFWN HEP++GQFNFEG  +LV+FIK I   G+YV+LR+G
Sbjct  1     MWPSLIAKAKKGGLDVIQTYVFWNAHEPIRGQFNFEGRYNLVRFIKEIQAQGLYVSLRMG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF+E+EW +GGFP+WL +VP I FR+ NEPF  +MK F E IV+MMK  KL+ PQGGPII
Sbjct  61    PFIESEWKYGGFPFWLHDVPGIVFRSDNEPFKFYMKSFVEKIVNMMKLEKLYYPQGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             ++QIENEY  +E   PA  +    Y+ WAA MA+ L   +PW+MCKQ++AP  VI+TCNG
Sbjct  121   ISQIENEYQMVE---PAFHEAGPPYVRWAAAMAVSLQTGVPWMMCKQDDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
              +CG+TF GPN   KPS+WTENWTA+Y  +G  P+ R  E++A+S+  F A KNGS++ Y
Sbjct  178   LKCGETFAGPNSPTKPSLWTENWTARYPVYGKEPSMRRVEDLAFSVALFIARKNGSFVNY  237

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+G++ +S+VTT YYD  PLDE+GL   P W HLR+ HA ++LS  PL  GT 
Sbjct  238   YMYHGGTNFGKSPSSYVTTSYYDRAPLDEYGLIWLPTWGHLRELHAVIKLSSEPLLWGTY  297

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSIKFRGTQYYLPGFSTSVLPDCKTA  1262
             T   L   QE   F+  + K CAAFL N +     ++ F    Y LP  S S+LPDCK+ 
Sbjct  298   TNVSLGQLQEAHVFQTNSGK-CAAFLVNFDEHLNATVCFHNATYELPSKSISILPDCKSV  356

Query  1263  VFNSQNIVSQHNAR--RFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKD  1436
              FN+  + +Q+  R  R V S    +   KW  F + +P + +        LE  + TKD
Sbjct  357   AFNTAKVSAQYGNRSARAVQSFDNAK---KWMAFLDGVPNVHDASFITKELLEQMSTTKD  413

Query  1437  TSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDD-KALS  1613
              +DY WY+    FS    S+ G     L V S  H L AFVN EFVGS HG++D  + ++
Sbjct  414   VTDYLWYT----FSYNYKSSDGQ--QALHVDSRAHVLHAFVNDEFVGSVHGSSDGPRIMT  467

Query  1614  LRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHS  1793
               K + L+ G N+++LL V+ G P+SGA ++KRF G R V+I    +    +T   W + 
Sbjct  468   FEKDISLREGQNNLSLLSVMVGLPDSGAYLEKRFAGLRRVSIHCNGSRPQNLTNWLWGYQ  527

Query  1794  VGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMV  1970
             +G+ GEKL+++T++G  KV WK V +++  P+TWYKT F  P G NPVAL + +M KG V
Sbjct  528   IGLLGEKLEIYTQKGLPKVDWKTVGSSICKPLTWYKTTFHVPLGTNPVALDLSSMGKGEV  587

Query  1971  WVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNR  2150
             W+NG+SIGRYWV+F SP GQPSQ  YH+PR+F+KP  NL+V+FEE GGDP  I +  ++ 
Sbjct  588   WINGESIGRYWVSFTSPNGQPSQTLYHVPRSFLKPFGNLLVLFEELGGDPLGITVNTISV  647

Query  2151  DTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGA  2330
               ICS+V++ +  ++ S +RK           +PSV+L+C E + +  I+FA+YG+P G 
Sbjct  648   THICSNVAESFSPSLFS-KRK-----------QPSVQLQCHEGQAIYSIKFASYGNPIGD  695

Query  2331  CGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             C N+ +G C    +  ++EKAC+GK +C +P+  + F     D CP +  K+L V A C
Sbjct  696   CENYALGTCHSVLSKAVMEKACVGKRRCSIPISATKF---GGDPCPGIA-KSLLVVADC  750



>ref|XP_008338665.1| PREDICTED: beta-galactosidase 16 isoform X2 [Malus domestica]
Length=757

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/780 (46%), Positives = 506/780 (65%), Gaps = 30/780 (4%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWP ++ +AKEGG++VIQTYVFWNIHE  QG+F+F G ND++ FIK + + G+YVTLR+G
Sbjct  1     MWPSLIAKAKEGGIDVIQTYVFWNIHERQQGKFDFSGRNDIISFIKEVQNQGLYVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             PF+E+EW +GG P WL+++P I +R+ NEPF   M+K+   IV MMK  KL+A  GGPII
Sbjct  61    PFIESEWTYGGLPIWLRDIPGIVYRSDNEPFKIEMEKWTTRIVYMMKSEKLYASLGGPII  120

Query  546   LAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNG  725
             L+QIENEY  IE   PA  +    Y+ WAA MA+GL   +PW MCKQ++AP  VI+TCNG
Sbjct  121   LSQIENEYKMIE---PAFHERGPPYVRWAAAMAVGLQTGVPWXMCKQDDAPDPVINTCNG  177

Query  726   RQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgy  905
              +CG+TF GPN  NKP++WTENWT+QY+ +GD P  RSAE+IAY +  F A   GSY+ Y
Sbjct  178   MKCGETFTGPNSPNKPALWTENWTSQYQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNY  237

Query  906   ymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTP  1085
             YMY+GGTN+GR+ ++FV T YYDE PLDE+G  R PKW HL++ HAA++L+  PL  G  
Sbjct  238   YMYHGGTNFGRSASAFVITSYYDEAPLDEYGSVRQPKWGHLKELHAAVKLASNPLLSGGH  297

Query  1086  TIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAV  1265
             T   L   Q+   F+ ++ + CAAFL N      S+ F+ + Y LP  S S+LPDCKT  
Sbjct  298   TNVSLGELQDAYVFQVKSGE-CAAFLVNKGPKDASVVFQNSPYQLPRKSISILPDCKTVA  356

Query  1266  FNSQNIVSQHNARRF-VPSKLAGRDDLKWEMFQETIPTIDNLPIK-NLRPLELYTLTKDT  1439
             FN+  + +Q + R + V  K    +  +WE ++E IP  DN   + N  P +L+T TKD 
Sbjct  357   FNTAKVNAQQSTRSWQVTQKFDSTE--RWEEYKEAIPNFDNXXSRANTLPEQLFT-TKDE  413

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDY WY+  +   ++D +T+      L V S GH L AFVNG FVGS HG + ++  SL 
Sbjct  414   SDYLWYTISL---KQDSNTQSK----LXVQSRGHVLHAFVNGVFVGSAHGRHRNEXFSLE  466

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             + V L  G N ++ L  + G P+SGA +++R  G R V I         ++ NSW + VG
Sbjct  467   QTVILNKGVNSLSFLSAMVGLPDSGAYLERRVGGLRKVLIX-----ERDLSKNSWGYXVG  521

Query  1800  VSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWV  1976
             +SGEKL+++T+ G  KV+W  + ++ + P+ W+KT+FDAP GN+P+AL + +M KG  +V
Sbjct  522   LSGEKLEIYTDAGXSKVEWNKLGSSANQPLKWFKTHFDAPAGNDPIALNLGSMGKGEAFV  581

Query  1977  NGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDT  2156
             NG+SIGRYWV F +P G+PSQ  YH+PRAF+KP  NL+V+ EE+ GDP  + L  ++   
Sbjct  582   NGQSIGRYWVLFQTPEGKPSQTWYHVPRAFLKPTGNLLVLLEEENGDPLKVSLDKISVAQ  641

Query  2157  ICSSVSDYYPGNVKSW---ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDG  2327
             +C  VS+ +   V  W   + + +   +   D RP V+L CP  + + K+ FA++G+P G
Sbjct  642   VCGXVSETHLPPVVKWLGLKTQNQNNTRKNRDRRPKVQLSCPPKRNISKVLFASFGNPSG  701

Query  2328  ACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              C N+  G+C    +  IVE+ C+GK +C + + K+ F     D CP  + KTL V A+C
Sbjct  702   DCQNYSTGSCHSSISTAIVEQVCIGKRRCSILLSKNRF----GDPCPG-ISKTLLVDAQC  756



>ref|XP_006441550.1| hypothetical protein CICLE_v10023501mg [Citrus clementina]
 gb|ESR54790.1| hypothetical protein CICLE_v10023501mg [Citrus clementina]
Length=798

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/809 (44%), Positives = 512/809 (63%), Gaps = 44/809 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R +LF+GSIHYPR P EMWP ++ +AKEGGL+VIQTYVFWN+HEP  G+++F G
Sbjct  17    LIINGERKVLFSGSIHYPRSPREMWPSLISKAKEGGLDVIQTYVFWNLHEPETGKYDFSG  76

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK I  +G+Y ++R+GPF+++EW++GG P+WL +VP I FR  NEPF   M+ 
Sbjct  77    RRDLVRFIKEIQALGLYASIRIGPFIQSEWSYGGLPFWLHDVPGITFRCDNEPFKAFMQN  136

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK  +L+A QGGPIIL+QIENEY  +E+   A  +    YI WAA+MA+GL 
Sbjct  137   FTTKIVNMMKSERLYASQGGPIILSQIENEYQMVEN---AFGERGPPYIKWAAEMAVGLQ  193

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+ CNGR+CG+TF GPN  NKPS+WTENWT++Y+ +G+ P  R
Sbjct  194   TGVPWVMCKQDDAPDPVINACNGRKCGETFKGPNSPNKPSIWTENWTSRYQAYGEDPIGR  253

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             +A++IA+ +  + A +NGS++ YYMY+GGTN+GR  ++FVT  YYD+ PLDE+G+   PK
Sbjct  254   TADDIAFHVALWVA-RNGSFVNYYMYHGGTNFGREASAFVTASYYDDAPLDEYGMINQPK  312

Query  1017  WSHLRDCHAALRLSKRPLFLG---TPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT  1187
             W HL++ HAA++L    L LG   TP +Q  P  +  +  EN + +  +AFL N +    
Sbjct  313   WGHLKELHAAIKLCSNTLLLGKAMTP-LQLGPKQEAYLFAENSSEECASAFLVNKDKQNV  371

Query  1188  SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQET  1367
              + F+ + Y L   S S+LPDC+  +FN+  + +Q N R  +P       D +WE F+E 
Sbjct  372   DVVFQNSSYKLLANSISILPDCRNVIFNTAEVKTQTNTRTRIPIMYFNVSD-QWEEFKEP  430

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             IP  ++  +K+   LE    TKDTSDY WYS   +    D   +      L V+S+GH L
Sbjct  431   IPNFEDTSLKSDTLLEHTDTTKDTSDYLWYSFSFQHEPSDTRAQ------LSVHSLGHVL  484

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
              AFVNG  VGS HG+  + + +L+    L  G N+++LL V+ G P+SGA ++++  GP 
Sbjct  485   HAFVNGVPVGSAHGSYKNTSFTLQTDFSLSNGINNVSLLSVMVGLPDSGAYLERKRYGPV  544

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT--NVHPPVTWYKT  1901
              V+IQ    G++  T   W   VG+ GE L+++T+EGS+ ++W  ++  ++ PP+TWYKT
Sbjct  545   AVSIQN-KEGSMNFTNYKWGQKVGLLGENLQIYTDEGSKIIQWSKLSSLDISPPLTWYKT  603

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKN  2081
              FDA   +  VAL ++ M KG  WVNG+S GRYW +  +P G+PSQ  Y+IPR+F+KP  
Sbjct  604   AFDATGEDEHVALNVNGMRKGEAWVNGQSFGRYWPSLRTPRGEPSQISYNIPRSFLKPTG  663

Query  2082  NLMVVFEEQGGDPSSIELVLVNRDTIC----SSVSDYYPGNVKSWERKGEELRQVVEDIR  2249
             NL+V+ EE+GGDP SI L  V  D++C    +S   +Y G+ ++                
Sbjct  664   NLLVLLEEEGGDPLSITLEKVVIDSVCGKARASPYRHYNGSREA----------------  707

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACG--NFIVGNCSFPNANKIVEKACLGKSQCKVP  2423
               V L+C  +  + KI FA+YG P G CG     +G C  PN+    EKACLGK  C +P
Sbjct  708   KLVHLQCAPNGYITKILFASYGTPFGGCGRDGHAIGYCDSPNSKFAAEKACLGKRSCLIP  767

Query  2424  VEKSLFQEGSKDLCPNLVHKTLAVQAKCG  2510
                  F     D CP+   K+L V+A CG
Sbjct  768   ASDQFFD---GDPCPS-KKKSLIVEAHCG  792



>ref|XP_011069425.1| PREDICTED: beta-galactosidase 14-like, partial [Sesamum indicum]
Length=537

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/543 (59%), Positives = 410/543 (76%), Gaps = 8/543 (1%)
 Frame = +3

Query  186   MWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVG  365
             MWPD++++AKEGGLN+IQTYVFWN+HEP QG++NFEGN DLVKFIK I + G++VTLR+G
Sbjct  1     MWPDIIRKAKEGGLNIIQTYVFWNLHEPNQGEWNFEGNRDLVKFIKCIWEQGLWVTLRIG  60

Query  366   PFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPII  545
             P++EAEWN GGFPYWL+EVP I FR+ NE F  HM+K+AE +++MMKK KLFA QGGPI+
Sbjct  61    PYIEAEWNMGGFPYWLREVPDIIFRSDNEAFKYHMQKYAEKVINMMKKEKLFADQGGPIV  120

Query  546   LAQIENEYSSIE-SDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCN  722
             + QIENEY++++ + R   I     Y+ WAA+MA+ LYN +PWIMCKQ +APP VI TCN
Sbjct  121   MMQIENEYNNVQLAYRERGI----SYVKWAANMALSLYNGVPWIMCKQKDAPPTVISTCN  176

Query  723   GRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylg  902
             GRQC DTF GPNG +KPS+WTENWTAQYR FGD P+QR+AE+I++++ RF          
Sbjct  177   GRQCADTFAGPNGPDKPSLWTENWTAQYRVFGDTPSQRAAEDISFAVARFFTRNGTLNNY  236

Query  903   yymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGT  1082
             Y  Y G      +++SFVTTRYYDE PLDE+GL R+PK+ HLRD H AL+LSK+PL  GT
Sbjct  237   YMYYGGSNFGRTSSSSFVTTRYYDEAPLDEYGLRREPKFGHLRDLHRALKLSKKPLLRGT  296

Query  1083  PTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTSVLPDCKT  1259
             P ++++  + EI T+E  +  LC AFLTNN+T    +I FRG  YYLP  S S+LPDCKT
Sbjct  297   PKVERISQDLEITTYEKPSENLCVAFLTNNDTREAKTIHFRGKDYYLPSKSVSILPDCKT  356

Query  1260  AVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDT  1439
              V+N+  IV+QH++R FV  + A     KWEMF+ETIPTI++L  +   P ELY+ TKD 
Sbjct  357   VVYNTAAIVAQHSSRNFVVPQQAKFS--KWEMFKETIPTINDLKDRTPAPKELYSFTKDV  414

Query  1440  SDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLR  1619
             SDYAWYST I+   RDL  R D+ P L + S+GHAL+AFVNGE++G +HG+N +K+   R
Sbjct  415   SDYAWYSTSIKIDARDLPMRPDVRPGLHIASLGHALLAFVNGEYIGFEHGSNVEKSHIFR  474

Query  1620  KPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVG  1799
             KPV+L  G+NDITLL +  GFPNSGA M+KRF GPR VT++GLM+GTL +T N+W   VG
Sbjct  475   KPVNLTAGDNDITLLAMTVGFPNSGAYMEKRFAGPRAVTLEGLMSGTLDITNNNWGQQVG  534

Query  1800  VSG  1808
             V+G
Sbjct  535   VNG  537



>tpg|DAA48742.1| TPA: hypothetical protein ZEAMMB73_126543 [Zea mays]
Length=706

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/643 (52%), Positives = 442/643 (69%), Gaps = 8/643 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
                DG R+I  +GSIHYPR PP+MWP+++ +AKEGGLN I+TYVFWNIHEP +G+FNFEG
Sbjct  50    LMFDGHREIFLSGSIHYPRSPPDMWPELIAKAKEGGLNTIETYVFWNIHEPEKGEFNFEG  109

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              ND+V+F ++I +  MY  +R+GPF++AEWN GG PYWL+E+P I FRT NEP+  HM+ 
Sbjct  110   QNDVVRFFQLIQEHDMYAMVRLGPFIQAEWNHGGLPYWLREIPDIVFRTNNEPYKMHMET  169

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F ++I+  +K A LFA QGGPIILAQIENEY  +E+   A      KYINWAA MA+   
Sbjct  170   FVKIIIKRLKDANLFASQGGPIILAQIENEYQHMEA---AFKDEGTKYINWAAKMAISTN  226

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPWIMCKQ +AP  VI TCNGR CGDT+ GP   + P +WTENWTAQYR FGDPP+QR
Sbjct  227   IGIPWIMCKQTKAPSDVIPTCNGRNCGDTWPGPTNKSMPLLWTENWTAQYRVFGDPPSQR  286

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+++ RF +   G+   YYMY+GGTN+GRT+A+FV  +YYDE PLDEFGLY++PK
Sbjct  287   SAEDIAFAVARFFS-VGGTLANYYMYHGGTNFGRTSAAFVMPKYYDEAPLDEFGLYKEPK  345

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HLRD H AL+L K+ L  GTP+ +KL    E   FE    K+C AFL+N+NT    ++
Sbjct  346   WGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQKVCVAFLSNHNTKDDATM  405

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQ-ETI  1370
              FRG  Y++P  S SVL DC+T VF +Q++ +QHN R F  +    ++++ WEMF  E +
Sbjct  406   TFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFADQTAQNNV-WEMFDGENV  464

Query  1371  PTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             P      I+  +  +LY LTKD +DY WY++  +    D+  R DI  VL+V S GHA V
Sbjct  465   PKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRSDIKTVLEVNSHGHASV  524

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             AFVN +FVG  HG   +KA +L KP+DLK G N + +L    G  +SGA M+ R  G   
Sbjct  525   AFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGMTDSGAYMEHRLAGVDR  584

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V I GL AGTL +T N W H VG+ GE+ +++T++G   V WKP  N   P+TWYK +FD
Sbjct  585   VQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKPAMN-DRPLTWYKRHFD  643

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQ  2039
              P G +PV L M  M KGM++VNG+ IGRYW+++   LG+PSQ
Sbjct  644   MPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPSQ  686



>gb|AAG29193.1|AC078898_3 beta-galactosidase, putative [Arabidopsis thaliana]
Length=780

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/807 (45%), Positives = 500/807 (62%), Gaps = 56/807 (7%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHY R  P+MWP ++ +AK GG++V+ TYVFWN+HEP QGQF+F G
Sbjct  19    LIIDGEHKILFSGSIHYTRSTPQMWPSLIAKAKSGGIDVVDTYVFWNVHEPQQGQFDFSG  78

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + D+VKFIK + + G+YV LR+GPF++ EW++GG P+WL  V  I FRT NEPF  HMK+
Sbjct  79    SRDIVKFIKEVKNHGLYVCLRIGPFIQGEWSYGGLPFWLHNVQGIVFRTDNEPFKYHMKR  138

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +A+MIV +MK   L+A QGGPIIL+QIENEY  +     A  +  K Y+ W A +A+ L 
Sbjct  139   YAKMIVKLMKSENLYASQGGPIILSQIENEYGMVGR---AFRQEGKSYVKWTAKLAVELD  195

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +++ CNGRQCG+TF GPN  NKP++WTENWT+            
Sbjct  196   TGVPWVMCKQDDAPDPLVNACNGRQCGETFKGPNSPNKPAIWTENWTS-----------L  244

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A KNGS++ YYMY+GGTN+GR  + FV T YYD+ PLDE+GL R PK
Sbjct  245   SAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  303

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ HAA++L + PL  G  T   L   Q    F  +   LCAA L N +   ++++
Sbjct  304   WGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAILVNQDKCESTVQ  362

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK----WEMFQE  1364
             FR + Y L   S SVLPDCK   FN+  + +Q+N R         R +L     WE F E
Sbjct  363   FRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTR-----TRKARQNLSSPQMWEEFTE  417

Query  1365  TIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             T+P+     I++   LE    T+DTSDY W +TR + SE   S       VL V  +GHA
Sbjct  418   TVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAPS-------VLKVNHLGHA  470

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             L AFVNG F+GS HG        L K + L  G N++ LL V+ G PNSGA +++R  G 
Sbjct  471   LHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVGS  530

Query  1725  RDVTIQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHP-PVTWY  1895
             R V I     G   + FN  SW + VG+ GEK  ++TE+GS KV+WK   +    P+TWY
Sbjct  531   RSVKIWN---GRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWY  587

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKP  2075
             K  FD PEG +PVAL + +M KG  WVNG+SI  +           S   YHIPR+F+KP
Sbjct  588   KASFDTPEGEDPVALNLGSMGKGEAWVNGQSIAMF-----------SYFRYHIPRSFLKP  636

Query  2076  KNNLMVVFEEQ-GGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVV--EDI  2246
              +NL+V+ EE+  G+P  I +  V+   +C  VS+  P  V S  +KG   + +    D 
Sbjct  637   NSNLLVILEEEREGNPLGITIDTVSVTEVCGHVSNTNPHPVISPRKKGLNRKNLTYRYDR  696

Query  2247  RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPV  2426
             +P V+L+CP  + + KI FA++G P+G+CG++ +G+C  PN+  +V+KACL KS+C VPV
Sbjct  697   KPKVQLQCPTGRKISKILFASFGTPNGSCGSYSIGSCHSPNSLAVVQKACLKKSRCSVPV  756

Query  2427  EKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                 F     D CP+ V K+L V+A+C
Sbjct  757   WSKTF---GGDSCPHTV-KSLLVRAQC  779



>ref|XP_010312841.1| PREDICTED: beta-galactosidase 16 [Solanum lycopersicum]
Length=814

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/803 (44%), Positives = 498/803 (62%), Gaps = 32/803 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R +LF+GSIHYPR  P+MWP ++ +AKEGG++VI+TYVFWN+HEP  GQ++F G
Sbjct  37    LIIDGQRKMLFSGSIHYPRSTPDMWPSLISKAKEGGIDVIETYVFWNLHEPQPGQYDFSG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V FIK I   G+Y  LR+GP++EAEW +GGFP+WL +VP I +R+ NEPF  +M+ 
Sbjct  97    RRDIVAFIKQIQAQGLYACLRIGPYIEAEWTYGGFPFWLHDVPGIVYRSDNEPFKFYMQN  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK   L+A QGGPIIL+QIENEY + E            Y+ WAA MA+ L 
Sbjct  157   FTTKIVNLMKSEGLYASQGGPIILSQIENEYQNKEKSFGEK---GPPYVRWAAKMAVELD  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ++AP  VI+TCNGR CG+TF GPN  NKPS+WTENWT+ Y+ +G+   +R
Sbjct  214   TGVPWIMCKQDDAPDPVINTCNGRTCGETFKGPNSPNKPSIWTENWTSFYQVYGENAVKR  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE +AY +  F A KNG+Y+ YYMY+GGTN+GR+ A F+ T YYD  PLDE+GL   PK
Sbjct  274   SAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMITSYYDLAPLDEYGLISQPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSI-  1193
             + H ++ HAA++L    +    PT+  L   QE+  +   +   C+A L N + +  +I 
Sbjct  334   YGHFKELHAAIKLCSENILSTFPTMHSLGPLQEVYVYGEDSGTKCSALLVNTDHSNKNIT  393

Query  1194  -KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL-KWEMFQET  1367
              KFR   Y LP  S S+LPDCKT VFN+  + +Q N R   P+ +   D   KWE F E 
Sbjct  394   VKFRDLTYQLPPKSISILPDCKTVVFNTAKVSTQFNTRS--PTTVFKFDRAEKWEQFHEI  451

Query  1368  IPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHAL  1547
             IP  D   +++   LE    TKD SDY WY+  +E    +   +      L V S+GH L
Sbjct  452   IPQFDATTVRSETLLEQTNTTKDVSDYLWYTASLEQESEEEQVK------LSVKSLGHVL  505

Query  1548  VAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
               FVNG  VG  HG     +  +   V LK G N I+ L    G PNSGA +++R  G  
Sbjct  506   HVFVNGHLVGYGHGQFRKASFLVESTVSLKKGKNQISFLSATVGLPNSGAFLERRSLGVH  565

Query  1728  DVTIQGLMAGTLVVTFN--SWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKT  1901
              V IQ  +   ++  F   SW + VG+ GEKL++++   ++   W  + +    +TWYK+
Sbjct  566   SVMIQ--LDNRVLKNFTDFSWGYQVGLLGEKLQIYSSGRTKSGNWSRLGSSKQQLTWYKS  623

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKN  2081
              FDAP+G++PV L + +M KG VWVNG+SIGR+W++F +P G PSQ  Y++PR+F+KPK+
Sbjct  624   IFDAPKGDDPVTLNLGSMGKGEVWVNGQSIGRFWLSFHTPQGVPSQTWYNVPRSFLKPKD  683

Query  2082  NLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV-KSWERKGEELRQVVEDIRPSV  2258
             N++V+FEE+ G+P  I +  ++   +C+ V+D  P  V  SW + G          RP V
Sbjct  684   NVLVLFEEEIGNPLGITIDTISITKVCAHVADSNPPPVINSWRKHGR---------RPKV  734

Query  2259  RLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSL  2438
             +L CP+ + + KI FA++G+P G C ++ +G C   N+  IVEKACLGKS+C +      
Sbjct  735   QLSCPQGRKISKILFASFGNPIGDCDDYDIGLCHSSNSKAIVEKACLGKSKCTIAHSSKK  794

Query  2439  FQEGSKDLCPNLVHKTLAVQAKC  2507
             F     D CP  + K+L V  +C
Sbjct  795   F---GGDPCPG-ISKSLLVDVQC  813



>ref|XP_002306647.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93643.2| beta-galactosidase family protein [Populus trichocarpa]
Length=788

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/798 (44%), Positives = 489/798 (61%), Gaps = 44/798 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G   ILF+GSIHYPR  P+MW  ++ +AK GG++VIQTYVFWN+HEP QGQF F G
Sbjct  33    LIINGQHKILFSGSIHYPRSTPDMWSSLISKAKAGGIDVIQTYVFWNLHEPQQGQFYFNG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+F+K I   G+Y  LR+GPF+E+EW +GG P+WL ++P + +R+ N+PF  HMK+
Sbjct  93    RADLVRFVKEIQAQGLYACLRIGPFIESEWTYGGLPFWLHDIPGMVYRSDNQPFKYHMKR  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK  KL+A QGGPIIL+Q+ENEY ++E+   A  +    Y+ WAA MA+ L 
Sbjct  153   FVSRIVNMMKSEKLYASQGGPIILSQVENEYKNVEA---AFHEKGPSYVRWAALMAVNLQ  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI++CNG +CG+TF GPN  NKPS+WTE+WT+ Y+ +G+    R
Sbjct  210   TGVPWVMCKQDDAPDPVINSCNGMRCGETFAGPNSPNKPSIWTEDWTSFYQVYGEETYMR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA++IA+ +  F A K GSY+ YYMY+GGTN+GRT ++F  T YYD+ PLDE+GL R PK
Sbjct  270   SAQDIAFHVALFIA-KTGSYVNYYMYHGGTNFGRTASAFTITSYYDQAPLDEYGLIRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             W HL++ HAA++   + L  G      L   Q+   F+  N   CAAFL NN+      +
Sbjct  329   WGHLKELHAAIKSCSKLLLHGAHKTFSLGPLQQAYVFQG-NSGQCAAFLVNNDGKQEVEV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+   Y LP  S S+LPDCKT  FN+  + +Q+  R   P++       KWE + E IP
Sbjct  388   LFQSNSYKLPQKSISILPDCKTMTFNTAKVNAQYTTRSMKPNQKFNSVG-KWEEYNEPIP  446

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D   ++  R LE  + TKDTSDY WY+ R + +  +  +      V +  S GH L A
Sbjct  447   EFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQNLPNAQS------VFNAQSHGHVLHA  500

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNG   G  HG++ + + SL+  V LK G N + LL    G P+SGA +++R  G R V
Sbjct  501   YVNGVHAGFGHGSHQNTSFSLQTTVRLKNGTNSVALLSATVGLPDSGAYLERRVAGLRRV  560

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQ         T  +W + VG+ GE+L+++TE GS KVKW  +   + P+ WYKT FDA
Sbjct  561   RIQ-----NKDFTTYTWGYQVGLLGERLQIYTENGSNKVKWNKL-GTNRPLMWYKTLFDA  614

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  Y+IPRAF+KP  NL+V
Sbjct  615   PAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSQGSPSQTWYNIPRAFLKPTGNLLV  674

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+ G P  I +  V+   +C   S                     E    +V+L CP
Sbjct  675   LLEEEKGYPPGITVDTVSVTKVCGYAS---------------------ESHLSAVQLSCP  713

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +  I FA++G P G C ++ +GNC   ++   VEKAC+GK  C +P     F    
Sbjct  714   LKRNISSIIFASFGTPSGNCESYAIGNCHSSSSKANVEKACIGKRSCSIPQSNHFF---G  770

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP  + K L V+AKC
Sbjct  771   GDPCPG-IPKVLLVEAKC  787



>ref|XP_011003430.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=788

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/798 (44%), Positives = 488/798 (61%), Gaps = 44/798 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G   ILF+GSIHY R  P+MW  ++ +AK GG++VIQTYVFWN+HEP QGQF F G
Sbjct  33    LIINGQHKILFSGSIHYSRSTPDMWSSLISKAKAGGIDVIQTYVFWNLHEPQQGQFYFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+F+K I   G+Y  LR+GPF+E+EW +GG P+WL ++P + +R+ N+PF  HMK+
Sbjct  93    RADLVRFVKEIQAQGLYACLRIGPFIESEWTYGGLPFWLHDIPGMVYRSDNQPFKYHMKR  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK  KL+A QGGPIIL QIENEY ++E+   A  +    Y+ WAA MA+ L 
Sbjct  153   FVSRIVNMMKSEKLYASQGGPIILQQIENEYKNVEA---AFHEKGPSYVRWAASMAVNLQ  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI++CNG +CG+TF GPN  NKPS+WTE+WT+ Y+ +G+    R
Sbjct  210   TGVPWVMCKQDDAPDPVINSCNGMRCGETFAGPNSPNKPSIWTEDWTSFYQVYGEETYMR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA++IA+ +  F A K GSY+ YYMY+GGTN+GRT ++F  T YYD+ PLDE+GL R PK
Sbjct  270   SAQDIAFHVALFIA-KTGSYVNYYMYHGGTNFGRTASAFTITSYYDQAPLDEYGLIRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             W HL++ HAA++   + L  G      L   Q+   F+  N   CAAFL NN+      +
Sbjct  329   WGHLKELHAAIKSCSKLLLHGEHKTFSLGPLQQAYVFQG-NSGQCAAFLVNNDGKQEVEV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+   Y LP  S S+LPDCKT  FN+ N+ +Q+  R   P++       KWE + E IP
Sbjct  388   LFQSNSYKLPQKSISILPDCKTMTFNTANVNAQYTTRSMKPNQKFNSVG-KWEEYNEPIP  446

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D   ++  R LE  + TKDTSDY WY+ R + +  +  +      V +  S GH L A
Sbjct  447   EFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQNLPNAQS------VFNAQSRGHVLHA  500

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNG   G  HG++ + + SL+  V LK G N++ LL    G P+SGA +++R  G R V
Sbjct  501   YVNGVHAGYGHGSHQNTSFSLQTTVPLKNGTNNVALLSATVGLPDSGAYLERRVAGLRRV  560

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQ     T +     W + VG+ GE+L+++TE GS KVKW      + P+ WYKT FDA
Sbjct  561   RIQNKDFTTYM-----WGYQVGLLGERLQIYTENGSNKVKWNKF-GTNRPLMWYKTLFDA  614

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P GN+PVAL + +M KG  WVNG+SIGRYWV+F +  G PSQ  Y+IPRAF+KP  NL+V
Sbjct  615   PAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGSPSQTWYNIPRAFLKPTGNLLV  674

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP  2273
             + EE+ G P  I +  V+   +C   S                     E    +V+L CP
Sbjct  675   LLEEEKGYPPGITVDTVSVTKVCGYAS---------------------EPHLSAVQLSCP  713

Query  2274  EDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGS  2453
               + +  I FA++G P G C +F +GNC   ++   VEKAC+GK  C +P     F    
Sbjct  714   PKRNISSIIFASFGTPSGNCESFAIGNCHSSSSKANVEKACIGKRSCSIPQSNHFF---G  770

Query  2454  KDLCPNLVHKTLAVQAKC  2507
              D CP  + K L V+AKC
Sbjct  771   GDPCPG-IPKVLLVEAKC  787



>gb|ACC64531.1| beta-galactosidase 6 [Oryza sativa Indica Group]
Length=811

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/817 (44%), Positives = 507/817 (62%), Gaps = 34/817 (4%)
 Frame = +3

Query  75    WVTMARR*RMIVDLFFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFW  254
             W  + R          + G R + F+G +HY R  PEMWP ++ +AK GGL+VIQTYVFW
Sbjct  22    WAELGREITYDGRALVVSGARRMFFSGDMHYARSTPEMWPKLIAKAKNGGLDVIQTYVFW  81

Query  255   NIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIA  434
             N+HEP+QGQ+NFEG  DLVKFI+ I   G+YV+LR+GPF+EAEW +GGFP+WL +VP I 
Sbjct  82    NVHEPIQGQYNFEGRYDLVKFIREIQAQGLYVSLRIGPFVEAEWKYGGFPFWLHDVPSIT  141

Query  435   FRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQK  614
             FR+ NEPF  HM+ F   IV MMK   L+ PQGGPII++QIENEY  IE   PA      
Sbjct  142   FRSDNEPFKQHMQNFVTKIVTMMKHEGLYYPQGGPIIISQIENEYQMIE---PAFGASGP  198

Query  615   KYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENW  794
             +Y+ WAA MA+GL   +PW+MCKQN+AP  VI+TCNG  CG+TF GPN  NKP++WTENW
Sbjct  199   RYVRWAAAMAVGLQTGVPWMMCKQNDAPDPVINTCNGLICGETFVGPNSPNKPALWTENW  258

Query  795   TAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYD  974
             T++Y  +G+    R  E+IA+++  + A K GS++ YYMY+GGTN+GR  AS+VTT YYD
Sbjct  259   TSRYPIYGNDTKLRDPEDIAFAVALYIARKKGSFVSYYMYHGGTNFGRFAASYVTTSYYD  318

Query  975   EGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCA  1154
               PLDE+GL   P W HLR+ H A++ S  PL  G+ +   L   QE   FE  + K C 
Sbjct  319   GAPLDEYGLIWQPTWGHLRELHCAVKQSSEPLLFGSYSNFSLGQQQEAHVFET-DFK-CV  376

Query  1155  AFLTN--NNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLA  1328
             AFL N   + TP  ++FR     L   S SVL DC+  VF +  + +QH +R    + + 
Sbjct  377   AFLVNFDQHNTP-KVEFRNISLELAPKSISVLSDCRNVVFETAKVNAQHGSR--TANAVQ  433

Query  1329  GRDDL-KWEMFQETIPT-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRG  1502
               +D+  W+ F E +P  +        +  E    TKD +DY WY      S ++ ++ G
Sbjct  434   SLNDINNWKAFIEPVPQDLSKSTYTGNQLFEQLPTTKDETDYLWYIV----SYKNRASDG  489

Query  1503  DILPVLDVYSMGHALVAFVNGEFVGSKHGNNDD-KALSLRKPVDLKPGNNDITLLGVLTG  1679
             + +  L V S+ H L AFVN E+VGS HG++D  + + L   + LK G+N I+LL V+ G
Sbjct  490   NQIARLYVKSLAHILHAFVNNEYVGSVHGSHDGPRNIVLNTHMSLKEGDNTISLLSVMVG  549

Query  1680  FPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWK  1859
              P+SGA M++R  G + V IQ       ++  + W + VG+ GEK  ++T+EG   V+W 
Sbjct  550   SPDSGAYMERRTFGIQTVGIQQGQQPMHLLNNDLWGYQVGLFGEKDSIYTQEGPNSVRWM  609

Query  1860  PVTN-VHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPS  2036
              + N ++ P+TWYKT F  P GN+ V L + +M KG VWVNG+SIGRYWV+F +P GQPS
Sbjct  610   DINNLIYHPLTWYKTTFSTPPGNDAVTLNLTSMGKGEVWVNGESIGRYWVSFKAPSGQPS  669

Query  2037  QGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKG  2216
             Q  YHIPR F+ PK+NL+V+ EE GGDP  I +  ++  T+C +V ++   +V   + +G
Sbjct  670   QSLYHIPRGFLTPKDNLLVLVEEMGGDPLQITVNTMSVTTVCGNVDEF---SVPPLQSRG  726

Query  2217  EELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKAC  2396
             +          P VR+ C   K +  IEFA+YG+P G C +F +G+C   ++  +V+++C
Sbjct  727   K---------VPKVRIWCQGGKRISSIEFASYGNPVGDCRSFRIGSCHAESSESVVKQSC  777

Query  2397  LGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +G+  C +PV  + F     D CP  + K+L V A C
Sbjct  778   IGRRGCSIPVMAAKF---GGDPCPG-IQKSLLVVADC  810



>gb|KDP31634.1| hypothetical protein JCGZ_14859 [Jatropha curcas]
Length=815

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/807 (45%), Positives = 501/807 (62%), Gaps = 33/807 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R +LF+GS+HYPR  PEMWP ++ +AK+GG++VI+TYVFWN+HEP  GQ++F G
Sbjct  31    LIVDGQRRLLFSGSVHYPRSTPEMWPSLIAKAKDGGIDVIETYVFWNLHEPQPGQYDFSG  90

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+V+F+K I   G++  LR+GPF++AEW++GG P+WL ++P I +R+ NEPF + M+ 
Sbjct  91    RRDIVRFVKEIQAQGLHACLRIGPFIQAEWSYGGLPFWLHDIPGIVYRSDNEPFKSQMQN  150

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MM+   L+A QGGPIIL+QIENEY  +E    A  +  + Y+ WAA MA+GL 
Sbjct  151   FTTKIVKMMQSEGLYASQGGPIILSQIENEYGMVEE---AFGEEGQAYVKWAAQMAVGLN  207

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQN+AP  VID+CNG +CG+TF GPN  NKP++WTENWT +Y   G+    R
Sbjct  208   TGVPWVMCKQNDAPDPVIDSCNGLKCGETFVGPNSPNKPAIWTENWTTRYVINGEDIRTR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             S E+IAY +  F   KNGS++ YYMY+GGTN+GRT ++F+   YYD+ PLDE+GL R+PK
Sbjct  268   SVEDIAYQVALFLVAKNGSFVNYYMYHGGTNFGRTASAFIPPSYYDQAPLDEYGLVREPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL++ HAA++L   PL  G      L   Q+   F  Q+ + CAAFL N++T    S+
Sbjct  328   FGHLKELHAAIKLCSTPLLSGVQVYISLGQQQQAYVFNGQSGE-CAAFLVNSDTENEASV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +F+   Y LP  S S+LPDCK       N+ SQ+  R  V SKL    +  WE F E IP
Sbjct  387   QFQNGSYDLPPISISILPDCK-------NVNSQYGTRSMVRSKLLDGGE-TWEEFHEPIP  438

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D+  IK+   LE  + TKD SDY WY+ R +    D         VL+V S+GH L A
Sbjct  439   KFDDTSIKSETILEQMSTTKDASDYLWYTFRFQKESSDSQA------VLNVKSLGHVLHA  492

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+  GS  G++     +L+  V L  G N+++LL V+ G P+SGA M++R  G   V
Sbjct  493   FVNGQAAGSAQGSHKTPRFNLQSTVHLVGGINNVSLLSVMVGLPDSGAHMERRSAGLSRV  552

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              IQ         T +SW + +G+ GEKL+++T++GS +V+W+  +N     TWYK  FDA
Sbjct  553   IIQDKQGNNKDFTNHSWGYQIGLLGEKLQIYTDKGSTQVQWQKFSNPWNSPTWYKALFDA  612

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P G  PVAL + +M KG  WVNG+SIGRYW ++ SP G  SQ  Y++PR+F+KP  NL+V
Sbjct  613   PAGEVPVALNLGSMGKGEAWVNGESIGRYWPSYRSPDGS-SQIWYNVPRSFLKPTGNLLV  671

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELR---QVVEDI-----R  2249
             V EE GG+P  I +       +CS V+  +P  V +W     + +   ++  +I     R
Sbjct  672   VMEEMGGNPLQISVDTATISQVCSHVTASHPPPVSTWIGHYYQYQIPNKLNTNIKHKGRR  731

Query  2250  PSVRLKCPEDKVVKKIEFANYGDPDGACGN-FIVGNCSFPNANKIVEKACLGKSQCKVPV  2426
             P V L CP    +  I FA+YG P G C + F VG C    +  IVEKAC+G+ +C +PV
Sbjct  732   PKVHLDCPLHTKISNISFASYGTPLGNCSSTFGVGMCHSFASKAIVEKACVGQRRCTIPV  791

Query  2427  EKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                 F E   D C +   K+L V A C
Sbjct  792   WNRYFGE---DPC-SANEKSLLVVADC  814



>ref|XP_006376211.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|ERP54008.1| beta-galactosidase family protein [Populus trichocarpa]
Length=788

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/801 (44%), Positives = 483/801 (60%), Gaps = 50/801 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R I+F+GSIHYPR  PEMWP ++ +AKEGGL+ I+TYVFWN+HEP  G ++F G
Sbjct  33    LIIDGQRKIVFSGSIHYPRSTPEMWPSLIAKAKEGGLDAIETYVFWNVHEPQPGHYDFSG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              +D+V+FIK +   G+Y  LR+GPF+++EW++GG P+WL ++P I FR+ NEPF  +M+ 
Sbjct  93    GHDIVRFIKEVQAQGLYACLRIGPFIQSEWSYGGLPFWLHDIPGIVFRSDNEPFKVYMQN  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   +V MM+   L+A QGGPIIL+QIENEY +++    A  +    Y+ WAA MA GL 
Sbjct  153   FTAKVVSMMQSENLYASQGGPIILSQIENEYGTVQK---AYGQEGLAYVQWAAQMAEGLQ  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQN AP  VI++CNG +CG TF GPN  NKPS+WTENWT Q           
Sbjct  210   TGVPWVMCKQNNAPGHVINSCNGMKCGQTFVGPNSPNKPSIWTENWTTQ-----------  258

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+ +  F A K GS++ YYMY+GGTN+GRT ++FVTT YYD+ PLDE+GL   PK
Sbjct  259   SAEDIAFHVTLFIAAKKGSFVNYYMYHGGTNFGRTASAFVTTSYYDQAPLDEYGLTTQPK  318

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             W HL++ HAA++L   PL  G      L   Q+   F N     CAAFL NN+++   S+
Sbjct  319   WGHLKELHAAIKLCSTPLLSGVQVNLYLGPQQQAYIF-NAVSGECAAFLINNDSSNAASV  377

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              FR   Y LP  S S+LPDCK       N+ +Q+  R     ++    D  W+ F E IP
Sbjct  378   PFRNASYDLPPMSISILPDCK-------NVSTQYTTRTMGRGEVLDAAD-AWQEFTEAIP  429

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D+   ++   LE    TKD+SDY WY+ R +    D         +LDV S+GHAL A
Sbjct  430   NFDSTSKRSKTLLEQMNTTKDSSDYLWYTFRFQHESSDTQA------ILDVSSLGHALHA  483

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             FVNG+ VGS  G+  +        V L  G N+++LL V+ G P+SGA ++ R  G R V
Sbjct  484   FVNGQSVGSVQGSRKNPRFKFETSVSLSKGINNVSLLSVMVGMPDSGAFLENRAAGLRTV  543

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDA  1913
              I+          + SW + +G+ GE L+++TE+GS +V+WK  +N   P+TWYKT  DA
Sbjct  544   MIRDKQDNNDFTNY-SWGYQIGLQGETLQIYTEQGSSQVQWKKFSNAGNPLTWYKTQVDA  602

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P G+ PVAL + +M KG  WVNG+SIGRYW         PS   YH+PR+F+KP  NL+V
Sbjct  603   PPGDVPVALNLASMGKGEAWVNGQSIGRYW---------PS---YHVPRSFLKPTGNLVV  650

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQ--VVEDIRPSVRLK  2267
             + EE+GG+P  + L  V+   +C  V+  +   V SW    +  +    V   RP V L 
Sbjct  651   LQEEEGGNPLQVSLDTVSISQVCGHVTASHLAPVSSWIEHNQRYKSPAKVSGRRPKVLLA  710

Query  2268  CPEDKVVKKIEFANYGDPDGACGN-FIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
             CP    + +I FA+YG P G C N   VG C   N+  +VE+ACLGK +C +PV    F 
Sbjct  711   CPSKSKISRISFASYGTPLGNCRNSMAVGTCHSQNSKAVVEEACLGKMKCSIPVSVRQF-  769

Query  2445  EGSKDLCPNLVHKTLAVQAKC  2507
                 D CP    K+L V A+C
Sbjct  770   --GGDPCPAKA-KSLMVVAEC  787



>gb|KDP32835.1| hypothetical protein JCGZ_12127 [Jatropha curcas]
Length=778

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/799 (44%), Positives = 494/799 (62%), Gaps = 44/799 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  PEMWP ++ +AK GG++VIQTYVFWN+HEP +GQ++F G
Sbjct  21    LIIDGHHRILFSGSIHYPRSTPEMWPSLISKAKNGGIDVIQTYVFWNLHEPHRGQYDFSG  80

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               D+VKFIK I   G+YV LR+GP++EAEW +GG PYWL ++P I FR+ N+PF +HM++
Sbjct  81    RKDIVKFIKEIQAQGLYVALRIGPYIEAEWTYGGLPYWLHDIPGIVFRSDNDPFKHHMQR  140

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK  +L+A QGGPII++QIENEY ++E+   A  +   +Y+NWAA MA+ L 
Sbjct  141   FVTKIVNIMKYHRLYASQGGPIIISQIENEYQNVEA---AFHENGPRYVNWAASMAVRLQ  197

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  VI+TCNG +CG+TF GPN  NKP+MWTENWT+ Y+T+G     R
Sbjct  198   TGVPWMMCKQDDAPDPVINTCNGMRCGETFKGPNSPNKPAMWTENWTSFYQTYGGETYMR  257

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+    F A K  SY+ YYMY+GGTN+GRT ++F+ T YYD+ PLDE+G    PK
Sbjct  258   SAEDIAFHAALFIAKKG-SYINYYMYHGGTNFGRTASAFMITSYYDQSPLDEYGQISQPK  316

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+  HA ++     L  G      L   Q+   F+ +N   C AFL NN++     +
Sbjct  317   WGHLKKLHATIKSCSDTLLHGANYTVHLGKLQQAYVFK-ENSGACVAFLVNNSSRRDAQV  375

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+   Y +P  S S+LP+CKT  FN+  + +Q+N R  + S+     +   E ++ETIP
Sbjct  376   LFQNISYQIPRKSISILPNCKTVTFNTAKVNTQYNTRSMIKSRRFNPTETW-EEYEETIP  434

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
               D   ++    L+  ++TKD SDY WY+ R    + D     +   V+  +S GH L A
Sbjct  435   AFDKTSLRETSLLDHMSITKDQSDYLWYTFRF---KNDFP---NAQAVIQAFSHGHVLHA  488

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             ++NG + GS HGN+ +   +L   + LK G ND+ LL    G PN+GA ++++  G R V
Sbjct  489   YINGVYAGSAHGNHSNPIFTLENSIYLKEGENDVALLSATVGLPNAGAYLERKIAGLRRV  548

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW-KPVTNVHPPVTWYKTYFD  1910
             ++Q         T   W + VG+ GE+L+++TE+GS  V+W K   +   P+TWYKT FD
Sbjct  549   SLQ-----NKDFTRYEWGYQVGLVGEELQIYTEKGSSNVQWNKFKGSSQRPLTWYKTLFD  603

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLM  2090
             AP GN+PVAL + +M KG  WVNG+SIGRYWV+F +  G+PSQ  YHIPR+F+KP  NL+
Sbjct  604   APAGNDPVALNLHSMGKGEAWVNGQSIGRYWVSFHTYKGRPSQTWYHIPRSFLKPTGNLL  663

Query  2091  VVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLKC  2270
             V+ EE+ G P  I +  ++   +C                     R V E    +V L C
Sbjct  664   VLLEEEQGYPPDITVDTISITRVC---------------------RHVSESHFSAVHLSC  702

Query  2271  PEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEG  2450
             P +  +  I+FA++G P G C ++ +GNC   N+  + EKAC+GK +C +      F   
Sbjct  703   PRNMKISSIQFASFGTPVGNCESYAIGNCHSSNSKAVAEKACIGKQKCSIVRSNQFF---  759

Query  2451  SKDLCPNLVHKTLAVQAKC  2507
               D CP  + K L V A+C
Sbjct  760   GGDPCPG-IPKALLVAAEC  777



>ref|XP_010095419.1| Beta-galactosidase 16 [Morus notabilis]
 gb|EXB60111.1| Beta-galactosidase 16 [Morus notabilis]
Length=783

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/804 (44%), Positives = 488/804 (61%), Gaps = 68/804 (8%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             IDG   ILF+GSIHYPR  PEMWP ++ +AKEGG++VIQTYVFWN+HEP Q +++F G N
Sbjct  38    IDGQHRILFSGSIHYPRSTPEMWPSLIAKAKEGGIDVIQTYVFWNLHEPQQEKYDFSGRN  97

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK I   G+YV LR+GPF+E EW++GGFP+WL ++P I FRT NEPF   M++FA
Sbjct  98    DLVRFIKEIQAQGLYVCLRIGPFIEGEWSYGGFPFWLHDIPDIVFRTDNEPFKKEMQRFA  157

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               IVDMMK+ +L+A QGGPIIL+QIENEY  +E    A  +  K Y+ WAA+MA+GL   
Sbjct  158   TKIVDMMKEERLYASQGGPIILSQIENEYKLVEE---AFHEKGKSYVRWAANMAVGLQTG  214

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ++AP  VI+TCNG +CG+TF GPN   KP++WTENWT+   T+G+ P  RS 
Sbjct  215   VPWVMCKQDDAPDPVINTCNGMRCGETFAGPNSPQKPALWTENWTSFVETYGEEPYIRSP  274

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E IA+ +  F A K  SY+ YYMY+GGTN+GR+ ++FV T YYD+ PLDE+GL R PKW 
Sbjct  275   EEIAFHVALFIAKKG-SYVNYYMYHGGTNFGRSASAFVKTSYYDQAPLDEYGLTRQPKWG  333

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFR  1202
             HL++ HAA++L  +PL  G  T   L   Q+   + +     CAAFL NN +    + F 
Sbjct  334   HLKELHAAMKLCSKPLTSGQQTTLPLGQLQQAYVYGDYKSGDCAAFLVNNGSKDAEVLFY  393

Query  1203  GTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTID  1382
                Y LP  S S+LPDCK   FN+  + +Q++ R  VP +  G  + +WE F+E +P  D
Sbjct  394   NVLYQLPRKSISILPDCKAVAFNTAKVSTQYDTRTMVPCEKFGSKE-RWEDFREAMPDFD  452

Query  1383  NLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVN  1562
                ++    LE    TKD SDY WY+ R +    +          L+V S GH L AFVN
Sbjct  453   KTSLRATVLLEQMNTTKDESDYLWYTLRFQHDSPNAQA------TLNVQSCGHVLRAFVN  506

Query  1563  GEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQ  1742
             G F                                      NSGA ++++  G R V I+
Sbjct  507   GHF--------------------------------------NSGAYLERKVAGLRSVRIE  528

Query  1743  GLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV---TNVHPPVTWYKTYFDA  1913
             G      +     W + VG+SGE+L+++++ GS+KV+W       N   P+TWYK  FDA
Sbjct  529   GKDFSRYL-----WGYQVGLSGEQLQIYSDLGSRKVEWNKFGSSDNQPQPLTWYKIEFDA  583

Query  1914  PEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMV  2093
             P G+ P+AL + +M KG  W+NG++IGRYWV+F +  GQPSQ  Y++PR+F+KP  NL++
Sbjct  584   PAGSEPLALNLGSMGKGQAWINGQNIGRYWVSFHTYKGQPSQTWYNVPRSFLKPSGNLLI  643

Query  2094  VFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW--ERKG----EELRQVVEDIRPS  2255
             + EE+ G+P  I L  V+    C  VS+ +   V SW  E++G       ++      P 
Sbjct  644   LLEEENGNPLGISLDRVSTTRACVKVSESHLPPVTSWLVEKQGGVKKNNRQKNGRKTPPY  703

Query  2256  VRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKS  2435
             V+L CP  + + KI FA+YG+P G C ++  G+C   N+  IV++ACLGK  C +     
Sbjct  704   VQLSCPRGRTISKILFASYGNPAGDCQSYAQGSCHASNSKTIVKQACLGKRSCSISASNG  763

Query  2436  LFQEGSKDLCPNLVHKTLAVQAKC  2507
              F     D CP L+ KTL + A+C
Sbjct  764   KF----GDPCPGLL-KTLVIDAQC  782



>ref|XP_008656261.1| PREDICTED: beta-galactosidase 7-like isoform X1 [Zea mays]
Length=820

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/798 (45%), Positives = 494/798 (62%), Gaps = 33/798 (4%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             +DG R +LFAG +HYPR  PEMWP ++ +AKEGGL+VIQTYVFWN+HEP+QGQ+NFEG  
Sbjct  48    LDGARRMLFAGEMHYPRSTPEMWPKLIAKAKEGGLDVIQTYVFWNVHEPIQGQYNFEGRY  107

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK I   G+YV+LR+GPF+E+EW +GGFP+WL +VP I FR+ NEPF  HM++F 
Sbjct  108   DLVRFIKEIQAQGLYVSLRIGPFIESEWKYGGFPFWLHDVPNITFRSDNEPFKQHMQRFV  167

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               IV+MMK   L+ PQGGPII +QIENEY  +E   PA     ++Y++WAA MA+ L   
Sbjct  168   TDIVNMMKHEGLYYPQGGPIITSQIENEYQMVE---PAFGSSGQRYVSWAAAMAVDLQTG  224

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW MCKQN+AP  VI+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G+    RS 
Sbjct  225   VPWTMCKQNDAPDPVINTCNGLICGETFVGPNSANKPALWTENWTSRYLIYGNDTKLRSP  284

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             ++I +++  F A KNGSY+ YYMY+GGTN+GR  +S+VTT YYD  PLDE+GL   P W 
Sbjct  285   QDITFAVALFIARKNGSYVSYYMYHGGTNFGRFASSYVTTSYYDGAPLDEYGLIWQPTWG  344

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-IKF  1199
             HLR+ HAA++ S  PL  GT +   +   QE   FE +    C AFL N +    S + F
Sbjct  345   HLRELHAAVKQSSEPLLFGTYSNLSIGQEQEAHIFETET--QCVAFLVNFDQHHISEVVF  402

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK-WEMFQETIPT  1376
             R     L   S S+L DCK  VF +  + +QH +R     ++    D+  W+ F+E IP 
Sbjct  403   RNISLELAPKSISILLDCKQVVFETAKVNAQHGSR--TAEEVQSFSDISTWKAFKEPIPQ  460

Query  1377  -IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
              +        R  E  + TKD +DY WY    E++  D       L +++V S  H L A
Sbjct  461   DVSKSAYSGNRLFEHLSTTKDATDYLWYIVGYEYTPSDDGQ----LVLINVESRAHILHA  516

Query  1554  FVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             FVN  +VG  HG++   A +     + L+ G N I+LL  + G P+SGA M++R  G R 
Sbjct  517   FVNNAYVGRIHGSHGGPANIIFSTNISLQEGPNTISLLSAMVGSPDSGAHMERRVFGIRK  576

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV-HPPVTWYKTYF  1907
             V+IQ       ++    W + VG+ GE+  ++T++ S+  +W  + N+ + P+TWYKT F
Sbjct  577   VSIQQGQEPENLLNNELWGYQVGLFGERNNIYTQD-SKITEWTTIDNLTYSPLTWYKTTF  635

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
               P GN+ V L +  M KG VWVNG+SIGRYWV+F +P G PSQ  YHIPR F+ P++N 
Sbjct  636   STPVGNDAVTLNLTGMGKGEVWVNGESIGRYWVSFKAPSGNPSQSLYHIPREFLNPQDNT  695

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +V+FEE GG+P  I +  ++   +C +V++    +++             +D  P+V L 
Sbjct  696   LVLFEEMGGNPQLITVNTMSVSRVCGNVNELSAPSLQ------------YKDKEPAVDLW  743

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CPE K +  IEFA+YG P G C  F  G C   ++  +V++ACLGKS C VPV    F  
Sbjct  744   CPEGKHISAIEFASYGGPTGDCKKFGFGRCHAGSSESVVKQACLGKSGCSVPVTPIKF--  801

Query  2448  GSKDLCPNLVHKTLAVQA  2501
                D CP  + K+L V A
Sbjct  802   -GGDPCPG-IQKSLLVVA  817



>ref|XP_008656262.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Zea mays]
Length=820

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/798 (45%), Positives = 494/798 (62%), Gaps = 33/798 (4%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             +DG R +LFAG +HYPR  PEMWP ++ +AKEGGL+VIQTYVFWN+HEP+QGQ+NFEG  
Sbjct  48    LDGARRMLFAGEMHYPRSTPEMWPKLIAKAKEGGLDVIQTYVFWNVHEPIQGQYNFEGRY  107

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK I   G+YV+LR+GPF+E+EW +GGFP+WL +VP I FR+ NEPF  HM++F 
Sbjct  108   DLVRFIKEIQAQGLYVSLRIGPFIESEWKYGGFPFWLHDVPNITFRSDNEPFKQHMQRFV  167

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               IV+MMK   L+ PQGGPII +QIENEY  +E   PA     ++Y++WAA MA+ L   
Sbjct  168   TDIVNMMKHEGLYYPQGGPIITSQIENEYQMVE---PAFGSSGQRYVSWAAAMAVDLQTG  224

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW MCKQN+AP  VI+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G+    RS 
Sbjct  225   VPWTMCKQNDAPDPVINTCNGLICGETFVGPNSANKPALWTENWTSRYLIYGNDTKLRSP  284

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             ++I +++  F A KNGSY+ YYMY+GGTN+GR  +S+VTT YYD  PLDE+GL   P W 
Sbjct  285   QDITFAVALFIARKNGSYVSYYMYHGGTNFGRFASSYVTTSYYDGAPLDEYGLIWQPTWG  344

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-IKF  1199
             HLR+ HAA++ S  PL  GT +   +   QE   FE +    C AFL N +    S + F
Sbjct  345   HLRELHAAVKQSSEPLLFGTYSNLSIGQEQEAHIFETET--QCVAFLVNFDQHHISEVVF  402

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK-WEMFQETIPT  1376
             R     L   S S+L DCK  VF +  + +QH +R     ++    D+  W+ F+E IP 
Sbjct  403   RNISLELAPKSISILLDCKQVVFETAKVNAQHGSR--TAEEVQSFSDISTWKAFKEPIPQ  460

Query  1377  -IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
              +        R  E  + TKD +DY WY    E++  D       L +++V S  H L A
Sbjct  461   DVSKSAYSGNRLFEHLSTTKDATDYLWYIVGYEYTPSDDGQ----LVLINVESRAHILHA  516

Query  1554  FVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
             FVN  +VG  HG++   A +     + L+ G N I+LL  + G P+SGA M++R  G R 
Sbjct  517   FVNNAYVGKIHGSHGGPANIIFSTNISLQEGPNTISLLSAMVGSPDSGAHMERRVFGIRK  576

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV-HPPVTWYKTYF  1907
             V+IQ       ++    W + VG+ GE+  ++T++ S+  +W  + N+ + P+TWYKT F
Sbjct  577   VSIQQGQEPENLLNNELWGYQVGLFGERNNIYTQD-SKITEWTTIDNLTYSPLTWYKTTF  635

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
               P GN+ V L +  M KG VWVNG+SIGRYWV+F +P G PSQ  YHIPR F+ P++N 
Sbjct  636   STPVGNDAVTLNLTGMGKGEVWVNGESIGRYWVSFKAPSGNPSQSLYHIPREFLNPQDNT  695

Query  2088  MVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRLK  2267
             +V+FEE GG+P  I +  ++   +C +V++    +++             +D  P+V L 
Sbjct  696   LVLFEEMGGNPQLITVNTMSVSRVCGNVNELSAPSLQ------------YKDKEPAVDLW  743

Query  2268  CPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQE  2447
             CPE K +  IEFA+YG P G C  F  G C   ++  +V++ACLGKS C VPV    F  
Sbjct  744   CPEGKHISAIEFASYGGPTGDCKKFGFGRCHAGSSESVVKQACLGKSGCSVPVTPIKF--  801

Query  2448  GSKDLCPNLVHKTLAVQA  2501
                D CP  + K+L V A
Sbjct  802   -GGDPCPG-IQKSLLVVA  817



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/822 (43%), Positives = 496/822 (60%), Gaps = 41/822 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  P+MW  ++++AK+GGL+VIQTYVFWN HEP  G +NFEG
Sbjct  35    IIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPSPGTYNFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +  +G+YV LRVGP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  95    RYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKMAMQG  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV+MMK   LFA QGGPIIL+QIENEY     +  A     + Y+NWAADMA+GL 
Sbjct  155   FTQKIVEMMKSESLFASQGGPIILSQIENEYG---PESKALGSAGRSYVNWAADMAVGLG  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+ +AP  VI+TCNG  C D+F  PN   KP MWTE W+  +  FG     R
Sbjct  212   TGVPWVMCKEEDAPDPVINTCNGFYC-DSFT-PNKPYKPMMWTEAWSGWFTEFGGTIRHR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE++A+++ RF  N       Y  + G          F+TT Y  + P+DE+GL R+PK
Sbjct  270   PAEDLAFAVARFIQNGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIREPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HL++ H A++L ++ L    PT+  L + Q+   F +++   CAAFL+N+   +   I
Sbjct  330   YGHLKELHKAIKLCEQALVSADPTVTSLGSLQQAHVFSSES-GGCAAFLSNHEPNSYAKI  388

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y LP +S S+LPDC+  VFN+  I  Q +  +  P+       L WE + E + 
Sbjct  389   MFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMYPTN---TQSLMWERYDEEVA  445

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ +N  I     LE   +T+DTSDY WY T ++ S  +   +G  LPVL V S GHAL 
Sbjct  446   SLEENSLITATGLLEQINVTRDTSDYLWYITSVDISSAEEFLKGGKLPVLTVRSAGHALH  505

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              FVNG+  GS +G  ++K +     ++L+ G N I LL V  G PNSG   +   TG   
Sbjct  506   IFVNGQLSGSAYGTRENKRIKFSGNINLRAGTNRIALLSVAVGLPNSGVHYELWSTGVLG  565

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV--HPPVTWYKT  1901
              V +  L  G+  +T+ +WS+ VG+ GE + L + EG+  V+W   + V    P+TWY+ 
Sbjct  566   PVVLHELDEGSRDLTWQTWSYQVGLKGEDMNLNSLEGASSVEWMQGSLVQNQQPLTWYRA  625

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL--------------------SP  2021
             YFDAP+G+ P+AL M +M KG VW+NG+SIGRYW A+                     S 
Sbjct  626   YFDAPDGDEPLALDMASMGKGHVWINGQSIGRYWTAYAPKENCKSCSYTGTYRSPKCQSG  685

Query  2022  LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKS  2201
              GQP+Q  YH+PR++++P  NL+VVFEE GGD + I L++ +  ++C+ VS+++P  +K+
Sbjct  686   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDATKIALMMRSVSSVCADVSEWHP-TIKN  744

Query  2202  WERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKI  2381
             W    E   +  E  +P V L+C   + +  I+FA+YG P G CGNF  G C  PN++ I
Sbjct  745   WHI--ESYGEPEEYRKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSHTI  802

Query  2382  VEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +EK C+GK +C V + ++ F     D CPN V K +AV+A C
Sbjct  803   LEKKCIGKEKCVVAISQANF---GGDPCPN-VMKKVAVEAVC  840



>gb|EMT17497.1| Beta-galactosidase 12 [Aegilops tauschii]
Length=798

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/768 (46%), Positives = 471/768 (61%), Gaps = 63/768 (8%)
 Frame = +3

Query  162   HYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMG  341
             H P  P +MWP +LK AKEGGLN I+TYVFWN HEP  G+FNFEG ND++KF+K+I   G
Sbjct  26    HEPE-PGKMWPRLLKIAKEGGLNTIETYVFWNAHEPEPGKFNFEGRNDMIKFLKLIQSFG  84

Query  342   MYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLF  521
             MY  +R+GPF++ EWN G  PYWL+E+P I FR  NEP+   M+KF + IV M+K   +F
Sbjct  85    MYAIVRIGPFIQGEWNHGALPYWLREIPHIIFRANNEPYKREMEKFVKFIVQMLKDENMF  144

Query  522   APQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPP  701
             A QGG +ILAQIENEY +I+ D    I    KY+ WA +MA+     +PWIMCKQ+ AP 
Sbjct  145   ASQGGHVILAQIENEYGNIKKDH---ITEGDKYLEWAGEMALSTNIGVPWIMCKQSTAPG  201

Query  702   KVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAAN  881
              VI TCNGR CGDT+   +  NKP +WTENWTAQ+R FG+  AQRSAE+IAYS++RF A 
Sbjct  202   VVIPTCNGRHCGDTWVMKD-ENKPHLWTENWTAQFRAFGNDLAQRSAEDIAYSVLRFFA-  259

Query  882   KNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSK  1061
             K G+ + YYMYYGGTN+GRT AS+V T YYDEGP+DE+G+ + PK+ HLRD H  ++   
Sbjct  260   KGGTLVNYYMYYGGTNFGRTGASYVLTGYYDEGPVDEYGMPKAPKYGHLRDLHNVIKSYS  319

Query  1062  RPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SIKFRGTQYYLPGFSTS  1238
             R    G  + + L    E   FE    KLC AF++NNNT    ++ FRG +YY+P  S S
Sbjct  320   RAFLEGKQSFELLGQGYEARNFEIPEEKLCLAFISNNNTGEDGTVNFRGDKYYIPSRSVS  379

Query  1239  VLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLEL  1418
             +L DCK  V+N++ +  QH+ R F  +  A ++++ WEMF E IP+              
Sbjct  380   ILADCKHVVYNTKRVFVQHSERSFHKADKATKNNV-WEMFSEVIPS--------------  424

Query  1419  YTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEF---------  1571
             + L  D                DL  RGDI PVL V S  HALVAFVN  F         
Sbjct  425   FRLEAD----------------DLPIRGDIRPVLAVKSSSHALVAFVNDAFAAKSRYQLQ  468

Query  1572  ---------------VGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMD  1706
                             G+ HG   +K  +  +P++L+ G N + LL    G  +SG  + 
Sbjct  469   ALTIVLKRDLITTINAGNGHGTKKEKGFTFDRPINLRLGVNHLALLSSSMGMKDSGGELV  528

Query  1707  KRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPV  1886
             +   G +D TIQGL  GTL +  N W H   + GE+ +++TE+G   VKW P T+    V
Sbjct  529   ELKGGIQDCTIQGLNTGTLDLQVNGWGHKAKLEGEEKEIYTEKGMGAVKWVPATSGQ-AV  587

Query  1887  TWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAF  2066
             TWYK YFD P+G++PV L M +M KGM++VNG+ +GRYW +F++P    SQ  YHIPR F
Sbjct  588   TWYKRYFDEPDGDDPVVLDMTSMCKGMIFVNGEGMGRYWTSFITPGKVASQAVYHIPRPF  647

Query  2067  MKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDI  2246
             +K KNNL+VVFEE+ G P  I +  V RD IC  +S++ P  +K W+  G +++ + ED 
Sbjct  648   LKSKNNLLVVFEEELGKPEGILIQTVRRDDICVFISEHNPAQIKPWDEHGGQIKLIAEDH  707

Query  2247  RPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEK  2390
                  L CP  K ++++ FA++G+P G+CGNF VG C  PNA  IV K
Sbjct  708   NTRGFLNCPPKKTIQEVVFASFGNPVGSCGNFTVGTCHVPNAKDIVAK  755



>ref|XP_004970752.1| PREDICTED: beta-galactosidase 7-like [Setaria italica]
Length=829

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/805 (44%), Positives = 501/805 (62%), Gaps = 34/805 (4%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R +LF+G +HYPR  PEMWPD++ +AK+GGL+VIQTYVFWN+HEP+QGQ+NFEG
Sbjct  52    LILDGARRMLFSGDMHYPRSTPEMWPDLIAKAKKGGLDVIQTYVFWNVHEPLQGQYNFEG  111

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFI+ I   G+YV+LRVGPF+E+EW +GG P+WL+++P I FR  NEPF  HM+K
Sbjct  112   RYDLVKFIREIHAQGLYVSLRVGPFIESEWKYGGLPFWLRDIPNITFRCDNEPFKRHMQK  171

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK  +LF PQGGPII++QIENEY  +E+   A       Y++WAA MA+ L 
Sbjct  172   FVTKIVNLMKDERLFYPQGGPIIISQIENEYKLVEA---AFHSKGPPYVHWAAAMAVNLQ  228

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +I+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G     R
Sbjct  229   TGVPWMMCKQDDAPSPIINTCNGLICGETFLGPNSPNKPALWTENWTSRYPVYGQDQRYR  288

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA ++A+++  F A K GS++ YYMY+GGTN+GR  +S+VTT YYD  PLDE+GL   P 
Sbjct  289   SAADLAFAVALFIARKKGSFVNYYMYHGGTNFGRFASSYVTTSYYDGAPLDEYGLIWQPT  348

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSI  1193
             W+HLR+ HAA++ S  PL  G  +       QE   F  ++   C AFL N +    ++I
Sbjct  349   WAHLRELHAAVKQSAEPLLWGAYSNHSFGQQQEGHVFATES--ECVAFLVNFDKHKISTI  406

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             +F    + L   S S+L  C+  VF +  I +QH  R     +     D +W+ F+E IP
Sbjct  407   QFGEEVFQLAPKSISILSQCRELVFETGKINAQHGLRTAKVVQSLNHVD-RWKTFKEPIP  465

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             T   N+     +  E  + TKD +DY WY T   +     S  G +  VL+V +  H L 
Sbjct  466   TSPSNISHVGNQLYEHLSTTKDETDYLWYLTTYNYRR---SGNGQL--VLNVEAHAHILH  520

Query  1551  AFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
             AF+N ++VG  HG++D    + L+ P+ L+ G N I+LL V+ G P+SGA M++R  G R
Sbjct  521   AFINNDYVGIVHGSHDKPGNIVLKAPILLREGRNSISLLCVMVGSPDSGAYMERRIFGIR  580

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPV-TNVHPPVTWYKTY  1904
              V+I+        +    W H VG+SGE  K++T  GS + +W  +  ++H P+ WYKT 
Sbjct  581   KVSIKRRQQRPCSMNNEMWKHQVGLSGEINKVYTSGGSSRAEWTAIDRSMHLPLIWYKTT  640

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNN  2084
             FD P GN+PV L + +M KG VW+NG+SIGRYWV+F +P GQPSQ  YHIPR F+K  +N
Sbjct  641   FDTPWGNDPVTLNLSSMGKGEVWINGESIGRYWVSFKTPSGQPSQSLYHIPRRFLKSGDN  700

Query  2085  LMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             L+V+ EE GGDP  I +  V+   I  SVS++   ++ S E              P+V L
Sbjct  701   LLVLMEEIGGDPLQITVNTVSVTRIYGSVSEFSTPSLLSREN------------HPAVHL  748

Query  2265  KCPEDKVVKKIEFANYGDPDGAC---GNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKS  2435
             +C + K +  IEFA+YG+P   C   G    G+C    +  +V+ AC G+ +C VPV  +
Sbjct  749   RCQKGKRITDIEFASYGNPVEDCRESGRSCHGSCHAEMSEFVVKNACQGRRKCAVPVRAA  808

Query  2436  LFQEGSKDLCPNLVHKTLAVQAKCG  2510
              F     D CP +  K+L+V A CG
Sbjct  809   KF---GADPCPGIA-KSLSVVAICG  829



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/823 (42%), Positives = 492/823 (60%), Gaps = 42/823 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R IL +GSIHYPR  PEMW  ++++AK+GGL+VIQTYVFWN HEP  G +NFEG
Sbjct  28    IIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPSPGTYNFEG  87

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +  +G+YV LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  88    RYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKMAMQG  147

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV MMK   LF  QGGPIIL+QIENEY     +  A       Y+NWAA+MA+GL 
Sbjct  148   FTQKIVQMMKSESLFGSQGGPIILSQIENEYG---PESKAFGSAGHSYVNWAAEMAVGLK  204

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+ CNG  C D+F  PN   KP+MWTE W+  +  FG     R
Sbjct  205   TGVPWVMCKEDDAPDPVINACNGFYC-DSFT-PNKPYKPTMWTEAWSGWFTEFGGTIHHR  262

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E++A+++ RF          Y  + G          F+TT Y  + P+DE+GL R+PK
Sbjct  263   PVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVREPK  322

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HL++ H A++L +R L    PT+  L + Q+   F +Q+   CAAFL+N+N  +   +
Sbjct  323   YGHLKELHRAIKLCERALVSADPTVISLGSLQQAHVFSSQS-GGCAAFLSNHNPNSFARV  381

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y +P +S S+LPDC+  VFN+  +  Q +  +  P  +     L WE + E + 
Sbjct  382   MFNNMHYNIPPWSISILPDCRNVVFNTAKVGVQTSQMQMYPINV---QSLMWERYDEEVA  438

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ +N  I     LE   +T+DTSDY WY T ++ S  +   RG   PVL V S GHAL 
Sbjct  439   SLEENSLITTTGLLEQINVTRDTSDYLWYITSVDVSPAEGFLRGRKRPVLMVESAGHALH  498

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              FVNG+  GS +G+ +D+ +     V+L+ G N I LL V  G PN+G   +   TG   
Sbjct  499   IFVNGQLSGSAYGSREDRRIKFSGNVNLRAGTNRIALLSVAVGLPNAGVHYELWSTGVLG  558

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G+  +T+  WS+ +G+ GE + L + EG+  V+W     V     P+TWY+
Sbjct  559   PVVLHGLDEGSRDLTWQKWSYQLGLKGEAMNLNSLEGASSVEWMQGSLVAQNQQPLTWYR  618

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL--------------------S  2018
              YFDAP+GN+P+AL M +M KG VW+NG+SIGRYW A+                     S
Sbjct  619   AYFDAPDGNDPLALDMGSMGKGHVWINGQSIGRYWTAYAPSEYCNSCSYRGTYRSPKCQS  678

Query  2019  PLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVK  2198
               GQP+Q  YH+PR++++P  NL++VFEE GGD + I L   +  ++C+ VS+++P  +K
Sbjct  679   GCGQPTQRWYHVPRSWLQPTRNLLIVFEELGGDATKISLAKRSVSSVCADVSEWHP-TIK  737

Query  2199  SWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANK  2378
             +W    E   +  E  +P V L+C + + +  I+FA+YG P G CGNF  G C  PN++ 
Sbjct  738   NWHI--ENYGRPEEHHKPKVHLRCAQGQFISAIKFASYGTPIGTCGNFQQGACHSPNSHT  795

Query  2379  IVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             I+EK C+GK +C V + +++F     D C N V K +AV+A C
Sbjct  796   ILEKMCIGKEKCMVAISQNIF---GGDPCRN-VMKRVAVEAIC  834



>ref|XP_006655346.1| PREDICTED: beta-galactosidase 7-like, partial [Oryza brachyantha]
Length=799

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/801 (44%), Positives = 496/801 (62%), Gaps = 34/801 (4%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             + G R +LF+G +HY R  PEMWP ++ +AK GGL+VIQTYVFWN+HE +QGQ+NFEG  
Sbjct  26    VSGARRMLFSGDMHYSRSTPEMWPKLIAKAKAGGLDVIQTYVFWNVHEHIQGQYNFEGRY  85

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLVKFI+ I   G+YV+LR+GPF+EAEW +GGFP+WL +VP I FRT NEPF  HM+ F 
Sbjct  86    DLVKFIRAIQAKGLYVSLRIGPFVEAEWKYGGFPFWLHDVPNITFRTDNEPFKQHMQNFV  145

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               IV +MK   L+ PQGGPII++QIENEY  +E    +      +Y+ WAA MA+ L   
Sbjct  146   TKIVTLMKHEGLYYPQGGPIIISQIENEYQMVEHAFGSG---GPRYVRWAAAMAVNLQTG  202

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQN+AP  VI+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G+    RS 
Sbjct  203   VPWMMCKQNDAPDPVINTCNGLICGETFVGPNSPNKPALWTENWTSRYPIYGNDTKMRSP  262

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E+IA+++  F A K GS++ YYMY+GGTN+GR  AS+VTT YYD  PLDE+GL   P W 
Sbjct  263   EDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFAASYVTTSYYDGAPLDEYGLIWQPTWG  322

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN--NNTTPTSIK  1196
             HLR+ HAA++ S  PL  G+ +   L   QE   FE      C AFL N   + TP  ++
Sbjct  323   HLREMHAAIKHSSEPLLFGSYSNFSLGQQQEAHVFETG--YECVAFLVNFDQHNTP-KVE  379

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDL-KWEMFQETIP  1373
             FR     L   S S+L DC++ VF +  + +   +R    + +   +++  W+ F E +P
Sbjct  380   FRNISLQLAPKSISILSDCRSVVFETAKVNAPQGSR--TANIVQSLNEINNWKAFIEPVP  437

Query  1374  T-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
               +        +  E  T TKD +DY WY    E    D    GD L  L V S+ H L 
Sbjct  438   QDMSKCMYTGNQLFEQLTTTKDETDYLWYIASYENRASD----GDQLVRLYVVSLAHILH  493

Query  1551  AFVNGEFVGSKHGNNDD-KALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPR  1727
             AFVN E++GS HG++D  + + L   + LK GNN I+LL V+ G P+SGA M++R+ G +
Sbjct  494   AFVNNEYIGSVHGSHDGPRNIVLNTHISLKEGNNTISLLSVMVGSPDSGAYMERRYFGIQ  553

Query  1728  DVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTN-VHPPVTWYKTY  1904
              V IQ       ++  N W + VG+ GE+ +++ +E +  V W  + N  +  +TWYKT 
Sbjct  554   KVGIQQGQQPLHLLNNNLWGYQVGLFGEEDRIYMQEQTDSVGWMDINNWTYHLLTWYKTT  613

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNN  2084
             F  P G++ V L + +M KG VWVNG SIGRYWV+F +P GQPSQ  YHIPR F+KPK+N
Sbjct  614   FATPVGDDAVTLNLTSMGKGEVWVNGDSIGRYWVSFKAPSGQPSQSLYHIPRGFLKPKDN  673

Query  2085  LMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRPSVRL  2264
             L+V+ EE GGDP  I +  ++   +C +V ++   +V   + +G++         P VR+
Sbjct  674   LLVLVEEMGGDPLQITVNTMSVTRVCGNVDEF---SVPRLQSRGKD---------PKVRI  721

Query  2265  KCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEKACLGKSQCKVPVEKSLFQ  2444
              C   K +  IEFA+YG+P G C NF +G+C   ++  +V+++C+G+  C +PV  + F 
Sbjct  722   WCQGGKHISAIEFASYGNPMGDCKNFSIGSCHVESSEFVVKQSCIGRRGCSIPVLPAKF-  780

Query  2445  EGSKDLCPNLVHKTLAVQAKC  2507
                 D CP  + K L V A C
Sbjct  781   --GGDPCPG-IQKRLLVVADC  798



>gb|EYU18852.1| hypothetical protein MIMGU_mgv1a001263mg [Erythranthe guttata]
Length=851

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/831 (42%), Positives = 482/831 (58%), Gaps = 51/831 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R +L +GSIHYPR  PEMWPD+++++K+GGL+VI+TYVFWN+HEP+QGQ++F+G
Sbjct  37    LVIDGKRRVLVSGSIHYPRSTPEMWPDLIQKSKDGGLDVIETYVFWNLHEPIQGQYDFKG  96

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKF+K++ + G+ V LR+GP++ AEWN+GGFP WL  +P I  RT NEPF   MKK
Sbjct  97    GKDLVKFVKLVKEAGLLVHLRIGPYVCAEWNYGGFPLWLHYIPGIVLRTDNEPFKAEMKK  156

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV+MMK+  L+A QGGPIIL+QIENEY +I+S   A     K YINWAA MA  L 
Sbjct  157   FTAKIVEMMKQENLYASQGGPIILSQIENEYGNIDS---AYGNGAKPYINWAASMATSLD  213

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MC+Q++AP  VI+TCNG  C D F  PN  N P MWTENW+  +  FGD    R
Sbjct  214   TGVPWVMCQQSDAPSSVINTCNGFYC-DQFT-PNSKNSPKMWTENWSGWFSAFGDSLPYR  271

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E++A+++ RF          Y  + G      +   F+TT Y  + P+DE+GL R PK
Sbjct  272   PTEDLAFAVARFYQLGGTFQNYYMYHGGTNFGRSSGGPFITTSYDYDAPIDEYGLLRQPK  331

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H A++L +  +    P    L +N E   ++ ++ K CAAFL N  T +  ++
Sbjct  332   WGHLKDVHKAIKLCEEAMVETDPKTTSLGSNLEATVYKTESGK-CAAFLANVGTHSDATV  390

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFV-----PSKLAGRDDL-KWEM  1355
             KF G  Y LP +S S+LPDC   V N+  I S     +FV      S  A  D    W  
Sbjct  391   KFNGNSYNLPAWSVSILPDCNNVVLNTAKINSVSTTTKFVRQTSKDSTTATTDAFSSWSW  450

Query  1356  FQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSM  1535
               E +    ++       +E    T D SDY WYS  ++    +         VL V S+
Sbjct  451   INEPVGISSDIAFTKPGLMEQINTTGDLSDYLWYSLSVDTKGNEPFLEDGSETVLHVNSL  510

Query  1536  GHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKR-  1712
             GHAL AF+NGE VGS  G N +  +S+  P+ LKPG N I LL +  G  N GA  DK  
Sbjct  511   GHALYAFINGELVGSGKGRNSNPKVSIDVPISLKPGKNKIDLLSLTVGLQNYGAFFDKTG  570

Query  1713  --FTGPRDVTIQGLMAG-TLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPP  1883
                TGP  V ++GL  G TL ++   W++ VG+SGE L L +   S  V  +P    + P
Sbjct  571   AGITGP--VQLKGLKNGSTLDLSSQQWTYQVGLSGEDLGLSSGGTSFWVS-QPTLPKNQP  627

Query  1884  VTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP--------------  2021
             + WYKT FDAP G++PVAL    M KG  W+NG+SIGRYW   ++P              
Sbjct  628   LMWYKTTFDAPSGSSPVALDFTGMGKGQAWINGQSIGRYWPTNIAPSSGCTDSCNYRGAY  687

Query  2022  --------LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSD  2177
                      G+PSQ  YH+PR++MKP  N++VVFEE GGDP+ +       ++ICS +S 
Sbjct  688   SDGKCRRNCGKPSQHLYHVPRSWMKPSGNILVVFEEGGGDPTQLSFATRETESICSRISQ  747

Query  2178  YYPGNVKSWERKGEELRQVVEDIRPSVRLKCP-EDKVVKKIEFANYGDPDGACGNFIVGN  2354
              +P  + +W    +E R+     +P++ L CP  ++V+ KI+FA++G+P G CG+F  G 
Sbjct  748   SHPIPIDTWTSSNKETRK---HTKPTLSLSCPFPNQVISKIKFASFGNPKGTCGSFSHGQ  804

Query  2355  CSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             CS  NA  IVEKAC+G   C + V  + F E         + K+LAV+A C
Sbjct  805   CSSKNARTIVEKACIGSRSCSIGVSVNTFGEPCAG-----ISKSLAVEASC  850



>ref|XP_009757670.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=839

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/824 (44%), Positives = 475/824 (58%), Gaps = 47/824 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMWP ++++AK+GGL++I+TYVFWN HEP  G+F FEG
Sbjct  35    IIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHEPSPGKFKFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++   G+YV LR+GP++  EWNFGGFP WLK VP + FR  N PF   M+ 
Sbjct  95    RYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADNHPFKLAMQG  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F E IV+MMK   LF PQGGPIILAQIENEY  IE +  +     K Y  WAA MA+GL 
Sbjct  155   FVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSP---GKAYTKWAAAMAVGLE  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VIDTCNG  C D    PN   KP MWTE WTA Y  FG P  +R
Sbjct  212   IGVPWIMCKQEDAPDPVIDTCNGFYCED--FRPNKPYKPKMWTEVWTAWYTKFGGPVPRR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE++A+S+ RF  N    +  Y  + G      T+A F+ T Y  + PL+E+GL  +PK
Sbjct  270   PAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGLLNEPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             + HLRD H A++LS+  L    PT+  L  NQE   F +++   CAAFL+N +T     +
Sbjct  330   YGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGD-CAAFLSNYDTKYSVKV  388

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+ TQY LP +S S+LPDCKTAV+N+  I SQ +     P  + G   L W+ + E  P
Sbjct  389   TFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAP--VVG--SLSWQSYSEETP  444

Query  1374  TI---DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             +    D L    L  LE   +T+D+SDY WY T +     +   +    P L V S GHA
Sbjct  445   SAEESDTLSANGL--LEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHA  502

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  F+NG+  G+ +G  D+  L+    V L+ G N I+LL V  G PN G   +   TG 
Sbjct  503   MHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGV  562

Query  1725  RD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW--KPVTNVHPPVTWY  1895
                VT+ GL  GT  +T   WS+ VG+ GE L   T  G   V+W    +     P+TWY
Sbjct  563   LGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWY  622

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP------------------  2021
             K  FDAPEGN+PVAL M +M KG +WVNG+ +GR+W  +++                   
Sbjct  623   KATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAKGHCGECNYAGEYTEKKCQ  682

Query  2022  --LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV  2195
                GQPSQ  YH+PR+++KP  NL+VVFEE GG P+ I LV      +C+ + D  P  +
Sbjct  683   TNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQP-TL  741

Query  2196  KSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNAN  2375
             K+W   G        ++ P   L CP+ K + KI+FA+YG P G CGNF  G C    + 
Sbjct  742   KNWRTVGSGKSN---NMHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHARKSY  798

Query  2376  KIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                EK C+G+  C V V   +F     D CPN   K L+V+A C
Sbjct  799   DAFEKNCIGRQSCSVNVVPEVF---GGDPCPN-TSKKLSVEAIC  838



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/822 (42%), Positives = 482/822 (59%), Gaps = 41/822 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMW D++++AKEGGL+VIQTYVFWN+HEP  G +NFEG
Sbjct  34    IIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVIQTYVFWNVHEPSPGNYNFEG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK +   G+YV LR+GP++  EWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  94    RYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPFKMAMQG  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV+MMK   LF  QGGPIIL+QIENEY    ++  A       Y+ WAA+MA+GL 
Sbjct  154   FTQKIVEMMKSEMLFESQGGPIILSQIENEYG---TESKAFGAAGHAYMTWAANMAIGLG  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+ +AP  VI+ CNG  C D FH PN   KP+MWTE W+  +  FG    QR
Sbjct  211   TGVPWVMCKEGDAPDPVINACNGFYC-DAFH-PNKPYKPAMWTEAWSGWFTEFGGTVHQR  268

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               +++A+++ RF  N       Y  + G          F+TT Y  + P+DE+GL R PK
Sbjct  269   PVQDLAFAVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRQPK  328

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HL++ H A++L +R L    PTI  L + Q+   F +++   CAAF+ N +  +   +
Sbjct  329   YGHLKELHRAIKLCERSLVSSDPTITSLGSYQQAHVFSSESGD-CAAFIANYDPNSAARV  387

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y LP +S S+LPDC+  VFN+  +  Q +  + +PS     +   WE + E + 
Sbjct  388   MFNNMHYNLPPWSISILPDCRNMVFNTAKVGVQTSQMQMLPSN---SELFSWETYDEDVS  444

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ DN  I ++  LE   +T+DTSDY WY T ++ S  +   RG   P L V S GHAL 
Sbjct  445   SLEDNSMITSVGLLEQINVTRDTSDYLWYITSVDISSSESFLRGGQSPTLIVESTGHALH  504

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F+NG+  GS  G  +++       V+L+ G N I LL +  G PN G   +   TG   
Sbjct  505   VFINGQLSGSASGTRENRRFMFTGKVNLRAGINKIALLSIAVGLPNVGTHFEAWKTGILG  564

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G + +T+  WS+ VG+ GE + L +  G   V W     V     P+TWYK
Sbjct  565   PVVLHGLDQGKMDLTWQKWSYQVGLKGEAMNLVSPNGISSVDWMQGSLVVQKQQPLTWYK  624

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------P  2021
              YF+APEG+ P+AL M +M KG VW+NG+SIGRYW  + +                    
Sbjct  625   AYFNAPEGDEPLALDMSSMGKGQVWINGQSIGRYWTIYANGNCNGCSYSGTFRPPKCQIG  684

Query  2022  LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKS  2201
              GQP+Q  YH+PR+++KP  NL+VVFEE GGD S I LV  +  ++C+ VS+++P N+K+
Sbjct  685   CGQPTQRWYHVPRSWLKPTQNLLVVFEEIGGDASGISLVKRSVSSVCADVSEWHP-NIKN  743

Query  2202  WERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKI  2381
             W+   E   +  E  RP V L+C   + +  I+FA++G P G CG+F  G C  P +  +
Sbjct  744   WQI--ESYGRTQEFHRPKVHLRCAPGQSISAIKFASFGTPLGTCGSFQQGICHAPTSYSV  801

Query  2382  VEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +E+ C+G+ +C V +    F     D CPN++ K L V+A C
Sbjct  802   LEERCVGQERCSVTISNRNF---GADPCPNVL-KRLTVEAIC  839



>ref|XP_009757671.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/824 (44%), Positives = 475/824 (58%), Gaps = 47/824 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMWP ++++AK+GGL++I+TYVFWN HEP  G+F FEG
Sbjct  35    IIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHEPSPGKFKFEG  94

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++   G+YV LR+GP++  EWNFGGFP WLK VP + FR  N PF   M+ 
Sbjct  95    RYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADNHPFKLAMQG  154

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F E IV+MMK   LF PQGGPIILAQIENEY  IE +  +     K Y  WAA MA+GL 
Sbjct  155   FVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSP---GKAYTKWAAAMAVGLE  211

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VIDTCNG  C D    PN   KP MWTE WTA Y  FG P  +R
Sbjct  212   IGVPWIMCKQEDAPDPVIDTCNGFYCED--FRPNKPYKPKMWTEVWTAWYTKFGGPVPRR  269

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE++A+S+ RF  N    +  Y  + G      T+A F+ T Y  + PL+E+GL  +PK
Sbjct  270   PAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGLLNEPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             + HLRD H A++LS+  L    PT+  L  NQE   F +++   CAAFL+N +T     +
Sbjct  330   YGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGD-CAAFLSNYDTKYSVKV  388

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+ TQY LP +S S+LPDCKTAV+N+  I SQ +     P  + G   L W+ + E  P
Sbjct  389   TFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAP--VVG--SLSWQSYSEETP  444

Query  1374  TI---DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             +    D L    L  LE   +T+D+SDY WY T +     +   +    P L V S GHA
Sbjct  445   SAEESDTLSANGL--LEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHA  502

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  F+NG+  G+ +G  D+  L+    V L+ G N I+LL V  G PN G   +   TG 
Sbjct  503   MHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGV  562

Query  1725  RD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW--KPVTNVHPPVTWY  1895
                VT+ GL  GT  +T   WS+ VG+ GE L   T  G   V+W    +     P+TWY
Sbjct  563   LGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWY  622

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP------------------  2021
             K  FDAPEGN+PVAL M +M KG +WVNG+ +GR+W  +++                   
Sbjct  623   KATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAKGHCGECNYAGEYTEKKCQ  682

Query  2022  --LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV  2195
                GQPSQ  YH+PR+++KP  NL+VVFEE GG P+ I LV      +C+ + D  P  +
Sbjct  683   TNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQP-TL  741

Query  2196  KSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNAN  2375
             K+W   G        ++ P   L CP+ K + KI+FA+YG P G CGNF  G C    + 
Sbjct  742   KNWRTVGSGKSN---NMHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHARKSY  798

Query  2376  KIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                EK C+G+  C V V   +F     D CPN   K L+V+A C
Sbjct  799   DAFEKNCIGRQSCSVNVVPEVF---GGDPCPN-TSKKLSVEAIC  838



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/820 (41%), Positives = 485/820 (59%), Gaps = 41/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R +LF+GSIHYPR  PEMW D++ +AKEGGL+V++TYVFWN+HEP  G +NFEG  
Sbjct  37    INGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNVHEPSPGNYNFEGRY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FR  NEPF N MK +A
Sbjct  97    DLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRADNEPFKNAMKGYA  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV++MK   LF  QGGPIIL+QIENEY        A      +Y  WAA+MA+GL   
Sbjct  157   EKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAP---GHQYATWAANMAVGLDTG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+ +AP  VI+TCNG  C + F  PN   KP++WTE W+  +  FG P  QR  
Sbjct  214   VPWVMCKEEDAPDPVINTCNGFYCDNFF--PNKPYKPAIWTEAWSGWFSEFGGPLHQRPV  271

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ +F          Y  + G          F+TT Y  + P+DE+GL R PK+ 
Sbjct  272   QDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRQPKYG  331

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL++ H A+++ ++ +    P I  L N Q+   + ++  + CAAFL+NN+  +   + F
Sbjct  332   HLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSETGE-CAAFLSNNDWKSAARVMF  390

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+  VFN+  +  Q +    +P+     + L WE + E +  +
Sbjct  391   NNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTN---SEMLSWETYSEDMSAL  447

Query  1380  DN-LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             D+   I++   LE   +T+DTSDY WY T ++    +    G  LP L V + GHA+  F
Sbjct  448   DDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGHAMHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS  G   ++    +  V+L+ G+N I LL V  G PN G   +   TG    V
Sbjct  508   INGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTGVLGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              IQGL  G   +++  W++ VG+ GE + L +  G   V W     +     P+TW+K Y
Sbjct  568   AIQGLDQGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLTWHKAY  627

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------PLG  2027
             F+ PEG+ P+AL M +M KG VW+NG+SIGRYW A+ +                     G
Sbjct  628   FNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGTFRPPKCQLGCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             +P+Q  YH+PR+++KP  NL+V+FEE GGDP+ I LV  +   +CS+V++Y+P N+K+W+
Sbjct  688   EPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP-NIKNWQ  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                E   +  E   P VR+ C   + +  I+FA++G P G CG+F  G C  P+++ +VE
Sbjct  747   I--ENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSHAVVE  804

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K CLG+  C V +  S F E   D CPN++ K L+V+A C
Sbjct  805   KKCLGRQSCAVTISNSNFGE---DPCPNVL-KRLSVEAHC  840



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/820 (41%), Positives = 484/820 (59%), Gaps = 41/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R +LF+GSIHYPR  PEMW D++ +AKEGGL+V++TYVFWN+HEP  G +NFEG  
Sbjct  37    INGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNVHEPSPGNYNFEGRY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FR  NEPF N MK +A
Sbjct  97    DLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRADNEPFKNAMKGYA  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV++MK   LF  QGGPIIL+QIENEY        A      +Y  WAA+MA+GL   
Sbjct  157   EKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAP---GHQYSTWAANMAVGLDTG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+ +AP  VI+TCNG  C + F  PN   KP++WTE W+  +  FG P  QR  
Sbjct  214   VPWVMCKEEDAPDPVINTCNGFYCDNFF--PNKPYKPAIWTEAWSGWFSEFGGPLHQRPV  271

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ +F          Y  + G          F+TT Y  + P+DE+GL R PK+ 
Sbjct  272   QDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRQPKYG  331

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL++ H A+++ ++ +    P I  L N Q+   + ++    CAAFL+NN+  +   + F
Sbjct  332   HLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSET-GGCAAFLSNNDWKSAARVMF  390

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+  VFN+  +  Q +    +P+     + L WE + E I  +
Sbjct  391   NNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTN---SEMLSWETYSEDISAL  447

Query  1380  DN-LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             D+   I++   LE   +T+DTSDY WY T ++    +    G  LP L V + GHA+  F
Sbjct  448   DDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGHAMHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS  G   ++    +  V+L+ G+N I LL V  G PN G   +   TG    V
Sbjct  508   INGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTGVLGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              IQGL  G   +++  W++ VG+ GE + L +  G   V W     +     P+TW+K Y
Sbjct  568   AIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLTWHKAY  627

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------PLG  2027
             F+ PEG+ P+AL M +M KG VW+NG+SIGRYW A+ +                     G
Sbjct  628   FNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQLGCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             +P+Q  YH+PR+++KP  NL+V+FEE GGDP+ I LV  +   +CS+V++Y+P N+K+W+
Sbjct  688   EPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP-NIKNWQ  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                E   +  E   P VR+ C   + +  I+FA++G P G CG+F  G C  P+++ +VE
Sbjct  747   I--ENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSHAVVE  804

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K CLG+  C V +  S F E   D CPN++ K L+V+A C
Sbjct  805   KKCLGRQTCAVTISNSNFGE---DPCPNVL-KRLSVEAHC  840



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/824 (41%), Positives = 484/824 (59%), Gaps = 41/824 (5%)
 Frame = +3

Query  111   DLFFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNF  290
             +   I+G R +LF+GSIHYPR  PEMW D++ +AKEGGL+V++TYVFWN+HEP  G +NF
Sbjct  33    EAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNVHEPSPGNYNF  92

Query  291   EGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHM  470
             EG  DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FR  NEPF N M
Sbjct  93    EGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRADNEPFKNAM  152

Query  471   KKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMG  650
             K +AE IV++MK   LF  QGGPIIL+QIENEY        A      +Y  WAA+MA+G
Sbjct  153   KGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAP---GHQYSTWAANMAVG  209

Query  651   LYNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPA  830
             L   +PW+MCK+ +AP  VI+TCNG  C + F  PN   KP+ WTE W+  +  FG P  
Sbjct  210   LDTGVPWVMCKEEDAPDPVINTCNGFYCDNFF--PNKPYKPATWTEAWSGWFSEFGGPLH  267

Query  831   QRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRD  1010
             QR  +++A+++ +F          Y  + G          F+TT Y  + P+DE+GL R 
Sbjct  268   QRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRQ  327

Query  1011  PKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPT  1187
             PK+ HL++ H A+++ ++ +    P I  L N Q+   + ++    CAAFL+NN+  +  
Sbjct  328   PKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSET-GGCAAFLSNNDWKSAA  386

Query  1188  SIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQET  1367
              + F    Y LP +S S+LPDC+  VFN+  +  Q +    +P+     + L WE + E 
Sbjct  387   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTN---SEMLSWETYSED  443

Query  1368  IPTIDN-LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             I  +D+   I++   LE   +T+DTSDY WY T ++    +    G  LP L V + GHA
Sbjct  444   ISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGHA  503

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  F+NG+  GS  G   ++    +  V+L+ G+N I LL V  G PN G   +   TG 
Sbjct  504   MHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTGV  563

Query  1725  RD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTW  1892
                V IQGL  G   +++  W++ VG+ GE + L +  G   V W     +     P+TW
Sbjct  564   LGPVAIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLTW  623

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS------------------  2018
             +K YF+ PEG+ P+AL M +M KG VW+NG+SIGRYW A+ +                  
Sbjct  624   HKAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQ  683

Query  2019  -PLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV  2195
                G+P+Q  YH+PR+++KP  NL+V+FEE GGDP+ I LV  +   +CS+V++Y+P N+
Sbjct  684   LGCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP-NI  742

Query  2196  KSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNAN  2375
             K+W+   E   +  E   P VR+ C   + +  I+FA++G P G CG+F  G C  P+++
Sbjct  743   KNWQI--ENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSH  800

Query  2376  KIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              +VEK CLG+  C V +  S F E   D CPN++ K L+V+A C
Sbjct  801   AVVEKKCLGRQTCAVTISNSNFGE---DPCPNVL-KRLSVEAHC  840



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/823 (42%), Positives = 489/823 (59%), Gaps = 42/823 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMW  ++++AK+  L+VIQTYVFWN HEP  G ++FEG
Sbjct  33    IIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNGHEPSPGTYDFEG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK + ++G+YV LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  93    RYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKMAMQG  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV M+K   LFA QGGPIIL+QIENEY  +     A     + Y+NWAA+MA+GL 
Sbjct  153   FTQKIVQMLKSESLFASQGGPIILSQIENEYGPVSR---ASGPPGRSYLNWAAEMAVGLE  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+TCNG  C DTF  PN   KP MWTE W+  +  FG P   R
Sbjct  210   TGVPWVMCKEDDAPDPVINTCNGFYC-DTFT-PNMPYKPIMWTEAWSGWFTEFGSPIHHR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E++A+++ RF          Y  + G          F+TT Y  + P+DE+GL R+PK
Sbjct  268   PVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIREPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HL++ H A++L ++ L    PT+  L + Q+   F +Q    CAAFL N N  +   +
Sbjct  328   YGHLKELHRAIKLCEQALVSADPTVTSLGSLQQAHVFSSQT-GGCAAFLANYNPDSFARV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y +P +S S+LPDC   VFN+  +  Q +  +  P   A    L WE + E + 
Sbjct  387   MFNNVHYNIPPWSISILPDCSNVVFNTAKVGVQTSQMQMYP---ANTQSLMWERYDEVVA  443

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ DN  I     LE   +T+DTSDY WY + ++ S  +    G  LPVL V S GHAL 
Sbjct  444   SLEDNSLITTTGLLEQINVTRDTSDYLWYISSVDVSPAEGFLHGGQLPVLTVQSAGHALH  503

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F+NG+  GS +G+ +D+ +     V+++ G N I +L V  G PN+G   +   TG   
Sbjct  504   IFLNGQLSGSAYGSREDRRIKFSGNVNIRAGTNKIAILSVAVGLPNAGVHYEFWSTGVLG  563

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G+  +T+  WS+ VG+ GE + L + EG+  V+W           P+TWY+
Sbjct  564   PVVLHGLDEGSRDLTWQKWSYQVGLKGEAMNLNSLEGASSVEWMQGSLAVQDQQPLTWYR  623

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL--------------------S  2018
              YFDAP+GN+P+AL M +M KG VW+NG+SIGRYW A+                     S
Sbjct  624   AYFDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAYAPNGDCNSCSYIGTYRSPKCQS  683

Query  2019  PLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVK  2198
               GQP+Q  YH+PR++++P  NL+V+FEE GGD + I ++  +  ++C+ VS+++P  +K
Sbjct  684   NCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWHP-TIK  742

Query  2199  SWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANK  2378
             +W+ + +   Q  E  +P V L+C   + +  I+FA+YG P G CGNF  G C  PN+  
Sbjct  743   NWDIESD--GQPEEYHKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSYT  800

Query  2379  IVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             I+EK C+G+ +C V +  + F     D CPN V K +AV+A C
Sbjct  801   ILEKNCIGQERCAVVISTTNF---GGDPCPN-VMKRVAVEAIC  839



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/820 (43%), Positives = 480/820 (59%), Gaps = 44/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R IL +GSIHYPR  PEMWPD++++AK+GGL+VIQTYVFWN HEP  G + FE   
Sbjct  39    INGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGNYYFEDRY  98

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLVKFIK++   G+YV LR+GP++ AEWNFGGFP WLK VP I FRT N PF   M+KF 
Sbjct  99    DLVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNGPFKAAMQKFT  158

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV MMK  KLF  QGGPIIL+QIENE+  +E +  A     K Y  WAADMA+ L   
Sbjct  159   EKIVSMMKSEKLFESQGGPIILSQIENEFGPVEWEIGAP---GKAYTKWAADMAVKLGTG  215

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ++AP  VI+TCNG  C + F  PN   KP +WTENWT  Y  FG     R A
Sbjct  216   VPWVMCKQDDAPDPVINTCNGFYC-ENFK-PNKDYKPKLWTENWTGWYTEFGGAVPYRPA  273

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E++A+S+ RF  N       Y  + G      +   F+ T Y  + PLDE+GL RDPKW 
Sbjct  274   EDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTSAGLFIATSYDYDAPLDEYGLTRDPKWG  333

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKF  1199
             HLRD H A++L +  L    PT++ L +NQE   F++++   CAAFL N +T     + F
Sbjct  334   HLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKS--SCAAFLANYDTKYSVKVTF  391

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                QY LP +S S+LPDCKTAVFN+  + +Q +  +  P   A    L W+ + E   T 
Sbjct  392   GNGQYDLPPWSISILPDCKTAVFNTARLGAQSSQMKMTPVGGA----LSWQSYIEEAATG  447

Query  1380  DNLPIKNLRPL-ELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                    L  L E   +T+D SDY WY T +     +   +    PVL ++S GH+L  F
Sbjct  448   YTDDTTTLEGLWEQINVTRDASDYLWYMTNVNIDSDEGFLKNGDSPVLTIFSAGHSLHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  G+ +G+ ++  L+  + V L  G N I+LL V  G PN G   +K   G    V
Sbjct  508   INGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGLPNVGVHFEKWNAGILGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW--KPVTNVHPPVTWYKTYF  1907
             T++GL  GT  ++   WS+ +G+ GE L L T  GS  V+W    ++    P+TWYK  F
Sbjct  568   TLKGLNEGTRDLSGWKWSYKIGLKGEALSLHTVTGSSSVEWVEGSLSAKKQPLTWYKATF  627

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL--------------------SPLG  2027
             DAPEGN+PVAL M +M KG +WVNG+SIGR+W A+                     S  G
Sbjct  628   DAPEGNDPVALDMSSMGKGQIWVNGQSIGRHWPAYTARGSCSACNYAGTYDDKKCRSNCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             +PSQ  YH+PR+++ P  NL+VVFEE GG+PS I LV     ++C+ + +  P  +K+W+
Sbjct  688   EPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPSGISLVKRTTGSVCADIFEGQPA-LKNWQ  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                      ++ ++P   L CP  + + KI+FA+YG P G CG+F  G+C    +    E
Sbjct  747   MIA---LGRLDHLQPKAHLWCPHGQKISKIKFASYGSPQGTCGSFKAGSCHAHKSYDAFE  803

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K C+GK  C V V   +F     D CP+   K L+V+A C
Sbjct  804   KKCIGKQSCSVTVAAEVF---GGDPCPD-SSKKLSVEAVC  839



>ref|XP_008674765.1| PREDICTED: beta-galactosidase 7 isoform X1 [Zea mays]
Length=822

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/809 (44%), Positives = 500/809 (62%), Gaps = 42/809 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               +DG R +LF+G +HYPR  PEMWPD++ +AK+GGL+VIQTYVFWN HEPVQGQFNFEG
Sbjct  45    LILDGARRMLFSGDMHYPRSTPEMWPDLIAKAKKGGLDVIQTYVFWNAHEPVQGQFNFEG  104

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFI+ I   G+YV+LR+GPF+E+EW +GG P+WL+ +P I FR+ NEPF  HM+K
Sbjct  105   RYDLVKFIREIHAQGLYVSLRIGPFVESEWKYGGLPFWLRGIPNITFRSDNEPFKRHMQK  164

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK  +LF PQGGPII++QIENEY  +E+   A       Y++WAA MA+ L 
Sbjct  165   FVTKIVNLMKDERLFYPQGGPIIISQIENEYKLVEA---AFHSKGSSYVHWAAAMAVNLQ  221

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +I+TCNG  CG+TF GPN  NKP++WTENWT++Y  +G     R
Sbjct  222   TGVPWMMCKQDDAPDPIINTCNGLICGETFPGPNSPNKPALWTENWTSRYPLYGQDQRYR  281

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SA ++A+++  F A K GS++ YYMY+GGTN+GR  +S+VTT YYD  PLDE+GL   P 
Sbjct  282   SAADLAFAVALFIARKKGSFVNYYMYHGGTNFGRVASSYVTTSYYDGAPLDEYGLIWQPT  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-I  1193
             W+HLR+ HAA++ S   L  G  +       QE   F   +   C AFL N +    S I
Sbjct  342   WAHLRELHAAVKQSAETLLWGAYSNHSFGQQQEGHVFATDS--GCVAFLVNFDMHKVSTI  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARR---FVPSKLAGRDDLKWEMFQE  1364
             +F    + L   S S+L  C+  +F +  I +QH  R      P   A R    W++F+E
Sbjct  400   QFGEGVFQLAPKSISILSQCRDLIFETGKINAQHGLRTAQVVQPLNHAHR----WKLFKE  455

Query  1365  TIPTIDN--LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMG  1538
              IP + +    +KN +  E  + TKD +DY WY +    S R+    GD+  VL+V +  
Sbjct  456   PIPAVPSKISHVKN-QLCEHLSTTKDETDYLWYLSMYN-SRRN--ENGDL--VLNVEAHA  509

Query  1539  HALVAFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRF  1715
             H L AF+N ++VGS HG++D    + L   + L+ G N I+LL V+ G P+SGA M++R 
Sbjct  510   HILHAFINNDYVGSVHGSHDKPGNIVLNVSISLREGQNSISLLCVMVGSPDSGAYMERRT  569

Query  1716  TGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT-NVHPPVTW  1892
              G R ++I+        +    W H VG+ GE  K++T EGS   +W   + ++H P+ W
Sbjct  570   FGVRKMSIKRRQQRPHSINIELWKHQVGLYGETNKIYTSEGSSHAEWTAFSKSIHLPLIW  629

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMK  2072
             YKT FDAP GN+PV L + +M KG VW+NG+SIGRYWV+F +P GQ SQ  YHIPR F+K
Sbjct  630   YKTTFDAPWGNDPVTLNLTSMGKGEVWINGQSIGRYWVSFKTPSGQSSQSMYHIPRYFLK  689

Query  2073  PKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWERKGEELRQVVEDIRP  2252
                NL+V+ EE GGDP  I +  ++   I  +VS++   ++ S E              P
Sbjct  690   TGENLLVLMEETGGDPLQITVNTMSITRIYGTVSEFSTPSLLSREN------------HP  737

Query  2253  SVRLKCPEDKVVKKIEFANYGDPDGAC---GNFIVGNCSFPNANKIVEKACLGKSQCKVP  2423
             +V L+C + K +  IEFA++G+P   C   G    G+C    +  +V+ ACLG+ +C +P
Sbjct  738   AVHLRCEKGKHITDIEFASFGNPVQDCRGSGQSCQGSCHAEISEFVVKNACLGRRKCVLP  797

Query  2424  VEKSLFQEGSKDLCPNLVHKTLAVQAKCG  2510
             V  + F     D CP  + K+L+V A CG
Sbjct  798   VWANKF---GGDPCPR-IEKSLSVAAICG  822



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/829 (41%), Positives = 486/829 (59%), Gaps = 53/829 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MW D++ +AKEGGL+VI+TY+FWN+HEP +G +NFEG
Sbjct  39    ILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYIFWNVHEPSRGNYNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  99    RYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKKAMQG  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDR-PADIKIQKKYINWAADMAMGL  653
             F E IV MMK  +L+  QGGPIIL+QIENEY +      PA     + Y+NWAA MA+  
Sbjct  159   FTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKLLGPAG----QNYVNWAAKMAVET  214

Query  654   YNEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQ  833
                +PW+MCK+++AP  VI+TCNG  C   +  PN   KPS+WTE W+  +  FG P  +
Sbjct  215   GTGVPWVMCKEDDAPDPVINTCNGFYC--DYFTPNKPYKPSIWTEAWSGWFSEFGGPNHE  272

Query  834   RSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDP  1013
             R  +++A+ + RF          Y  + G          F+TT Y  + PLDE+GL R P
Sbjct  273   RPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIRQP  332

Query  1014  KWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTS  1190
             K+ HL++ H A+++ +R L    P +  + N Q+   +  ++   CAAFL+N +T +   
Sbjct  333   KYGHLKELHKAIKMCERALVSADPAVTSMGNFQQAHVYTTKSGD-CAAFLSNFDTKSSVR  391

Query  1191  IKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETI  1370
             + F    Y LP +S S+LPDC+  VFN+  +  Q +  + +P+         WE F E I
Sbjct  392   VMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTN---THMFSWESFDEDI  448

Query  1371  PTIDN---LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGH  1541
              ++D+   + I     LE   +T+DTSDY WY T ++    +   RG  LP L V S GH
Sbjct  449   SSLDDGSAITITTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTLIVQSTGH  508

Query  1542  ALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTG  1721
             A+  F+NG+  GS +G  +D+       V+L+ G N I LL V  G PN G   +   TG
Sbjct  509   AVHVFINGQLSGSAYGTREDRRFRYTGTVNLRAGTNRIALLSVAVGLPNVGGHFETWNTG  568

Query  1722  PRD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVT  1889
                 V ++GL  G L +++  W++ VG+ GE + L +  G   V+W     V+  + P+T
Sbjct  569   ILGPVVLRGLNQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVSEKNQPLT  628

Query  1890  WYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVA--------------FLSP--  2021
             W+KTYFDAP+G+ P+AL M+ M KG +W+NG SIGRYW A              F  P  
Sbjct  629   WHKTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAAGICNGCSYAGTFRPPKC  688

Query  2022  ---LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGN  2192
                 GQP+Q  YH+PR+++KP +NL+VVFEE GGDPS I LV  +  +IC+ VS+Y+P N
Sbjct  689   QVGCGQPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSICADVSEYHP-N  747

Query  2193  VKSWE----RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCS  2360
             +++W      K EE         P V L C   + +  I+FA++G P G CGN+  G C 
Sbjct  748   IRNWHIDSYGKSEEFHP------PKVHLHCSPSQAISSIKFASFGTPLGTCGNYEKGVCH  801

Query  2361  FPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              P +   +EK C+GK +C V V  S F    +D CPN++ K L+V+A C
Sbjct  802   SPTSYATLEKKCIGKPRCTVTVSNSNF---GQDPCPNVL-KRLSVEAVC  846



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/823 (43%), Positives = 476/823 (58%), Gaps = 47/823 (6%)
 Frame = +3

Query  120   FIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGN  299
              +DG R ILF+GSIHYPR  PEMW  ++++AK+GGL+VIQTYVFWN HEP  G +NFEG 
Sbjct  35    LVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPTPGNYNFEGR  94

Query  300   NDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKF  479
              DLV+FIK +   GM+V LR+GP++  EWNFGGFP WLK VP I+FRT NEPF N M+ F
Sbjct  95    YDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPFKNAMQGF  154

Query  480   AEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYN  659
              E IV MMK   LFA QGGPIIL+QIENEY     +  A     K YINWAA MA+GL  
Sbjct  155   TEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGA---AGKAYINWAAKMAVGLDT  211

Query  660   EIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRS  839
              +PW+MCK+++AP  VI+ CNG  C DTF  PN   KP+MWTE W+  +  FG    QR 
Sbjct  212   GVPWVMCKEDDAPDPVINACNGFYC-DTFS-PNKPYKPTMWTEAWSGWFTEFGGTIRQRP  269

Query  840   AENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKW  1019
              E++A+ + RF          Y  + G          F+TT Y  + PLDE+GL R+PK+
Sbjct  270   VEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAREPKF  329

Query  1020  SHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSIK  1196
              HL++ H A++L ++PL    PT+  L + QE   F + +   CAAFL N N+ +   + 
Sbjct  330   GHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSS--GCAAFLANYNSNSYAKVI  387

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F    Y LP +S S+LPDCK  VFN+  +  Q N  +       G   + WE + E + +
Sbjct  388   FNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWAD---GASSMMWEKYDEEVDS  444

Query  1377  IDNLP-IKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   P + +   LE   +T+DTSDY WY T +E    +   +G     L V S GHAL  
Sbjct  445   LAAAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVDPSEKFLQGGTPLSLTVQSAGHALHV  504

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-  1730
             F+NG+  GS +G  +D+ +S     +L+ G N + LL V  G PN G   +   TG    
Sbjct  505   FINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGP  564

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKT  1901
             V I GL  G+  +T+ +WS+ VG+ GE++ L + EGS  V+W     V     P+ WY+ 
Sbjct  565   VVIHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWYRA  624

Query  1902  YFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL-------------------SPL  2024
             YFD P G+ P+AL M +M KG +W+NG+SIGRYW A+                    +  
Sbjct  625   YFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAGC  684

Query  2025  GQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW  2204
             GQP+Q  YH+PR++++P  NL+VVFEE GGD S I L       +C+ VS+Y+P N+K+W
Sbjct  685   GQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHP-NIKNW  743

Query  2205  --ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANK  2378
               E  GE      E     V LKC   + +  I+FA++G P G CG F  G C   N+N 
Sbjct  744   QIESYGEP-----EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNS  798

Query  2379  IVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             ++EK C+G  +C V +  S F     D CP  V K +AV+A C
Sbjct  799   VLEKKCIGLQRCVVAISPSNF---GGDPCPE-VMKRVAVEAVC  837



>gb|EMS61058.1| Beta-galactosidase 7 [Triticum urartu]
Length=839

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/826 (44%), Positives = 504/826 (61%), Gaps = 58/826 (7%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPE-----------------MWPDVLKRAKEGGLNVIQTYVF  251
             ++GTR +LF+G +HY R  PE                 MWP ++  A++GGL+VIQTYVF
Sbjct  40    LNGTRRVLFSGEMHYTRSTPERGSALAWDLSPIEFEPLMWPKLIASARKGGLDVIQTYVF  99

Query  252   WNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKI  431
             WN+HEPVQGQ+NFEG  DLVKFI+ I   G+YV+LR+GPF+EAEW +GGFP+WL +VP I
Sbjct  100   WNVHEPVQGQYNFEGRYDLVKFIREIQAQGLYVSLRIGPFIEAEWKYGGFPFWLHDVPNI  159

Query  432   AFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQ  611
              FRT NEPF  HM++F   IV+MMKK  L+ PQGGPII++QIENEY  +E   PA     
Sbjct  160   TFRTDNEPFKQHMQRFVTQIVNMMKKEGLYYPQGGPIIISQIENEYQMVE---PAFGSGG  216

Query  612   KKYINWAADMAMGLYNEIPWIMCKQNEAPPKVI---------DTCNGRQCGDTFHGPNGV  764
              +Y+ WAA+MA+GL   +PW+MCKQN+AP  ++         D  +       F  PN  
Sbjct  217   PRYVRWAAEMAVGLQTGVPWMMCKQNDAPDPIVSFHYYIVSPDCTSLANNSYQFDRPNSP  276

Query  765   NKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTT  944
             +KP++WTENWT +Y  +G+    RS E+IA+++  F A K GS++ YYMY+GGTN+GR  
Sbjct  277   SKPALWTENWTTRYPIYGNDTKLRSTEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFA  336

Query  945   ASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIIT  1124
             +S+VTT YYD  PLDE+GL   P W HL++ HAA+ LS  PL  GT +   L   QE   
Sbjct  337   SSYVTTSYYDGAPLDEYGLIWRPTWGHLKELHAAVNLSSEPLLFGTYSSFSLGQEQEAHI  396

Query  1125  FENQNLKLCAAFLTN--NNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHN  1298
             FE + LK C AFL N   + +PT + FR   + L   S S+L +C+T VF +  + +Q+ 
Sbjct  397   FETE-LK-CVAFLVNFDKHQSPTVV-FRNMSFQLAPKSISILSECRTVVFETAKVTAQYG  453

Query  1299  ARRFVPSKLAGRDDLKWEMFQETIPT-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEF  1475
             +R    +  +  D  +W+ F+E IP  I        +  E  ++TKD +DY WY    E+
Sbjct  454   SRT-AKAVESTNDIHRWKAFKEPIPEDISKAAYTGNQLFEHLSMTKDETDYLWYIVSYEY  512

Query  1476  SERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNND  1652
                D    G ++ +L+V S  H L AFVN E+VGS HG++D    + L   + LK G N 
Sbjct  513   RPSD---DGQLM-LLNVESRAHVLHAFVNTEYVGSVHGSHDGPGNIILNTNISLKEGQNT  568

Query  1653  ITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTE  1832
             I+LL V+ G P+SGA M++R  G R V+IQ       ++    W + VG+ GE  +++T+
Sbjct  569   ISLLSVMVGSPDSGAHMERRSFGIRKVSIQQGQQPLYLLNNELWGYQVGLYGEGKRIYTQ  628

Query  1833  EGSQKVKWKPVTNV-HPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVA  2009
             E +  V+W  + N+ + P+TWYKT F AP GN+ VAL + +M KG VWVNG+SIGRYWV+
Sbjct  629   EEASSVEWTEINNLTYHPLTWYKTTFAAPVGNDVVALNLTSMGKGEVWVNGESIGRYWVS  688

Query  2010  FLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPG  2189
             F +P GQPSQ  YHIP+ F+KP +NL+V+ EE GG+P  I L  V+  T+C +V++    
Sbjct  689   FKAPSGQPSQSLYHIPQHFLKPIDNLLVLVEEIGGNPLEITLNTVSITTVCGNVNELSSP  748

Query  2190  NVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPN  2369
              + + + KG           P V L+C   K +  IEFA+YG+P G C  F  G+C    
Sbjct  749   ALHT-QGKG-----------PEVHLRCQRGKHISAIEFASYGNPAGDCTTFSTGSCHATL  796

Query  2370  ANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +  +V++AC+GK  C +PV  + F     D CP  + K+L V A C
Sbjct  797   SESVVKQACIGKRGCSIPVSPARF---GGDPCPG-IQKSLLVVANC  838



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/826 (42%), Positives = 484/826 (59%), Gaps = 51/826 (6%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R ILF+GSIHYPR  P+MW D++++AKEGGL+VI+TYVFWN+HEP  G +NFEG N
Sbjct  35    INGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYVFWNVHEPSPGNYNFEGRN  94

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ F 
Sbjct  95    DLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKKAMQGFT  154

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV MMK   L+  QGGPIIL+QIENEY +      A   +   Y+NWAA MA+ +   
Sbjct  155   EKIVGMMKSEHLYESQGGPIILSQIENEYGAQSKLFGA---VGYNYMNWAAKMAVEMGTG  211

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+++AP  VI+TCNG  C D F  PN   KP+MWTE W+  +  FG P  QR  
Sbjct  212   VPWVMCKEDDAPDPVINTCNGFYC-DKFT-PNKPYKPTMWTEAWSGWFSEFGGPIHQRPV  269

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ RF          Y  + G          F+TT Y  + PLDE+GL R PK+ 
Sbjct  270   QDLAFAVGRFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIRQPKYG  329

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-IKF  1199
             HL++ H A+++ +R L    P +  L N Q+   +  ++   CAAFL N ++  ++ + F
Sbjct  330   HLKELHKAIKMCERALVSSDPVVTSLGNFQQASVYSTESGD-CAAFLANYDSKSSARVMF  388

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+ AVFN+  +  Q +  + +P+         WE F E   ++
Sbjct  389   NNMHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMQMLPTN---TQMFSWESFNEDTSSL  445

Query  1380  D---NLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             D   +  I     LE   +T+DTSDY WY T ++    +   RG  LP + V S GHA+ 
Sbjct  446   DYSSSTTITASGLLEQINVTRDTSDYLWYITSVDVGSSESFLRGGKLPSIIVQSTGHAVH  505

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F+NG+  GS +G  +D+       V+L+ G N I LL V  G PN G   +   TG   
Sbjct  506   VFINGQLSGSGYGTREDRRFRYTGIVNLRAGTNTIALLSVAVGLPNVGGHFETWNTGILG  565

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G L +++  W++ VG+ GE + L +  G   V+W     V   + P+TW+K
Sbjct  566   PVVLHGLDQGKLDMSWQKWTYQVGLKGEAMNLASPYGISSVEWMQSALVVQKNQPLTWHK  625

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVA--------------FLSP-----  2021
             T+FDAPEG  P+AL MD M KG +W+NG SIGRYW A              F  P     
Sbjct  626   TFFDAPEGEEPLALDMDGMGKGQIWINGVSIGRYWTASATGSCNGCSYAGSFRPPKCQLG  685

Query  2022  LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKS  2201
              G+P+Q  YH+PR+++KP +NL+VVFEE GGDPS I LV  +  ++C+ VS+Y+P N+K+
Sbjct  686   CGEPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHP-NIKN  744

Query  2202  WE----RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPN  2369
             W      K EE         P V L C   + +  I+FA++G P G CGN+  G C    
Sbjct  745   WHIDSYGKSEEFHP------PKVHLHCNPGQAISSIKFASFGTPLGTCGNYEQGACHSSA  798

Query  2370  ANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +  I+EK C+GK +C V V  S F    +D CPN++ K L+V+A C
Sbjct  799   SYAILEKKCIGKQRCIVTVSNSNF---GQDPCPNVL-KRLSVEAVC  840



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/819 (42%), Positives = 478/819 (58%), Gaps = 38/819 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMWPD++++AK+GGL+VIQTYVFWN HEP  G++ FEG
Sbjct  46    IIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGEYYFEG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++ + G+YV LR+GP+  AEWNFGGFP WLK +P I+FRT NEPF   M  
Sbjct  106   RYDLVKFIKLVKEAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTDNEPFKTAMAG  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IVDMMK+ +LF  QGGPIIL+QIENEY  +E +  A     + Y  WAA+MA+GL 
Sbjct  166   FTKKIVDMMKEEELFETQGGPIILSQIENEYGPVEWEIGAP---GQAYTKWAANMAVGLG  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ++AP  +I+TCN   C D F  PN   KP+MWTE WT+ +  FG P   R
Sbjct  223   TGVPWVMCKQDDAPDPIINTCNDHYC-DWF-SPNKNYKPTMWTEAWTSWFTAFGGPVPYR  280

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE++A++I +F          Y  + G          FV T Y  + P+DE+GL R PK
Sbjct  281   PAEDMAFAIAKFIQRGGSFINYYMYHGGTNFGRTAGGPFVATSYDYDAPIDEYGLIRQPK  340

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSI  1193
             W HL+D H A+++ +  L  G P +  L ++QE   F++++   CAAFL N +  +   +
Sbjct  341   WGHLKDLHKAIKMCEAALVSGDPIVTSLGSSQESHVFKSESGD-CAAFLANYDEKSFAKV  399

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+G  Y LP +S S+LPDC   VFN+  + +Q ++           D   WE + E   
Sbjct  400   AFQGMHYNLPPWSISILPDCVNTVFNTARVGAQTSSMTMTS---VNPDGFSWETYNEETA  456

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             + D+  I     LE   +T+D +DY WY+T I     +   +    PVL V S GHAL  
Sbjct  457   SYDDASITMEGLLEQINVTRDVTDYLWYTTDITIDPNEGFLKNGEYPVLTVMSAGHALHI  516

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-  1730
             F+NGE  G+ +G+ D+  L+    V L  GNN I++L +  G PN GA  +   TG    
Sbjct  517   FINGELSGTVYGSVDNPKLTYTGSVKLLAGNNKISVLSIAVGLPNIGAHFETWNTGVLGP  576

Query  1731  VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFD  1910
             V + GL  G   +++ +WS+ +G+ GE L+L +  GS  V+W  +     P+TWYKT F+
Sbjct  577   VVLNGLNEGRRDLSWQNWSYKIGLKGEALQLHSLTGSSSVEWSSLIAQKQPLTWYKTTFN  636

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAF--------------------LSPLGQ  2030
             APEGN P AL M  M KG +W+NG+SIGRYW A+                    L+  G+
Sbjct  637   APEGNGPFALDMSMMGKGQIWINGQSIGRYWPAYKAYGNCGECSYTGRYNEKKCLANCGE  696

Query  2031  PSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWER  2210
              SQ  YH+P +++ P  NL+VVFEE GGDP+ I LV     + C+ +S+++P  ++ W  
Sbjct  697   ASQRWYHVPSSWLYPTANLLVVFEEWGGDPTGISLVRRTTGSACAFISEWHP-TLRKWHI  755

Query  2211  KGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEK  2390
             K  +  +     RP   L C + + +  I+FA++G P G CGNF  G+C    +  I EK
Sbjct  756   K--DYGRAERPRRPKAHLSCADGQKISSIKFASFGTPQGVCGNFTEGSCHAHKSYDIFEK  813

Query  2391  ACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              C+G+  C V +   +F     D CPN V K LAV+A C
Sbjct  814   NCVGQQWCSVTISPDVF---GGDPCPN-VMKNLAVEAIC  848



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/820 (41%), Positives = 479/820 (58%), Gaps = 42/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R +LF+GSIHYPR  PEMW D++ +AKEGGL+V++TYVFWN+HEP  G +NFEG  
Sbjct  37    INGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNVHEPSPGNYNFEGRY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FR  NEPF N MK +A
Sbjct  97    DLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRADNEPFKNAMKGYA  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV++MK   LF  QGGPIIL+QIENEY        A      +Y  WAA+MA+GL   
Sbjct  157   EKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKALGA---TGHQYSTWAANMAVGLDTG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+ +AP  VI+TCNG  C + F  PN   KP++WTE W+  +  FG    QR  
Sbjct  214   VPWVMCKEEDAPDPVINTCNGFYCDNFF--PNKPYKPAIWTEAWSGWFSEFGSTLHQRPV  271

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ +F          Y  + G          F+TT Y  + P+DE+GL R PK+ 
Sbjct  272   QDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIRQPKYG  331

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL++ H A+++ ++ L    P I  L N Q+   + ++    CAAFL+NN+  +   + F
Sbjct  332   HLKELHRAVKMCEKALVSADPAITSLGNLQQAYVYSSETGD-CAAFLSNNDWKSAARVMF  390

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+  VFN+  +  Q +    +P+     + L WE + E I  +
Sbjct  391   NNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTN---SEMLSWESYNEDISAL  447

Query  1380  DN-LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             D+   I++   LE   +T+DTSDY WY T ++ S  +    G  LP L V S GHAL  F
Sbjct  448   DDSSSIRSFGLLEQINVTRDTSDYLWYITSVDISSTESFLHGGELPTLIVESTGHALHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS  G   ++    +  V+L+ G N I+LL V  G PN G   +   TG    V
Sbjct  508   INGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMGGHFETWSTGVLGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              + GL  G   +++  W++ VG+ GE + L +  G   V W     +     P+TW+K Y
Sbjct  568   AVHGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGSLIAQRQQPLTWHKAY  627

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------PLG  2027
             F+ P G+ P+AL M +M KG VW+NG+SIGRYW A+ +                     G
Sbjct  628   FNTPNGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQFGCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             QP+Q  YH+PR+++KP  NL+V+FEE GGDPS I LV     ++C+ V++Y+P N+K+W+
Sbjct  688   QPTQKWYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRTVSSVCADVAEYHP-NIKNWQ  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                E   +  E   P VR+ C   + +  I+FA++G P G CG+F  G C  P +  +VE
Sbjct  747   I--ENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSYAVVE  804

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K CLG+ +C V +  S F     D CPN++ K L+V+A C
Sbjct  805   KKCLGRQRCAVTIANSNF----GDPCPNVL-KRLSVEAHC  839



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/820 (41%), Positives = 481/820 (59%), Gaps = 42/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R +LF+GSIHYPR  PEMW D++ +AKEGGL+V++TYVFWN+HEP  G +NFEG  
Sbjct  37    INGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNVHEPSPGNYNFEGRY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FR  NEPF N MK +A
Sbjct  97    DLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRADNEPFKNAMKGYA  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV++MK   LF  QGGPIIL+QIENEY        A      +Y  WAA+MA+GL   
Sbjct  157   EKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKALGA---TGHQYSTWAANMAVGLDTG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+ +AP  VI+TCNG  C + F  PN   KP++WTE W+  +  FG    QR  
Sbjct  214   VPWVMCKEEDAPDPVINTCNGFYCDNFF--PNKPYKPTIWTEAWSGWFSEFGGTLHQRPV  271

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ +F          Y  + G          F+TT Y  + P+DE+GL R PK+ 
Sbjct  272   QDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIRQPKYG  331

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL++ H A+++ ++ L    P I  L N Q+   + ++    CAAFL+NN+  +   + F
Sbjct  332   HLKELHKAVKMCEKALVSADPAITSLGNLQQAYVYSSETGD-CAAFLSNNDWKSAARVMF  390

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+  VFN+  +  Q +    +P+     + L WE + E I  +
Sbjct  391   NNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTN---SEMLSWESYNEDISAL  447

Query  1380  DN-LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             D+   I++L  LE   +T+DTSDY WY T ++    +    G  LP L V S GHAL  F
Sbjct  448   DDSSSIRSLGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVESTGHALHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS  G   ++    +  V+L+ G N I+LL V  G PN G   +   TG    V
Sbjct  508   INGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMGGHFETWSTGVLGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              + GL  G   +++  W++ VG+ GE + L +  G   V W     +     P+TW+K Y
Sbjct  568   AVHGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGSLIAQRQQPLTWHKAY  627

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------PLG  2027
             F++P+G+ P+AL M +M KG VW+NG+SIGRYW A+ +                     G
Sbjct  628   FNSPDGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQLGCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             QP+Q  YH+PR+++KP  NL+V+FEE GGDP+ I LV     +IC+ V++Y+P N+K+W+
Sbjct  688   QPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRTVSSICADVAEYHP-NIKNWQ  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                E   +  E   P VR+ C   + +  I+FA++G P G CG+F  G C  P +  +VE
Sbjct  747   I--ENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGPCHAPTSYAVVE  804

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K CLG+ +C V +  S F     D CPN++ K L+V+A C
Sbjct  805   KKCLGRQKCAVTIANSNF----GDPCPNVL-KRLSVEAHC  839



>gb|EMT10431.1| Beta-galactosidase 7 [Aegilops tauschii]
Length=831

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/821 (44%), Positives = 501/821 (61%), Gaps = 53/821 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               ++GTR +LF+G +HY R  PEMWP ++  A++GGL+VIQTYVFWN+HEPVQGQ+NFEG
Sbjct  39    LVLNGTRRVLFSGEMHYTRSTPEMWPKLIANARKGGLDVIQTYVFWNVHEPVQGQYNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFI+ I   G+YV+LR+GPF+EAEW +GGFP+WL +VP I FRT NEPF  HM++
Sbjct  99    RYDLVKFIREIQAQGLYVSLRIGPFIEAEWKYGGFPFWLHDVPNITFRTDNEPFKQHMQR  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV MMK+  L+ PQGGPII++Q+ENEY  +E   PA      +Y+ WAA+MA+GL 
Sbjct  159   FVTQIVSMMKQEGLYYPQGGPIIISQVENEYQMVE---PAFGSGGPRYVRWAAEMAVGLQ  215

Query  657   NEIPWIMCKQNEAPPKVI---------DTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYR  809
               +PW+MCKQN+AP  ++         D  +       F  PN  +KP++WTENWT +Y 
Sbjct  216   TGVPWMMCKQNDAPDPIVSVHYYIVSPDCTSLANNSYQFDRPNSPSKPALWTENWTTRYP  275

Query  810   TFGDPPAQRSAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLD  989
              +G+    RS E+IA+++  F A K GS++ YYMY+GGTN+GR  +S+VTT YYD  PLD
Sbjct  276   IYGNDTKLRSTEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAPLD  335

Query  990   EFGLYRD--------PKWSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLK  1145
             E+G Y          P W HLR+ HAA+ LS  PL  GT +   L   QE   FE + LK
Sbjct  336   EYGKYFKESQGLIWRPTWGHLRELHAAVNLSSEPLLFGTYSNFSLGQEQEAHIFETE-LK  394

Query  1146  LCAAFLTN--NNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNAR--RFV  1313
              C AFL N   + +PT + FR   + L   S S+L +C+T VF +  + +Q+ +R  + V
Sbjct  395   -CVAFLVNFDKHQSPTVV-FRNIPFQLAPKSISILSECRTVVFETAKVNAQYGSRTAKVV  452

Query  1314  PSKLAGRDDLKWEMFQETIPT-IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDL  1490
              S     D   W+ F+E IP  I        +  E  ++TKD +DY WY    E+   D 
Sbjct  453   ESL---NDIHTWKAFKEPIPEDISKAVYTGNQLFEHLSMTKDETDYLWYIVSYEYRPSDD  509

Query  1491  STRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKA-LSLRKPVDLKPGNNDITLLG  1667
                   L +L+  S  H L AFVN E+VG  HG++D    + L   + LK G N I+LL 
Sbjct  510   GQ----LVLLNAESRAHVLHAFVNTEYVGCVHGSHDGPGNIILNTNISLKEGQNTISLLS  565

Query  1668  VLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQK  1847
             V+ G P+SGA M++R  G R V+IQ       ++    W + VG+ GE  +++T+E S  
Sbjct  566   VMVGSPDSGAHMERRSFGIRKVSIQQGQQPLHLLNNELWGYQVGLYGEGKRIYTQEESSS  625

Query  1848  VKWKPVTNV-HPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPL  2024
             V+W  + ++ + P+TWYKT F AP GN+ VAL + +M KG VWVNG+SIGRYWV+F +P 
Sbjct  626   VEWTEINSLTYHPLTWYKTTFAAPVGNDAVALNLTSMGKGEVWVNGESIGRYWVSFKAPS  685

Query  2025  GQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW  2204
             GQPSQ  YHIP+ F+KP +NL+V+ EE GG+P  I +  V+  T+C SV++    +  + 
Sbjct  686   GQPSQSLYHIPQHFLKPTDNLLVLVEEIGGNPLEITVNTVSITTVCGSVNEL---SSPAL  742

Query  2205  ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIV  2384
               +G++         P VRL+C   K +  IEFA+YG+P G C  F  G+C    +  +V
Sbjct  743   HTQGKD---------PEVRLRCQRGKHISAIEFASYGNPAGDCTTFSTGSCHAALSESVV  793

Query  2385  EKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             ++AC+GK  C +PV  + F     D CP  + K+L V A C
Sbjct  794   KQACIGKRGCSIPVSPARF---GGDPCPG-IQKSLLVVANC  830



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/825 (43%), Positives = 477/825 (58%), Gaps = 49/825 (6%)
 Frame = +3

Query  120   FIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGN  299
              +DG R ILF+GSIHYPR  PEMW  ++++AK+GGL+VIQTYVFWN HEP  G +NFEG 
Sbjct  35    LVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPTPGNYNFEGR  94

Query  300   NDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKF  479
              DLV+FIK +   GM+V LR+GP++  EWNFGGFP WLK VP I+FRT NEPF N M+ F
Sbjct  95    YDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPFKNAMQGF  154

Query  480   AEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYN  659
              E IV MMK   LFA QGGPIIL+QIENEY     +  A     K YINWAA MA+GL  
Sbjct  155   TEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGA---AGKAYINWAAKMAVGLDT  211

Query  660   EIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRS  839
              +PW+MCK+++AP  VI+ CNG  C DTF  PN   KP+MWTE W+  +  FG    QR 
Sbjct  212   GVPWVMCKEDDAPDPVINACNGFYC-DTFS-PNKPYKPTMWTEAWSGWFTEFGGTIRQRP  269

Query  840   AENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKW  1019
              E++A+ + RF          Y  + G          F+TT Y  + PLDE+GL R+PK+
Sbjct  270   VEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAREPKF  329

Query  1020  SHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSIK  1196
              HL++ H A++L ++PL    PT+  L + QE   F + +   CAAFL N N+ +   + 
Sbjct  330   GHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSS--GCAAFLANYNSNSYAKVI  387

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F    Y LP +S S+LPDCK  VFN+  +  Q N  +       G   + WE + E + +
Sbjct  388   FNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWAD---GASSMMWEKYDEEVDS  444

Query  1377  IDNLP-IKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   P + +   LE   +T+DTSDY WY TR+E    +   +G     L V S GHAL  
Sbjct  445   LAAAPLLTSTGLLEQLNVTRDTSDYLWYITRVEVDPSEKFLQGGTPLSLTVQSAGHALHV  504

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-  1730
             F+NG+  GS +G  +D+ +S     +L+ G N + LL V  G PN G   +   TG    
Sbjct  505   FINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGP  564

Query  1731  VTIQGLMAGTLVVTFNSWSH--SVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWY  1895
             V I GL  G+  +T+ +WS+   VG+ GE++ L + EGS  V+W     V     P+ WY
Sbjct  565   VVIHGLDEGSRDLTWQTWSYQFQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWY  624

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL-------------------S  2018
             + YFD P G+ P+AL M +M KG +W+NG+SIGRYW A+                    +
Sbjct  625   RAYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQA  684

Query  2019  PLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVK  2198
               GQP+Q  YH+PR++++P  NL+VVFEE GGD S I L       +C+ VS+Y+P N+K
Sbjct  685   GCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHP-NIK  743

Query  2199  SW--ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNA  2372
             +W  E  GE      E     V LKC   + +  I+FA++G P G CG F  G C   N+
Sbjct  744   NWQIESYGEP-----EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINS  798

Query  2373  NKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             N ++EK C+G  +C V +  S F     D CP  V K +AV+A C
Sbjct  799   NSVLEKKCIGLQRCVVAISPSNF---GGDPCPE-VMKRVAVEAVC  839



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/819 (42%), Positives = 481/819 (59%), Gaps = 41/819 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R IL +GSIHYPR  PEMWPD++++AKEGGL+VIQTYVFWN HEP QG++ FE   
Sbjct  39    INGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPQQGKYYFEERY  98

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLVKFIK++   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT N PF   M++F 
Sbjct  99    DLVKFIKLVQQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFKAAMQRFT  158

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV+MMK  KL+  QGGPIIL+QIENEY  +E +  A     K Y +WAA+MA+GL   
Sbjct  159   EKIVNMMKAEKLYETQGGPIILSQIENEYGPMEYELGAP---GKTYTHWAANMALGLRTG  215

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ++AP  VI+TCNG  C   +  PN   KP MWTE WT  Y  FG P   R A
Sbjct  216   VPWVMCKQDDAPDPVINTCNGFYC--DYFSPNKAYKPKMWTEAWTGWYTEFGGPVPTRPA  273

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E++A+ I RF          Y  + G          F+ T Y  + PLDEFGL + PKW 
Sbjct  274   EDLAFGIARFIQKGGSYVNYYMYHGGTNFDRTAGGPFIATSYDYDAPLDEFGLLKQPKWG  333

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL+D H A++L +  L    PT+ +L ++QE   F++ +   CAAFL N N ++   + +
Sbjct  334   HLKDLHRAIKLCEPALVSSDPTVVRLGSSQEAHVFKSGS-GACAAFLANYNPSSYAKVAY  392

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDCK  V+N+  + +Q    +F P      +   W+ + E   + 
Sbjct  393   GNNHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKFTPV----YNHFSWQSYNEETAST  448

Query  1380  DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFV  1559
             D+     L  LE    T+D +DY WY T ++    +   +G   PVL+V S GHAL  ++
Sbjct  449   DDSAFTVLGLLEQVNTTRDMTDYLWYMTDVKIDSNEGFLKGGKEPVLNVMSAGHALHVYI  508

Query  1560  NGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-VT  1736
             NG+ VG+ +G+ ++  +S  + V+++ G N I+LL +  G PN G   ++   G    V+
Sbjct  509   NGQLVGTAYGSLENPKISFGEGVNMRAGTNKISLLSIAVGLPNVGPNFERWNAGILGPVS  568

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW--KPVTNVHPPVTWYKTYFD  1910
             + GL  G   +T+  WS+ +G+ GE L L +  G   V+W          P+TWYKT F+
Sbjct  569   LSGLNEGRRDLTWQKWSYKIGMKGETLSLHSLSGVSNVEWVEGKFLAQRQPLTWYKTTFN  628

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAF--------------------LSPLGQ  2030
             AP GN P+AL M  M KG VW+NG++IGRYW A+                    L+  G 
Sbjct  629   APSGNEPLALDMGAMGKGQVWINGQNIGRYWPAYTAKGSCSDCSYAGYFSEKKCLTYCGD  688

Query  2031  PSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWER  2210
              SQ  YH+PR+++KP+ NLMVVFEE  G P+ I L+     +IC+ ++++ P  + +W  
Sbjct  689   ASQRWYHVPRSWLKPRGNLMVVFEEMSGAPNFISLMKKEISSICADINEWQP-TLVNWHL  747

Query  2211  KGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEK  2390
             K     ++ + +RP   L C   + +  I+FA++G P+G+CGN+  GNC   N+  I +K
Sbjct  748   KSSG--RIDKPLRPKAHLWCAPGQKISSIKFASFGTPEGSCGNYKQGNCHAHNSYDIFQK  805

Query  2391  ACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              C+G+  C + VE  LF     D CPN V K LAV+A C
Sbjct  806   DCVGQPGCAITVEPRLF---GGDPCPN-VMKKLAVEAIC  840



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/822 (41%), Positives = 487/822 (59%), Gaps = 41/822 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MW  ++++AK+GG++VI+TYVFWN+HEP  G+++FEG
Sbjct  33    LLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              NDLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   MK 
Sbjct  93    RNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKG  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F E IV++MK   LF  QGGPIIL+QIENEY        A+      Y+ WAA MA+   
Sbjct  153   FTERIVELMKSDNLFESQGGPIILSQIENEYGRQGQLLGAE---GHNYMTWAAKMAIATE  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+TCNG  C D+F  PN   KP++WTE W+  +  FG P  +R
Sbjct  210   TGVPWVMCKEDDAPDPVINTCNGFYC-DSF-APNKPYKPTIWTEAWSGWFTEFGGPMHKR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               +++A+++ RF          Y  + G          FVTT Y  + P+DE+GL R PK
Sbjct  268   PVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL++ H A+++ ++ L    P +  L N Q+   + +++   C+AFL N +T +   +
Sbjct  328   YGHLKELHRAIKMCEKALVSTDPVVTSLGNKQQAHVYSSES-GGCSAFLANYDTESAARV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y +P +S S+LPDC+ AVFN+  +  Q +    +P+ +   ++ +W+ + E + 
Sbjct  387   LFNNVHYNIPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNI---ENFQWQSYMEDLS  443

Query  1374  TIDNLPIKNLRP-LELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++D+         LE   +T+DTSDY WY+T ++  E + S  G  LP L + S GHA+ 
Sbjct  444   SLDDSSTFTTHGLLEQINVTRDTSDYLWYTTSVDIDETESSLHGGELPTLIIQSTGHAVH  503

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              FVNG+  GS  G   ++  + R  V+L  G N I LL V  G PN G   +   TG   
Sbjct  504   IFVNGQLSGSAFGTRQNRRFTYRGKVNLHSGTNRIALLSVAVGLPNVGGHFESWNTGILG  563

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVT---NVHPPVTWYK  1898
              V + GL  G L +++  W++ VG+ GE + L     +    W  V+       P+TW+K
Sbjct  564   PVAMHGLKQGKLDLSWQKWTYQVGLKGEAMNLAFPTNTPSNGWMDVSLTVQKPQPLTWHK  623

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL-------------------SP  2021
             TYFDAPEG+ P+AL M+ M KG +WVNG+SIGRYW AF                    S 
Sbjct  624   TYFDAPEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQSG  683

Query  2022  LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKS  2201
              GQP+Q  YH+PR+++KP  NL+V+FEE GG+PS++ LV  +   +C+ VS+Y+P N+K+
Sbjct  684   CGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHP-NIKN  742

Query  2202  WERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKI  2381
             W+ +     Q     RP V LKC   + +  I+FA++G P G CG++  G C    +  I
Sbjct  743   WQIESYGKGQTFH--RPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGECHAATSYAI  800

Query  2382  VEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +E+ C+GK++C V +  S F    KD CPN++ K L V+A C
Sbjct  801   LERKCVGKARCAVTISNSNF---GKDPCPNVL-KRLTVEAVC  838



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/828 (41%), Positives = 477/828 (58%), Gaps = 43/828 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMW D++++AK+GGL+VI TYVFWN HEP  G +NFEG
Sbjct  36    ILINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEG  95

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + DLV+FIK +  +G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT N PF   M+ 
Sbjct  96    SYDLVRFIKTVQRVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQG  155

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV MMK  KLFA QGGPIIL+QIENEY     +  A       Y+NWAA MA+GL 
Sbjct  156   FTQKIVQMMKNEKLFASQGGPIILSQIENEYG---PESKALGAAGHAYVNWAAKMAVGLD  212

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+TCNG  C D F  PN   KP++WTE W+  +  FG    +R
Sbjct  213   TGVPWVMCKEDDAPDPVINTCNGFYC-DAF-SPNKPYKPTLWTEAWSGWFTEFGGTVHRR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               +++A+++ RF       +  Y  + G          F+TT Y  + PLDE+GL R PK
Sbjct  271   PVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLMRQPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H A++L +  L    PT+  L   Q+   F     K CAAFL+N NT +   +
Sbjct  331   YGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSTGQQK-CAAFLSNYNTKSAARV  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F G QY LP +S S+LPDCK  VFN+  +  QH   + +P+   G   L WE + E I 
Sbjct  390   TFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPT---GSKLLSWETYDEDIS  446

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ ++  +  +  LE   +T+DTSDY WY T +E S  +   RG   P L V S GHA+ 
Sbjct  447   SLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRGGQKPTLTVESAGHAVH  506

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F+NG+F+GS  G  +++  +   P +L+ G N I LL +  G PN G   +   TG R 
Sbjct  507   VFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGLPNVGLHYETWETGVRG  566

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G   +T+  WS+ VG+ GE + L +   +  V W            + WYK
Sbjct  567   AVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWTRGSLAAQGQQSLKWYK  626

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAF-------------LSPL-----  2024
              YFDAP GN P+AL + +M KG VW+NG+SIGRYW+A+               P+     
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  686

Query  2025  -GQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYP-GNVK  2198
              G P+Q  YH+PR+++KP  NL+VVFEE GGD S I LV  +   +C+   +++P  +  
Sbjct  687   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNY  746

Query  2199  SWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANK  2378
               E KG             V L+C   + +  IEFA++G P G CG+F  G C  PN++ 
Sbjct  747   DIENKGNS----NSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHA  802

Query  2379  IVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRHA  2522
             ++EK C+G+  C + +   +F    KD CPN++ K L+VQA C    A
Sbjct  803   MLEKECIGQESCSIFISSGVF---GKDPCPNVL-KRLSVQAVCSTADA  846



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/820 (41%), Positives = 485/820 (59%), Gaps = 41/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R IL +GSIHYPR  P+MW D++++AK+GGL+V++TYVFWN+HEP  G +NFEG  
Sbjct  37    INGQRRILISGSIHYPRSTPDMWEDIIQKAKDGGLDVVETYVFWNVHEPSPGSYNFEGRY  96

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FI+ +   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ F 
Sbjct  97    DLVRFIRTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFT  156

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV +MK  +LF  QGGPIIL+QIENEY  ++S    D      Y+ WAA+MA+GL   
Sbjct  157   EKIVGLMKSERLFESQGGPIILSQIENEY-GVQSKLLGDAG--HDYMTWAANMAVGLGTG  213

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+ +AP  VI+TCNG  C D F  PN   KP++WTE W+  +  FG P  QR  
Sbjct  214   VPWVMCKEEDAPDPVINTCNGFYC-DAF-SPNKPYKPTIWTEAWSGWFNEFGGPLHQRPV  271

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             +++A+++ RF          Y  + G          F+TT Y  + P+DE+GL R PK+ 
Sbjct  272   QDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVRQPKYG  331

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTS-IKF  1199
             HL++ H +++L +R L    P +  L + Q+   + + +   CAAFL+N +T  ++ + F
Sbjct  332   HLKELHRSIKLCERALVSADPIVSSLGSFQQAHVYSS-DAGDCAAFLSNYDTKSSARVMF  390

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+ AVFN+  +  Q      +P+     + L WE + E I ++
Sbjct  391   NNMHYNLPPWSISILPDCRNAVFNTAKVGVQTAHMEMLPTN---AEMLSWESYDEDISSL  447

Query  1380  DNLP-IKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             D+      L  LE   +T+D SDY WY TRI+    +   RG  LP L + + GHA+  F
Sbjct  448   DDSSTFTTLGLLEQINVTRDASDYLWYITRIDIGSSESFLRGGELPTLILQTTGHAVHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS  G  + +  +  + V+L  G N I LL V  G PN G   +   TG    V
Sbjct  508   INGQLTGSAFGTREYRRFTFTEKVNLHAGTNTIALLSVAVGLPNVGGHFETWNTGILGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              + GL  G   +++  W++ VG+ GE + L +  G   V W           P+TW+K +
Sbjct  568   ALHGLNQGKWDLSWQRWTYKVGLKGEAMNLVSPNGISSVDWMQGSLAAQRQQPLTWHKAF  627

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS-------------------PLG  2027
             F+APEG+ P+AL M+ M KG VW+NG+SIGRYW A+ +                     G
Sbjct  628   FNAPEGDEPLALDMEGMGKGQVWINGQSIGRYWTAYANGNCQGCSYSGTYRPPKCQLGCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             QP+Q  YH+PR+++KP  NL+VVFEE GGDPS I LV  +  ++C+ V +Y+P N+K+W 
Sbjct  688   QPTQRWYHVPRSWLKPTQNLLVVFEELGGDPSRISLVRRSMTSVCADVFEYHP-NIKNWH  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
                E   +  E  +P V L+C   + +  I+FA+YG P G CG+F  G C  P++  IVE
Sbjct  747   I--ESYGKTEELHKPKVHLRCGPGQSISSIKFASYGTPLGTCGSFEQGPCHAPDSYAIVE  804

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K C+G+ +C V +  + F   ++D CPN++ K L+V+A C
Sbjct  805   KRCIGRQRCAVTISNTNF---AQDPCPNVL-KRLSVEAVC  840



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/828 (41%), Positives = 484/828 (58%), Gaps = 51/828 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R ILF+GSIHYPR  P+MW D++ +AKEGGL+VI+TYVFWN+HEP +G +NFEG
Sbjct  39    ILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYVFWNVHEPSRGNYNFEG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+F+K I   G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  99    RYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKKAMQG  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F E IV MMK  +L+  QGGPIIL+QIENEY +      +     + Y+NWAA MA+   
Sbjct  159   FTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKLLGS---AGQNYVNWAAKMAVETG  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+TCNG  C   +  PN   KPS+WTE W+  +  FG P  +R
Sbjct  216   TGVPWVMCKEDDAPDPVINTCNGFYC--DYFTPNKPYKPSIWTEAWSGWFSEFGGPNHER  273

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               +++A+ + RF          Y  + G          F+TT Y  + PLDE+GL R PK
Sbjct  274   PVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIRQPK  333

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL++ H A+++ +R L    P +  L N Q+   +  ++   CAAFL+N +T +   +
Sbjct  334   YGHLKELHKAIKMCERALVSTDPAVTSLGNFQQAHVYSAKSGD-CAAFLSNFDTKSSVRV  392

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y LP +S S+LPDC+  VFN+  +  Q +  + +P+         WE F E I 
Sbjct  393   MFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTN---TRMFSWESFDEDIS  449

Query  1374  TIDN---LPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             ++D+   +       LE   +T+DTSDY WY T ++    +   RG  LP L V S GHA
Sbjct  450   SLDDGSSITTTTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTLIVQSTGHA  509

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  F+NG+  GS +G  +D+  +    V+L+ G N I LL V  G PN G   +   TG 
Sbjct  510   VHVFINGQLSGSAYGTREDRRFTYTGTVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGI  569

Query  1725  RD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTW  1892
                V ++G   G L +++  W++ VG+ GE + L +  G   V+W     V++ + P+TW
Sbjct  570   LGPVVLRGFDQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVSDKNQPLTW  629

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLS------------------  2018
             +KTYFDAP+G+ P+AL M+ M KG +W+NG SIGRYW A  +                  
Sbjct  630   HKTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTALAAGNCNGCSYAGTFRPPKCQ  689

Query  2019  -PLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV  2195
                GQP+Q  YH+PR+++KP +NL+VVFEE GGDPS I LV  +  ++C+ VS+Y+P N+
Sbjct  690   VGCGQPTQRWYHVPRSWLKPDHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHP-NI  748

Query  2196  KSWE----RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSF  2363
             ++W      K EE         P V L C   + +  I+FA++G P G CGN+  G C  
Sbjct  749   RNWHIDSYGKSEEFHP------PKVHLHCSPGQTISSIKFASFGTPLGTCGNYEKGVCHS  802

Query  2364  PNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
               ++  +EK C+GK +C V V  S F    +D CPN++ K L+V+A C
Sbjct  803   STSHATLEKKCIGKPRCTVTVSNSNF---GQDPCPNVL-KRLSVEAVC  846



>ref|XP_009611028.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana tomentosiformis]
Length=837

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/824 (43%), Positives = 474/824 (58%), Gaps = 47/824 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMWPD++++AK+GGL++I+TYVFWN HE   G+F FEG
Sbjct  33    IIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDIIETYVFWNGHELSPGKFKFEG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK++   G+Y+ LR+GP++  EWNFGGFP WLK VP + FR  N PF   M+ 
Sbjct  93    RYDLVKFIKLVQQAGLYINLRIGPYICGEWNFGGFPVWLKYVPGMEFRADNHPFKLAMQG  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV+MMK   LF PQGGPIILAQIENEY  IE +  +     K Y  WAA+MA+ L 
Sbjct  153   FVQRIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSP---GKAYTKWAAEMAVSLD  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCKQ +AP  VIDTCNG  C D    PN   KP MWTE WTA Y  FG P  +R
Sbjct  210   IGVPWIMCKQEDAPDPVIDTCNGFYCED--FSPNKPYKPKMWTEVWTAWYTKFGGPVPRR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
              AE++A+S+ RF  N    +  Y  + G      T+A F+ T Y  + PLDE+GL  +PK
Sbjct  268   PAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLLNEPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSI  1193
             + HLRD H A++LS+  L    PT+  L  NQE   F +++   C+AFL+N +T     +
Sbjct  328   YGHLRDLHKAIKLSEPALVSSYPTVNWLGKNQEAHVFRSKSGD-CSAFLSNYDTKYSVKV  386

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F+  QY LP +S S+LPDCKTAV+N+  I SQ +     P  + G   L W+ + E  P
Sbjct  387   TFQNIQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAP--VVG--SLSWQSYNEETP  442

Query  1374  TI---DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHA  1544
             +    D L    L  LE   +T+D+SDY WY T +     +   +    P L V S GHA
Sbjct  443   SAEESDTLSANGL--LEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHA  500

Query  1545  LVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGP  1724
             +  F+NG+  G+ +G  D+  L+    V L+ G N I+LL V  G PN G   +   TG 
Sbjct  501   MHVFINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNKISLLSVAVGLPNVGLHFETWNTGV  560

Query  1725  RD-VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW--KPVTNVHPPVTWY  1895
                VT+ GL  GT  +T   WS+ VG+ GE L   T  G   V+W    +     P+TWY
Sbjct  561   LGPVTLSGLNEGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWY  620

Query  1896  KTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP------------------  2021
             K  FDAPEGN+PVAL M +M KG +WVNG+ +GR+W  +++                   
Sbjct  621   KATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAKGHCGECNYAGDYTEKKCQ  680

Query  2022  --LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNV  2195
                GQPSQ  YH+PR+++KP  NL+VVFEE GG P+ I LV     ++C+ + D  P  +
Sbjct  681   TNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATASVCADIVDGQP-TL  739

Query  2196  KSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNAN  2375
             K+W            ++R    L CP+ K + KI+FA+YG P G CGNF  G C    + 
Sbjct  740   KNWRMVSSGKSG---NVRRKAHLWCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSY  796

Query  2376  KIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
                EK C+G+  C V V   +F     D CPN   K L+V+A C
Sbjct  797   DAFEKNCIGRQSCSVNVVPKVF---GGDPCPN-TSKKLSVEAIC  836



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/820 (42%), Positives = 475/820 (58%), Gaps = 45/820 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R IL +GSIHYPR  PEMWPD++++AK+GGL+VIQTYVFWN HEP +G++ FE   
Sbjct  38    INGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSEGKYYFENRY  97

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLVKFIK++   G+YV LR+GP++  EWNFGGFP WLK VP IAFRT N PF  HM++F 
Sbjct  98    DLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGIAFRTDNGPFKWHMQRFT  157

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IV++MK   LF  QGGPII++QIENEY  +E +  A     K Y  WAA MA+GL   
Sbjct  158   EKIVNIMKAEGLFETQGGPIIMSQIENEYGPVEWEIGAP---GKAYTKWAAQMAVGLNTG  214

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ++AP  VID CNG  C +  + PN V KP +WTE WT  Y  FG P   R A
Sbjct  215   VPWVMCKQDDAPDPVIDACNGFYCEN--YKPNQVYKPKLWTEAWTGWYTEFGGPVPHRPA  272

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E++A+++ RF  N    +  Y  + G          F+ T Y  + PLDEFGL RDPKW 
Sbjct  273   EDLAFAVARFIQNGGAFFNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPRDPKWG  332

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTT-PTSIKF  1199
             HLRD H A++L++  L    PT+ KL NNQE   F + N   CAAFL N +T     + F
Sbjct  333   HLRDLHRAIKLAESALVSSDPTVTKLGNNQEAHVFRS-NTGACAAFLANYDTNYDVKVSF  391

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                +Y LP +S S+LPDCKTAV+N+  + +Q       P          WE + E   + 
Sbjct  392   GNGRYNLPPWSISILPDCKTAVYNTARLGAQSTVMWMTPV----YKGFSWESYNEETASA  447

Query  1380  DNLPIKNLRPL-ELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
             ++     L  L E   +T+D +DY WY T I     +   +    P+L+++S GHAL  F
Sbjct  448   NSGDTTALDGLWEQVYVTRDNTDYLWYLTDITIGSDEGFLKTGNYPLLNIFSAGHALHVF  507

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             VNG+  GS +G+ D   L+  + + L+ G N + LL V  G PN G   +    G    V
Sbjct  508   VNGQLTGSAYGSLDKPKLTFTQNIKLRAGVNKLALLSVAVGLPNVGLHFETWNAGVLGPV  567

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV--HPPVTWYKTYF  1907
             T+ GL  GT  ++   WS+ +G+ GEKL L T  GS  V+W   + +  H P+TWYKT F
Sbjct  568   TLNGLNTGTWDMSKWKWSYKIGLKGEKLGLHTVSGSSSVEWGQGSFLAKHQPLTWYKTTF  627

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP--------------------LG  2027
             +AP GN P+AL M++M KG +W+NG+SIGR+W A+ +                      G
Sbjct  628   NAPGGNGPLALDMNSMGKGQIWINGRSIGRHWPAYKASGGCGPCNYAGTFTDKKCRTDCG  687

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWE  2207
             QPSQ  YH+PR+++ P  NL+VVFEE GGDP+ I L      T+C+ + +  P  +++W 
Sbjct  688   QPSQRWYHVPRSWLNPTGNLLVVFEEWGGDPNWINLDQRTTGTVCADIHEGQP-TMENWG  746

Query  2208  RKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVE  2387
               G     V +       L CP    + +I+FA+YG P G CGN+  G+C    +  + +
Sbjct  747   ALGSGKVAVAK-----AHLWCPPGHKISQIKFASYGVPQGTCGNYRAGSCHAHKSYDVPQ  801

Query  2388  KACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             K C+G+  C V V    F     D CP  V K L+++A C
Sbjct  802   KNCVGQQSCTVIVAPQFF---GGDPCPG-VAKKLSLEAIC  837



>ref|XP_003522573.1| PREDICTED: beta-galactosidase 16-like [Glycine max]
Length=696

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/673 (48%), Positives = 439/673 (65%), Gaps = 18/673 (3%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG   ILF+GSIHYPR  P+MWP+++ +AKEGGL+VIQTYVFWN+HEP QGQ++F G
Sbjct  34    LIIDGQHKILFSGSIHYPRSTPQMWPNLIAKAKEGGLDVIQTYVFWNLHEPQQGQYDFRG  93

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               ++V+FIK I   G+YVTLR+GP++E+E  +GG P WL ++P I FR+ NE F  HM++
Sbjct  94    MRNIVRFIKEIQAQGLYVTLRIGPYIESECTYGGLPLWLHDIPGIVFRSDNEQFKFHMQR  153

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IV++MK A LFA QGGPIIL+QIENEY ++E    A  +    YI WAA MA+GL 
Sbjct  154   FTAKIVNLMKSANLFASQGGPIILSQIENEYGNVEG---AFHEKGLSYIRWAAQMAVGLQ  210

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCKQ+ AP  VI+TCNG QCG TF GPN  NKPS+WTENWT+ Y+ FG+ P  R
Sbjct  211   TGVPWVMCKQDNAPDPVINTCNGMQCGKTFKGPNSPNKPSLWTENWTSFYQVFGEVPYIR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IAY++  F A K GSY+ YYMY+GGTN+ R  ++FV T YYDE PLDE+GL R+PK
Sbjct  271   SAEDIAYNVALFIA-KRGSYVNYYMYHGGTNFDRIASAFVVTAYYDEAPLDEYGLVREPK  329

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             W HL++ H A++     L  GT T   L   Q    F   +++ CAAFL N      +I+
Sbjct  330   WGHLKELHEAIKSCSNSLLYGTQTSFSLGTQQNAYVFRRSSIE-CAAFLENTEDRSVTIQ  388

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             F+   Y LP  S S+LPDCK   FN+  + +Q NAR  + S+L      KW++++E IP+
Sbjct  389   FQNIPYQLPPNSISILPDCKNVAFNTAKVRAQ-NARA-MKSQLQFNSAEKWKVYREAIPS  446

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
               +  ++    L+  +  KDTSDY WY+ R+           +   +L  YS GH L AF
Sbjct  447   FADTSLRANTLLDQISTAKDTSDYLWYTFRL------YDNSANAQSILSAYSHGHVLHAF  500

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VNG  VGSKHG++ + +  +   ++L  G N+I+ L    G PNSGA ++ R  G R + 
Sbjct  501   VNGNLVGSKHGSHKNVSFVMENKLNLISGMNNISFLSATVGLPNSGAYLEGRVAGLRSLK  560

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAP  1916
             +QG        T  +W + VG+ GEKL+++T  GS KVKW+   +   P+TWYKT FDAP
Sbjct  561   VQGRD-----FTNQAWGYQVGLLGEKLQIYTASGSSKVKWESFLSSTKPLTWYKTTFDAP  615

Query  1917  EGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVV  2096
              GN+PV L + +M KG  WVNG+ IGRYWV+F +P G PSQ  YHIPR+ +K   NL+V+
Sbjct  616   VGNDPVVLNLGSMGKGYTWVNGQGIGRYWVSFHTPQGTPSQKWYHIPRSLLKSTGNLLVL  675

Query  2097  FEEQGGDPSSIEL  2135
              EE+ G+P  I L
Sbjct  676   LEEETGNPLGITL  688



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/819 (42%), Positives = 482/819 (59%), Gaps = 39/819 (5%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             I+G R IL +GSIHYPR  PEMWPD++++AK+GGL+VIQTYVFWN HEP  G++ FEGN 
Sbjct  41    INGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGKYYFEGNY  100

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLVKF+K++   G+Y+ LR+GP++ AEWNFGGFP WLK +P I FRT N PF   M+KF 
Sbjct  101   DLVKFVKLVQQAGLYMHLRIGPYVCAEWNFGGFPVWLKYIPGIRFRTDNGPFKAQMEKFT  160

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
               IV+MMK  +LFA +GGPIIL+QIENEY  +E +  A     K Y NWAA MA+GL   
Sbjct  161   RKIVNMMKAERLFASEGGPIILSQIENEYGPMEYELGAP---GKAYSNWAAHMAVGLGTG  217

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCKQ++AP  +I+ CNG  C   +  PN   KP MWTE WTA Y  FG P  +R A
Sbjct  218   VPWVMCKQDDAPDPIINACNGFYC--DYFSPNKAYKPKMWTEAWTAWYTEFGGPVPKRPA  275

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E++A+++ RF          Y  + G          F+ T Y  + PLDE+GL R PKW 
Sbjct  276   EDLAFAVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWG  335

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSIKF  1199
             HL+D H A++L +  L  G PT+ +L N ++   F++++   CAAFL N N  +   + F
Sbjct  336   HLKDLHRAIKLCEPALVSGDPTVTQLGNYEQAHVFKSKS-GACAAFLANYNPNSFAKVSF  394

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDC+  V+N+  + +Q +  +     + G   L W+ + E   + 
Sbjct  395   GNMHYNLPPWSISILPDCENTVYNTARVGAQSSTMKMTRVPIHG--GLSWQAYNEQTASY  452

Query  1380  DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFV  1559
             +         LE    T+D SDY WY T ++    +   R    PVL V S GHAL  FV
Sbjct  453   EETSFTVSGLLEQINTTRDASDYLWYMTDVKIDPSEEFLRSGKYPVLTVSSAGHALHVFV  512

Query  1560  NGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-VT  1736
             NG+  G+ +G+ +   L+L K V+L+ G N I LL +  G PN G   +    G    VT
Sbjct  513   NGQLAGTSYGSLEFPKLTLSKGVNLRAGINTIALLSIAVGLPNVGPHFETWNAGVLGPVT  572

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV--HPPVTWYKTYFD  1910
             + GL  G   +++  WS+ VG+ GE L L +  GS  V W   + V    P+TW+KT FD
Sbjct  573   LNGLNEGRRDLSWQKWSYKVGLRGEALSLHSLTGSSSVDWIQGSLVARKQPLTWFKTSFD  632

Query  1911  APEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAF--------------------LSPLGQ  2030
             AP G  P+AL M +M KG +W+NG+S+GRYW A+                    LS  G 
Sbjct  633   APAGYAPLALDMGSMGKGQIWINGQSLGRYWPAYKAQGSCGGCDYAGTYNEKKCLSNCGD  692

Query  2031  PSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSWER  2210
              SQ  YH+P++++KP  NL+VVFEE GGDP+ + LV  + DT+C+ + ++ P  + +W+ 
Sbjct  693   ASQRWYHVPKSWLKPTGNLLVVFEEWGGDPNGVFLVRRDVDTVCADIYEWQP-TLMNWQM  751

Query  2211  KGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKIVEK  2390
             +     +V + +RP   L C   + + KI+FA++G P+GACG+F  G+C   ++    E+
Sbjct  752   QSSG--KVDKPLRPKAHLSCGAGQKISKIKFASFGTPEGACGSFREGSCHAHHSYDAFER  809

Query  2391  ACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
              C+G++ C V V   +F     D CP+ V K L+V+A C
Sbjct  810   LCVGQNSCSVTVAAEMF---GGDPCPS-VMKKLSVEAIC  844



>ref|XP_010436954.1| PREDICTED: beta-galactosidase 14-like isoform X2 [Camelina sativa]
Length=631

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/583 (53%), Positives = 424/583 (73%), Gaps = 8/583 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  PEMWP ++ +AK GGLN IQTYVFWN+HEP QG+++F G
Sbjct  46    LIINGKRELLFSGSVHYPRSTPEMWPSIIDKAKAGGLNTIQTYVFWNVHEPEQGKYDFSG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEW+ GG PYWL+EVP++ FRT N+PF  H ++
Sbjct  106   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWSHGGLPYWLREVPEVYFRTDNKPFKEHTER  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPI+L QIENEY++++     +    ++YI WAA++   + 
Sbjct  166   YVRKILGMMKEEKLFASQGGPIVLGQIENEYNAVQLAYKEN---GERYIKWAANLVESMK  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  223   LGIPWVMCKQNDAPDNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G  ++PK
Sbjct  283   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGFEKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLR  H ALRL K+ LF G   +QKL  + E+   E    K+CAAFL+NNNT  T +I
Sbjct  342   YGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTKVCAAFLSNNNTRETNTI  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+      LK+EMF E I 
Sbjct  402   KFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKTTSKGLKFEMFHENIA  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY++ I+  E DL  +     +L V S+GHAL+ 
Sbjct  462   S--KLGGDSLIPGELYFLTKDKTDYAWYTSSIKIEEDDLPDKKGSKTILRVASLGHALIV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G+ HG+++ K+    KP++LK G+N I+++GVLTG P+SG+ M+ R+ GPR V
Sbjct  520   YVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISIMGVLTGLPDSGSYMEHRYAGPRAV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWK  1859
             +I GL +GT  +T N+ W H  G+ GEK +++TE+GS+KV+W+
Sbjct  580   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQWE  622



>ref|XP_010436955.1| PREDICTED: beta-galactosidase 14-like isoform X3 [Camelina sativa]
Length=629

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/583 (53%), Positives = 424/583 (73%), Gaps = 8/583 (1%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R++LF+GS+HYPR  PEMWP ++ +AK GGLN IQTYVFWN+HEP QG+++F G
Sbjct  46    LIINGKRELLFSGSVHYPRSTPEMWPSIIDKAKAGGLNTIQTYVFWNVHEPEQGKYDFSG  105

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKFIK+I + G+YVTLR+GPF++AEW+ GG PYWL+EVP++ FRT N+PF  H ++
Sbjct  106   RFDLVKFIKLIHEKGLYVTLRLGPFIQAEWSHGGLPYWLREVPEVYFRTDNKPFKEHTER  165

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             +   I+ MMK+ KLFA QGGPI+L QIENEY++++     +    ++YI WAA++   + 
Sbjct  166   YVRKILGMMKEEKLFASQGGPIVLGQIENEYNAVQLAYKEN---GERYIKWAANLVESMK  222

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               IPW+MCKQN+AP  VI+ CNGR CGDTF GPN  +KPS+WTENWT Q+R FGDPP  R
Sbjct  223   LGIPWVMCKQNDAPDNVINACNGRHCGDTFKGPNRHDKPSLWTENWTTQFRVFGDPPTHR  282

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             + E+IA+S+ R+ + KNGS++ YYMY+GGTN+GRT+A FVTTRYYD+ PLDE+G  ++PK
Sbjct  283   TVEDIAFSVARYFS-KNGSHVNYYMYHGGTNFGRTSAHFVTTRYYDDAPLDEYGFEKEPK  341

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPT-SI  1193
             + HLR  H ALRL K+ LF G   +QKL  + E+   E    K+CAAFL+NNNT  T +I
Sbjct  342   YGHLRHVHRALRLCKKALFWGQLRVQKLGPDTEVRYHEQPGTKVCAAFLSNNNTRETNTI  401

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
             KF G  Y LP  S S+LPDCKT V+N+  IV+QH+ R FV S+      LK+EMF E I 
Sbjct  402   KFNGQNYVLPSRSISILPDCKTVVYNTAQIVAQHSWRNFVKSEKTTSKGLKFEMFHENIA  461

Query  1374  TIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVA  1553
             +   L   +L P ELY LTKD +DYAWY++ I+  E DL  +     +L V S+GHAL+ 
Sbjct  462   S--KLGGDSLIPGELYFLTKDKTDYAWYTSSIKIEEDDLPDKKGSKTILRVASLGHALIV  519

Query  1554  FVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDV  1733
             +VNGE+ G+ HG+++ K+    KP++LK G+N I+++GVLTG P+SG+ M+ R+ GPR V
Sbjct  520   YVNGEYAGNAHGSHEMKSFVFEKPINLKTGDNHISIMGVLTGLPDSGSYMEHRYAGPRAV  579

Query  1734  TIQGLMAGTLVVTFNS-WSHSVGVSGEKLKLFTEEGSQKVKWK  1859
             +I GL +GT  +T N+ W H  G+ GEK +++TE+GS+KV+W+
Sbjct  580   SIIGLKSGTRDLTENNEWGHLAGLEGEKKEVYTEKGSKKVQWE  622



>ref|XP_007137444.1| hypothetical protein PHAVU_009G127500g [Phaseolus vulgaris]
 gb|ESW09438.1| hypothetical protein PHAVU_009G127500g [Phaseolus vulgaris]
Length=735

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/711 (46%), Positives = 455/711 (64%), Gaps = 34/711 (5%)
 Frame = +3

Query  60    LRAWWWVTMARR*RMIVDLFF----------------IDGTRDILFAGSIHYPRMPPEMW  191
             ++ WWW   +    +I+  F                 +DG   ILF+GSIHYPR  P+MW
Sbjct  38    VKVWWWWRWSSPFALILAAFIGGVCGGNVTYDGRSLIVDGQHRILFSGSIHYPRSTPQMW  97

Query  192   PDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNNDLVKFIKMIGDMGMYVTLRVGPF  371
             P+++ +AKEGGL+VIQTYVFWN+HEP QGQ+NF G +++V+FIK I   G+YVTLR+GP+
Sbjct  98    PNLIAKAKEGGLDVIQTYVFWNLHEPQQGQYNFRGRHNIVRFIKEIQAQGLYVTLRIGPY  157

Query  372   LEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFAEMIVDMMKKAKLFAPQGGPIILA  551
             +E+E  +GG P WL ++P I FR+ NE F  HM++FA  IV++MK A L+A QGGPIIL+
Sbjct  158   IESECTYGGLPIWLHDIPGIVFRSDNEQFKFHMQRFAAKIVNVMKSANLYASQGGPIILS  217

Query  552   QIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNEIPWIMCKQNEAPPKVIDTCNGRQ  731
             QIENEY ++E    A  +    YI WAA MA+GL   +PW+MCKQ+ AP  VI+TCNG Q
Sbjct  218   QIENEYGNVEG---AFHEKGLSYIRWAAQMAVGLQTGVPWVMCKQDNAPDPVINTCNGMQ  274

Query  732   CGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSAENIAYSIIRFAANKNgsylgyym  911
             CG TF GPN  NKPS+WTENWT+ Y+ FG  P  RSAE+IAY++  F A K GSY+ YYM
Sbjct  275   CGTTFKGPNSPNKPSLWTENWTSFYQVFGGVPYVRSAEDIAYNVALFIA-KRGSYVNYYM  333

Query  912   yyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWSHLRDCHAALRLSKRPLFLGTPTI  1091
             Y+GGTN+ +  ++FV T YYDE PLDE+GL R PKW HL++ HAA++ S + L  GT T 
Sbjct  334   YHGGTNFDKIASAFVMTAYYDEAPLDEYGLVRQPKWGHLKELHAAIKSSSKSLLYGTQTS  393

Query  1092  QKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIKFRGTQYYLPGFSTSVLPDCKTAVFN  1271
               L + Q    F++ + + CAAFL NN     +I+F+ T Y LP  S S+LPDCK   FN
Sbjct  394   FSLGSRQNAYVFKSSSTE-CAAFLENNADRSVTIQFQNTPYQLPPKSISILPDCKNVAFN  452

Query  1272  SQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTIDNLPIKNLRPLELYTLTKDTSDYA  1451
             +  + +Q N R   P  L      KW++++E IP+ D+  ++    L+  +  KDTSDY 
Sbjct  453   TAKVRTQ-NDRSMKP-HLQFNSAEKWKVYKEAIPSFDDTSLRANALLDQISTAKDTSDYM  510

Query  1452  WYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAFVNGEFVGSKHGNNDDKALSLRKPVD  1631
             WY+ R   +  +  +      +L  +S GH L  F+NG  VGS HG++ + +  +   ++
Sbjct  511   WYTFRFNDNSPNAQS------ILTAHSQGHVLHTFINGNLVGSAHGSHKNASFVMENKLN  564

Query  1632  LKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVTIQGLMAGTLVVTFNSWSHSVGVSGE  1811
             L  G N+I+ L    G PNSGA ++ +  G   V +QG        T  +W + VG+ GE
Sbjct  565   LIQGVNNISFLSATVGLPNSGAYLEHKVAGLSGVKVQGRD-----FTNQAWGYQVGLLGE  619

Query  1812  KLKLFTEEGSQKVKWKPVTNVHPPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSI  1991
             KL+++T  GS KV W+   +   P+TWYKT FDAPEGN+P+AL + +M KG  WVNG+ I
Sbjct  620   KLQIYTGSGSSKVHWESFQSSTKPLTWYKTTFDAPEGNDPLALNLGSMGKGYAWVNGQGI  679

Query  1992  GRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLV  2144
             GRYWV+F +P G  SQ  YHIPR+ +K   NL+V+ EE+ G+P +I L LV
Sbjct  680   GRYWVSFHTPKGTASQKWYHIPRSLLKSTGNLLVLLEEETGNPLAITLDLV  730



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/822 (42%), Positives = 479/822 (58%), Gaps = 47/822 (6%)
 Frame = +3

Query  123   IDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEGNN  302
             IDG R ILF+GSIHYPR  PEMW  ++++AK+GGL+VIQTYVFWN HEP  G +NFEG  
Sbjct  36    IDGQRRILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIQTYVFWNGHEPTPGNYNFEGRY  95

Query  303   DLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKKFA  482
             DLV+FIK +   GM+V LR+GP++  EWNFGGFP WLK VP I+FRT NEPF   M+ F 
Sbjct  96    DLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPFKMAMQGFT  155

Query  483   EMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLYNE  662
             E IVD+MK  +LFA QGGPIIL+QIENEY     +  A     K YINWAA MA+GL   
Sbjct  156   EKIVDLMKSEELFASQGGPIILSQIENEYGPEGKEFGA---AGKAYINWAAKMAVGLDTG  212

Query  663   IPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQRSA  842
             +PW+MCK+++AP  +I+TCNG  C D F  PN   KP MWTE W+  +  FG    QR  
Sbjct  213   VPWVMCKEDDAPDPLINTCNGFYC-DAFS-PNKPYKPMMWTEAWSGWFTEFGGTIRQRPV  270

Query  843   ENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPKWS  1022
             E++A+ + RF          Y  + G          F+TT Y  + PLDE+GL R+PK+ 
Sbjct  271   EDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLVREPKFG  330

Query  1023  HLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTN-NNTTPTSIKF  1199
             HL++ H A++L ++PL    PT+  L + QE   F + +   CAAFL N N+ +   + F
Sbjct  331   HLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSS--GCAAFLANYNSNSYAKVVF  388

Query  1200  RGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPTI  1379
                 Y LP +S S+LPDCK  VFN+  +  Q N  +       G   + WE + E + ++
Sbjct  389   NNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWAD---GASSMMWEKYDEEVDSL  445

Query  1380  DNLP-IKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                P + +   LE   +T+DTSDY WY T +E +  +   +G     L V S GHAL  F
Sbjct  446   AAAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVNPSEKFLQGGKPLSLTVQSAGHALHVF  505

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD-V  1733
             +NG+  GS +G  +D+ +S     +L+ G N + LL V  G PN G   +   TG    V
Sbjct  506   INGQLQGSAYGTREDRRISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGPV  565

Query  1734  TIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYKTY  1904
              I GL  G+  +T+ +WS+ VG+ GE++ L + EGS  V+W     V     P+ WY+ Y
Sbjct  566   VIHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWYRAY  625

Query  1905  FDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFL-------------------SPLG  2027
             F+ P G+ P+AL M +M KG +W+NG+SIGRYW A+                    +  G
Sbjct  626   FETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKECSYTGTFRAPKCQAGCG  685

Query  2028  QPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPGNVKSW-  2204
             QP+Q  YH+PR++++P  NL+VVFEE GGD S I LV  +   +C+ VS+Y+P N+K+W 
Sbjct  686   QPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSGVCADVSEYHP-NIKNWQ  744

Query  2205  -ERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANKI  2381
              E  GE      E     V LKC   + +  I+FA++G P G CG F  G C   N++ +
Sbjct  745   IESYGEP-----EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSSNSHSV  799

Query  2382  VEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             +EK C+G  +C V +  + F     D CP  V K +AV+A C
Sbjct  800   LEKKCIGLQRCVVAISPNSF---GGDPCPE-VMKRVAVEAVC  837



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/828 (41%), Positives = 475/828 (57%), Gaps = 43/828 (5%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  PEMW D++++AK+GGL+VI TYVFWN HEP  G +NFEG
Sbjct  36    ILINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEG  95

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
             + DLV+FIK +  +G+Y  LR+GP++ AEWNFGGFP WLK VP I+FRT N PF   M+ 
Sbjct  96    SYDLVRFIKTVQRVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQG  155

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV MMK  KLFA QGGPIIL+QIENEY        A       Y+NWAA MA+GL 
Sbjct  156   FTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKSLGA---AGHAYVNWAAKMAVGLD  212

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI++CNG  C D F  PN   KP++WTE W+  +  FG    +R
Sbjct  213   TGVPWVMCKEDDAPDPVINSCNGFYC-DAF-SPNKPYKPTLWTEAWSGWFTEFGGAVHRR  270

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               +++A+++ RF       +  Y  + G          F+TT Y  + PLDE+GL R PK
Sbjct  271   PVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLMRQPK  330

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             + HL+  H A++L +  L    PT+  L   Q+   F     K CAAFL+N NT +   +
Sbjct  331   YGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQK-CAAFLSNYNTKSAARV  389

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F G QY LP +S S+LPDCK  VFN+  +  QH   + +P+   G   L WE + E I 
Sbjct  390   TFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPT---GSKLLSWETYDEDIS  446

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ ++  +  +  LE   +T+DTSDY WY T +E S  +   RG   P L V S GHA+ 
Sbjct  447   SLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRGGQKPTLTVESAGHAVH  506

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRD  1730
              F+NG+F+GS  G  +++  +   P +L+ G N I LL +  G PN G   +   TG R 
Sbjct  507   VFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGLPNVGLHYETWETGVRG  566

Query  1731  -VTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKP---VTNVHPPVTWYK  1898
              V + GL  G   +T+  WS+ VG+ GE + L +   +  V W            + WYK
Sbjct  567   AVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWTRGSLAAQGQQSLKWYK  626

Query  1899  TYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAF-------------LSPL-----  2024
              YFDAP GN P+AL + +M KG VW+NG+SIGRYW+A+               P+     
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  686

Query  2025  -GQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYP-GNVK  2198
              G P+Q  YH+PR+++KP  NL+VVFEE GGD S I LV  +   +C+   +++P  +  
Sbjct  687   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  746

Query  2199  SWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPNANK  2378
               E KG             V L+C   + +  IEFA++G P G CG+F  G C  PN++ 
Sbjct  747   DIENKGNS----NSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHA  802

Query  2379  IVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKCGLRHA  2522
             ++EK C+G+  C + +   +F     D CPN++ K L+VQA C    A
Sbjct  803   MLEKECIGQESCSIFISSGVF---GTDPCPNVL-KRLSVQAVCSTADA  846



>ref|XP_010253630.1| PREDICTED: beta-galactosidase 8 [Nelumbo nucifera]
Length=845

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/833 (42%), Positives = 478/833 (57%), Gaps = 57/833 (7%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R +L +GSIHYPR  PEMWPD+++++KEGGL+VI+TYVFWN+HEPV+ Q++FEG
Sbjct  33    LLIDGKRRVLISGSIHYPRSTPEMWPDLIQKSKEGGLDVIETYVFWNLHEPVRNQYDFEG  92

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLVKF+K + + G+YV LR+GP++ AEWN+GGFP WL  +P I FRT NEPF   M++
Sbjct  93    RKDLVKFVKTVAEAGLYVHLRIGPYVCAEWNYGGFPLWLHFIPGIEFRTDNEPFKMEMQR  152

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IVDMMK+ +L+A QGGPIIL+QIENEY +I+S   A     K YINWAA MA  L 
Sbjct  153   FTTKIVDMMKQEQLYASQGGPIILSQIENEYGNIDS---AYGSAAKSYINWAAGMATSLD  209

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MC+Q +AP  +I+TCNG  C D F  PN   KP MWTENW+  + +FG     R
Sbjct  210   TGVPWVMCQQADAPDPIINTCNGFYC-DQFT-PNSAKKPKMWTENWSGWFLSFGGSVPYR  267

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E++A+++ RF          Y  + G      T   F+ T Y  + P+DE+GL R PK
Sbjct  268   PVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTTGGPFIATSYDYDAPIDEYGLVRQPK  327

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNT-TPTSI  1193
             W HL+D H A++L +  L    PT   L  N E   ++     +CAAFL N  T +  ++
Sbjct  328   WGHLKDLHKAIKLCEEALIATDPTFTSLGPNLEAHVYKTSG--VCAAFLANVGTQSAATV  385

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLK------WEM  1355
              F G  Y LP +S S+LPDCK  VFN+  I SQ    RF P       D        W  
Sbjct  386   NFNGNSYTLPAWSVSILPDCKNVVFNTAKINSQAMNLRFEPQTSKDTVDSSEAFQSGWSW  445

Query  1356  FQETIPTIDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSM  1535
             F E +    +     L  LE    T D SDY WYS   E    +   +      + V S+
Sbjct  446   FNEPVGISRSNAFMKLGLLEQINTTADVSDYLWYSLSTEIQGDEPFLQDGYQSRIHVESL  505

Query  1536  GHALVAFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDK--  1709
             GHA+  F+NG+F GS  GN+ +  ++L +P+ L PG N I LL +  G  N GA  DK  
Sbjct  506   GHAVHVFINGKFAGSGSGNSGNAKVTLERPITLIPGKNTIDLLSLTVGLQNYGAFFDKWG  565

Query  1710  -RFTGPRDVTIQGLMAGTLV-VTFNSWSHSVGVSGEKLKLFTEEGSQKVKWKPVTNV--H  1877
                TGP  V ++G   GT V ++ + W++ +G+ GE+L L T   SQ   W  ++++  +
Sbjct  566   AGITGP--VKLKGSKNGTTVDLSSSQWTYQIGLKGEELGLSTASSSQ---WVSLSDLPKN  620

Query  1878  PPVTWYKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP------------  2021
              P+ WYKT FDAP GN+P AL    M KG  WVNG+SIGRYW  ++SP            
Sbjct  621   QPLIWYKTSFDAPSGNDPTALDFTGMGKGEAWVNGQSIGRYWPTYISPQSGCTDSCDYRG  680

Query  2022  ----------LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSV  2171
                        G+ SQ  YH+PR++++P  N +V+FEE GGDP+ I        ++CS V
Sbjct  681   PYNSNKCHKNCGKASQNLYHVPRSWIQPSGNTLVLFEEVGGDPTQISFATRQTGSLCSHV  740

Query  2172  SDYYPGNVKSWERKGEELRQVVEDIRPSVRLKCP-EDKVVKKIEFANYGDPDGACGNFIV  2348
             S+ +P  V +W+   +  ++      P ++L+CP  ++V+  I FA++G P GACG+F  
Sbjct  741   SESHPPPVDTWDSDTKTGKKS----GPVLQLECPFPNQVISSINFASFGTPRGACGSFKQ  796

Query  2349  GNCSFPNANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             G CS  +A  IV++AC+G   C + V    F     D C   V K+LAV+A C
Sbjct  797   GKCSSTSALAIVQQACVGSKSCSIAVSIDSF----GDPCVG-VTKSLAVEATC  844



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/826 (42%), Positives = 484/826 (59%), Gaps = 48/826 (6%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               I+G R IL +GSIHYPR  P+MW  ++++A++GGL+VIQTYVFWN HEP  G +NFEG
Sbjct  31    IIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGHEPSPGNYNFEG  90

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
               DLV+FIK    +GMYV LR+GP++  EWNFGGFP WLK VP I+FRT NEPF   M+ 
Sbjct  91    RYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPVWLKYVPGISFRTDNEPFKIAMQG  150

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F + IV MMK   LFA QGGPIIL+QIENEY     +  A       Y+NWAA MA+GL 
Sbjct  151   FTQKIVQMMKSESLFASQGGPIILSQIENEYG---PESKAFDAAGHAYVNWAAKMAVGLG  207

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PW+MCK+++AP  VI+ CNG  C D F  PN   KP+MWTE W+  +  FG    QR
Sbjct  208   TGVPWVMCKEDDAPDPVINACNGFYC-DAFT-PNKPYKPTMWTEAWSGWFTEFGGTVRQR  265

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
               E++A+++ RF          Y  + G          F++T Y  + P+DEFGL R+PK
Sbjct  266   PVEDLAFAVARFLQKGGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEFGLIREPK  325

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNN-TTPTSI  1193
             + HLR+ H A++L +  L    PT+  L + +E   F +++   CAAFL N N  +   +
Sbjct  326   YGHLRELHKAIKLCESALVSADPTVTSLGSYEEAHVFSSES-GGCAAFLANYNPNSFARV  384

Query  1194  KFRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIP  1373
              F    Y LP +S S+LPDC+  VFN+  +  Q +  + +P   A    L WE + E + 
Sbjct  385   IFNNMHYNLPPWSISILPDCRNIVFNTAKVGVQTSQMQMLP---ANSQSLMWETYDEDVA  441

Query  1374  TI-DNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALV  1550
             ++ DN  I     LE   +T+D SDY WY T ++ S  +   RG   PVL V S GHAL 
Sbjct  442   SLGDNSLITIAGLLEQINVTRDASDYLWYITSVDVSPAEGFLRGGQFPVLTVQSAGHALH  501

Query  1551  AFVNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGA---LMDKRFTG  1721
              FVNG+  GS +GN  ++ ++    V+L  G+N I LL V  G PN+G    L +    G
Sbjct  502   VFVNGQLSGSAYGNRKNRRITYTGNVNLHAGSNRIALLSVAVGLPNAGVHYELWNTGVLG  561

Query  1722  PRDVTIQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW---KPVTNVHPPVTW  1892
             P  V + G+  G   +T+  WS+ VG+ GE + L + EG+  V+W     V+    P+TW
Sbjct  562   P--VVLHGVDEGKRDLTWQKWSYQVGLKGEAMNLNSLEGTSSVEWIKESLVSQRQQPLTW  619

Query  1893  YKTYFDAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSP-----------------  2021
             Y+ YFDAP G++P+ L M +M KG  W+NG+SIGRYW   L+P                 
Sbjct  620   YRAYFDAPAGHDPLGLDMGSMGKGQAWINGQSIGRYWT-LLAPNGDCKGCNYAGTYRIPK  678

Query  2022  ----LGQPSQGEYHIPRAFMKPKNNLMVVFEEQGGDPSSIELVLVNRDTICSSVSDYYPG  2189
                  GQP+Q  YH+PR++++P  NL+VVFEE GGD + I LV  +  ++C+ VS+++P 
Sbjct  679   CQTGCGQPTQLWYHVPRSWLQPTKNLLVVFEELGGDATKISLVKKSVSSVCADVSEWHP-  737

Query  2190  NVKSWERKGEELRQVVEDIRPSVRLKCPEDKVVKKIEFANYGDPDGACGNFIVGNCSFPN  2369
              +KSW    +   Q  E  +P V L+C   +++  I+FA++G P G CGNF  G C  PN
Sbjct  738   TIKSWHI--QSYGQPEEYHKPKVHLRCASGQLISAIKFASFGTPLGTCGNFQQGACHSPN  795

Query  2370  ANKIVEKACLGKSQCKVPVEKSLFQEGSKDLCPNLVHKTLAVQAKC  2507
             ++  +EK C+G+ +C V +  + F     D CP+ V K +AV+A C
Sbjct  796   SHTTLEKKCVGQQRCAVTISTNNF---GGDPCPD-VMKRVAVEAVC  837



>dbj|BAF01618.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=718

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/676 (49%), Positives = 440/676 (65%), Gaps = 15/676 (2%)
 Frame = +3

Query  117   FFIDGTRDILFAGSIHYPRMPPEMWPDVLKRAKEGGLNVIQTYVFWNIHEPVQGQFNFEG  296
               IDG R +LF+GSIHYPR  PEMWP ++K+AKEGG++VIQTYVFWN+HEP  GQ++F G
Sbjct  39    LIIDGQRKLLFSGSIHYPRSTPEMWPSLIKKAKEGGIDVIQTYVFWNLHEPKLGQYDFSG  98

Query  297   NNDLVKFIKMIGDMGMYVTLRVGPFLEAEWNFGGFPYWLKEVPKIAFRTYNEPFMNHMKK  476
              NDLVKFIK I   G+YV LR+GPF+EAEWN+GG P+WL++VP + +RT NEPF  HM+K
Sbjct  99    RNDLVKFIKEIRSQGLYVCLRIGPFIEAEWNYGGLPFWLRDVPGMVYRTDNEPFKFHMQK  158

Query  477   FAEMIVDMMKKAKLFAPQGGPIILAQIENEYSSIESDRPADIKIQKKYINWAADMAMGLY  656
             F   IVD+MK   L+A QGGPIIL+QIENEY+++E    A  +    YI WA  MA+GL 
Sbjct  159   FTAKIVDLMKSEGLYASQGGPIILSQIENEYANVEG---AFHEKGASYIKWAGQMAVGLK  215

Query  657   NEIPWIMCKQNEAPPKVIDTCNGRQCGDTFHGPNGVNKPSMWTENWTAQYRTFGDPPAQR  836
               +PWIMCK  +AP  VI+TCNG +CG+TF GPN  NKP MWTE+WT+ ++ +G  P  R
Sbjct  216   TGVPWIMCKSPDAPDPVINTCNGMKCGETFPGPNSPNKPKMWTEDWTSFFQVYGKEPYIR  275

Query  837   SAENIAYSIIRFAANKNgsylgyymyyggtnygRTTASFVTTRYYDEGPLDEFGLYRDPK  1016
             SAE+IA+    F A KNGSY+ YYMY+GGTN+GRT++S+  T YYD+ PLDE+GL R PK
Sbjct  276   SAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAPLDEYGLLRQPK  334

Query  1017  WSHLRDCHAALRLSKRPLFLGTPTIQKLPNNQEIITFENQNLKLCAAFLTNNNTTPTSIK  1196
             + HL++ HAA++ S  PL  G  TI  L   Q+   FE+ N   C AFL NN+   + I+
Sbjct  335   YGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFEDAN-NGCVAFLVNNDAKASQIQ  393

Query  1197  FRGTQYYLPGFSTSVLPDCKTAVFNSQNIVSQHNARRFVPSKLAGRDDLKWEMFQETIPT  1376
             FR   Y L   S  +L +CK  ++ +  +  + N R   P ++    D  W +F+ETIP 
Sbjct  394   FRNNAYSLSPKSIGILQNCKNLIYETAKVNVKMNTRVTTPVQVFNVPD-NWNLFRETIPA  452

Query  1377  IDNLPIKNLRPLELYTLTKDTSDYAWYSTRIEFSERDLSTRGDILPVLDVYSMGHALVAF  1556
                  +K    LE   LTKD +DY WY++  +      +      P +   S GH +  F
Sbjct  453   FPGTSLKTNALLEHTNLTKDKTDYLWYTSSFKLDSPCTN------PSIYTESSGHVVHVF  506

Query  1557  VNGEFVGSKHGNNDDKALSLRKPVDLKPGNNDITLLGVLTGFPNSGALMDKRFTGPRDVT  1736
             VN    GS HG+ D + + L+ PV L  G N+I++L  + G P+SGA M++R  G   V 
Sbjct  507   VNNALAGSGHGSRDIRVVKLQAPVSLINGQNNISILSGMVGLPDSGAYMERRSYGLTKVQ  566

Query  1737  IQGLMAGTLVVTFNSWSHSVGVSGEKLKLFTEEGSQKVKW---KPVTNVHPPVTWYKTYF  1907
             I       + ++ + W +SVG+ GEK++L+  +   +VKW   K     + P+ WYKT F
Sbjct  567   ISCGGTKPIDLSRSQWGYSVGLLGEKVRLYQWKNLNRVKWSMNKAGLIKNRPLAWYKTTF  626

Query  1908  DAPEGNNPVALRMDNMAKGMVWVNGKSIGRYWVAFLSPLGQPSQGEYHIPRAFMKPKNNL  2087
             D P G+ PV L M +M KG +WVNG+SIGRYWV+FL+P GQPSQ  YHIPRAF+KP  NL
Sbjct  627   DGPNGDGPVGLHMSSMGKGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKPSGNL  686

Query  2088  MVVFEEQGGDPSSIEL  2135
             +VVFEE+GGDP  I L
Sbjct  687   LVVFEEEGGDPLGISL  702



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8506225923558